GenomeNet

Database: RefSeq
Entry: NC_013079
LinkDB: NC_013079
Original site: NC_013079 
LOCUS       NC_013079             999246 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome C complete sequence.
ACCESSION   NC_013079
VERSION     NC_013079.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 999246)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 999246)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 999246)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928167.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..999246
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="C"
     repeat_region   4613..5029
                     /rpt_type=long_terminal_repeat
     mobile_element  8607..9116
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
                     /mobile_element_type="transposon"
     gene            complement(<9795..>10538)
                     /locus_tag="KLTH0C00220g"
                     /db_xref="GeneID:8291096"
     mRNA            complement(<9795..>10538)
                     /locus_tag="KLTH0C00220g"
                     /product="KLTH0C00220p"
                     /transcript_id="XM_002552193.1"
                     /db_xref="GeneID:8291096"
     CDS             complement(9795..10538)
                     /locus_tag="KLTH0C00220g"
                     /note="similar to uniprot|P40586 Saccharomyces cerevisiae
                     YIR042C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C00220p"
                     /protein_id="XP_002552239.1"
                     /db_xref="GeneID:8291096"
                     /db_xref="GOA:C5DDE0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DDE0"
                     /translation="MVAQNLYGQEIGDPLPNWAGREGPHRTVFEGNYCRLEPLNVQNH
                     GLQLFQAFSNAKDDRMWTYLPVGPFKDYPEYKKIATKFEQDQETVHYAVISKEGNRAL
                     GSLSLMRADVSNGTIEIGFVMFSPKLQKTTASTEAQFLLMKHVFDGLGYRRCEWKCDS
                     LNAPSRNCALRLGFTFEGTFRNAAVYKGRSRDTQWFSIIDTEWQDIRKSFELWLKAGN
                     FLEGKQNKKLAAIRNEVKESKDVKKDHVQ"
     gene            <12563..>12979
                     /locus_tag="KLTH0C00264g"
                     /db_xref="GeneID:8291097"
     mRNA            <12563..>12979
                     /locus_tag="KLTH0C00264g"
                     /product="KLTH0C00264p"
                     /transcript_id="XM_002552194.1"
                     /db_xref="GeneID:8291097"
     CDS             12563..12979
                     /locus_tag="KLTH0C00264g"
                     /note="some similarities with uniprot|P53053 Saccharomyces
                     cerevisiae YGL263W COS12 Protein of unknown function
                     member of a family of conserved often subtelomerically-
                     encoded proteins"
                     /codon_start=1
                     /product="KLTH0C00264p"
                     /protein_id="XP_002552240.1"
                     /db_xref="GeneID:8291097"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DDE1"
                     /translation="MMFFGLTLALITGLLINFAMKRVATDSMMELQFMKEIAAIKPGI
                     DMKDCDVLAARMNTYLSSNSVLATPYYFYNGKSCYPFFRKNYLQPRLIVKYASYQNAN
                     IASGSQPFVHKAIKIHEERANEDWEGILNKSRRFEQ"
     gene            <14835..>16043
                     /locus_tag="KLTH0C00286g"
                     /db_xref="GeneID:8291098"
     mRNA            <14835..>16043
                     /locus_tag="KLTH0C00286g"
                     /product="KLTH0C00286p"
                     /transcript_id="XM_002552195.1"
                     /db_xref="GeneID:8291098"
     CDS             14835..16043
                     /locus_tag="KLTH0C00286g"
                     /note="similar to uniprot|Q2TZW5 Aspergillus oryzae
                     AO090011000693 Protein involved in biosynthesis of
                     mitomycin antibiotics/polyketidefumonisin"
                     /codon_start=1
                     /product="KLTH0C00286p"
                     /protein_id="XP_002552241.1"
                     /db_xref="GeneID:8291098"
                     /db_xref="InterPro:IPR008775"
                     /db_xref="UniProtKB/TrEMBL:C5DDE2"
                     /translation="MFKQQSNDKPDEAVSSRFFPEHSLSVDDLKVICSRKASLSTYPL
                     ASSIQENIPIYELTAFSDSDQNTVSMLKDEWYHILHSGPGVFVMKAMYHTKEYEKVLE
                     SASSSFEKILEREKGNSTDSKGDHFAAEGSNDRIWNSLSKHAFEDPNSFFEYYSNPWL
                     AHVCDAWLGPRYQITAQVNNVKPGSLPQECHRDYHLGIQGRSKCVRYPRGLQIASQYL
                     TLQGAVAHSNMALESGPTRFLPFSQTFEPGYIAYQLEQFRDFFLQNYVVLPLELGDGV
                     FFNPALFHGAGANTTKAFLRSANLLQISSAFGKPMETIDSLPIVKLCWILLKERYTRD
                     GLSSRVSAFINAVFNGYPYPTNLDKRLPAQNSMMPESEQDIAIRGLQNSWSTEKVMET
                     LRQMKIDSKA"
     gene            <25162..>26811
                     /locus_tag="KLTH0C00330g"
                     /db_xref="GeneID:8291100"
     mRNA            <25162..>26811
                     /locus_tag="KLTH0C00330g"
                     /product="KLTH0C00330p"
                     /transcript_id="XM_002552196.1"
                     /db_xref="GeneID:8291100"
     CDS             25162..26811
                     /locus_tag="KLTH0C00330g"
                     /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
                     YLL055W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C00330p"
                     /protein_id="XP_002552242.1"
                     /db_xref="GeneID:8291100"
                     /db_xref="GOA:C5DDE3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DDE3"
                     /translation="MTQSQSSSSLEEHPVTVTGKENPGFDSSDNEVGLVLPSSPEKES
                     SDTKDFKVITSRDADVTLRFLEENDHLVEPITPEEERKLSRKVMWIVVSLTALINLIL
                     YADKAVMSYAAIFTFFEDTGLTQNKYNNANTLFYFGYIVGQGNLFFLQKFPLSRVMFV
                     MTALWSIIIFLHCTAYNYQGVYALRFFLGFVESIGVPSLNTTMGQFLTPQEKSATAPV
                     FYAACMGVTIPVGFIAYGVLNITNSSIPTWKIFSIIIGCCTFLSSVLIFLVYPSNPTD
                     AKFLSKKEKIWVIRRVQQTTGSSIEQKTFKPYQAKEALKDPISWIFGAFFLLQQLANN
                     LTYQQNLLFEDLGNITALDSTLVSVASGGFAVVMAIIASTFLMYKKNFIAFSVVVWSL
                     PSFVGSIGAATLPWHNSIGLLAFVCLACPVFGIPWILMFSWNAQTCSGYTKKMTRNAI
                     VMFWFGISNIISPQLWQERDAPRYIPAWIVQIVLSFFLAPSLALVIWFILRRRNKERL
                     AKLDSAGKQIGVIEENGERTEVNVALLDLTDLENEAFIYPL"
     gene            complement(<28541..>30217)
                     /locus_tag="KLTH0C00352g"
                     /db_xref="GeneID:8291101"
     mRNA            complement(<28541..>30217)
                     /locus_tag="KLTH0C00352g"
                     /product="KLTH0C00352p"
                     /transcript_id="XM_002552197.1"
                     /db_xref="GeneID:8291101"
     CDS             complement(28541..30217)
                     /locus_tag="KLTH0C00352g"
                     /note="similar to uniprot|P40445 Saccharomyces cerevisiae
                     YIL166C Hypothetical ORF, memberof the Dal5p subfamily of
                     the major facilitator family"
                     /codon_start=1
                     /product="KLTH0C00352p"
                     /protein_id="XP_002552243.1"
                     /db_xref="GeneID:8291101"
                     /db_xref="GOA:C5DDE4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DDE4"
                     /translation="MGFREPPAPKDQTRTVPENESNILNETNHKESFLVDVENVSTSS
                     SSADNIFADPNVANYYSSIYEKCQYECRHLFDPEFTWSQKEERKVRWKNDWYVTFWTF
                     FMFTALDFDRSNISQALADDMLENLNLTTNDYNTANTINLICFLASELPSQLISKKIG
                     ADVWIPMQICLWSFVSISQAAIKSKTGFYVTRALLGAMQGGFICDVCLWMSYFFTSKE
                     LPFRLSLFYIANPMTTVWSSLLSFGLLKIKTGGLMNQSWRWLFLIEGIFTLIVGVASF
                     FKMPPSPAQTKAWYRKKGWYTDREEKIVVNKVLRDDPTKGDMHNRQPVRPKELLKTLL
                     DYDLLPIYIVRFLGDIGSTPAKSYMTLTLRKLGFSTYKTNALSIPYNIIAVITMLLAG
                     YFSEVVNQRALIIMGTPIWVLVFLFPLRYWPGSQVDVWGTYAILTILLGQAPIWPLTI
                     SWCSANSNSVRTRAVSAAVVNIFSQASNIVSANIYRDDDKPLYHRGNEALIGTAFAAI
                     ASCLFAKFYYIWRNKQKDNKWSTLSEEEKSYYLANTTDQGNKRLDFRFVH"
     gene            complement(<32017..>33147)
                     /locus_tag="KLTH0C00374g"
                     /db_xref="GeneID:8291102"
     mRNA            complement(<32017..>33147)
                     /locus_tag="KLTH0C00374g"
                     /product="KLTH0C00374p"
                     /transcript_id="XM_002552198.1"
                     /db_xref="GeneID:8291102"
     CDS             complement(32017..33147)
                     /locus_tag="KLTH0C00374g"
                     /note="similar to uniprot|P32804 Saccharomyces cerevisiae
                     YGL255W ZRT1 High-affinity zinc transporter of the plasma
                     membrane responsible for the majority of zinc uptake
                     transcription is induced under low-zinc conditions by the
                     Zap1p transcription factor"
                     /codon_start=1
                     /product="KLTH0C00374p"
                     /protein_id="XP_002552244.1"
                     /db_xref="GeneID:8291102"
                     /db_xref="GOA:C5DDE5"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:C5DDE5"
                     /translation="MSGSEPWWQQYDPDTVTISDDSVPDSWKICTIDGVYFGGNSYSG
                     SLGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAFIHL
                     LDPAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRFGITHGH
                     GDEIENAIVKRQEATNNNVDIESHNLGHSADSDDKSKKSYDVVSNASTEIVTQSFESQ
                     IGAFLILEFGVIFHSVMIGLNLGTTDDEFSTLYPVLVFHQSFEGLGIGARLSAIEFPK
                     NKWWWPYALCVAYGLTTPICVAIGLGVRTTYDGNSYTVNVVSGVLDAISAGILMYTGL
                     VELLARDFIFDENRTNDISKLLFMVNCTLWGAGLMALLGKWA"
     gene            complement(<33868..>35277)
                     /locus_tag="KLTH0C00396g"
                     /db_xref="GeneID:8291103"
     mRNA            complement(<33868..>35277)
                     /locus_tag="KLTH0C00396g"
                     /product="KLTH0C00396p"
                     /transcript_id="XM_002552199.1"
                     /db_xref="GeneID:8291103"
     CDS             complement(33868..35277)
                     /locus_tag="KLTH0C00396g"
                     /note="similar to uniprot|P00635 Saccharomyces cerevisiae
                     YBR093C PHO5 One of three repressible acid phosphatases a
                     glycoprotein that is transported to the cell surface by
                     the secretory pathway induced by phosphate starvation and
                     coordinately regulated by PHO4 and PHO2"
                     /codon_start=1
                     /product="KLTH0C00396p"
                     /protein_id="XP_002552245.1"
                     /db_xref="GeneID:8291103"
                     /db_xref="GOA:C5DDE6"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DDE6"
                     /translation="MISQALVLLAASLTEAAPVLKQGKASTADVSKIGTQEKLFPYLA
                     GSGPHYDYPLSYGIPKEIPEQCTLQQVQLFARHGERYPTQNKGKAIASTYKKLHDFNG
                     TFTGALEFLNEDYEFFVQDTANYEELTTWDNILDPINPYVGELDAQKHARQFLFQYGE
                     LLENHTSFPIFTSNSKRVHDTANFFAKALGDRYNVSLQIIDEDPSMGANTLTPIESCT
                     VYNESEQADVMNEYSDAYLVNLAGRLNTENSGLNLTKSDALNLFSWCAFEVNVKGYSN
                     ICDVFTADELVSFAYYDDMTSYYEDGPGNSLGSTVGGVNFNASVELLKQHEELDNKVW
                     LSFTHDTNIVNYLSAIGLFDDGNKLPTDHVPIQNHVYHKSWMVPQGARVYTQLYQCGN
                     SSYVRYVVNDVTIPIETCQSGPGFSCELNDFVDYASTRLEGQNYIENCKISSSSNQTS
                     LTFYWDYTQKTYNASLIHS"
     gene            <38245..>39039
                     /locus_tag="KLTH0C00418g"
                     /db_xref="GeneID:8291104"
     mRNA            <38245..>39039
                     /locus_tag="KLTH0C00418g"
                     /product="KLTH0C00418p"
                     /transcript_id="XM_002552200.1"
                     /db_xref="GeneID:8291104"
     CDS             38245..39039
                     /locus_tag="KLTH0C00418g"
                     /note="similar to uniprot|Q12512 Saccharomyces cerevisiae
                     YOL154W ZPS1 Putative GPI-anchored protein transcription
                     is induced under low-zinc conditions as mediated by the
                     Zap1p transcription factor and at alkaline pH"
                     /codon_start=1
                     /product="KLTH0C00418p"
                     /protein_id="XP_002552246.1"
                     /db_xref="GeneID:8291104"
                     /db_xref="GOA:C5DDE7"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR029482"
                     /db_xref="UniProtKB/TrEMBL:C5DDE7"
                     /translation="MSKEIGTFRRNGLVLLTSIVCIGTLIAGFVLAIIAERDAVNIKN
                     TRKTFTTVATGEWANAQFPRLHKSCNATDVDFLTRTMNETMEVASYAKEQLLVKGAND
                     TIYKRWFGDGELYDVLGVVDGIANMTKTDVLLRCDDVDGLCAANPNYYAGHHREKADA
                     ETVICDYFYESRAWLSDICANGTLKDFPPPRYAGIDMIHRYFHVSFINLDEYIGEYTE
                     EVEDVLDLAKSNSTFAVRNVDNYLYYLADVYSSDKISGGCLGLDGV"
     gene            complement(<39458..>47005)
                     /locus_tag="KLTH0C00440g"
                     /db_xref="GeneID:8291105"
     mRNA            complement(<39458..>47005)
                     /locus_tag="KLTH0C00440g"
                     /product="KLTH0C00440p"
                     /transcript_id="XM_002552201.1"
                     /db_xref="GeneID:8291105"
     CDS             complement(39458..47005)
                     /locus_tag="KLTH0C00440g"
                     /note="some similarities with uniprot|P32768 Saccharomyces
                     cerevisiae YAR050W FLO1 Lectin-like protein involved in
                     flocculation"
                     /codon_start=1
                     /product="KLTH0C00440p"
                     /protein_id="XP_002552247.1"
                     /db_xref="GeneID:8291105"
                     /db_xref="GOA:C5DDE8"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:C5DDE8"
                     /translation="MVRHLIRIDTTTSYANMSWQTLCLTVSALLLNAVCAKDLGNVFT
                     SLSFVGYSDYNYAVDKVWRADLDFAITPEMNVQMGDTFQLVAPNVLKFYPSRTIGSSG
                     YVEIKDASGSIIANCLIQNGFHASAQSTLDCSISKTDIYKASGSLSIDFVVNFGGSAD
                     STALKAASSVSKGKNTLTWNGLSATANFNLPGSFTSVSSSNFKSYDTLFPNRDNLQES
                     FYLGNTCSSTFSDTIKISYSGTPSNNGQLASCSDIQVHIAKSFNDFNMPVEARALSSN
                     SYTLSCSGSSITVTASNIPAGYHIFINANQLMDRSISNVQYVNRYTESMVCNGKTSTN
                     QYPRSITFVGGSAEGWGSQETLQWYTTTTGWTGSYTTTVTSTTPVIGTDGALTPEPII
                     VIETPTKALTSTTYTPWGGSETVTYSTATTTFTGPDGIPTTETIYYVETPTVGIESTT
                     YTPWTGSETVTYNTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFS
                     TETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVP
                     TTETIYYVETPTVGIESTTYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTV
                     GTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGT
                     ETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFT
                     GSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYY
                     VETPTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTY
                     TPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFST
                     ETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGSETVTFSTETTTFTGSDGVPT
                     TETIYYVETPSVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVG
                     TESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTE
                     TSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTG
                     SDGVPTTETIYYVETPTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYV
                     ETPTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYT
                     PWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTE
                     TTTFTGSDGIPTTETIYYVETPTVGTESTIYTPWTGSETVTFSTETTTFTGSDGVPTT
                     ETIYYVETPSVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGT
                     ESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGSET
                     VTFSTETTTFTGSDGVPTTETIYYVETPSVGTESTIYTPWTGTETSTFSTETTTFTGS
                     DGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVE
                     TPTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTP
                     WTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTET
                     TTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTE
                     TIYYVETPTVGTESTIYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGIE
                     STTYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETTTVGTESTIYTPWTGTETS
                     TFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTETSTFSTETTTFTGSD
                     GVPTTETIYYVETPTVGIESTTYTSWTGRFTSTYSTDVLTFTGSNGVHTTETLYYVET
                     PNLPFFPNTSVIFSTSTASVPTQISTSSTVSISTPTVASTSGTSVLSSTSSFEGSSSS
                     EMTSMPTVSSSATSVPESSSSYPSSNSLLSSTHSYSQESSVTTLASTTFGESSSSSSA
                     ITASFETKPLTSPEPSTSSSSSSSVFSLATETITHESSTTVLTYGSTTTLMPSSSSVL
                     SSASSGTNSDVTSTSTERSSFSPSSSFVEIRPSSTLSASTETSPFGTTTSTADRSSHT
                     TTSASTATSLTDSQTFSAPGPSSPVISVTTETVTESGSTTVVVSTSTSESDTSSPSSS
                     SSASIQSTSTILTSTEPTTSAPSSSASTVTSDRTETTFAESTPASSSGITSTTGVTET
                     ASEERSVTPSSATASASLGWMSSERPVGSTTTEPAQLSSSMVTPVESAASSGTSSGQA
                     SVTTSDIVTPLESNTLSGTSSTVTPAITTGTPSSTASVTSEQRSSLTTSSSAIISLST
                     ASVSQSSTLQSVSTYEGAANKLGLGLLFALPLALI"
     gene            complement(<49362..>51074)
                     /locus_tag="KLTH0C00462g"
                     /db_xref="GeneID:8291106"
     mRNA            complement(<49362..>51074)
                     /locus_tag="KLTH0C00462g"
                     /product="KLTH0C00462p"
                     /transcript_id="XM_002552202.1"
                     /db_xref="GeneID:8291106"
     CDS             complement(49362..51074)
                     /locus_tag="KLTH0C00462g"
                     /note="highly similar to uniprot|P23585 Saccharomyces
                     cerevisiae YMR011W HXT2 High-affinity glucose transporter
                     of the major facilitator superfamily expression is induced
                     by low levels of glucose and repressed by high levels of
                     glucose"
                     /codon_start=1
                     /product="KLTH0C00462p"
                     /protein_id="XP_002552248.1"
                     /db_xref="GeneID:8291106"
                     /db_xref="GOA:C5DDE9"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDE9"
                     /translation="MSSSATPMNNRSNNNTDLAIAGTSTNLDSQSATPSNKMSDDAFD
                     IKGSPAAEAHEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFG
                     DYNTTTEEYYLSNVRTGLIVAIFNIGCAVGGLTLGRLGDMQGRRLGLMAVILVYVVGI
                     VIQISASGKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLG
                     IFLGYCTNYGTKTYTNSVQWRLPLGLCFLWAIFMIGGMVFVPESPRYLIEKGRFEEAK
                     RSIAKSNKLDTEDSGVLAEVDLINAGVEAEKLAGNARWGELFSPRGKILQRVIMGCVI
                     QSLQQLTGNNYFFYYGTTIFQAVGLDDSFQTSIILGVVNFMSTFVGLYTVEKFGRRKC
                     LLWGSAAMSVCFVVFASVGVTKLYPNGKDMPTSKSAGNAMIFFTCLFIFFFATTWAPI
                     AYVIVSETYPLRVKNRAMAMSVGSNWIWGFLIGFFTPFITSAIGFYYGYVFMGCLVFS
                     FFYVFFFVCETKGLTLEEVNEMYEEGVLPWKSESWVPALRRDESYDVNETHEDGKPFY
                     KRFV"
     gene            complement(<52014..>53858)
                     /locus_tag="KLTH0C00484g"
                     /db_xref="GeneID:8291107"
     mRNA            complement(<52014..>53858)
                     /locus_tag="KLTH0C00484g"
                     /product="KLTH0C00484p"
                     /transcript_id="XM_002552203.1"
                     /db_xref="GeneID:8291107"
     CDS             complement(52014..53858)
                     /locus_tag="KLTH0C00484g"
                     /note="similar to uniprot|P36102 Saccharomyces cerevisiae
                     YKL025C PAN3 Essential subunit of the Pan2p- Pan3p
                     poly(A)-ribonuclease complex which acts to control poly(A)
                     tail length and regulate the stoichiometry and activity of
                     postreplication repair complexes"
                     /codon_start=1
                     /product="KLTH0C00484p"
                     /protein_id="XP_002552249.1"
                     /db_xref="GeneID:8291107"
                     /db_xref="GOA:C5DDF0"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DDF0"
                     /translation="MDKANAEWAKDIPCKNITIYGFCKYENDGCIFNHGSTKANATSP
                     GPKFNAKTASSFTPSKVLNSKNSTSAAIKAEKVAKALTTAVEQPTTSSPLAMKSAPFT
                     ASYNPYAANFTPVGSAGTSTPPPASSSHPGFNPYSAPAGINNTGDAPMQSSASFIPGS
                     PAPFAQEAPGRHTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPEMLFIPND
                     IREELLKKNQAALQVFPSGGNLPEIVGDYFGLVPLEFHNRASNKERYQGHQNSLYKVF
                     SNFDGKIYIMRRIHDVKIKESVQIFKPFQDWKKLVNSNVVGVRDAFVTRAFSDSSLCL
                     VHDYYPQSSSLYETHFVSFNPTPITQDLLWSYLVQLCSAIQAAHSFNLAFQNICLDKV
                     IVTGNPGRIKIGDSCLHDILYFQEDTDATKEQQKDFVDLGTLLRDLAAKSTGSQDTDI
                     ESLVVDNDFKQVLNYLLEPKSLKTLPELMALFSHKILPVLSSLQTYAEYTESILAREL
                     ENARLFRLMCKLNFIFGRMESRIDINWSESGEKFPIILFYDYVFHQSDESGKPVMDLT
                     HVLRCLNKLDAGIGEKLMLVTPDEMNCFITSYKELKDLIDSTFRALSQ"
     gene            <53979..>54803
                     /locus_tag="KLTH0C00506g"
                     /db_xref="GeneID:8291108"
     mRNA            <53979..>54803
                     /locus_tag="KLTH0C00506g"
                     /product="KLTH0C00506p"
                     /transcript_id="XM_002552204.1"
                     /db_xref="GeneID:8291108"
     CDS             53979..54803
                     /locus_tag="KLTH0C00506g"
                     /note="similar to uniprot|P40579 Saccharomyces cerevisiae
                     YIR035C or to uniprot|P40580 Saccharomyces cerevisiae
                     YIR036C Hypothetical ORFs"
                     /codon_start=1
                     /product="KLTH0C00506p"
                     /protein_id="XP_002552250.1"
                     /db_xref="GeneID:8291108"
                     /db_xref="GOA:C5DDF1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DDF1"
                     /translation="MSKVVLVTGASKGIGRAIVDVLCSSGEDIKVLGIARSVDDLEAL
                     KTKHQGKFDYLCADITDTAAIVGYVKKINKNYGSLDAVIANAGVLAPVQSVARADVMQ
                     WKQLFDVNFFSIVSLVSELLPSLKKSSQGDVILVSSGASVKPYVCDKHHNRFAKEITT
                     NNQKQYAWGAYGASKAALNQFAQILALEEPQIKTVALAPGVVNTQMQDAIRDELGPPN
                     MTPEALKRFTDLREKNELLEPEIPATIYANLALHGIPATINGKYLRYNDELLKEYR"
     gene            <55308..>56156
                     /locus_tag="KLTH0C00528g"
                     /db_xref="GeneID:8291109"
     mRNA            <55308..>56156
                     /locus_tag="KLTH0C00528g"
                     /product="KLTH0C00528p"
                     /transcript_id="XM_002552205.1"
                     /db_xref="GeneID:8291109"
     CDS             55308..56156
                     /locus_tag="KLTH0C00528g"
                     /note="highly similar to uniprot|P15700 Saccharomyces
                     cerevisiae YKL024C URA6"
                     /codon_start=1
                     /product="KLTH0C00528p"
                     /protein_id="XP_002552251.1"
                     /db_xref="GeneID:8291109"
                     /db_xref="GOA:C5DDF2"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006266"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDF2"
                     /translation="MLRTAFRARIGPQTALRTVKTSQLLLPRAARFYSSNGGSQQPKS
                     RGKLLVLMGALALGSTLFSINYQKNPPVAFVEEENDKKTQRPAFSEKEVSVIFVLGGP
                     GAGKGTQCANLVRDFQFVHLSAGDLLRAEQNRSNSKYGELIKHYIKEGLIVPQEVTVA
                     LLKQAIQESYEKGQKRFLVDGFPRKMDQAVTFEEEIVPSKFTLFFDCPESVMLKRLLE
                     RGKTSGRSDDNVESIKKRFKTFIDTSMPVVKHFEEQGKVVTVSCDHDMNEVYNQVKAA
                     VKDKIL"
     gene            <56455..>57318
                     /locus_tag="KLTH0C00550g"
                     /db_xref="GeneID:8291110"
     mRNA            <56455..>57318
                     /locus_tag="KLTH0C00550g"
                     /product="KLTH0C00550p"
                     /transcript_id="XM_002552206.1"
                     /db_xref="GeneID:8291110"
     CDS             56455..57318
                     /locus_tag="KLTH0C00550g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C00550p"
                     /protein_id="XP_002552252.1"
                     /db_xref="GeneID:8291110"
                     /db_xref="UniProtKB/TrEMBL:C5DDF3"
                     /translation="MDDGCLIDFLLEDDFATMNADSSCLDSKWLVEKDCICDDRVIKR
                     PNRKTKSRTKSKRRSLCKELLDESIDELVNLIIKDTKLSLTIGSEPNQRTKVPQTVSS
                     SKKKSRREGWTNKIGDDQGLLTVFGGEQLAGEFAFNLLDVPEPDVTTESNKKKKVKRN
                     RTRNGASKKAESHPIEPTDQSYAATKGHGHSSAPNSNAEKDAAVKKGKNKKKKRKGQA
                     DDENKLKGNAKDSTKSNSQPRAESRDRESQRKDKSPINSSSKSGPPVHGKRSSRKKTK
                     SASSSNNDQSC"
     gene            complement(<57378..>59540)
                     /locus_tag="KLTH0C00572g"
                     /db_xref="GeneID:8291111"
     mRNA            complement(<57378..>59540)
                     /locus_tag="KLTH0C00572g"
                     /product="KLTH0C00572p"
                     /transcript_id="XM_002552207.1"
                     /db_xref="GeneID:8291111"
     CDS             complement(57378..59540)
                     /locus_tag="KLTH0C00572g"
                     /note="similar to uniprot|P09798 Saccharomyces cerevisiae
                     YKL022C CDC16 Subunit of the anaphase-promoting
                     complex/cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition required for sporulation"
                     /codon_start=1
                     /product="KLTH0C00572p"
                     /protein_id="XP_002552253.1"
                     /db_xref="GeneID:8291111"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DDF4"
                     /translation="MSRGNTPSQHNSTLAISPLVGSRSLQVPQQRNAANASSTRQWSG
                     SHRAAQTPHHSVTYSPLVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPTMPS
                     TLRKVSILGDARRQSTSIDNAASDAAGAEDRVADDRLVQDIDIAQLPAAEKLRLWRHD
                     SLMQHQYRTAEYIGDKVYAMTGDPNDAFWLAQVYYNSGSYIRAVELLTRNNLDTSSVM
                     CRYLTALCLIQLKKYEDALDIVGETNPFRDPLGNHVKNQDGGIKLESSMCYLRGKIFS
                     ALNNFDKAKESLKEALLVDVKNFEAFDELISKNLLTPTEQWTFISSLDFSDLDDNEEL
                     IKSLYITKLSKYLNLDQVHNAHEFLGEEYKLDNNTDLIQSNADTLFTQCKFSECLKLC
                     EEALEKDEFNFSILPIYISCLYELGGKNKLFLVSHKMAENFPKHPITWFGVGAYYMCT
                     NKISEARKYFSKASILDPSFSQAWIGFAHTYAVEGEHEQAVSAYSTASRYFPGTHLPN
                     LFLGMQYLLMGTLPLAEEYFALAYDICPYDPLLLNEMGVLYFKKNDYLKAKRYLKKAW
                     EAIKALDSESKSWISIHTNLAHTYRKLGDNERAVKCFRLVLETTGKDADTLCALGYVY
                     LRMNRIEKAIDSLHSSLALRPSNQAAQDLLKQALDVNLSTVLDESHPLVISSKLQEQG
                     TGTASKKRTANILDVHGVAKKLKHGQDSSDDEDSMDLE"
     gene            <61284..>62402
                     /locus_tag="KLTH0C00594g"
                     /db_xref="GeneID:8291112"
     mRNA            <61284..>62402
                     /locus_tag="KLTH0C00594g"
                     /product="KLTH0C00594p"
                     /transcript_id="XM_002552208.1"
                     /db_xref="GeneID:8291112"
     CDS             61284..62402
                     /locus_tag="KLTH0C00594g"
                     /note="highly similar to uniprot|P38998 Saccharomyces
                     cerevisiae YIR034C LYS1 Saccharopine dehydrogenase (NAD
                     L-lysine-forming) catalyzes the conversion of saccharopine
                     to L-lysine which is the final step in the lysine
                     biosynthesis pathway"
                     /codon_start=1
                     /product="KLTH0C00594p"
                     /protein_id="XP_002552254.1"
                     /db_xref="GeneID:8291112"
                     /db_xref="GOA:C5DDF5"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR027281"
                     /db_xref="UniProtKB/TrEMBL:C5DDF5"
                     /translation="MAPVILHLRAETKDQEARAALTPTTVEKLLSKGFKIYVEESDQS
                     TFDIDEYRKVGAEIVPKGSWVNAPKDRLIIGLKELPEDNFPLVHEHIQFAHCYKNQAG
                     WQDVLGRFKRGHGILYDLEFLENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHADSE
                     DLPGVTPSPNEQELVKDVTKDYQAALKKGAKKPTVLIIGALGRCGSGAIDMLRKAGIP
                     EKNIIKWDMKETARGGPFQEIAQADIFINCIYLSKPIAPFINSTLLNSNSRRLRSIVD
                     VSADTTNVHNPVPVYTVATVFSKPTVLVPTTKGPKLSVISIDHLPSLLPRESSEFFAR
                     DLLPSLEQLPDRENAPVWARARALFYRHCARLERQSKF"
     gene            complement(<62501..>63724)
                     /locus_tag="KLTH0C00616g"
                     /db_xref="GeneID:8291113"
     mRNA            complement(<62501..>63724)
                     /locus_tag="KLTH0C00616g"
                     /product="KLTH0C00616p"
                     /transcript_id="XM_002552209.1"
                     /db_xref="GeneID:8291113"
     CDS             complement(62501..63724)
                     /locus_tag="KLTH0C00616g"
                     /note="similar to uniprot|P20484 Saccharomyces cerevisiae
                     YKL021C MAK11 Protein essential for cell growth and
                     replication of M dsRNA virus contains four beta-
                     transducin repeats"
                     /codon_start=1
                     /product="KLTH0C00616p"
                     /protein_id="XP_002552255.1"
                     /db_xref="GeneID:8291113"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DDF6"
                     /translation="MSQNQFRIVVGSYEHNLLCLSLNLSLPSPLFTPIFHFQAHSLSV
                     KCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITSLKFSRGAAIPNQDGDD
                     SEKPVTHGNSKWLLSASEDHNLVVWRVKDWENFGTLKGHSARINDFDIHPSNRIAISV
                     SEDHSIRLWNLMTVKKAGILKLKKYNQNGQFVRWCGDNGEFFAVALLNKVLIYKTSTA
                     KVHREIDVGRSTIMHLEVEKINDKQYIVVALGNGSVSMYQGEQLFKDDADEAEEAEKT
                     GDAEETPITPEYTLQGHATRVKDFKFYRNEFGHYLVTISSDGKIVVWDMSNREQVAVY
                     DCGERLNCLAICDESVERYEMMKKRVAEEADLGEQSEVEEDTEDLKSIMLGTNKKKSK
                     KSRSKKNKKVKVQLE"
     gene            complement(<63995..>67252)
                     /locus_tag="KLTH0C00638g"
                     /db_xref="GeneID:8291114"
     mRNA            complement(<63995..>67252)
                     /locus_tag="KLTH0C00638g"
                     /product="KLTH0C00638p"
                     /transcript_id="XM_002552210.1"
                     /db_xref="GeneID:8291114"
     CDS             complement(63995..67252)
                     /locus_tag="KLTH0C00638g"
                     /note="similar to uniprot|P40578 Saccharomyces cerevisiae
                     YIR033W MGA2 or to uniprot|P35210 Saccharomyces cerevisiae
                     YKL020C SPT23, ER membrane proteins involved in regulation
                     of OLE1 transcription"
                     /codon_start=1
                     /product="KLTH0C00638p"
                     /protein_id="XP_002552256.1"
                     /db_xref="GeneID:8291114"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002909"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DDF7"
                     /translation="MVQQDTHMMETELLEDFLFAESQQQQQQQQEQQEQQHQQPGSYG
                     GGDGEEQHGDDLFSTFINTDMLLQPSNYTLQPQHTSSMMLGVGAPDLLNGFSEPRQPR
                     KSISPLGGTSDIQSPAPSISTGLTTPPQAMSYSQGCERLVDRSLQFGRTKPIQSAYLN
                     SSDFLDIPEDTLPYKLVVSGMPSASRVETQIKLELSISPPPREYIVHLPTDCITKQKW
                     YLEDDITTYPREIQNEILYLESFLVCASNGKPTYVCSRCVKREQRRASRRKSGLCDNM
                     LWCNNENRRAVVFNSKQVFSIKDVNCTPQFKSFDLSTRIVCYCRHHKEPEGFKILFVL
                     RNANQEVLAKSLTGPIMIMDKKSNRDAAANTSLQDSVADSNNNTDGSRSERSEIPNVT
                     STSDFSGMENHKPRDDFMHLSVKGEHMLSPTSMGGDSSEAHATDANVVESYGPRGAAS
                     SVSLPDKASGYKRKRSSPDYNSTAIGFSPQNFTKPHANSNFSKSLSASSSNHSIPLLN
                     QPAHNNPTAAMMTATNSMLREISDLAEVPQAPRPYINRVIPSQGPVKGGIEVTLLGSN
                     FKPGMIVKFGQNRALSTQCWSESTLVTYLPPSSRAQEVLVTVFEKEEEQPEVLGTMSN
                     SKAIFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVGHEGNSSNSTPSPSAN
                     NAPQNSYNIGMGQVLYSDESLLLKVIKLLNSSSNLSMCDEEGQTMLHLACLKGYYHLA
                     SALVRKGARVDAKDSFGFLPLHFACLNGDARIIRLLVQCKATVHAETINGSSPRALFI
                     ANHDTDDERYEDYLNEVLDALDTDSSSEEYSCNMLRKLSDSSFQSSVFDAESLASLND
                     NIQVHISKMAEDTLSDDDEDLDGYEEDGDECLLQDDDDSIATADNSQSQDSALIATSQ
                     EAHRHSGQFENSIWNRVLNAFNDDLPKYEDLFPVLDRERNKKSLLANRNPTELTATQS
                     STAEDSQTSSEDEEDALQARLNRFFQQRQNFRNDKMLLFFWLPVAIILLSSFLIFEFG
                     HDGNRIHHLSQAVSEYLRVGLANVMLGNERVKGAFKGSLHSLQAGAAVAGGIEGS"
     gene            <68274..>69221
                     /locus_tag="KLTH0C00660g"
                     /db_xref="GeneID:8291115"
     mRNA            <68274..>69221
                     /locus_tag="KLTH0C00660g"
                     /product="KLTH0C00660p"
                     /transcript_id="XM_002552211.1"
                     /db_xref="GeneID:8291115"
     CDS             68274..69221
                     /locus_tag="KLTH0C00660g"
                     /note="similar to uniprot|P29703 Saccharomyces cerevisiae
                     YKL019W RAM2 CAAX farnesyltransferase alpha subunit"
                     /codon_start=1
                     /product="KLTH0C00660p"
                     /protein_id="XP_002552257.1"
                     /db_xref="GeneID:8291115"
                     /db_xref="GOA:C5DDF8"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:C5DDF8"
                     /translation="MSDAPEFQYDDIEPLPISGGQEGELCQIMYDGEYRTVMGIARAL
                     LQKLEFSERALHATSQAIDLVPAFYTMWNYRFQIVKALYGTDGAELNRELDWLDEFTL
                     NNPKNYQIWSYRQALLRLHPSPEFQRELPILQSMIDDDTKNYHVWSYRRWCVLFFGDF
                     TNELQFASSLIARDVYNNSAWCHRMFVLKNQVPKGPPAEALTGELHYTKKQIELAPQN
                     ISSWNYLRGLYDEFLDGKADPAIMEFALSFTPGIFAADASDTGPQIQSSYALEFLARA
                     YAKNEDTFAQARKAYQALSDHFDPIRKNFWAYKIRSLTA"
     gene            <69344..>70501
                     /locus_tag="KLTH0C00682g"
                     /db_xref="GeneID:8291116"
     mRNA            <69344..>70501
                     /locus_tag="KLTH0C00682g"
                     /product="KLTH0C00682p"
                     /transcript_id="XM_002552212.1"
                     /db_xref="GeneID:8291116"
     CDS             69344..70501
                     /locus_tag="KLTH0C00682g"
                     /note="similar to uniprot|Q02256 Saccharomyces cerevisiae
                     YIR026C YVH1 nitrogen starvation-induced protein
                     phosphatase"
                     /codon_start=1
                     /product="KLTH0C00682p"
                     /protein_id="XP_002552258.1"
                     /db_xref="GeneID:8291116"
                     /db_xref="GOA:C5DDF9"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016278"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DDF9"
                     /translation="MGHLIASTPHRPSKFPFSTHNLLREVAKYQYLMSTIDRILGNIY
                     VGSVQPIIDHVPLRTDYNISHILSVMKFEVLPEYLVRKSYTLKNVAIDDDETTDILQY
                     IDETNRFIDSCLFPHEPEYDPRKVDFRKKPQQGGVYVHCHAGVSRSVTFIVAYLMYRY
                     RLNLKSALYAVKRKHPGAQPNDNFMEQLKIYQDMGSYHVDIDNQAYKVWKLTNSVKED
                     GTGENILAQEDTFKHNDQKRLQEMTPEELSAVTVIRCKKCRQKLALSTSFIQHEPPSK
                     ESTEGHFIRRAAGGRRIIGIQQSQDSCSHFFVEPLNWMKDELQGKQELEGKFSCPGCS
                     SKVGGYNWKGSRCSCGKWMVPAIHLQNAKVDQIAFAKKALPNMVGSELTKE"
     gene            complement(<70539..>71513)
                     /locus_tag="KLTH0C00704g"
                     /db_xref="GeneID:8291117"
     mRNA            complement(<70539..>71513)
                     /locus_tag="KLTH0C00704g"
                     /product="KLTH0C00704p"
                     /transcript_id="XM_002552213.1"
                     /db_xref="GeneID:8291117"
     CDS             complement(70539..71513)
                     /locus_tag="KLTH0C00704g"
                     /note="some similarities with uniprot|P40577 Saccharomyces
                     cerevisiae YIR025W MND2 Subunit of the anaphase-promoting
                     complex (APC) needed for meiotic nuclear division"
                     /codon_start=1
                     /product="KLTH0C00704p"
                     /protein_id="XP_002552259.1"
                     /db_xref="GeneID:8291117"
                     /db_xref="GOA:C5DDG0"
                     /db_xref="InterPro:IPR008402"
                     /db_xref="UniProtKB/TrEMBL:C5DDG0"
                     /translation="MNFDLPDSLQLAIDTVSGRDHGCSLENLPVFRAREDHTASRNDP
                     KSLGSRGRRQTDRETKSKFYTMPPLAAYSAFSEHPFYHVHKATGSKFDPFEMRLELSE
                     KQQESIRMLGWDSIRPVGIGFTMKERKDLAKLEAKEQERQQQQGSHGVRDLLSTDRPQ
                     ENVNTPQQTTLPHEAVIRSLTPPDMDINLDQDIHEDETSYDYDDEFARIEPDDDVAEP
                     HNARDDNYERAERTVQQFIETSHIEGVSHPYDMENNYQHSYNYSDNEDSGSLALPPVT
                     IPDIEAYDVGINGPEIADINSGGASPPLPRQRRQRLRSPFDVDDLGCD"
     gene            complement(<71655..>71891)
                     /locus_tag="KLTH0C00726g"
                     /db_xref="GeneID:8291118"
     mRNA            complement(<71655..>71891)
                     /locus_tag="KLTH0C00726g"
                     /product="KLTH0C00726p"
                     /transcript_id="XM_002552214.1"
                     /db_xref="GeneID:8291118"
     CDS             complement(71655..71891)
                     /locus_tag="KLTH0C00726g"
                     /note="similar to uniprot|Q3E7A7 Saccharomyces cerevisiae
                     YKL018C-A"
                     /codon_start=1
                     /product="KLTH0C00726p"
                     /protein_id="XP_002552260.1"
                     /db_xref="GeneID:8291118"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:C5DDG1"
                     /translation="MLSYEKSDLKRYIRRYLDWGEGLYERLVRVAKRSAYFRKETPLD
                     GFLDGMFKRVEELGRGPVSEGLSREQATAAARRR"
     gene            <72171..>73157
                     /locus_tag="KLTH0C00748g"
                     /db_xref="GeneID:8291119"
     mRNA            <72171..>73157
                     /locus_tag="KLTH0C00748g"
                     /product="KLTH0C00748p"
                     /transcript_id="XM_002552215.1"
                     /db_xref="GeneID:8291119"
     CDS             72171..73157
                     /locus_tag="KLTH0C00748g"
                     /note="highly similar to uniprot|P36104 Saccharomyces
                     cerevisiae YKL018W SWD2 Subunit of the COMPASS complex
                     which methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="KLTH0C00748p"
                     /protein_id="XP_002552261.1"
                     /db_xref="GeneID:8291119"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DDG2"
                     /translation="MSLDISRETLLGFKAVKTFKPGENEVAPVTSLSFDDHGRYLLAA
                     SANDNMHLYDAMNCRFLNTIASKKYGCHSAKFTHAQNECVYSSTMKSFDIRHLNLETN
                     QYLRYFTGHGALVSDIQISPLNDTFLSASYDESVRLWDMRVSKAQAIVPSLVPNCIAY
                     DPSGLVFALGNPENCEIGLYNLRQLKNGPFLVIKVHPSFNQWSKIEFSNDGKYILLAS
                     SAGKQVILDAFDGSQLFELAGTKSFPLREFMDAGSACFTPDGRFTLSTDYAGKIALFN
                     HADSISGRTLKPCGSINAAPESCPRSIAFNPKYSMFVTADESVDLYVYDKPI"
     gene            complement(<73182..>75161)
                     /locus_tag="KLTH0C00770g"
                     /db_xref="GeneID:8291120"
     mRNA            complement(<73182..>75161)
                     /locus_tag="KLTH0C00770g"
                     /product="KLTH0C00770p"
                     /transcript_id="XM_002552216.1"
                     /db_xref="GeneID:8291120"
     CDS             complement(73182..75161)
                     /locus_tag="KLTH0C00770g"
                     /note="similar to uniprot|P34243 Saccharomyces cerevisiae
                     YKL017C HCS1 Hexameric DNA polymerase alpha- associated
                     DNA helicase A involved in lagging strand DNA synthesis
                     contains single-stranded DNA stimulated ATPase and dATPase
                     activities replication protein A stimulates helicase and
                     ATPase activities"
                     /codon_start=1
                     /product="KLTH0C00770p"
                     /protein_id="XP_002552262.1"
                     /db_xref="GeneID:8291120"
                     /db_xref="GOA:C5DDG3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004483"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDG3"
                     /translation="MNKVIGERFLECIAHEQSQDTELTARLLETLPLSQLVSKGLAIN
                     HLTLQNVRSGLAGRLYVELGPDTAIDQEIIRGDVRNGDLVVIRPSGAKKDAFSCEGVV
                     TKCSEKCITVAVDEAQEKDALNLYSSLRLYLLKTTNTITYKRMQSTLRKLCEFDGVPQ
                     NEVIQYLLDAPVFTSQTQPLKVDFFNPDLNTSQKKAIEFSLQNRISIIHGPPGTGKTH
                     TVVELVHQLYNKGQRVLVCGPSNIAVDTILERLAKVMPGESLLRIGHPARLLESNLSH
                     SLEVLSKSGDAGAITKDISKEIDDTIASIKKLKSYKQRKEQWKEVRELRKELKLREKK
                     VISDLVLSARVVVSTLHGSSARELVDCYKHTDHIFDTLIIDEVSQSLEPQCWIPLIAH
                     YKSDIQKLVLAGDDKQLPPTIKTEDNTKVKNTLGTTLFDRLVKKYGDSFRNLLDTQYR
                     MNSEIMEFSSIKMYDGKLKAADSVASWTLVDLPATECNENTEVPLIWYDTQAGDFPER
                     AEDQDSGSLVSSKYNENEAFLALHHVTSLIDSNVPQECIGIISPYNAQVAFLKKTVHP
                     QYPLVEISTVDGFQGREKEVIILSLVRSNDKFEVGFLSDQRRLNVAMTRPKKQLCVIG
                     NMETLERSGIEYLKDWVRWSEEHSEIRYPDLSEIL"
     gene            complement(<75339..>75863)
                     /locus_tag="KLTH0C00792g"
                     /db_xref="GeneID:8291121"
     mRNA            complement(<75339..>75863)
                     /locus_tag="KLTH0C00792g"
                     /product="KLTH0C00792p"
                     /transcript_id="XM_002552217.1"
                     /db_xref="GeneID:8291121"
     CDS             complement(75339..75863)
                     /locus_tag="KLTH0C00792g"
                     /note="highly similar to uniprot|P30902 Saccharomyces
                     cerevisiae YKL016C ATP7 Subunit d of the stator stalk of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="KLTH0C00792p"
                     /protein_id="XP_002552263.1"
                     /db_xref="GeneID:8291121"
                     /db_xref="GOA:C5DDG4"
                     /db_xref="InterPro:IPR008689"
                     /db_xref="UniProtKB/TrEMBL:C5DDG4"
                     /translation="MSIAKSAANKLDWASVISSLKLTGKTATQLTSFKKRNDEARRKL
                     LELQAQPTAVDFSYYRSVLKNSEVVDKIESFYKSYKPVTVDVKKQLSTIEAFESQALE
                     NAKETEKFVAQELKDLSDTLKNIESARPFDQLTVEELAKARPDIDAKVEEMVKKGRWE
                     VPGYKEKFGDLTVM"
     gene            <76637..>79141
                     /locus_tag="KLTH0C00814g"
                     /db_xref="GeneID:8291122"
     mRNA            <76637..>79141
                     /locus_tag="KLTH0C00814g"
                     /product="KLTH0C00814p"
                     /transcript_id="XM_002552218.1"
                     /db_xref="GeneID:8291122"
     CDS             76637..79141
                     /locus_tag="KLTH0C00814g"
                     /note="similar to uniprot|P25502 Saccharomyces cerevisiae
                     YKL015W PUT3 Positive regulator of PUT (proline
                     utilization) genes zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type"
                     /codon_start=1
                     /product="KLTH0C00814p"
                     /protein_id="XP_002552264.1"
                     /db_xref="GeneID:8291122"
                     /db_xref="GOA:C5DDG5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DDG5"
                     /translation="MMQEVNSVAMEDAGLDQPTEYLPSASYEGVVSDSDEMSSRTSKR
                     RIKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYMEPNKKLVVSMKYLQKLQSDL
                     AEMKRENIKLQASVKNIAPQDAAEAGPSNRPSDVKFHKNTVDQSTLGSSSAASASSRA
                     ATTDDEEIVPNFTERRGRLVASRTGQQYFVGSSSMTLFGMEIQSLIPKRLASRKRDGR
                     ELTSLEVDGTPRAPVQPIDEILQEEGNAYKIVLSKNDGTNDISVNFSLPSYSYAILLV
                     DTFVTYNDGCFYFFNEGIVKEQLKAVYEGGTALPDHTLQTIWFCKVLLIFATGEMYLG
                     TANNMNGSKLPSKAGAKLPGSGFFEQASKIFSCLFSSGRIENVTKPGGLEVMLLYAFY
                     LQVADCTVASYFYFGQALRACLIMGWHVDAQRDSITRFELEHRRRLWWTVYMFERMLS
                     SKAGLPLSFTDETITTELPDDFDMSSPPAGCEHYIFPEAEYITNCVKITQINAQILNK
                     LYQRQPGSNILPVLKEIVLQLIEWRRTLSGFLQADFQRKDFKISRLSTNIFTEYFQGM
                     NLAIRPLLFHFASIQLKRSETSDTYINLQDYSPTISALLNCSLQASINTIRSLWYLKL
                     QNMVALFGYMDREYLFTAACTLVLFNAAFGIHDQTAEHLDHALLTFTKMRNLGNNPAG
                     HRRAQLLRLMSSLDFKGSMKELIQNHVDDLRPDAQFENHGDKEAEIVSYVSTESDVVR
                     ISPSASVSLEGDFRADSPKEGEIVRENNASTFEPFSLDSKSDIQKFLAGLENVDTSEN
                     ELWKEISHQAMWLGNAMDPTGPVGDEDTTGGLNFFE"
     gene            complement(<79382..>84553)
                     /locus_tag="KLTH0C00836g"
                     /db_xref="GeneID:8291123"
     mRNA            complement(<79382..>84553)
                     /locus_tag="KLTH0C00836g"
                     /product="KLTH0C00836p"
                     /transcript_id="XM_002552219.1"
                     /db_xref="GeneID:8291123"
     CDS             complement(79382..84553)
                     /locus_tag="KLTH0C00836g"
                     /note="similar to uniprot|P34241 Saccharomyces cerevisiae
                     YKL014C URB1 Nucleolar protein required for the normal
                     accumulation of 25S and 5.8S rRNAs associated with the
                     27SA2 pre-ribosomal particle proposed to be involved in
                     the biogenesis of the 60S ribosomal subunit"
                     /codon_start=1
                     /product="KLTH0C00836p"
                     /protein_id="XP_002552265.1"
                     /db_xref="GeneID:8291123"
                     /db_xref="InterPro:IPR021714"
                     /db_xref="UniProtKB/TrEMBL:C5DDG6"
                     /translation="MSHFRGRFAQTGGAGKPQSQKHGGSSMMDDGVFDKLQSVISEID
                     LLNEGVSNDYQPVISFFSSKFAAQIIQSWSYHAQVNNHQKFSSCTSRLAKALRVLGSD
                     SSTLIYGSNLVRSILQENTKVLYRGLNNMKPSITNPTLRLLRQIIAFNKGQHVDDFLT
                     CFDMSLPSLPRLLSPTKAELSDLEHTIKNPELSMRFNFIQFWLCLIENATPILRKAVL
                     TENPKIMSAWYKHMTKIDSVKLLIQTLNTLINFVLKERSLKRVTKCKILNESLISKIH
                     YFYSSTNADLVHHTDLFFESYSSVKGDGVTFSDDKIWFTEPVYSSAGAGSGSTGALVV
                     INNKKFYLYNKLLFTMLTFFKPWEDEIQLNRVKKVLENVPELVAPYSHYLGTLGNHDP
                     RMTSYWFGMTLLLGRMMNLPVPPKVREVQTDKHPSSHLVMESIIPCTITKSALTKSLS
                     HNVNLIKQMGCQLLVFSFKKLDIVINLYDEKGWSSAKSELINLFKARIPELSSISSAL
                     EAAGQAQNENKVLSASLSVILNYYSKFFPLNFSITLPSDNIFVTIMKSDTFSGLDLVM
                     LDNFLHFQQFNNSHTKWYNPNAGENSIFTSLLRLASSANATNSITNKVKELLENLLNF
                     TVLFNNDELLASPVLVLINSLQVIMRSESCRSSAQESKIWKLLDETVARCMKTPYKYV
                     DMSVPYENCSPFLVALIEQWSFVDKQTPFELVLRWMLIYLRSCYFVREPIESLKPLLE
                     AAPSISSDLQSEYLNFENYDDSLDLLQGQDYLLSNNAPYSFFQHITLVSTSDLDQVAR
                     YPTNELDIAGLLTRIQFLLKADTSSMKLQKFCAIVDNLLMKAANYTLSQDDFKQKFAS
                     TKYFEKVTIAADIDTENELVCEKSAYVTNSMLEVYLQLDEDVSEVSAYIHHLWGERLP
                     QWSSNPDLMSILIKGLQILSDSQLSEIQLRLLLNNQDLLPLILTEMVKRGTTLPGTRF
                     MELLALKSEKITDVLSEYLTKKLVENPNFESIISLALEDAISYPIIIDCLAYEEGAKK
                     IMGFLDLIKCESLCINVAAAISDKAKDTEASHFVDRALHSACDDLSKLSVLDFEAAMK
                     LFYDCHANASEDLKHNVLGFLISQNEYRFSPWAAKIVELYNVKGDHNISTWMQKSVLY
                     ITKTFAERNHLSSKFSEFLQNFKGLLFKVNIWSLGVQSILETQVEVILGGMWVGRAEA
                     LEYLNILLLGASNSQVNSNKMLQLLLNNEQSSLNDQKTNSHARFLTSSIMSRLFHLDA
                     AKNATPIVQEKLLLSYNGSVSADDRIIFDVLKEIESRTLSSWTNNVFVWDFQEDFEED
                     QADDTPLLTKEREGLVLTIKRARINTTIENFACEQPSIPQFASGNVEDTWHRLVAFEE
                     AIELTYQNFERKVYDPLFILLLVANNKELFRNDNSDLESQSQASFFDMRKVVVSGLLE
                     LVILSLSERNETKDVALALIYKMIDSLKHGGSFKDSNIFHIFLMKVAYTFHTEKDQEV
                     SPLVWYMISRLSSILTQPSSVLYEKAYKWVLASPSVQPQHLPLYDAVVVTRPTEDGEH
                     YYKYLNWFLEAIQRGIKSEDDIKLLRSRNLLEWMMNLLNSPYINLGQRNTLNLLVYRI
                     QRIETGGPTLITRYAGVSFLEALREGSSEGLVGVSTETLANTKNKLRLKQFLVSQQLD
                     VNYSELGAGYAAVSKSQKRLAEWMEGDVDNVLKRLCTIGNQTSHQTNLNYPFMHV"
     gene            <84727..>85731
                     /locus_tag="KLTH0C00858g"
                     /db_xref="GeneID:8291124"
     mRNA            <84727..>85731
                     /locus_tag="KLTH0C00858g"
                     /product="KLTH0C00858p"
                     /transcript_id="XM_002552220.1"
                     /db_xref="GeneID:8291124"
     CDS             84727..85731
                     /locus_tag="KLTH0C00858g"
                     /note="similar to uniprot|P40576 Saccharomyces cerevisiae
                     YIR024C (putative) involved in cell cycle control"
                     /codon_start=1
                     /product="KLTH0C00858p"
                     /protein_id="XP_002552266.1"
                     /db_xref="GeneID:8291124"
                     /db_xref="UniProtKB/TrEMBL:C5DDG7"
                     /translation="MLILPITCRCEVNGESKLGRELEPLKTECPAFQLFLGASKKAEI
                     GQNNLVASIAEAATARITSTLVTRAIKSRWNPTNNLIKMWNFSRLASRISRRLYSSSF
                     PHASSKNPGNSKFDKTMLKPALVIVLFGSMLTNVMEQQKRNSELERRYGMKLGVLQDL
                     IDKVKHGEDSSIDIDKELALVNKLFERFEISKYVELEEEASKVRKLNDQADVISQNEI
                     AARLNGKKPVDDETSLRELFRDIMKDIDDIPVARNEESKQHDSKVVSSDQNKAIYQVE
                     MKTVPESEIQTNERVLTEEAKNEKQRLKFRPATDSHVIVENPGEYSTAAEDHKVSKFL
                     "
     gene            complement(<85841..>89098)
                     /locus_tag="KLTH0C00880g"
                     /db_xref="GeneID:8291125"
     mRNA            complement(<85841..>89098)
                     /locus_tag="KLTH0C00880g"
                     /product="KLTH0C00880p"
                     /transcript_id="XM_002552221.1"
                     /db_xref="GeneID:8291125"
     CDS             complement(85841..89098)
                     /locus_tag="KLTH0C00880g"
                     /note="similar to uniprot|P21657 Saccharomyces cerevisiae
                     YIR023W DAL81 Positive regulator of genes in multiple
                     nitrogen degradation pathways contains DNA binding domain
                     but does not appear to bind the dodecanucleotide sequence
                     present in the promoter region of many genes involved in
                     allantoin catabolism"
                     /codon_start=1
                     /product="KLTH0C00880p"
                     /protein_id="XP_002552267.1"
                     /db_xref="GeneID:8291125"
                     /db_xref="GOA:C5DDG8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DDG8"
                     /translation="MTNNTLDNWNSGASGGQGSGNVNNSMLNLNDDYTNILNNLGNSQ
                     SQLLGDDLANRHDSQSSQQSPYNLPNLNARPSNEKQPNLDLLLQHYQELFSRSSGGSG
                     DNSPDPSGVVAPNTNSKALAAQENKSVIAEKPCDHCRRRQIKCVIAPDLPNCVQCENK
                     GIKCAYSELPSSRVPTDIVPDKQKRSRVDENVDVHELLKRAKLNNNDSVSQYYSDLLQ
                     NLNQSSNSRNPSGPSQYPTRSNQLNPFMMYGTPGLNDQASKSGTASVHNGASPAYLSG
                     NTTYNTNNPIAQKMAYTPPPIQYPRSSFYVGPTSVFDINLVNHVKLDKIDQVQLSKTL
                     ALRKVAPNVQFLLRDDLNQQLYMKQEQEIDMVEKLVHPHGKILVDIFFKLIHPQYPIL
                     HERVFLEKYSRSYRELTAPLLAALYSLSLQWWDFHPQLIGFPKPDVVNQLNEIALRTF
                     FDVVERPKLSIIQTGLLILQCRSESSSNWVICSEIVALAEDLGLGIDCQDWRLPGWER
                     GLRRRLAWAVWLEDKWASMMEARYSHLILGRNWLVKMLADEDFPESSPVINDSNGNNK
                     MNYQGLKDVTSPVGNISMLDMTPTGEDFKNGKLLFQHMVSLSIILGEVMDTFYTLGAL
                     KTVTKIEQVLKLAKPLQLKMREWYHSLPSQLSMNNFQQRRFTSNASLTLSYFAVELTL
                     HRKIITTLNSETSPQLVQVCRLAAKTRLIAAIEFVRDLKFEHVNSFWYTCSTGNLTLI
                     GTFAALLYVTAPSKEESIVFRDCLRNFVWILRMSSKGFEKAENGLKKIHMLLAQIPGL
                     LTDDPVVPQQPQQSFVAPPSESPMMPQQQLQQQQQRQQQQQQQQQQQQQQQQQQQQQQ
                     QAGQQSYGAALSQSPFDPQRSFNQLRQLPPEILQQLASLQNNMPSINSSSSTEETMKP
                     SDHRSVKPSRPEGPENRETLPDFHNMSPELTSLDLRSSPQKNTRAQPEHESSTRPEQA
                     VGSEDTQQSPTKTPGITEKSKILTPQSVYGANGKKANASEQNDDHSREINNYDPKREG
                     SHVSPASLAESNGNDKPVDSGNAQKVSRDLEDSATAESKETKSGSGTSSPSSDQT"
     gene            complement(<89610..>90125)
                     /locus_tag="KLTH0C00902g"
                     /db_xref="GeneID:8291126"
     mRNA            complement(<89610..>90125)
                     /locus_tag="KLTH0C00902g"
                     /product="KLTH0C00902p"
                     /transcript_id="XM_002552222.1"
                     /db_xref="GeneID:8291126"
     CDS             complement(89610..90125)
                     /locus_tag="KLTH0C00902g"
                     /note="highly similar to uniprot|P33204 Saccharomyces
                     cerevisiae YKL013C ARC19 Subunit of the ARP2/3 complex
                     which is required for the motility and integrity of
                     cortical actin patches"
                     /codon_start=1
                     /product="KLTH0C00902p"
                     /protein_id="XP_002552268.1"
                     /db_xref="GeneID:8291126"
                     /db_xref="GOA:C5DDG9"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="UniProtKB/TrEMBL:C5DDG9"
                     /translation="MSQSLRPYLTAVRFSLQAALNLTNFSSQVVERHNRPEVEVSNTS
                     AELKLQPMHVSRNEHEQVLIEPSVNSVRVSIKVKQADEIEQILVHKFTRFLEQRAESF
                     YVLRRVPIDGFSISFLITNKHTETMKTEKLVDFIIEFMEEVDKEISEMKLFLNARARF
                     VAEAYLGEFVY"
     gene            <90830..>92524
                     /locus_tag="KLTH0C00924g"
                     /db_xref="GeneID:8291127"
     mRNA            <90830..>92524
                     /locus_tag="KLTH0C00924g"
                     /product="KLTH0C00924p"
                     /transcript_id="XM_002552223.1"
                     /db_xref="GeneID:8291127"
     CDS             90830..92524
                     /locus_tag="KLTH0C00924g"
                     /note="similar to uniprot|P33203 Saccharomyces cerevisiae
                     YKL012W PRP40 U1 snRNP protein involved in splicing
                     interacts with the branchpoint-binding protein during the
                     formation of the second commitment complex"
                     /codon_start=1
                     /product="KLTH0C00924p"
                     /protein_id="XP_002552269.1"
                     /db_xref="GeneID:8291127"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="InterPro:IPR027237"
                     /db_xref="UniProtKB/TrEMBL:C5DDH0"
                     /translation="MSSWKEANDAEGRVYYYNADSGETTWDKPRELFTQLELKLEKHG
                     WKTGKTDEGQVYYYNQETGKSCWEIPTFEEHGEEEEAERPHTSDERSTTPAQSNIESY
                     VNNSIILNAPVMSQNEAEHVFMEMLKEHQIDSTWSFNKIISELGCKDPRYWCVDDDPL
                     WKSQAFEKYLSNRSEDQLLKEHSAVNKFKAAFTAMLSQNKDIRYYTRWTTAKRLFANE
                     PIYKHSVVSERTKRQVFQDYVDDLRRNQSEELNKTKQQAKTELQDYLESIMPDKKSLL
                     SWQELSTKYLFENSTRFTSNRHFQALSKHDVLMQYITIVEAYTSKTEEELKKLKSANY
                     TKDRIARDHFKELLAEHSKSIRCNSKWEDLYSLFKSDSRFLSLLGRNGSSALDLFMDL
                     VEEKANIMKAQKSIANQILIDTSFQWSSDAVQDREKVNEILSKHQQLNSLDTIDRGIL
                     VDKMIDDQNQKRAQQAEMIQRLLEQRKKYFLLLLQRVFSSPNAKPETWEKARDVLKGY
                     PEYIDIKEESVKEQIFKEFEPAKGQNTAAAAATGSSALAAPQISRKRQMTPVELDY"
     gene            complement(<92590..>93096)
                     /locus_tag="KLTH0C00946g"
                     /db_xref="GeneID:8291128"
     mRNA            complement(<92590..>93096)
                     /locus_tag="KLTH0C00946g"
                     /product="KLTH0C00946p"
                     /transcript_id="XM_002552224.1"
                     /db_xref="GeneID:8291128"
     CDS             complement(92590..93096)
                     /locus_tag="KLTH0C00946g"
                     /note="highly similar to uniprot|P15367 Saccharomyces
                     cerevisiae YIR022W SEC11 18kDa catalytic subunit of the
                     Signal Peptidase Complex (SPC Spc1p Spc2p Spc3p and
                     Sec11p) which cleaves the signal sequence of proteins
                     targeted to the endoplasmic reticulum"
                     /codon_start=1
                     /product="KLTH0C00946p"
                     /protein_id="XP_002552270.1"
                     /db_xref="GeneID:8291128"
                     /db_xref="GOA:C5DDH1"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019759"
                     /translation="MNLRLELTRFLNLCFALASAFMFWKGLSIVTNSHSPIVVVLSGS
                     MEPAFQRGDILFLWNRNELNKVGDVVVYEVDNKEIPIVHRVLREHVDETSGKQLLLTK
                     GDNNAGNDIPLYAKRKIYLHKEKDIVGTVKGYIPQLGYITIWISENKYAKMGLMGLIA
                     LSALLSNE"
     gene            <93347..>94012
                     /locus_tag="KLTH0C00968g"
                     /db_xref="GeneID:8291129"
     mRNA            <93347..>94012
                     /locus_tag="KLTH0C00968g"
                     /product="KLTH0C00968p"
                     /transcript_id="XM_002552225.1"
                     /db_xref="GeneID:8291129"
     CDS             93347..94012
                     /locus_tag="KLTH0C00968g"
                     /note="similar to uniprot|Q04304 Saccharomyces cerevisiae
                     YMR090W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C00968p"
                     /protein_id="XP_002552271.1"
                     /db_xref="GeneID:8291129"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DDH2"
                     /translation="MKVAVFGGAGRVGKILCLALRDNEAFEPLAVVRSGEQANALQES
                     GVNASVLDIEKCTVEKITAAIEGCDAVVWTACSGGIAMDRIFTMDLDGAIKAIEATQK
                     AKIQRFIMVSAINVDNRDAWWHTALKNNFIAKRTADRILQTSGLQYTILRPGSLHSEQ
                     GTGKLCSLDSLEQKKPCHYLIEREDVASFIVLALTHPEKTTYKTIPLANGELPMQGFL
                     YVV"
     gene            complement(<94049..>95122)
                     /locus_tag="KLTH0C00990g"
                     /db_xref="GeneID:8291130"
     mRNA            complement(<94049..>95122)
                     /locus_tag="KLTH0C00990g"
                     /product="KLTH0C00990p"
                     /transcript_id="XM_002552226.1"
                     /db_xref="GeneID:8291130"
     CDS             complement(94049..95122)
                     /locus_tag="KLTH0C00990g"
                     /note="similar to uniprot|Q03702 Saccharomyces cerevisiae
                     YKL011C CCE1 cruciform cutting endonuclease"
                     /codon_start=1
                     /product="KLTH0C00990p"
                     /protein_id="XP_002552272.1"
                     /db_xref="GeneID:8291130"
                     /db_xref="GOA:C5DDH3"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="UniProtKB/TrEMBL:C5DDH3"
                     /translation="MHKAGVGRSTLEALDWCCHKSDAKTLKKLAFSVGSRVGTTKAII
                     TENILDQCGILNQLAAMRTQRGNLSITAVDLGLENFAYSRFSWAASDNIPRLVKWDKI
                     RLDGAFIDLKMQKLQLAPKHMALLGQKLTEVLMLDPTDVFVIERQRTRTLGSANVPDP
                     ILKVNALEYTLFAFLRSKALYSRPAESPGQRLDYIVESSDPKKMTEYWCNSIPTNALL
                     DSTFGAGSPKAKLKARSSALTKMLKIALTKSMLMERTNPKFEVPEIINKNLGSLPLAK
                     KFSLFDLLGLGEAAGKSKEDDLADSLLHGLAWLQWTKTFEELKNTIEPSRSSTQALEI
                     FKGFVETKSQELSNYSMSCISRL"
     gene            <95515..>96648
                     /locus_tag="KLTH0C01012g"
                     /db_xref="GeneID:8291131"
     mRNA            <95515..>96648
                     /locus_tag="KLTH0C01012g"
                     /product="KLTH0C01012p"
                     /transcript_id="XM_002552227.1"
                     /db_xref="GeneID:8291131"
     CDS             95515..96648
                     /locus_tag="KLTH0C01012g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C01012p"
                     /protein_id="XP_002552273.1"
                     /db_xref="GeneID:8291131"
                     /db_xref="UniProtKB/TrEMBL:C5DDH4"
                     /translation="MSYDSRSSILRRGFRLSSSRCQRRSTKGACKYKLKSISRATENY
                     CVHHLAISVLMPFSRDWVDSQRTSPVPTRPGTVYLGKYSFSRDTLEETRNEEQITDFR
                     TPPKSSRSFRTSIKRVFGKQALQQIEPHPDPTKRHHKFRRWLNTPEKEFTCTWSDFED
                     GLAPRTATTSDEARSERSSGNEVASMTHGTGESAYDTLRRERDDSSDVVFEMFSRMFL
                     DSNSGATLHEDKLQSEPIKTAGSAPCARSKNRSGKRKHTILRKFRSTLRRSRPRETAG
                     QFTLTEKYMGSDENLQRCLDDMDLMPFDLTAPSTAGNSGEFRDASAAAHGHETAFAGG
                     FSDAERTYRRRFSNESYDSGFLPGALHVRKIRQCHAERSPHCE"
     gene            <97077..>98609
                     /locus_tag="KLTH0C01034g"
                     /db_xref="GeneID:8291132"
     mRNA            <97077..>98609
                     /locus_tag="KLTH0C01034g"
                     /product="KLTH0C01034p"
                     /transcript_id="XM_002552228.1"
                     /db_xref="GeneID:8291132"
     CDS             97077..98609
                     /locus_tag="KLTH0C01034g"
                     /note="some similarities with uniprot|P36076 Saccharomyces
                     cerevisiae YKL088W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0C01034p"
                     /protein_id="XP_002552274.1"
                     /db_xref="GeneID:8291132"
                     /db_xref="GOA:C5DDH5"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:C5DDH5"
                     /translation="MVGSTNEASGSTPVSILAKNGNTTREITAYKGGSGGAQNTQEST
                     PSYRPAEESTYMNPQKLRVVTSGKDKESNGPAATGQRVESSVGAEQARSASGAGLKSP
                     MSALGTAVSFTVSNIADKISHRGSISARPSSVALAAQANNGVGGGGAQGEEQPPVNTG
                     TPFGSSAASSRQNSVHIPGEFIFFEPTNRPQSASPSANSSAVRKLPHHSNKAIIDSQP
                     GPQVPFTEFFQKQDDKKIHILIGATGSVATIKVPAIIDKLFKTYGPDKVSIQLVVTKP
                     AEHFLRGLKISTDVKIWRDEDEWCGFKRMGDPVLHTELRRWADVCLLAPLSANTLAKI
                     ANGICDNLLTSLLRCWTASTPVLVAPAMNTFMYTHPVTKKHLTMLQEDWPFITVLKPV
                     EKVLVCGDIGMGGMRDWHDIVDILTKKISEIRGGVGGSDAEEEDGDDDDDEADANAAD
                     ETDSEDSGLDDDDDDDDEDDDDDGEEGNANGSGYRDLKDPQNVEPLAPLRSARSVQGS
                     QS"
     gene            <99846..>102080
                     /locus_tag="KLTH0C01056g"
                     /db_xref="GeneID:8291133"
     mRNA            <99846..>102080
                     /locus_tag="KLTH0C01056g"
                     /product="KLTH0C01056p"
                     /transcript_id="XM_002552229.1"
                     /db_xref="GeneID:8291133"
     CDS             99846..102080
                     /locus_tag="KLTH0C01056g"
                     /note="weakly similar to uniprot|Q08905 Saccharomyces
                     cerevisiae YOR381w FRE3 protein Ferric reductase, reduces
                     siderophore-bound iron prior to uptake by transporters"
                     /codon_start=1
                     /product="KLTH0C01056p"
                     /protein_id="XP_002552275.1"
                     /db_xref="GeneID:8291133"
                     /db_xref="GOA:C5DDH6"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C5DDH6"
                     /translation="MALSGLTARVVYKCAMCGRVLFLEVLFQNCSYLYSMKLPLPIAL
                     AQFIVSCSAKPSELTYKEIDYVAYSCMYTLSSTAAWCSSDLYGLSCYCTDDNAMGSFL
                     YCVHEFLETKNPDTVEEWVYPQCANSTVEGLKQIYENSTNYMVNTSEVPGFNISVPVD
                     FPVYVNATMYQYNYMTYNAFWGNLKHANFMGTGAVAYWGLVFLCGTISSMMHRFAPRL
                     TLSLNKKSSQLWIVRWYRKNVSLPAAFGTVHTKRNFALGLLPTRLESLIIFGFFVMVL
                     LFQAVNIKRTMNNTFFPEKVQEISRYVGDRSGVIANYLMTLTYLLAGRNQIFMWLTGW
                     KQSTFMTYHKWVGRFLFLTVFTHTISMLMYTYAEDAYEYYSGSQWWRYGAAATVAGGT
                     MFLQAFSWLREKNYEVFLYVHIAMAIVFLLGAWKHIEIFDYQEWAYATLAIWAFDRVV
                     RLVRIFSFGVKTAKVCIVSNETLQVTVDRGSWWPFFPGAFGYVHFLKTSIFWQSHPFT
                     VCKTDNNELRLYIKIKRGVTEILYKQLLNEPNYTGEVKIAVEGPYGDKKPAKSYEQVL
                     LYSGGNGIPGPYAYAKELGVTANTQKTQFVKLYWVIRHWNSLDWSLEELQALQKYTNI
                     QTVIYVTKAHEVKFGDKLLPHFEPSCSSSSIAEKDSAVAITSAAYNDVLQKVLPHIEF
                     REGRPVISDVVREDIEDCQDKNTALITCGHSDMCDEIRQVIAVKVGDHKTSRIDLFEE
                     LQTW"
     gene            <103368..>103649
                     /locus_tag="KLTH0C01078g"
                     /db_xref="GeneID:8291134"
     mRNA            <103368..>103649
                     /locus_tag="KLTH0C01078g"
                     /product="KLTH0C01078p"
                     /transcript_id="XM_002552230.1"
                     /db_xref="GeneID:8291134"
     CDS             103368..103649
                     /locus_tag="KLTH0C01078g"
                     /note="highly similar to uniprot|P87108 Saccharomyces
                     cerevisiae YHR005C-A MRS11 Essential protein of the
                     mitochondrial intermembrane space forms a complex with
                     Tim9p (TIM10 complex) that mediates insertion of
                     hydrophobic proteins at the inner membrane has homology to
                     Mrs5p which is also involved in this process"
                     /codon_start=1
                     /product="KLTH0C01078p"
                     /protein_id="XP_002552276.1"
                     /db_xref="GeneID:8291134"
                     /db_xref="GOA:C5DDH7"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027100"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:C5DDH7"
                     /translation="MSFLGFGGQPQLNSQQKISAAEAELDLVTDMFNKLVDNCHKKCV
                     QTSYSEGDLNKNESSCIDRCVAKYFETNVKVGENMQKMGNAFAGGPGRV"
     gene            complement(<103757..>104485)
                     /locus_tag="KLTH0C01100g"
                     /db_xref="GeneID:8291135"
     mRNA            complement(<103757..>104485)
                     /locus_tag="KLTH0C01100g"
                     /product="KLTH0C01100p"
                     /transcript_id="XM_002552231.1"
                     /db_xref="GeneID:8291135"
     CDS             complement(103757..104485)
                     /locus_tag="KLTH0C01100g"
                     /note="similar to uniprot|Q00873 Saccharomyces cerevisiae
                     YKL087C CYT2 Cytochrome c1 heme lyase involved in
                     maturation of cytochrome c1 which is a subunit of the
                     mitochondrial ubiquinol-cytochrome-c reductase links heme
                     covalently to apocytochrome c1"
                     /codon_start=1
                     /product="KLTH0C01100p"
                     /protein_id="XP_002552277.1"
                     /db_xref="GeneID:8291135"
                     /db_xref="GOA:C5DDH8"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:C5DDH8"
                     /translation="MGSETESTCPVDHTAREAWLKNMSKTDGAEGADAAAKESCPVNH
                     DARKVWLQQAEASNAPEAVECTSDQIPNTPQYKTDVKLPTEREVSSIPRTGTEGQHWV
                     YPSQKQFFEAMLRKQWNPNSDDMKTVVPIHNQVNERVWNYIRLWEKGQGGEECGGVQL
                     TSFKGDSKKLTPRAWFRSSILGYSKPFDRHDWTVNRCGKDVDYVIDFYSSDTTGGPSV
                     YLDVRPKLNSKEGILLRCKKMLGL"
     gene            <104968..>106293
                     /locus_tag="KLTH0C01122g"
                     /db_xref="GeneID:8291136"
     mRNA            <104968..>106293
                     /locus_tag="KLTH0C01122g"
                     /product="KLTH0C01122p"
                     /transcript_id="XM_002552232.1"
                     /db_xref="GeneID:8291136"
     CDS             104968..106293
                     /locus_tag="KLTH0C01122g"
                     /note="similar to uniprot|P08539 Saccharomyces cerevisiae
                     YHR005C GPA1 GTP-binding alpha subunit of the
                     heterotrimeric G protein that couples to pheromone
                     receptors negatively regulates the mating pathway by
                     sequestering G(beta)gamma and by triggering an adaptive
                     response activates the pathway via Scp160p"
                     /codon_start=1
                     /product="KLTH0C01122p"
                     /protein_id="XP_002552278.1"
                     /db_xref="GeneID:8291136"
                     /db_xref="GOA:C5DDH9"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDH9"
                     /translation="MGCAASTALSADEQDPFLQSKRANDMVERSLQMQKHKEKKEIKL
                     LLLGAGESGKSTVLKQLRLLHQGGFGNQERVQYTQVIWADAVQSMKILIIQARKLGIP
                     LDCDNPETNRHLFEQKRLLLRARPLEHIDASLAGGSGFLNDYVLKYSETSENKRRTKS
                     TGRAQAFQGLEDGDTFNLQELSEGLSEDGTNSALAQSQNVATRSVSSQQIADAISELW
                     KHDRGVRQCFARSNEFQLESSAEYYFEHIHNFANPTYVCSDEDILKGRIKTTGITETA
                     FNIGSTNFKVLDAGGQRSERRKWIHCFQDITAVLFVLAVSEYDQMLFEDERVNRMHES
                     IMLFNTLLNSKWFSNTPFILFLNKTDIFKEKLTRSPIRQYFPEYQGRVGDVDAGLKYF
                     ESIFLSLNKTGRPVYVHRTCATDTQSMRFVLTAVADLIIQQNLKKSGIL"
     gene            <106485..>106904
                     /locus_tag="KLTH0C01144g"
                     /db_xref="GeneID:8291137"
     mRNA            <106485..>106904
                     /locus_tag="KLTH0C01144g"
                     /product="KLTH0C01144p"
                     /transcript_id="XM_002552233.1"
                     /db_xref="GeneID:8291137"
     CDS             106485..106904
                     /locus_tag="KLTH0C01144g"
                     /note="similar to uniprot|P36077 Saccharomyces cerevisiae
                     YKL086W SRX1 Sulfiredoxin contributes to oxidative stress
                     resistance by reducing cysteine-sulfinic acid groups in
                     the peroxiredoxins Tsa1p and Ahp1p that are formed upon
                     exposure to oxidants conserved in higher eukaryotes"
                     /codon_start=1
                     /product="KLTH0C01144p"
                     /protein_id="XP_002552279.1"
                     /db_xref="GeneID:8291137"
                     /db_xref="GOA:C5DDI0"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR016692"
                     /db_xref="UniProtKB/TrEMBL:C5DDI0"
                     /translation="MSIQTGGLNKISEIPLSQIRRPIAPVLDFQKIDAMVSTMKGVPE
                     ASKTCTIEEASKMDGQLPPIDVVCVRHNGQNFYFGFGGCHRFQAYERIRDQTGKDVLV
                     RCKVIPATKDQLKLYVGSSVDDMFGTIDNEASREARQ"
     gene            <107662..>108555
                     /locus_tag="KLTH0C01166g"
                     /db_xref="GeneID:8291138"
     mRNA            <107662..>108555
                     /locus_tag="KLTH0C01166g"
                     /product="KLTH0C01166p"
                     /transcript_id="XM_002552234.1"
                     /db_xref="GeneID:8291138"
     CDS             107662..108555
                     /locus_tag="KLTH0C01166g"
                     /note="weakly similar to uniprot|Q08909 Saccharomyces
                     cerevisiae YOR385W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C01166p"
                     /protein_id="XP_002552280.1"
                     /db_xref="GeneID:8291138"
                     /db_xref="UniProtKB/TrEMBL:C5DDI1"
                     /translation="MGSTPSKPITQHTADVPPSLRFCRERHMVLASVFYKTRSLMCFP
                     TQHSFEKFLSNSRKIRAEDDGMGVPSLVLEDPYLLSRVFKGDGVRYRIYKYVLCSASD
                     PLPHPSCSVVSQADDRIIYKMPFCEVYKAVHGGLQPGYRLVFYTPDGSLNVDLIKHRT
                     SFDMDSQLGEWNVKWVRKARSLLLPDKFELLVVGSVAPPPPTTAGAPGAHRSAAYAAT
                     RASGAAVWARYKDTDTAFLPKITRKLASLNVGEIEIESNAASYGLDEIPWYTQVIACM
                     SLVICTLQQDRKEKRRRNNSM"
     gene            <110532..>111533
                     /locus_tag="KLTH0C01188g"
                     /db_xref="GeneID:8291139"
     mRNA            <110532..>111533
                     /locus_tag="KLTH0C01188g"
                     /product="KLTH0C01188p"
                     /transcript_id="XM_002552235.1"
                     /db_xref="GeneID:8291139"
     CDS             110532..111533
                     /locus_tag="KLTH0C01188g"
                     /note="highly similar to uniprot|P17505 Saccharomyces
                     cerevisiae YKL085W MDH1 Mitochondrial malate dehydrogenase
                     catalyzes interconversion of malate and oxaloacetate
                     involved in the tricarboxylic acid (TCA) cycle"
                     /codon_start=1
                     /product="KLTH0C01188p"
                     /protein_id="XP_002552281.1"
                     /db_xref="GeneID:8291139"
                     /db_xref="GOA:C5DDI2"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:C5DDI2"
                     /translation="MFAKVAKRAFSSSTANPYKVTVLGAGGGIGQPLSLLLKLNHKVT
                     DLRLYDLKGAAGVAADLSHIPTNSVVKGFSADAQDGIKSALKDTDVVLIPAGVPRKPG
                     MTRDDLFSINASIVRDLAAACAENAPNAAILVISNPVNSTVPIVAEVLKSKGVYNPKK
                     LFGVTTLDVIRASRFISEVSGTNPTTEKVNVIGGHSGITIIPLISQTKHKLMDKEKRD
                     ALIHRIQFGGDEVVKAKNGAGSATLSMAQAGARFANSVLAGLEGEADVIEPSFVDSPL
                     FKSEGIEFFASPVKLGPQGVEKIFSIGEISSEEQELLDKCKETLKKNIEKGTAFVKS"
     gene            <111667..>112002
                     /locus_tag="KLTH0C01210g"
                     /db_xref="GeneID:8291140"
     mRNA            <111667..>112002
                     /locus_tag="KLTH0C01210g"
                     /product="KLTH0C01210p"
                     /transcript_id="XM_002552236.1"
                     /db_xref="GeneID:8291140"
     CDS             111667..112002
                     /locus_tag="KLTH0C01210g"
                     /note="similar to uniprot|P36078 Saccharomyces cerevisiae
                     YKL084W HOT13 Mitochondrial intermembrane space protein
                     first component of a pathway mediating assembly of small
                     TIM (Translocase of the Inner Membrane) complexes which
                     escort hydrophobic inner membrane proteins en route to the
                     TIM22 complex"
                     /codon_start=1
                     /product="KLTH0C01210p"
                     /protein_id="XP_002552282.1"
                     /db_xref="GeneID:8291140"
                     /db_xref="GOA:C5DDI3"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="InterPro:IPR016694"
                     /db_xref="UniProtKB/TrEMBL:C5DDI3"
                     /translation="MNLPKGQLVDEQTRCIHWNSPLDVVCFKFKCCESFYACYSCHES
                     QESHLIKRYNLTSEPTEEVVLCGVCREAMTFEEYRNGLMRTEQLDCPYCGALFNPGCK
                     LHYSIYFDM"
     gene            complement(<112021..>113283)
                     /locus_tag="KLTH0C01232g"
                     /db_xref="GeneID:8291141"
     mRNA            complement(<112021..>113283)
                     /locus_tag="KLTH0C01232g"
                     /product="KLTH0C01232p"
                     /transcript_id="XM_002552237.1"
                     /db_xref="GeneID:8291141"
     CDS             complement(112021..113283)
                     /locus_tag="KLTH0C01232g"
                     /note="similar to uniprot|Q04749 Saccharomyces cerevisiae
                     YMR068W AVO2 Component of a complex containing the Tor2p
                     kinase and other proteins which may have a role in
                     regulation of cell growth"
                     /codon_start=1
                     /product="KLTH0C01232p"
                     /protein_id="XP_002552283.1"
                     /db_xref="GeneID:8291141"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DDI4"
                     /translation="MLDDPGVRLRNAVMVGKLLIVKRILSRFPDLINVIDPSNGWSLL
                     HYASYYGRYLTCVHLVQLGHGKSEVLRTFKGNTCVHLALLNGHEQTAHLLLQHFPYCL
                     NMKGHKGLTPVQMTCLHDHHQCLSLLLSLGADISVRDDNGNTALHTCLMYGSESCMRM
                     LVLEANMEDLESQKLGEWTPADLCQTFELAEAYQKALKEKQARAKLSKRPSYQFVASP
                     LTIPQPFFENTGSPLLTSSPAVQSLTSSLPPLPQISTSRRTSVGSQNVWSPRTPIMCA
                     HNTASVNTPSKKLTTKPSISSQMGSASSASLSHQESALSMNSGRNKPQEHFATPKFSR
                     PSTANTPSMGKSISTTSITSSDNNTTKNSPLFHDTQTRPVLRAGSRSDSREASRDSVA
                     SQKHSMAPPKSAPISLLNIPISKLRNRD"
     gene            complement(<113435..>114739)
                     /locus_tag="KLTH0C01254g"
                     /db_xref="GeneID:8291142"
     mRNA            complement(<113435..>114739)
                     /locus_tag="KLTH0C01254g"
                     /product="KLTH0C01254p"
                     /transcript_id="XM_002552238.1"
                     /db_xref="GeneID:8291142"
     CDS             complement(113435..114739)
                     /locus_tag="KLTH0C01254g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C01254p"
                     /protein_id="XP_002552284.1"
                     /db_xref="GeneID:8291142"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DDI5"
                     /translation="MTGQTQSDLRPPTDIEIEELKKIYGWKKAFKTWWSRADAKENEK
                     KLLSTLEFFPGGDSIRNCELLDVDIGNKQHIHEFSIQNIESCSRDYCKDLVMVHGYGA
                     ALGLFVRNFDGLSRIPGINLHALDMLGCGLSSRPRFPGTGLISSVIKRGRVTKEEVYE
                     AENFFIDSLEKWRQQRKLDKFVLVGHSLGGYLSCCYALKFPERVEKLVLVSPVGVEKS
                     VFDLTKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPDEAGNVERVP
                     NMPWIFSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFAENTEQLLTFHEYCYSI
                     FSGSGSGEYALTRILAPGVLARVPLLSRVPENLKCDSFWMYGSHDWMSKEAGSVIVRQ
                     INKTKGSVKADYSVVSDAGHHLYLDNPEEFNQKLAKFLKVDL"
     gene            <114880..>116118
                     /locus_tag="KLTH0C01276g"
                     /db_xref="GeneID:8291143"
     mRNA            <114880..>116118
                     /locus_tag="KLTH0C01276g"
                     /product="KLTH0C01276p"
                     /transcript_id="XM_002552239.1"
                     /db_xref="GeneID:8291143"
     CDS             114880..116118
                     /locus_tag="KLTH0C01276g"
                     /note="weakly similar to uniprot|P54730 Saccharomyces
                     cerevisiae YMR067C UBX4 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="KLTH0C01276p"
                     /protein_id="XP_002552285.1"
                     /db_xref="GeneID:8291143"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR021569"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DDI6"
                     /translation="MSLVSVVYKFSTYKAKAEPGCVLNEVLQKSVVHFKVESENKSWI
                     LTHHGKELPLTVPLRLLNLPKGAKLELNHCIEKAASEAKMFRVKFQVLGRGVEVVAVQ
                     QSDSIIKTIENICEKNSWTLDPQVLKLQCFSKVWNYEALVTASFAHLGILEDVAVRLT
                     ISNSVVPAKPSVEKTPSLVEYKKDHTPPQIAEKPLLHEVLAYVPNETPSTATKQNVAD
                     EDYEVSIGQFKSYQRTISKSAGSNELLTKRMREEQENAKKHVIDQCNIRVRFPDRACI
                     DINFNPDETMNLVYEAIKRCLADRTVSFRLYYSHPHKEIEDSEAKLVADLGFGSKTLL
                     VFETNHKGPYLKEELLQKAKTLADAQSAALQEQRGSRTNELGEETSHAQSNKVGESSV
                     KSSAGLRMGQKPKWLKLGKK"
     gene            complement(<116156..>118810)
                     /locus_tag="KLTH0C01298g"
                     /db_xref="GeneID:8291144"
     mRNA            complement(<116156..>118810)
                     /locus_tag="KLTH0C01298g"
                     /product="KLTH0C01298p"
                     /transcript_id="XM_002552240.1"
                     /db_xref="GeneID:8291144"
     CDS             complement(116156..118810)
                     /locus_tag="KLTH0C01298g"
                     /note="weakly similar to uniprot|Q04748 Saccharomyces
                     cerevisiae YMR066W SOV1 Synthesis Of Var (putative)
                     involved in respiration"
                     /codon_start=1
                     /product="KLTH0C01298p"
                     /protein_id="XP_002552286.1"
                     /db_xref="GeneID:8291144"
                     /db_xref="UniProtKB/TrEMBL:C5DDI7"
                     /translation="MISCRDICVRARIGSQLRFYRKRLKPRYNHVPQVSSLQSELLQP
                     RELRLQAHSPESVERDLRRLGFREIDESGPVDDMLVEYLESSKSPFKKSSKHLNSLKS
                     TLVNNKSPNQDRMKALFDFLLKESEQEVRRLESMGPEQLQMLQTIHDSEKSEHSAKEI
                     SSERELEKAILRELMESSQDEEGRSLLPNTECLFRVLSDLNMNRLAKADIISVEQMVG
                     AFEISKLLPAYKLRQRGILLSGHLIYSLGNVRMDPINESFYIESLVYYGFYKKALELF
                     NTYREKVEKRWWFEMGMMVCLRANHIRQFDKLLEHSLKTFGSDYISPKVLRTAIRKKL
                     YLRNYQCSEKLTKLLINVASAYGLKLSSQQQQNPQGIFFQSETQADLFLNEKEQVTEA
                     DFVAIIQYHLFRNREKPALALLAEFVKLPDVDKNLLSTALVHLKLHLLKSFDVLEKDM
                     HSLLSGKDMKLLRQAFSNATRRFHVEAIQKKFDTVLFDSISDIASQPVLTQNIEQFVA
                     NTNKNLPRNPENIQDETVHSKKLHNLLKALLKSGKEDLAASLMKDANSYSSSVKESKL
                     SLDEDDFSGINAHHYAVWIDHYSRKVQKAKNPREKYEYEAKIKEIVEKVNKGNVQYNS
                     VLMTSLLTHFTVTANLDNCFNIINPLMDFRCSKTEESKGNRKLLSFFERREITKSLYF
                     QIWKALILYFSRFENGLGTTEIRSNQKAWGYKISAERSKITVHPNYDFRTLFKLMVLE
                     DNILPDRPFYHTILQAFIKVRDWAYIPAILRYMRHINGIEIDRKLQRYINGGLKLEYI
                     AVERERLDSQKAEFSGVEKFTTPVVNTARRNVENRIKKGDILGETSTDYSLQVEQNIL
                     NFLRSYRSHEMERVQQAFEEVGIEVINT"
     gene            complement(<119087..>120466)
                     /locus_tag="KLTH0C01320g"
                     /db_xref="GeneID:8291145"
     mRNA            complement(<119087..>120466)
                     /locus_tag="KLTH0C01320g"
                     /product="KLTH0C01320p"
                     /transcript_id="XM_002552241.1"
                     /db_xref="GeneID:8291145"
     CDS             complement(119087..120466)
                     /locus_tag="KLTH0C01320g"
                     /note="similar to uniprot|P36080 Saccharomyces cerevisiae
                     YKL082C RRP14 Required for normal pre-rRNA Processing
                     Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0C01320p"
                     /protein_id="XP_002552287.1"
                     /db_xref="GeneID:8291145"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="InterPro:IPR029188"
                     /db_xref="InterPro:IPR029190"
                     /db_xref="UniProtKB/TrEMBL:C5DDI8"
                     /translation="MSNSLEERLRINSNAFDGLLSLIPAKYYYDDKTQDQWKAKKKTK
                     AQSKLDKRKKLDPEQQNEESASALEVMEAREKNGKPAVIPGQKPSREQEEASSEEEEE
                     VEEESTSGDEGASETGENAGQVQAEPKGPVNSKIESEQEDGSKGEEDDEDSIDVIFDD
                     EGNKVEAQPESFDKPAAEAASAVEDQPAPPADSKASKKQNLEKLRAKLQEKIQAMKEK
                     RRAPGTQVTGALSSREAILAQRKRKEELKRKRTEQNTPKDEDSSDESNSGSDAEGDSE
                     TVSKKRRVDDGIANDLMFQNIVFDDGSRATSDLQRLRKAREKKGPSKNDIKAHLSATE
                     AKRAKLESEDELVQIQQKEKEKWQRAMLQAEGERMRDDEKLLRKALKRKEAKKRKSAV
                     EWRERKEAVATAISDKQKRREENLQIRKENKGKKRNHREKMKRGIKGVAPTKKRAGFE
                     GRLKSGKKK"
     gene            <122117..>123611
                     /locus_tag="KLTH0C01342g"
                     /db_xref="GeneID:8291146"
     mRNA            join(<122117..122324,122572..>123611)
                     /locus_tag="KLTH0C01342g"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_002552242.1"
                     /db_xref="GeneID:8291146"
     CDS             join(122117..122324,122572..123611)
                     /locus_tag="KLTH0C01342g"
                     /note="similar to uniprot|P36008 Saccharomyces cerevisiae
                     YKL081W TEF4 Translation elongation factor EF- 1gamma"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_002552288.1"
                     /db_xref="GeneID:8291146"
                     /db_xref="GOA:C5DDI9"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DDI9"
                     /translation="MSQGTLYVNSLARGYLPSALVKYLGLDIEIVDTEKDQESFLKQF
                     PLGKIPAFVGPEGFKLTEVMAIAYYLVNLKGDENIKKVLCGATLEEEAQIMRSLSFTN
                     SELAVAFPTFALMLLGKLPYNKKICDEKRAAFDACMDVFEQRLSEYTYLATEEVSLAD
                     LFLGTLYAFSSILIFGAEYRAKYPAIARWFKTVIAHPALAGVFDLSKFRKDTLQYVAP
                     KKESKKETKKETKKPAAEKPKAAAEAEKPAEQPKKPKHPLELLGKATFPLDDWKRKYS
                     NEDTRPVALPWFWEHYNPEEYSIWRVDFKYNDELTLCFMSNNQVGGFMERLTGSVKYM
                     FGCMVVYGEDRNNGIVGAIMLRGQDYAPAFEVAPDWTSYDYAKLDTSNEEDKEFINNM
                     WAWDKPVVINGEPREISDGKVLK"
     gene            122390..122498
                     /gene="SNR38"
                     /locus_tag="KLTH0C01364r"
                     /db_xref="GeneID:8291147"
     ncRNA           122390..122498
                     /ncRNA_class="snoRNA"
                     /gene="SNR38"
                     /locus_tag="KLTH0C01364r"
                     /product="snR38"
                     /note="C/D snoRNA intronic SNR38"
                     /transcript_id="XR_002432178.1"
                     /db_xref="GeneID:8291147"
     gene            <123963..>125141
                     /locus_tag="KLTH0C01386g"
                     /db_xref="GeneID:8291624"
     mRNA            <123963..>125141
                     /locus_tag="KLTH0C01386g"
                     /product="KLTH0C01386p"
                     /transcript_id="XM_002552243.1"
                     /db_xref="GeneID:8291624"
     CDS             123963..125141
                     /locus_tag="KLTH0C01386g"
                     /note="highly similar to uniprot|P31412 Saccharomyces
                     cerevisiae YKL080W VMA5 Vacuolar H ATPase subunit C of the
                     catalytic (V1) sector"
                     /codon_start=1
                     /product="KLTH0C01386p"
                     /protein_id="XP_002552289.1"
                     /db_xref="GeneID:8291624"
                     /db_xref="GOA:C5DDJ0"
                     /db_xref="InterPro:IPR004907"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ0"
                     /translation="MATALHTANEFVLLSLPMNAQPASAPGKSATSWLHESLVGGRTF
                     VSEFHIPEFKIGSLDTLVVQSEELAKIDSQIGSSVAKILEILGNLTESQTNAYKTVPI
                     GNVPIPEYLENFQWQTRKFKLDRSIKELIEEISRESFQLDADVRATSTNYSNAKTNLA
                     AAERKRTGDLSVRSLHDIVKPSDFILDSEYLTTVLVAVPKNLQDDFQKSYESLAKNVV
                     PCSASVLKRDDDYVLFNVHLFKKSVNEFVSACRERKFIPREFEYSEELINQLTKEHDS
                     AAHLEQSLRVQLVRLAKTAYSDVFMNWFHIKALRIFVESVLRYGLPPHFNTSLIAVPP
                     KTLSKCKAELVQQFGYLGGNAFSKDKAGKIKQQDSSLHEYASLVDTEYEPFVMYTVEL
                     "
     gene            complement(<125984..>127537)
                     /locus_tag="KLTH0C01408g"
                     /db_xref="GeneID:8291148"
     mRNA            complement(<125984..>127537)
                     /locus_tag="KLTH0C01408g"
                     /product="KLTH0C01408p"
                     /transcript_id="XM_002552244.1"
                     /db_xref="GeneID:8291148"
     CDS             complement(125984..127537)
                     /locus_tag="KLTH0C01408g"
                     /note="some similarities with uniprot|Q06150 Saccharomyces
                     cerevisiae YLR267W BOP2 Protein of unknown function
                     overproduction suppresses a pam1 slv3 double null
                     mutation"
                     /codon_start=1
                     /product="KLTH0C01408p"
                     /protein_id="XP_002552290.1"
                     /db_xref="GeneID:8291148"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ1"
                     /translation="MKMSNYENMNMLVKSEGPVRNGLLSLPIEVVEMIVQQLTASPKT
                     TVVDYYHLLQALGETNGPVAALLRSKIAVRDLTRGRCDLAKVLGGSKGSIKGDDTIPS
                     QTSFYVVAIDEDALELAPGATALPAPYGDIQLSLVFHSDRQVPLTEIHEKFRRRFPQD
                     CYRVQHLIVTSSRCQTLEFRANDGNLLDTRLYSERDPMFAQVTYLNASRIVIAATALT
                     EFISGVARGTKTSMPELCYGCNSHLANTLKIHSMLEPPLPMVTRVPVNFPLVESVAFS
                     GSDGSPGSLNVIDLYAFCRIREQDAKLTLNSLLSVYSLRHWNLPSVKRFTGHRLKLSD
                     GSSDVHQRSRSARETITRIRTIAQQESPDGLLHVNAQLVPDGVVHTTIENWIPMEAKF
                     GGRAGRDCSPLICFRNSSLKSLRLGLAMKPEGTLVVEGLYLPSLEKLDVTSYSDDTPR
                     NEVRLPSYSITFSAWNDLDKCRGLGFSSAEFNGHSIVQNLNLKQVFPRLDVANTFRQK
                     FSSSSVLAV"
     gene            <128670..>129500
                     /locus_tag="KLTH0C01430g"
                     /db_xref="GeneID:8291149"
     mRNA            <128670..>129500
                     /locus_tag="KLTH0C01430g"
                     /product="KLTH0C01430p"
                     /transcript_id="XM_002552245.1"
                     /db_xref="GeneID:8291149"
     CDS             128670..129500
                     /locus_tag="KLTH0C01430g"
                     /note="weakly similar to uniprot|P50091 Saccharomyces
                     cerevisiae YGR239C PEX21 Part of a two-member peroxin
                     family (Pex18p and Pex21p) specifically required for
                     peroxisomal targeting of the Pex7p peroxisomal signal
                     recognition factor and PTS2-type peroxisomal matrix
                     proteins"
                     /codon_start=1
                     /product="KLTH0C01430p"
                     /protein_id="XP_002552291.1"
                     /db_xref="GeneID:8291149"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ2"
                     /translation="MSLCQAGANPISRLAGKSEQLRGVGRLHDARPGVGGVRDGREAQ
                     FRGAGASAQPMAQPVPHPMAAAPAAADAWVNQFSNMHIKDPLSFSSEYQRLYSSYEQP
                     QAVRPAQPQTLHAVQPQYQRQFYPSSYSQSLSQQFSQSFTADNSALFDSEFDQIEQEE
                     AAQQQQQQQQQGPAAQDTATAVPALDDEQAKFQQAATEIYARLSPGPQTPPEMEAKLH
                     NPKLQNSKFLGLMRRISDGVVTLQNDQNSQKYTQLYSPTTGEVVGNEYFPVVDAILEP
                     "
     gene            complement(<129587..>130726)
                     /locus_tag="KLTH0C01452g"
                     /db_xref="GeneID:8291150"
     mRNA            complement(<129587..>130726)
                     /locus_tag="KLTH0C01452g"
                     /product="KLTH0C01452p"
                     /transcript_id="XM_002552246.1"
                     /db_xref="GeneID:8291150"
     CDS             complement(129587..130726)
                     /locus_tag="KLTH0C01452g"
                     /note="some similarities with uniprot|P38854 Saccharomyces
                     cerevisiae YHR159W Protein of unknown function that
                     localizes to the cytoplasm potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0C01452p"
                     /protein_id="XP_002552292.1"
                     /db_xref="GeneID:8291150"
                     /db_xref="GOA:C5DDJ3"
                     /translation="MSKLDGFIEEHDRESNIDSGARLESTKPSPKVGSPAQRVRQNGV
                     KSPILQTQATPAKPSEQEHPLKETPTRATAGGKMTRSNTLKRLSLIQPVISPETTPKE
                     HRQQQATRNRSRSVVSVHSRSSSSASEQLADATKDVNALLQLLANKELELLETKHKIE
                     ELKKTLTQEEKALLRQTHELQDLKTQVGKALNSGIDEQIQQQSQSSHHSPNQRSLAVP
                     TSHTPGNESRPAHAKKESVWTKPLSFLNQFDQLIQHELEKKLNWDDVASPEKTPGAES
                     GTLSGRSASPASYNNGNSNNNNNNNSNRGRPNEDVLGNMSSSLWSFVSDVKTGLLGIN
                     EEEEEESAEAPAVASSGESNNQLRFVGSKNNSEVELKEYNASKRQ"
     gene            <131243..>134413
                     /locus_tag="KLTH0C01474g"
                     /db_xref="GeneID:8291151"
     mRNA            <131243..>134413
                     /locus_tag="KLTH0C01474g"
                     /product="KLTH0C01474p"
                     /transcript_id="XM_002552247.1"
                     /db_xref="GeneID:8291151"
     CDS             131243..134413
                     /locus_tag="KLTH0C01474g"
                     /note="similar to uniprot|P38853 Saccharomyces cerevisiae
                     YHR158C KEL1 Protein required for proper cell fusion and
                     cell morphology functions in a complex with Kel2p to
                     negatively regulate mitotic exit interacts with Tem1p and
                     Lte1p localizes to regions of polarized growth potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0C01474p"
                     /protein_id="XP_002552293.1"
                     /db_xref="GeneID:8291151"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ4"
                     /translation="MAPFKFAKKISKDKAKHEPAPAPKAAPQPQPQPQIAKRFTHSAI
                     PEPAAARIFPTPVPVQQRNVSSASALQQTEYTPWSRVKLANSPFPRYRHVASAYASEQ
                     NQVYVIGGLHDQSVYGDTWIISAHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFV
                     IFGGDTHKVNSDGLMDDDVYLFNINSYKWTIPRPVGPRPLGRYGHKISIIATSQMRTK
                     LYVFGGQFDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWV
                     FGGDTPQGLINDVFMFDPQINDWKVMQTTGDKPPPLQEHAAVLYGDLMCVVGGKDEQD
                     VYSNSVFFLNLISLKWFKLPSYRSGIPQGRSGHSLTLLPNHKLLIMGGDKFDYARGGE
                     GDVHTSDVDLGCGTLLYVLDLSKLGEQCPGIFDAKRVAAPQKGVENIPTSPPQPSRNA
                     SIQQNILTPFSERYQTPNTDQGGFSAVEKFTTPKTDGVFSPRPEAEDSNTEASALGTP
                     QDIKKPTSPVPQLKTNHWSAQSPPPRVVSLSSANESELGSSRGHDSQFSGDVSEEYGV
                     AMIGNSPSRPVVRESILPEDETLENLPSRSYSGETTPQREDIQPVSSTPEPARPVVAR
                     DQGNLGTQVQENIASPGPENMAVRSQENTATRGQENTATRGQESMVARGQENTMKRTQ
                     ENSMARGEEGLMTRSPDNSTQNGMKGVPFEIIEALRKELGDLRSEAEKSAQSASRRIE
                     ELEQENSRLKESNDAGSRLVKLQTDYDLAVADRKAHEDRVGEVEDLLSKKFLDVARLH
                     DIIRVQSSKIGSLEGEETFKEKYEELNDKYEQLLKDHETLKAKDREEEKSLHESIAQY
                     SVQLEQFLASRNEGQEEGNGGVRSISGHHQKVIEDLRSRMDQMVSEKQGTDSSAAELS
                     EKHKELENKCRKLEEELKAIEYNYESSVNSVNNASRALALSQEELNKYKQESKRLADE
                     LEEMKYKSVDRRDTSLTSNDDSLLSSSGAGLAAEPKSDMRDAPYRLKIKDLKAELFII
                     KQERNALKDDVMELKKKLLNLENEDD"
     gene            complement(<134478..>134948)
                     /locus_tag="KLTH0C01496g"
                     /db_xref="GeneID:8291152"
     mRNA            complement(<134478..>134948)
                     /locus_tag="KLTH0C01496g"
                     /product="KLTH0C01496p"
                     /transcript_id="XM_002552248.1"
                     /db_xref="GeneID:8291152"
     CDS             complement(134478..134948)
                     /locus_tag="KLTH0C01496g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C01496p"
                     /protein_id="XP_002552294.1"
                     /db_xref="GeneID:8291152"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ5"
                     /translation="MSRSIVCVEEFSKQYDVPEEVSRRFLPRNDVCIISEDEFKKTRA
                     TRKREAEFQLSGLEVKKASYDGWDEEHAAETREDCTLNSEVPEGAGRSLTLELDSFQL
                     LGSDNGSEAESSMVLFTSSRIEYDSDTGVLLQSGDFASEPDDTRERAGANPHTP"
     gene            <135506..>137566
                     /locus_tag="KLTH0C01518g"
                     /db_xref="GeneID:8291153"
     mRNA            <135506..>137566
                     /locus_tag="KLTH0C01518g"
                     /product="KLTH0C01518p"
                     /transcript_id="XM_002552249.1"
                     /db_xref="GeneID:8291153"
     CDS             135506..137566
                     /locus_tag="KLTH0C01518g"
                     /note="some similarities with uniprot|P50089 Saccharomyces
                     cerevisiae YGR237C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C01518p"
                     /protein_id="XP_002552295.1"
                     /db_xref="GeneID:8291153"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ6"
                     /translation="MADSAQYVSHVSFDDLTPSLIDDQARLLQKHGQEVTFSNPFLHI
                     PPQYNPLYASGAADGNSPRVSGLGSPKKSYFSLDSYSRSPYGSSPNLYSESSGQDGLK
                     LPQSDPSVDSVHSARSSTTPVPAYLPGRLPPAASPPVLKKRPQRDYEVVKDFDLINPD
                     YVKEHQLTLLTDENTQQNSGCSHGYTTSGFANLNEVEDKVMRKDHAETSQTSKEGGRR
                     KSFAGMSLEELAALEREYESASRTNYNVEQFDFSEQVQHYIGPDQRRAIGPSNDWPQT
                     IYPSRPCVNHRALAITRSHREYSDYIKDHGRNQTKGSLRTVVCLISGRKHTWSAVDWY
                     VENMARGGDYLVIVSRIPVFEDSVKRPTPPQTSLSENYDIKASKPKSRSLSRKCSLTE
                     QGLMVQDVDVLARAKCNDILNYYLHKLTGKIMKLTVEIIKDDSTVFALTSAIALYKPD
                     FKVVSTVSTNLHIKFRNGHVKLANFVMRHFWVPTYVVPFEFIDPALLGEKVPDRRITN
                     NPKEEKDDVHIIANIDKVIKRTLNNPFGSQTPREPNDSDGDLASVNSYFPTDPETKRK
                     VEEFESMGYLRPVPTRRECDLNKVGSFPGSSRSSRRSSRIQFAGDHNGMYKVKSLIDA
                     DDKDDDMVRKIKSVSSTHSRSSMKKGHMSARRTKSIDSPGGVEAKKKGSKFSGFLKKI
                     GFGK"
     gene            <138023..>138460
                     /locus_tag="KLTH0C01540g"
                     /db_xref="GeneID:8291154"
     mRNA            <138023..>138460
                     /locus_tag="KLTH0C01540g"
                     /product="KLTH0C01540p"
                     /transcript_id="XM_002552250.1"
                     /db_xref="GeneID:8291154"
     CDS             138023..138460
                     /locus_tag="KLTH0C01540g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C01540p"
                     /protein_id="XP_002552296.1"
                     /db_xref="GeneID:8291154"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ7"
                     /translation="MKIDSKIYEEAHRLALMPRMRMMFYGVVCGAIVPAMYLRSYYLP
                     SIKSQDAKDVSALADKVKMLEHRTSNMEHPAVRSNSGVGRSASAKSAENALASSENLG
                     ALASVGEVPIASWHIKGRNRFSNDDQYRKLVEEANTIMFSSIM"
     gene            <138749..>139441
                     /locus_tag="KLTH0C01562g"
                     /db_xref="GeneID:8291155"
     mRNA            <138749..>139441
                     /locus_tag="KLTH0C01562g"
                     /product="KLTH0C01562p"
                     /transcript_id="XM_002552251.1"
                     /db_xref="GeneID:8291155"
     CDS             138749..139441
                     /locus_tag="KLTH0C01562g"
                     /note="similar to uniprot|P50087 Saccharomyces cerevisiae
                     YGR235C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C01562p"
                     /protein_id="XP_002552297.1"
                     /db_xref="GeneID:8291155"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ8"
                     /translation="MAPNFYRPVELVSEGVVPPETGSIVSSEAKEAAPSHVTKQSVSH
                     SATEILGDNKLLDGISVRSPTYLNKFFSSWRLNLSGLIENTCDTIDEKSRKYYSYERK
                     LTTTVANLHSDPRELLLPGMTYSLVAAMSGSVLTRNRNILARIMAPLALGACCFSYVL
                     PVTSSNTFGLLFDLEKQAFPRFAQNQRALYNTCKNTVHQTIAVAGRTSDAISGSFSKS
                     MHLVKEWTGLNV"
     gene            complement(<139563..>142304)
                     /locus_tag="KLTH0C01584g"
                     /db_xref="GeneID:8291156"
     mRNA            complement(<139563..>142304)
                     /locus_tag="KLTH0C01584g"
                     /product="KLTH0C01584p"
                     /transcript_id="XM_002552252.1"
                     /db_xref="GeneID:8291156"
     CDS             complement(139563..142304)
                     /locus_tag="KLTH0C01584g"
                     /note="some similarities with uniprot|P38850 Saccharomyces
                     cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
                     Establishes Silent Chromatin involved in silencing"
                     /codon_start=1
                     /product="KLTH0C01584p"
                     /protein_id="XP_002552298.1"
                     /db_xref="GeneID:8291156"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:C5DDJ9"
                     /translation="MSASSKLFQGLNFVIVANKETEPETERIIEILENNSANKCTIYN
                     VLENEAHQALDKDVFCKTFDFEVHAIIASTCDFWFYRLAAFDFLIPVVTSDWVNACVA
                     TRRITRASSFSPDSSHLLKNHQIYVSKHAFSPSEYTLYSAIVRALGGVCIDHLSSKTS
                     HILTNDAQDPAIAAVADIKSLSIKYVLPTWAVAVFASGDLVSETPYSLDPHDRPEDVE
                     DKSASTWELVQKTQVGSCTDFLCGHEFFFSSDLILPSQCFDFLVDFILAAGGNAIRHS
                     EPMEISKFNGDCFLGQNSISEDFISANSRGLHKGNLSWLFHMWSLQSFVLPQFKLLLS
                     PLRPPVFNKGQLILSYTNYLGQQRYYIQKLVEALGGVSTTELTKKNTHLLTCLPLGQK
                     YEAALRWEGTCKIANHLWLEDCYRKQTQVPFVGTRYNEIPAPGGLSTKLGQMPLEIND
                     EDLTDTILPQEADMPSQNHILLRGQDSATETPTQCEDVLPDNGIFPDPVTIPEEVPTP
                     EEPHPQMQINIVEGTSSRQEPLEKHTEHKVSSKRAFDEFLKDDAFSPDQTLEPHKDNT
                     PSSNIAAEGAPDIVGPQRDDLSQEATSYVPLRQASPNASFSSLPHDHSQFLPSSNSRK
                     AKEKAALKLHTDMEALNEFEQNLKRKKNRSLLPEEIQKLNKLKEVGEKVREHLETVAG
                     RPKGKSMKPYDIIAVCTGCHEEIDEFDLELLRRVGVTILKAVDVQCNTIIAPKKMRTA
                     KFLTSFGFHPLKWALMPEFVSELLSIFRQTTPIQELPKPEDYLIPEIEPEVLKKTKLS
                     TKVFQRAGIKSINLTEGVPGGEEVLSSILKAHGVLNVHMLPKKYTEEDVVINNGKKNS
                     PTHILIAQKASQSKKFAKLCRNAGENKVMVVEWNWCVESIFTLEANLETSRYVVYRS"
     gene            142970..143042
                     /locus_tag="KLTH0C01606r"
                     /db_xref="GeneID:8291157"
     tRNA            142970..143042
                     /locus_tag="KLTH0C01606r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8291157"
     gene            <143303..>146572
                     /locus_tag="KLTH0C01628g"
                     /db_xref="GeneID:8291158"
     mRNA            <143303..>146572
                     /locus_tag="KLTH0C01628g"
                     /product="KLTH0C01628p"
                     /transcript_id="XM_002552253.1"
                     /db_xref="GeneID:8291158"
     CDS             143303..146572
                     /locus_tag="KLTH0C01628g"
                     /note="similar to uniprot|P17442 Saccharomyces cerevisiae
                     YGR233C PHO81 Cyclin-dependent kinase (CDK) inhibitor
                     regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin- CDK
                     complexes in response to phosphate levels required for
                     derepression of PHO5 transcriptionally regulated by Pho4p
                     and Pho2p"
                     /codon_start=1
                     /product="KLTH0C01628p"
                     /protein_id="XP_002552299.1"
                     /db_xref="GeneID:8291158"
                     /db_xref="GOA:C5DDK0"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DDK0"
                     /translation="MKFGKHLETRQLALPEYNGHFIDYKSLKKLIKQLSLPAVGSNGI
                     LETGDESLVHQVLQEHKASFFFRLERELEKVNAYYLEKEADLRIKFDILRLRFEEFEK
                     RGKLASKNTVSYRHLRDGIKKFERDLAHLEQFVELNRTGFSKVLKKWDKRSHSHTKDF
                     YLATVVSVQPVFTRNEASELNDAVSVILMQLNEIGNSEDFFSGSFNARTVSTSYARVQ
                     DIDPVASSVASYSLSGGFKPQTEPDFFDIGTEIESWYLEALSIGKLKDEEPRWTLLRD
                     FPQQKVQAFVESHVPHSRIDKNLIVRDALTKIFLLLVSSSIDDESLRVFFESAGSSID
                     LSYTEEDDVVFSKRNIFHEAAICEPHSRGFILLRALDQCKGSASFESTLRTLLNAQDA
                     NGRTPLHYACDLGKMEFVKLLLNSNLLDSVDILDNDSKTPLVLSVIKNQPEITEALLV
                     LGHANPSPSVKDSGKPQFAPLNVACAYQNFAAAKLILDFSNFDLSAVQDSHGLCPLHI
                     VAKNGGDAKMIELLVSHGSDPNRIDGFNGWTPVFYAIQEGHRNTVEELLKHGASIDIY
                     DEDNLSPYFYALWEGHLSVVNLLRGHCSQKTDTTNPSMDPLRSVLEPTTVMRLEDSLH
                     GIPDFTLPPPIIPLRKYGHNFLEKKIFVNLSFRAGTASIVLNKEDEMVLSSPGRITLT
                     SNVSDIIPRNVILPTEDDDENFVVFQVDSLDGFSIDFEIFPSFGTRMIAKTTAMSSLF
                     KGHDKQPSSKGAFILPLFDARLKNVGELVLDYTFIFPYSGRPLEITKYETYWKSTTGN
                     ETGKSGNQFITSSLSGTYTNFFLFPLNDGTLIVSPKKAFSTGPMDLKIFDLNANQLEK
                     LMGYSLQGNHEGSKEVTYEQLLNERFTTLETLLNNTPPNAKLEIEVCFPTACEFESIP
                     LKLSPLVNINDFIDNVLSSSFAHARQRFHNGMTSSIVFTSRNPEVCSILNWKQPNFPV
                     LFYMNGLRKENGVLVKDTPHHLSHLSMDPEKVNYKEPCSRCIREAVQFASYNNLLGVI
                     VPLELLRSSQQLVSEIRGRGLLVIGSLFEGENIAVDLAGEDINGVRTHDTLQFKGSID
                     M"
     gene            complement(<146654..>147352)
                     /locus_tag="KLTH0C01650g"
                     /db_xref="GeneID:8291159"
     mRNA            complement(<146654..>147352)
                     /locus_tag="KLTH0C01650g"
                     /product="KLTH0C01650p"
                     /transcript_id="XM_002552254.1"
                     /db_xref="GeneID:8291159"
     CDS             complement(146654..147352)
                     /locus_tag="KLTH0C01650g"
                     /note="similar to uniprot|P50086 Saccharomyces cerevisiae
                     YGR232W NAS6 Regulatory non-ATPase subunit of the 26S
                     proteasome homolog of the human oncoprotein gankyrin which
                     interacts with the retinoblastoma tumor suppressor (Rb)
                     and cyclin-dependent kinase 4/6"
                     /codon_start=1
                     /product="KLTH0C01650p"
                     /protein_id="XP_002552300.1"
                     /db_xref="GeneID:8291159"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DDK1"
                     /translation="MSQGSFPLHEACREGQESKVRELVEEQPKLLLSQDLDSRYPLHW
                     AVSYQHESIVKILLSRMQSVDLDDLVDESGWSPLHIASSVGNLDIFTELLHHAIKPDA
                     DLGTSQGVTALHLACSKQHLAIARLLVKEGASVRKKDVRGQLALHRAASVGSIPLVKL
                     LCDERSPVNAKDVQGWIPLFHALSEGHGDVAVILVQEYNAEYRELQDNSGKAPLDVVP
                     DDKVKRFFLENVEQ"
     gene            <147893..>148816
                     /locus_tag="KLTH0C01672g"
                     /db_xref="GeneID:8291160"
     mRNA            <147893..>148816
                     /locus_tag="KLTH0C01672g"
                     /product="KLTH0C01672p"
                     /transcript_id="XM_002552255.1"
                     /db_xref="GeneID:8291160"
     CDS             147893..148816
                     /locus_tag="KLTH0C01672g"
                     /note="highly similar to uniprot|P50085 Saccharomyces
                     cerevisiae YGR231C PHB2 Possible role in aging
                     mitochondrial protein prohibitin homolog homolog of
                     mammalian BAP37 and S. cerevisiae Phb1p"
                     /codon_start=1
                     /product="KLTH0C01672p"
                     /protein_id="XP_002552301.1"
                     /db_xref="GeneID:8291160"
                     /db_xref="GOA:C5DDK2"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:C5DDK2"
                     /translation="MNRSPGEFQRFAKTLQQQLQRAQKAGNGKGPQAPRGAFAGLGGL
                     VLLGGGAFLLNSSLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRA
                     KPRNVASLTGTKDLQMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKS
                     VVAQFNASQLITQREKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQ
                     IAQQDAQRAAFVVDKARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVELKRLDTARE
                     IATILSQSPNRVILDNEALLLNTAADTRNRK"
     gene            complement(<149232..>149483)
                     /locus_tag="KLTH0C01694g"
                     /db_xref="GeneID:8291161"
     mRNA            complement(<149232..>149483)
                     /locus_tag="KLTH0C01694g"
                     /product="KLTH0C01694p"
                     /transcript_id="XM_002552256.1"
                     /db_xref="GeneID:8291161"
     CDS             complement(149232..149483)
                     /locus_tag="KLTH0C01694g"
                     /note="some similarities with uniprot|P50084 Saccharomyces
                     cerevisiae YGR230W"
                     /codon_start=1
                     /product="KLTH0C01694p"
                     /protein_id="XP_002552302.1"
                     /db_xref="GeneID:8291161"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:C5DDK3"
                     /translation="MSTPSIQPLHQAQDTGASLRRSMFKKPEVRPLRDKFASPTDDML
                     SPCSQKLNDHKSKLFTAKAKPTKLNFATEQKQEDSDDDY"
     gene            <154752..>155870
                     /locus_tag="KLTH0C01716g"
                     /db_xref="GeneID:8291162"
     mRNA            <154752..>155870
                     /locus_tag="KLTH0C01716g"
                     /product="KLTH0C01716p"
                     /transcript_id="XM_002552257.1"
                     /db_xref="GeneID:8291162"
     CDS             154752..155870
                     /locus_tag="KLTH0C01716g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C01716p"
                     /protein_id="XP_002552303.1"
                     /db_xref="GeneID:8291162"
                     /db_xref="UniProtKB/TrEMBL:C5DDK4"
                     /translation="MFFDPNEMNGIQNGRIEPLGLEAYSVEATTPVKPLDGLLFSSVE
                     NCCINYLEGHNQPLYQIFSPNDKTYEDEKARSLGNLSRKSSWESAEPKTCFLVSRSET
                     FDHYSPYETTANGDLEIDGLNDRLLIRESNIRSVSKLDMTLVPLKIEFEDWNPFRYSK
                     KVSKYCSDSSETRQFLKIRKVMQNNVIRLYFQLESSSGSQAFNEGEMRISLINRRVNP
                     LTFDNSSLNKHNYDDSEDQLIDMAFLTVSEFISVIKFILKDLDKGSPELRFKLKRDFP
                     ASSSYDPYLPNRIRSNIREFLKGKTLRGFVPNDFAEKLLPSQIDFMIGLFAQISNYET
                     EKPTRNNSQLSVVKLEDFEKAVKKCVSFYFFALPNGQG"
     gene            <158112..>158345
                     /locus_tag="KLTH0C01738g"
                     /db_xref="GeneID:8291163"
     mRNA            <158112..>158345
                     /locus_tag="KLTH0C01738g"
                     /product="KLTH0C01738p"
                     /transcript_id="XM_002552258.1"
                     /db_xref="GeneID:8291163"
     CDS             158112..158345
                     /locus_tag="KLTH0C01738g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C01738p"
                     /protein_id="XP_002552304.1"
                     /db_xref="GeneID:8291163"
                     /db_xref="UniProtKB/TrEMBL:C5DDK5"
                     /translation="MILCASNVFEKMAIGQTADVDLHFSQSDDAPFAKREVHCALAGA
                     KDAGGSNILIHTWASKTLAKHFRPARSHSSGTA"
     gene            <158660..>160210
                     /locus_tag="KLTH0C01760g"
                     /db_xref="GeneID:8291164"
     mRNA            <158660..>160210
                     /locus_tag="KLTH0C01760g"
                     /product="KLTH0C01760p"
                     /transcript_id="XM_002552259.1"
                     /db_xref="GeneID:8291164"
     CDS             158660..160210
                     /locus_tag="KLTH0C01760g"
                     /note="similar to uniprot|P32566 Saccharomyces cerevisiae
                     YGR229C SMI1 Protein involved in (1 3)-beta-glucan
                     synthesis possibly through regulation of cell wall glucan
                     and chitin synthesis chromatin binding protein 57 kDa
                     nuclear protein"
                     /codon_start=1
                     /product="KLTH0C01760p"
                     /protein_id="XP_002552305.1"
                     /db_xref="GeneID:8291164"
                     /db_xref="GOA:C5DDK6"
                     /db_xref="InterPro:IPR009203"
                     /db_xref="InterPro:IPR018958"
                     /db_xref="UniProtKB/TrEMBL:C5DDK6"
                     /translation="MEGVKKKWKELLYSFSTNDRYADYNENQGTGISRVSAGSGSAAA
                     AASSSQIQLTDFVDGHESSNDGVSEAMLAWRHIEAWASENHSDLYATLSEPCTRSDIA
                     NAEKDLAIIFPASVRASLRLHDGQEDLESLTGTSGLIFGLQLMPLDQIVQMTMTWRSV
                     AENMSKKNRNSSPVPSGNGSGIEMPNKSATPQTLKTKGYGKLDSQDYPNTNPGLQRDI
                     SHNSNKQFKMNSIPRQGSVPQNAIQPTYANAGWIPLVTDNAGNHVAVDLAPGPKGVYG
                     QVILFGREFDTKYVVANNWGDFLLAFANDLEKGNWYIMDADDDYLSGEGDLVFRDKED
                     DGPVVDYFDVLKARTHAALQRQHSSTGKEQPEYTQARKVSRGAPAAAGESSTMIEVSP
                     VVSSDNANPDKKTVENTVIESPANSTQASVAGLKVEEEPKETKPEVQESSKASDMTQK
                     DEKLEEEPSKDAKVTQQPSEVSKETKITSGAAQESADEQANTSNTEIPPETASVKELK
                     EEFESVAL"
     gene            complement(<160347..>161861)
                     /locus_tag="KLTH0C01782g"
                     /db_xref="GeneID:8291165"
     mRNA            complement(<160347..>161861)
                     /locus_tag="KLTH0C01782g"
                     /product="KLTH0C01782p"
                     /transcript_id="XM_002552260.1"
                     /db_xref="GeneID:8291165"
     CDS             complement(160347..161861)
                     /locus_tag="KLTH0C01782g"
                     /note="similar to uniprot|P50076 Saccharomyces cerevisiae
                     YGR227W DIE2 Dolichyl-phosphoglucose-dependent
                     glucosyltransferase of the ER functions in the dolichol
                     pathway that synthesizes the dolichol-linked
                     oligosaccharide precursor for N-linked protein
                     glycosylation has a role in regulation of ITR1 and INO1"
                     /codon_start=1
                     /product="KLTH0C01782p"
                     /protein_id="XP_002552306.1"
                     /db_xref="GeneID:8291165"
                     /db_xref="GOA:C5DDK7"
                     /db_xref="InterPro:IPR016900"
                     /db_xref="UniProtKB/TrEMBL:C5DDK7"
                     /translation="MDTKDEKELTLEEKLENEILHEVEAGFLFNLIVWPILLVYFGVT
                     FAKLANSVVPYQFIDEVFHVKQTIQYIGGNWKTWDPKITTPPGLYVLGWLNYKWLRLL
                     TSWSSLTILRLTNLFGGMIILPLVVLRPLFLFNAIGFWPASLICFPLMASYYYLYYTD
                     VWSSIFILESLTLAITLPFGETTSIWLSALSALVSCLFRQTNIVWNIFIMVVVIERRA
                     LIHKDFNNVHFNNYLKFIIHALENFKQVVLPYGLNLMLFAMFVIYNRSLTLGDKDNHT
                     AGIHLTQMFYCITFIAFFSAPLWISKAGLDYYRFRVQAKKFRTFLELLGIMLVIRFFS
                     VVHPFLLADNRHYTFYLFKKVIARNFWFKYLLMPWIYHFSTLNYIEIMRQKVMHFHPI
                     LPIEIKSPVELPVQLTHISWTALIICTFMTVVPSPLFEPRYYILPYFFWRLFVTPTSD
                     SILDNSPSESELKYCKRLALEFGWFMCINVLTLCVFALRSFMWEDEVNPQRVIW"
     gene            <162120..>163631
                     /locus_tag="KLTH0C01804g"
                     /db_xref="GeneID:8291166"
     mRNA            <162120..>163631
                     /locus_tag="KLTH0C01804g"
                     /product="KLTH0C01804p"
                     /transcript_id="XM_002552261.1"
                     /db_xref="GeneID:8291166"
     CDS             162120..163631
                     /locus_tag="KLTH0C01804g"
                     /note="weakly similar to uniprot|P38849 Saccharomyces
                     cerevisiae YHR151C hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C01804p"
                     /protein_id="XP_002552307.1"
                     /db_xref="GeneID:8291166"
                     /db_xref="GOA:C5DDK8"
                     /db_xref="InterPro:IPR016187"
                     /translation="MNRVVYGLLLTLVLNVVRGQSFWPALSSDSLIALRSQRDVLSNI
                     SIDKVPMVGVQLNEVAFRGTSNETESLEILASLLNVGVQAYMMDIEFDESYNLTISGS
                     DTSLGTTLSTFKRFISSSNNYLNADMLVLLLRLKQNTNTSTKGAPSNFPNITAILDLY
                     LGSSTLYTPSQLAYDRSSGNVAPSYGNLNSPDWPSLNYFLYSIQKRAVVFYVDTASSD
                     ALQSPAIFNASNLNYETSNTPIVCPLTNNAQVLNTSSLSWRFLQKDYSPSDIREYTMC
                     GYSPIIDNKYNPNSINTISNVLENSLLWSWASNEPNTSDDTRSNSTSLVARRCAVVHY
                     TKSNSSSYWTVANCYDRKRALCKRDGNDFEWAVTQEGASYFSHHDQDGNGFCPDNFSL
                     SLPQTALQEKSLDNYLSQLSPEGWEIWIDLNSVSVPDCWVPDGPYASCPYQKEVSTRN
                     FVSMITPVSVFAAVTILMLIMLSWRRVPIQDNRKRWKRVINSHLGSKAEGVPA"
     gene            complement(<163729..>165357)
                     /locus_tag="KLTH0C01826g"
                     /db_xref="GeneID:8291167"
     mRNA            complement(<163729..>165357)
                     /locus_tag="KLTH0C01826g"
                     /product="KLTH0C01826p"
                     /transcript_id="XM_002552262.1"
                     /db_xref="GeneID:8291167"
     CDS             complement(163729..165357)
                     /locus_tag="KLTH0C01826g"
                     /note="similar to uniprot|P38848 Saccharomyces cerevisiae
                     YHR150W PEX28 Peroxisomal integral membrane protein
                     involved in regulation of peroxisome size and number
                     genetic interactions suggest that Pex28p and Pex29p act at
                     steps upstream of those mediated by Pex30p Pex31p and
                     Pex32p"
                     /codon_start=1
                     /product="KLTH0C01826p"
                     /protein_id="XP_002552308.1"
                     /db_xref="GeneID:8291167"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:C5DDK9"
                     /translation="MTEMPVTRGRRDSIIGGFMARKYANKNHAVPEEDDDSTFKRVSN
                     RDLIHGVASSFFEAAYQRLKSSKASDGITIDEDYDQFAQFVPSESSDGFWKDENFRQE
                     YELGSELGSSQTSEPEKMAEKPKSERTRGTQEHFIDILLDKMISTILPENFPEREHFS
                     QRLNDPDRKRRQKLSATILASNLKILTTKLGSIFELQDSVIRLVAWRNPSGTITMLIM
                     VTMICFNPIYLAVIPLLYVLYGLMVPGYMHRHPPRRTNFLSRKQYGRSLIVSLTSGGK
                     RTHNYLNEDIREYDYNLEADPQDVKKAHNIKQSMEFVVNLRDLQNSMSAMVSLSNSIE
                     RFVYGTAGFKDEHRSTVLFLAGLGALLLSGIISPFINWSALLAALAWLSMVAIHPKVR
                     PKLAQVVKKEQLDRGKEALKRTERYDVILDEQPEVRVIEIFEIFKKEALSNNWSFVKY
                     SSSVFDPRDSFRKAQVLPPGVDELECVCPPLTWSFDANSVWEIDYNVGGWSTERCLNL
                     QIDDQFLVDDAFKRRRLTRKVLRYASPARKPSYK"
     gene            complement(<165526..>167517)
                     /locus_tag="KLTH0C01848g"
                     /db_xref="GeneID:8291168"
     mRNA            complement(join(<165526..166121,166518..>167517))
                     /locus_tag="KLTH0C01848g"
                     /product="KLTH0C01848p"
                     /transcript_id="XM_002552263.1"
                     /db_xref="GeneID:8291168"
     CDS             complement(join(165526..166121,166518..167517))
                     /locus_tag="KLTH0C01848g"
                     /note="similar to uniprot|P50082 Saccharomyces cerevisiae
                     YGR225W AMA1 Required for sporulation"
                     /codon_start=1
                     /product="KLTH0C01848p"
                     /protein_id="XP_002552309.1"
                     /db_xref="GeneID:8291168"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DDL0"
                     /translation="MHKKGQKSTKGTERHTKIRTGSDKAAFITPKRVRGGNTDGRSCD
                     ITDRFIPQLASGSAFRAAQRLKTLDFDSTEHVLEASPSPSHLSMPGFFTDLRTTRHYN
                     SVVPSNTQPPSSKEDASVGDFQKLYRRYVADALGFQSTERVYQFSPLEAAVAASLTKT
                     NTIATKYSANHSRVDPLLSVLCPRLVLPYLASQAFSHSLRTRSLVPAFQRPATRAKSY
                     TPFRVLDAPSLRNDFYSNLVSWSPKTGNIAVGLGCAVYLWSDTRGAVNVLHYSYLQLR
                     NDFVTCVSFSPFERYLLVGTKQGRLLLYDQVEDEEPSDEGGYKPLSVSSDRSLQGICC
                     LSINGTATQLAVGGNDNSCTIWDISDLKNPRMEFLLPHKAAVKAVAFCPWSRSLLATG
                     GGSKDRNIRFWHTRSGTLMKETKAPGQITSLIWSLRQKQIVATFGFGDVEKPTLVSVY
                     SYPAMTPTIEVHSSTSLRVLSAAASPDHSSICVATNDETVRFYELWNLQDCPIFEAQE
                     RGIYGSDLIEYTEGIHKNRELIR"
     gene            <168487..>169758
                     /locus_tag="KLTH0C01870g"
                     /db_xref="GeneID:8291169"
     mRNA            <168487..>169758
                     /locus_tag="KLTH0C01870g"
                     /product="KLTH0C01870p"
                     /transcript_id="XM_002552264.1"
                     /db_xref="GeneID:8291169"
     CDS             168487..169758
                     /locus_tag="KLTH0C01870g"
                     /note="similar to uniprot|P50079 Saccharomyces cerevisiae
                     YGR223C HSV2 Phosphatidylinositol 3 5-
                     bisphosphate-binding protein predicted to fold as a seven-
                     bladed beta-propeller displays punctate cytoplasmic
                     localization"
                     /codon_start=1
                     /product="KLTH0C01870p"
                     /protein_id="XP_002552310.1"
                     /db_xref="GeneID:8291169"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DDL1"
                     /translation="MNTRPPIVASNPVSDGRFLGVNFNQDYSCFSCSTQTGFMVFNVD
                     PLECKLSRQFSNGNASGIATTRMLYRTNYVALVGGGRKPRYPPNKLVIWDDLQQRESI
                     TLSFMSAVKEMFLSRVHIVVVLENSIEIYEFSASHKRLISPLETCAGAAADFVVCQRT
                     MRRLSATQAQASSGNIPQTITKGILAFPSARNPGQVQVADLSHLQSSEIEERAATQLP
                     TSIIKAHKTPIRLIKLSPNGSMVATCSQQGTIIRIFSTQNGSLLGEFRRGLDRADLYE
                     MAWSPRSNRLAVVSDKQTLHIFQVTDEDGDMKNKTHVLKDVPFFWKPKYLDSTWSMCS
                     LHLRSALKGRDSMNDQDFYNDRCKLGWCQEGDEDSLVLIWKQSGVWEKYAILEKEPKT
                     YAVNETLQTSVTAQNQNKKHWEIVRESWRKL"
     gene            complement(<169802..>170770)
                     /locus_tag="KLTH0C01892g"
                     /db_xref="GeneID:8291170"
     mRNA            complement(<169802..>170770)
                     /locus_tag="KLTH0C01892g"
                     /product="KLTH0C01892p"
                     /transcript_id="XM_002552265.1"
                     /db_xref="GeneID:8291170"
     CDS             complement(169802..170770)
                     /locus_tag="KLTH0C01892g"
                     /note="similar to uniprot|P10834 Saccharomyces cerevisiae
                     YGR222W PET54 Protein required for splicing of the COX1
                     intron AI5 beta also specifically required together with
                     Pet122p and Pet494p for translation of the COX3 mRNA
                     located in the mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0C01892p"
                     /protein_id="XP_002552311.1"
                     /db_xref="GeneID:8291170"
                     /db_xref="UniProtKB/TrEMBL:C5DDL2"
                     /translation="MKSVYLGKRHPFIYFSKVRPGNKIIKLSMSLTDYEQKRDNAPAG
                     NIRTLELRINPMSSSKVVKSVLGKLKSTGNVVGSYPAAHNAARGHGSEDEELKYAKPR
                     ILELKSYNPLLAKSDFVDLLPQTRFSTRAVASSVLDFEVLKVRDPRYFQFRDKYRLVF
                     PDHKTMEAYRKYITFSRVDGVRPHFTQSSSQNPEVGYGLYARNLLAAFDSRESFFHTL
                     RSGRGAGTPELTLETIRKTVEPLQTKSLLVWNFPSDLRPYHIMDRFWLYDIKHCFKLY
                     WDPTTGRTLTFMAFNSEDDCARFSQNYHGVYFHENDDCKLLVEALT"
     gene            170809..170972
                     /gene="SNR7"
                     /locus_tag="KLTH0C01914r"
                     /db_xref="GeneID:8291171"
     ncRNA           170809..170972
                     /ncRNA_class="snRNA"
                     /gene="SNR7"
                     /locus_tag="KLTH0C01914r"
                     /product="U5 RNA"
                     /note="SNR7 (U5 RNA)"
                     /transcript_id="XR_002432179.1"
                     /db_xref="GeneID:8291171"
     gene            <171545..>173581
                     /locus_tag="KLTH0C01936g"
                     /db_xref="GeneID:8291628"
     mRNA            <171545..>173581
                     /locus_tag="KLTH0C01936g"
                     /product="KLTH0C01936p"
                     /transcript_id="XM_002552266.1"
                     /db_xref="GeneID:8291628"
     CDS             171545..173581
                     /locus_tag="KLTH0C01936g"
                     /note="weakly similar to uniprot|P32900 Saccharomyces
                     cerevisiae YHR149C SKG6 Protein of unknown function found
                     in the bud tip and bud neck potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0C01936p"
                     /protein_id="XP_002552312.1"
                     /db_xref="GeneID:8291628"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="UniProtKB/TrEMBL:C5DDL3"
                     /translation="MITTSIERPTTTVFLAPPRIFRRADSSTNSGSSTSESSSKASST
                     KCGNGSKCTLPADRTESATVAVAVVVPVVVVILVLGFVLWKVWRRSRKEAMEDNDPDF
                     DGDGEYMPAANAGYELKENSVPTSGSNFDDYEFKSQGYPADAGYAGSNYYKPPIVDPF
                     QLPMSDDAGDLRTFARSIQNNEFDGYRLASHSASELSLSNPTGGFHRPQTFIQQGRSG
                     SFTSSNLMSVESADNVARINDGHIQDSMPQATQAEEMASGESGEYASDVENSPIKNAR
                     AEVAQGYIGDSAGLDPEKSFKGSASIENDKASSNQSFVDACLNVSKTGMEKGSEYDDD
                     YEIHNSKEEENIKRMKSIYEVYLDRNGTVRTVNPPSKETEEELGAHEEGFAASESLPA
                     GASFQIHEAAERQKQLDASNAGVVRDELQLPGQGEETVARTRAASSIYSELPAMPQQT
                     AQANQYRRQAPYEQPAQYEYQPEYYNDPNAVYSYQNQAYMPQQYHHPQALENIEELPN
                     PSSLPFSATTSSLTSYNKKAGRSLTPGGMPVYNGTKVNPIDHPELFYSQSSLVDEQPA
                     YAQQTPSQGQVLPHHLRQSVVMTNPAQLSHPTLFKPAGSFRNFSAANSRNNSMTSQHS
                     VQQHQTQLAHQRVSGILDDHDTVQPPRLGGILPHSGSHDDLRRQLGSSDNYNVS"
     gene            complement(<173708..>174259)
                     /locus_tag="KLTH0C01958g"
                     /db_xref="GeneID:8291172"
     mRNA            complement(<173708..>174259)
                     /locus_tag="KLTH0C01958g"
                     /product="KLTH0C01958p"
                     /transcript_id="XM_002552267.1"
                     /db_xref="GeneID:8291172"
     CDS             complement(173708..174259)
                     /locus_tag="KLTH0C01958g"
                     /note="highly similar to uniprot|P32899 Saccharomyces
                     cerevisiae YHR148W IMP3 Component of the SSU processome
                     which is required for pre-18S rRNA processing essential
                     protein that interacts with Mpp10p and mediates
                     interactions of Imp4p and Mpp10p with U3 snoRNA"
                     /codon_start=1
                     /product="KLTH0C01958p"
                     /protein_id="XP_002552313.1"
                     /db_xref="GeneID:8291172"
                     /db_xref="GOA:C5DDL4"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:C5DDL4"
                     /translation="MVRKLKHHEQKLLKKVDFLDWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNKLCGDVRRLSHKLSLLPPSDAFRIKHEQLLLEKLYAMGILTTKSKISDLENKVT
                     VSAICRRRLPVIMHRLKMAETLSDAVKFIEQGHIRVGPNLITDPAYLVTRSMEDYVTW
                     VDSSKIKKTILRYRNQIDDFDFA"
     gene            <174934..>175611
                     /locus_tag="KLTH0C01980g"
                     /db_xref="GeneID:8291173"
     mRNA            <174934..>175611
                     /locus_tag="KLTH0C01980g"
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /transcript_id="XM_002552268.1"
                     /db_xref="GeneID:8291173"
     CDS             174934..175611
                     /locus_tag="KLTH0C01980g"
                     /note="similar to uniprot|P32904 Saccharomyces cerevisiae
                     YHR147C MRPL6 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /protein_id="XP_002552314.1"
                     /db_xref="GeneID:8291173"
                     /db_xref="GOA:C5DDL5"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:C5DDL5"
                     /translation="MIGGCSGFKALGNALSRRCFSQSRTAWSHIGSLPVYTTRDTKFE
                     IGELKPAYVIRKGNKSLKLSQIYSVTGPRGSLSMRVPEFVSVDQDAENGKLTVSVRDE
                     SDKIQKSLWGTVRSHLHNHIVGVNEGHMAVLRFVGTGYRAQLEQDGKFVSVKVGASIM
                     QGLPVPEGITVKSPAPTSLIVEGCDKQQVYLFAANLRKFHPPEPYKGKGIYINDEKIT
                     LKDKKIK"
     gene            <175811..>176617
                     /locus_tag="KLTH0C02002g"
                     /db_xref="GeneID:8291174"
     mRNA            <175811..>176617
                     /locus_tag="KLTH0C02002g"
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /transcript_id="XM_002552269.1"
                     /db_xref="GeneID:8291174"
     CDS             175811..176617
                     /locus_tag="KLTH0C02002g"
                     /note="similar to uniprot|P31334 Saccharomyces cerevisiae
                     YGR220C MRPL9 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL9"
                     /protein_id="XP_002552315.1"
                     /db_xref="GeneID:8291174"
                     /db_xref="GOA:C5DDL6"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="InterPro:IPR019927"
                     /db_xref="UniProtKB/TrEMBL:C5DDL6"
                     /translation="MSSLVSRLFKSQVRFSSAKASLVAPSVVNTIQSSAPVINHCPEQ
                     AQSRKRLPNRCGALSLKRGMIPYFDEASGNRVAATVLELNNVEVIMHRNLKDNGYFAC
                     QVGFGSKHPSKVSRQMLGHFASKIVNPKEKVVEFRVKDQSGLLPLGTLIKPSFFMPGQ
                     YVDLRSISKGKGFAGVMKRYNFKGLKASHGVSVSHRKGGSYGQNQTPGRVLPGKKMPG
                     HMGVQQVTIQNSQILKVDDENGVVIVKGSVAGPKGGFVRIQDAIKKAPKF"
     gene            complement(<176824..>180078)
                     /locus_tag="KLTH0C02024g"
                     /db_xref="GeneID:8291175"
     mRNA            complement(<176824..>180078)
                     /locus_tag="KLTH0C02024g"
                     /product="KLTH0C02024p"
                     /transcript_id="XM_002552270.1"
                     /db_xref="GeneID:8291175"
     CDS             complement(176824..180078)
                     /locus_tag="KLTH0C02024g"
                     /note="highly similar to uniprot|P30822 Saccharomyces
                     cerevisiae YGR218W CRM1 Major karyopherin involved in
                     export of proteins RNAs and ribosomal subunits from the
                     nucleus"
                     /codon_start=1
                     /product="KLTH0C02024p"
                     /protein_id="XP_002552316.1"
                     /db_xref="GeneID:8291175"
                     /db_xref="GOA:C5DDL7"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DDL7"
                     /translation="MESILDFTQDLDINALDQVVDTFYKGSGVQQKQAQEVLTKFQDH
                     PDSWQRADQILQFSQNPQTKFIGLSILDKLINTKWKLLPPEHRVGIRNFIVGMIISLC
                     QDDAVFQSQKNLINKSDLTLVQILKQEWPQNWPDFIPELVQSSQSSVNVCENNMVILK
                     LLSEEVFDFSAEQMTQAKALHLKTSMSKEFEQIFKLCFQVMDAGSTTSLVLAALESLL
                     RYLHWIPYHYIYNSNLLDLLSTKFLMSSDTRAVTIKCLTEISNLEIPQNDPKIAEQTV
                     LFFQNTLQQVGNNVVPVTADLKATYATANGRDQSFLQDFAMLLTTYLARHRALLESDE
                     RLRELLLTAHQYLIQLSKIDERELFKTTLDYWHHLVAHLFQEVQTLPVAELNPLLKLS
                     VGSQAINSSGGAPNPEFLKRFPLKKHIYDGICSQLRWVVIESMVRPEEVLIVENDEGE
                     IVREFVKESDTIQLYKSEREVLVYLTHLDVVDTEDIMINKLARQIDGSEWSWHNINTL
                     CWAIGSISGTMSEETEKRFVVTVIKDLLALTEKKRGKDNKAVVASNIMYVVGQYPRFL
                     KAHWKFLKTVVIKLFEFMHETHEGVQDMACDTFIKIVKKCKHHFGVQQPNEPEPFIHT
                     IIREIQSTTADLQPQQVHTFYKACGIIISDERNATERERLLADLMQLPNMAWDAIVEQ
                     SAANPDLLLDPETVKIIANILKTNVAVCSTMGAEFYPQLGHIYYNMLQLYRAVSSMIS
                     VQVAKDGLIATKTPKVRGLRTIKKEVLKLVEFYISHAKNLEEVVKVLVEPLLNAVLED
                     YMNNVPDARDAEVLNCMTTVVHKVGHMIPSGVILILQSVFECTLDMINKDFTEYPEHR
                     VEFYRLLKEINSRSFNALLELPSAAFKLFVDAICWAFKHNNRDVEVNGLQLALDLIKN
                     IEAMGSTPFSNAFYENFYFTFISETFYVLTDSDHKSGFSKQSLLLMRLISLVQENKIA
                     VPLYQPGDVPEGTTNQLYLANYLAGMLNGAFPHLSQEQVTSFISALIKQYQDPAKFSA
                     TLRDFLVQIKEFGGDPTDYLFAEDKERALEEKTRMEKERAAAVGGLLKPSELED"
     gene            complement(<180744..>186761)
                     /locus_tag="KLTH0C02046g"
                     /db_xref="GeneID:8291176"
     mRNA            complement(<180744..>186761)
                     /locus_tag="KLTH0C02046g"
                     /product="KLTH0C02046p"
                     /transcript_id="XM_002552271.1"
                     /db_xref="GeneID:8291176"
     CDS             complement(180744..186761)
                     /locus_tag="KLTH0C02046g"
                     /note="similar to uniprot|P50077 Saccharomyces cerevisiae
                     YGR217W CCH1 Voltage-gated calcium channel involved in
                     calcium influx in response to mating pheromones"
                     /codon_start=1
                     /product="KLTH0C02046p"
                     /protein_id="XP_002552317.1"
                     /db_xref="GeneID:8291176"
                     /db_xref="GOA:C5DDL8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:C5DDL8"
                     /translation="MASRRNLTHRQPPMEHETSVEPNQTPVIVKIDEADTVTEGEGGV
                     LNLNPAGGSKHQENTKNLRRPNLTVITRNSDSSFDRSQLSATSIKSHFRNFISPTRTE
                     QSDTEGSGSADEGPISYTSALSDEDNLRSAAVISTIDEGDLSDFKDLQDEFKNAMKEG
                     NSTWLPKSRRNSKVPDAETQEAPRREPHLSLEPPREHDRSSSASPLRAASSLGIQLTR
                     DSSNGKNPSKYTNRIFSDAGGYDHDADSDWSEEESAQGSSNRPQREEPSKPPLLLFGN
                     SMGLISPNNPIRRKLAALLLKKWAPLPNLAFLVAMVATLALSHINNSGDFTYDSTGID
                     SLLLVANAFFTIEILAKIVAFGFWDDSQLFHARGEKYKTVYQTLGLAKFFHNLEAKYG
                     SEFMKKIFPFDIDDTSATKEIRDKQLRSSVTFNGAPRSYNTEIPLHRAFARSSWNRID
                     LLSTVCLWISLSLTINEYDFKHGIRIFKAIGVLRVLKLAAIQDRQSDILRSLKYGLPQ
                     LLNVGFMLLYFWVFFGILGVQSFRGSLRRQCVWTNPNDTTETYVNEMQFCGGYLESVT
                     KNKKPYIFSDGKEGPIAKGFLCPQNSKCISDTNPYNGRVSFDNILTSMELVFVTISAN
                     TFTDIMYYTMDSDSMAASIFFVFCIFSLNIWMINLLIAVLVSSFEKANELVRKKGQKN
                     IVPSAFQRIRKSTFDYIKKKARSKRLSPRAELWLKWYKRFEFLFVSLIFAELIMQATV
                     TSRSSSNHIEHVLKFDQATAFVLLFESVLRLVIHSDNIWKFLINPAYVFDLLNSIFST
                     IITLPNARRKLGQNYYWLNLIQVVRFYRVITEISVTRNLWKQVLGNVLLIWDLTGFYF
                     LFLFLVSIVISVYFDGVIPISQIDETPFGMYSVTNTFLTLFTIGSTENWTDALYALQE
                     NLPNKSSQFFGVVLLIMWFFMANFVMLNIFIAIIAESLDVKEEEKRPLQIKHYLKHVY
                     PQKIRDFASASLMGRIKNKIFGNSGYDDSKDFRQFLFRGTAIVSIAQQYNILEDSPQD
                     TTTKEGVPYFIKNIKRILNNYSVLKLFANNPFYKKPEVVYVETVDSVGLNKKFTLKLN
                     EFEEEKLRYLKEHPMYNNSYFIFPPNHILRKFCQSLTTPCVGKRTDGFRFFGDNTNTY
                     DRNSYFKHIKKDVFVGFISIATILMVVYSCSLTPLYRINHASGVNKWSMISDAIFVTI
                     FSLEFLIKTVADGVIHTPNAYLRNPWNCIDVIVLLSLWIDFVSGLKRDDDLSRVFRGL
                     TALRALRCLTISKTARSTFDQVLFDGIRKIIGAAMVSLTLLFPFAVWGLGLFRGRFGV
                     CNDGVDLSQCYNEFSNQVFDFEILTPRVYSQPYLYMNSFSTAFRSLYEIVSLEGWVDM
                     LSNSMASTGIGTVPETFASPGNGAFFVLFNFLSMVFILTLFISFIIRNHARTTGSAFY
                     TIEEKSWLEVKKLLSQARPEPTPDVLSMSKFRSFVYRLAVEKTYFWYAFFLQAVLYLH
                     IITLLLYAYHEANGLGTYQDVIFIISSSVFLMQEGLYIFGKGVRLWFAKKWDVFKFFV
                     VVMSFGLNVAQTRMDGIVLGFTNVRDLFQLAIFLFVIQQNDILSELINTAMASLPSIL
                     SLTYTWGILFLVYAIALNQIFGLTKLGPNTTGNINFRTVIKSLIVLFRCSFGEGWNYI
                     MDDLTVKSPFCYVDKTSGRTDCGSKPYAYVLLMSWNILSMYIFLNMFVSLILESFSYL
                     YHAGSGSKSVASRDEIRKFRNAWRKFDPDGVGEIETNLLPRFMHSFDGLLSYKIWEGR
                     LSVSNLVKNYMKVNPSDPYDVEVDLVGLNKELESIDRKKIIERKTQYRRFIQEARHLS
                     AFNNGVKFSKIVQQIPLYTAYNPQECLGIDEFVKRLYVMGKVDRFLENERNVDVLEMV
                     VTRWKFLSERRILRSKAAGGFRNTPQPRNILDLALTSSDHPDTPKLNFSVSNFNWSPR
                     RRGSDQGGHLLDTNSLSPEQDGENTESDSGGSSKSSDSQSHKRGLIP"
     gene            <186916..>188733
                     /locus_tag="KLTH0C02068g"
                     /db_xref="GeneID:8291177"
     mRNA            <186916..>188733
                     /locus_tag="KLTH0C02068g"
                     /product="KLTH0C02068p"
                     /transcript_id="XM_002552272.1"
                     /db_xref="GeneID:8291177"
     CDS             186916..188733
                     /locus_tag="KLTH0C02068g"
                     /note="similar to uniprot|P53306 Saccharomyces cerevisiae
                     YGR216C GPI1 Membrane protein involved in the synthesis of
                     N-acetylglucosaminyl phosphatidylinositol"
                     /codon_start=1
                     /product="KLTH0C02068p"
                     /protein_id="XP_002552318.1"
                     /db_xref="GeneID:8291177"
                     /db_xref="GOA:C5DDL9"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="UniProtKB/TrEMBL:C5DDL9"
                     /translation="MKYIYWPKVAGFNKNDARIVVALQAPESDLIVISLLTARETKLL
                     QKSNRFKRIGHIDGNNEFVSELDEKDICIVEFWPPKLNLMQFYALEPISLALPEKADS
                     TLLSRATGGQPSPTEKFQMRESINSINLYYKHLQSLRALIGRAGPSNRGIPVRRIARA
                     LADLCGLLPLLSALRQALTYMIIFIHSFARFLSAVLNWNPLCLVSFSATAQQIDLRSQ
                     QFCYFPVQYLRITENAVFNRMRPRSELSVCHPKEKQETRGNASAGVFPCEYYPDYIRF
                     YNTIWLIVNDVSFGLTVGTLLAENKLRIAKFINFHLTDYLFHKVHYITAYLGQNPLGI
                     KLNGELAHFLSELFLWIIDFSYSTYIRRILDVSSIQTVISIVSRTSCCFGVTFALSLT
                     VDLMSVLSMHISLFYYISAKMYHWQLHVMRSLLYLFWGKKRNLLRKRVDSNMFELDQL
                     VMGTLFFTMMVFLLPTLAVFYISFTALRMTILMPELLLESLMALLNHFPLFVLLLRLK
                     DPSRIPGGVSMEALGSKNRFALQNNPLTVSSMFRPYSLLMGMMAENYCSVATLKQILV
                     GRPITIKRYKMYQVLYSALPKVPIATSKLWEALKGSRPS"
     gene            complement(<188861..>189187)
                     /locus_tag="KLTH0C02090g"
                     /db_xref="GeneID:8291178"
     mRNA            complement(<188861..>189187)
                     /locus_tag="KLTH0C02090g"
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /transcript_id="XM_002552273.1"
                     /db_xref="GeneID:8291178"
     CDS             complement(188861..189187)
                     /locus_tag="KLTH0C02090g"
                     /note="similar to uniprot|P53305 Saccharomyces cerevisiae
                     YGR215W RSM27 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /protein_id="XP_002552319.1"
                     /db_xref="GeneID:8291178"
                     /db_xref="InterPro:IPR013219"
                     /db_xref="UniProtKB/TrEMBL:C5DDM0"
                     /translation="MSIPKSRLLKIANLSAKIFDENFNPTATRTGSKILSKRLKGPSI
                     VGYYGNPDFLKFKHLKTLYPGFSFVDQQEEYRLLMNEARKRRGKGAPAKKKEASKDKS
                     KTKKRK"
     gene            complement(<189741..>190838)
                     /locus_tag="KLTH0C02112g"
                     /db_xref="GeneID:8291179"
     mRNA            complement(join(<189741..190406,190749..>190838))
                     /locus_tag="KLTH0C02112g"
                     /product="40S ribosomal protein S0"
                     /transcript_id="XM_002552274.1"
                     /db_xref="GeneID:8291179"
     CDS             complement(join(189741..190406,190749..190838))
                     /locus_tag="KLTH0C02112g"
                     /note="highly similar to uniprot|P32905 Saccharomyces
                     cerevisiae YGR214W RPS0A protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="XP_002552320.1"
                     /db_xref="GeneID:8291179"
                     /db_xref="GOA:C5DDM1"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /translation="MSLPATFDLTPEDAQLLLAANVHLGSKNVQVHQEPYVFKTRPDG
                     VNVVNVGKTWEKIVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFSAHTGATAIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKESSYVNIPVIALTDLDSPSEYVDVAI
                     PCNNKGKHSIGLIWYLLAREVLRLRGSLVDRTQPWSIMPDLYFYRDPEEVDQQVAEEA
                     TAAADEDVKEEVAEEQTEAADWAEGNTEEVASW"
     gene            <191811..>193844
                     /locus_tag="KLTH0C02134g"
                     /db_xref="GeneID:8291180"
     mRNA            <191811..>193844
                     /locus_tag="KLTH0C02134g"
                     /product="KLTH0C02134p"
                     /transcript_id="XM_002552275.1"
                     /db_xref="GeneID:8291180"
     CDS             191811..193844
                     /locus_tag="KLTH0C02134g"
                     /note="similar to uniprot|Q12209 Saccharomyces cerevisiae
                     YLR047C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02134p"
                     /protein_id="XP_002552321.1"
                     /db_xref="GeneID:8291180"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:C5DDM2"
                     /translation="MFDFTHDAAIPAATGPAAAQSTDVAVRRAINWSAVVAIGLAAFA
                     VAVALPLWNYLSLTAWFFRLRHHLRHDVLRKIRVFHGSRLYHNQALKICLFWGALAFA
                     CSFVQTGGDIIQITKRFGRIAVALMPPLLFLTLRPSPLPHTLYLSLIPIHKWVSRVVV
                     LLSLLHTALYTWYWISVRMFFLKIKKPANLWGVIAMALFLLIAITSLSGVRRYNFRLF
                     YYVHYVSTWLTVVLLHFHARPPVSGYTALNCCILVAQIAYRVIRTTKVRITVVPVSPN
                     LILVEFPLSGLSKKPHMPSSTIRMAPYHNHPLKRLFQQLIPLQHPYTIASLPSDDMIR
                     LIIRRGKFQLRNNAEYLVTGAFEPKIDFISKSSRSVNIFQGSVAFQNQTPALLASPLH
                     YLISARRALLVTGGSAISFGLPLLRILNFNGVTVRLKWVTRDYRDLTLLNHFKNNFDG
                     LEIYVTGSAGEEQDLQIDYVDFDQRPSQDSSLNEELEPIHPSAPETAPESNYGTFKSF
                     EPPSGLTLQNQGRSNQEDEIDFTQMFSARSLKSKKSHLAEQLPHTPFAKGDIFRKPSI
                     VVPPPEQVDDMQDLPSLPGETDPKVLKIPAGVQVFFGRPNLTNHDYQWCLERECIGPS
                     DTNDCFRLDGPAANVDDLSRVWVLAAGPPQLVENTKRWATDGGLHFHEESFTS"
     gene            complement(<193918..>196374)
                     /locus_tag="KLTH0C02156g"
                     /db_xref="GeneID:8291181"
     mRNA            complement(<193918..>196374)
                     /locus_tag="KLTH0C02156g"
                     /product="KLTH0C02156p"
                     /transcript_id="XM_002552276.1"
                     /db_xref="GeneID:8291181"
     CDS             complement(193918..196374)
                     /locus_tag="KLTH0C02156g"
                     /note="weakly similar to uniprot|P40355 Saccharomyces
                     cerevisiae YJR061W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02156p"
                     /protein_id="XP_002552322.1"
                     /db_xref="GeneID:8291181"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:C5DDM3"
                     /translation="MRVTRLCRRVVSASMVMLLMVWLIKSIDPNSNVEKQLKLLKSQG
                     NPNSSRLMWILSKPELAALFQALFLPETAGLNSEFWNDDYTLKDLTESTRVASGNKLW
                     GLRFPYYTFDARLTAAVYYKHVQNSQHRGEIMFSWYDWKNLGSVLNPLITSKPQENPQ
                     CQDIFEAPEESQRIVSSSNKWGSFPKASLENSLLSSYCTNSQKSPIGFEVHRIQPHSD
                     AESLVLQSSSFLFSGGLVPKNLVFLSKDGPAVHTSVKNSAAYLSLASSDLLEEFLSSH
                     DELESTLVFDPLKEIKNIHSKPPFPTPKPGRGFLFELSPEAFEFDLISQKELLSQSEF
                     PFEREFSYLSSLRFAQSYDSSGDNKFKYFYESSSIQNHPDNFQNHMDIRFFSGWVPKW
                     KRLRTLNSLMRTWLDFTKSENLTSWLAHSSLHAYLYSGSQFPWAASQNVQMPIQDLHK
                     LAMFYNQTLVIESPSEGYGRFFIDVQPFIFSRDHDESLDKVDARFIDIDTGLFIDILG
                     VGFSSNALTNTRIMSQLRNERNRNPDVLTPSDDESGSKPLEDQASYKNSRFNRANEIV
                     SEKSGKSYLLSDISPLRISKYHGKQVNIPHRALTIAKDEFHIVPWLFGPKQRQEKHRF
                     VPALGSWLDLPTLKALLGPRRVQEAHTITASQLEQALESLLEKSASHCEEMLSWFNSQ
                     DQFKFRLEELAIESSNLDLNSKYELLQALQTNYRDLPSSYKDPFLHEKKERKWEECTK
                     QANTAVGSQEYSNIIIKEVMKSLVKAFVANHGLKLKHEEISAHDNISQLAPTSLYNLR
                     ENSMEPLLEAPQALKADFTL"
     gene            complement(<196605..>197999)
                     /locus_tag="KLTH0C02178g"
                     /db_xref="GeneID:8291182"
     mRNA            complement(<196605..>197999)
                     /locus_tag="KLTH0C02178g"
                     /product="KLTH0C02178p"
                     /transcript_id="XM_002552277.1"
                     /db_xref="GeneID:8291182"
     CDS             complement(196605..197999)
                     /locus_tag="KLTH0C02178g"
                     /note="weakly similar to uniprot|P53304 Saccharomyces
                     cerevisiae YGR212W SLI1 N-acetyltransferase confers
                     resistance to the sphingolipid biosynthesis inhibitor
                     myriocin (ISP-1) by inactivating it co-operates with Ypk1p
                     in mediating resistance to myriocin converts myriocin into
                     N-acetyl-myriocin"
                     /codon_start=1
                     /product="KLTH0C02178p"
                     /protein_id="XP_002552323.1"
                     /db_xref="GeneID:8291182"
                     /db_xref="GOA:C5DDM4"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:C5DDM4"
                     /translation="MKSLSGLEEFFYYRSKQGLHSCFVVAITLNKSPTRSEIVQAVRA
                     VVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSNKIFKEVTFVY
                     GAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSLNASHADSTFPDEVVF
                     KPSPNIAHVPQHPYSRIPVSISGLLLRIVVRILVLISLLGIDLIGPVFVPELGSEDFK
                     FLHYRFPDGLLTSDGSVRNDNCQLKIKVPPNNLRALLRRCKEKKVSLSVFLLAVIAHS
                     LKLVGTDCVEGSRIKASVPMNARPLIQEILSMKPEAVEIGNFITGATLEYDRTSGGDI
                     WQTATKFREDLLSQKNSRSSIESAKLLELVDVEAFVERKKNARYPDSTFEVTNLGFQS
                     FDCGEDDRYYVQDSIFNNPQGLGDVLSCGCVATPVGGLNCSINFPKVLSSELRASIEY
                     IERTLGSLSSTGSP"
     gene            complement(<198184..>199686)
                     /locus_tag="KLTH0C02200g"
                     /db_xref="GeneID:8291183"
     mRNA            complement(<198184..>199686)
                     /locus_tag="KLTH0C02200g"
                     /product="KLTH0C02200p"
                     /transcript_id="XM_002552278.1"
                     /db_xref="GeneID:8291183"
     CDS             complement(198184..199686)
                     /locus_tag="KLTH0C02200g"
                     /note="highly similar to uniprot|P53303 Saccharomyces
                     cerevisiae YGR211W ZPR1 Essential protein with two zinc
                     fingers present in the nucleus of growing cells but
                     relocates to the cytoplasm in starved cells via a process
                     mediated by Cpr1p binds to translation elongation factor
                     eEF-1 (Tef1p)"
                     /codon_start=1
                     /product="KLTH0C02200p"
                     /protein_id="XP_002552324.1"
                     /db_xref="GeneID:8291183"
                     /db_xref="GOA:C5DDM5"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="UniProtKB/TrEMBL:C5DDM5"
                     /translation="MKRPEDHTLASENNKKVHTMPQDQENLFKPVGEFAREVDQPQGQ
                     GAQPDVAAPTNTGASDAEGHPVQEIESLCMNCHKNGTTRLLLTSIPYFREVVLMSFEC
                     PFCGFKNSEMQPASAIQEKGCKYMLKIEQKSDFNRQVIKAETASCKFQELDIEIPAKK
                     GQLTTVEGLLMEMIEDLAADQPARKTIDETLYSKIEEFIAKVRSYVACEPGTLPLTFT
                     LDDPAGNSWIEFKPDEPAHKWSQTQYVRSDEQNVQIGIISREQLEQQREEQRAKVADK
                     ERNPSVAQKSSFLSDETDIENFNNEVQTFTAACPSCSRPCDTHMKPVNIPHFKEVIIM
                     STVCENCGYKSNEVKTGGAIPEKGRKITLICDDPEDLSRDILKSETCSMTVPELHLDI
                     QQGTLGGRFTTLEGILRQVKDELTNRVFTQTSDSMDEETKNRWESFFARLQDGLDGKV
                     KFTVIMEDPLAGSYIQNVYAPDPDPNMTIEDYDRTDEQNEELGLNDIKLN"
     gene            complement(200388..200459)
                     /locus_tag="KLTH0C02222r"
                     /db_xref="GeneID:8291184"
     tRNA            complement(200388..200459)
                     /locus_tag="KLTH0C02222r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (CGT) cove score=76.93"
                     /db_xref="GeneID:8291184"
     gene            <200556..>201383
                     /locus_tag="KLTH0C02244g"
                     /db_xref="GeneID:8291185"
     mRNA            <200556..>201383
                     /locus_tag="KLTH0C02244g"
                     /product="KLTH0C02244p"
                     /transcript_id="XM_002552279.1"
                     /db_xref="GeneID:8291185"
     CDS             200556..201383
                     /locus_tag="KLTH0C02244g"
                     /note="weakly similar to uniprot|P36038 Saccharomyces
                     cerevisiae YKL208W CBT1 Subunit of complex involved in
                     processing of the 3' end of cytochrome b pre-mRNA involved
                     in RNA splicing"
                     /codon_start=1
                     /product="KLTH0C02244p"
                     /protein_id="XP_002552325.1"
                     /db_xref="GeneID:8291185"
                     /db_xref="UniProtKB/TrEMBL:C5DDM6"
                     /translation="MSLISIPHSFLKCAMSGVSRRFGDILGISKSITRYGGKHSGSRS
                     KLERKVLEEMTAGCYSRYLANYNCFVLLQWREIEGVGRANRARMWRRLCEGVNEAYRT
                     SGAASGAASSAENIGIPPSPVFFEHPLDTRLFARVLQTKHLCQKQKLLCSFQRLSSPE
                     SATALLQYLELAAKPADRSDGDAAFEPVVVGVKLASRDSSVVSHIQPLLEESSKMYQD
                     LNYEKLLQIAKCKSIGDADPAKSQAKKVLVALAENKLSKPRLADNQQWLLFTSYAQG"
     gene            <201515..>203326
                     /locus_tag="KLTH0C02266g"
                     /db_xref="GeneID:8291186"
     mRNA            <201515..>203326
                     /locus_tag="KLTH0C02266g"
                     /product="KLTH0C02266p"
                     /transcript_id="XM_002552280.1"
                     /db_xref="GeneID:8291186"
     CDS             201515..203326
                     /locus_tag="KLTH0C02266g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C02266p"
                     /protein_id="XP_002552326.1"
                     /db_xref="GeneID:8291186"
                     /db_xref="GOA:C5DDM7"
                     /db_xref="InterPro:IPR008313"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:C5DDM7"
                     /translation="MRRVSSRFIPILASLLFVCIIYNLSTSNQGYLAEPLNEKTPRKP
                     ATRPFQGASTAQRYQARVRKCPNYADYASVPHYRDEVSATPLDLPFQRPPENCRTFTS
                     ELVEKFIRQFTSRFRDRDLARLFENSFPNTLDTTILWHVSGSSNRKLRNHKEKSALFR
                     NEFPETFVVTGDIHAEWLRDSAWQLSVYQPFIKYDGKLAELIRGAINTQAQLVINNPF
                     CNAFHPPSYCSVKRGRSSIDNVDPKPNWSQVFECKYEVDSLASFLTLSRQYYENAPQE
                     LKFSFVTPDWISAVEKLMIVVSVESDSTFDEDGFVNTFPYVFRRNTNVASETLPLAGT
                     GNPVNSGIGLVRSAFRPSDDSTIFQYFIPGNAHLSVELETLAEYLRGYLKQTTSSPSE
                     LERVKELISAAAVTSSRIRDGIMDHAIVKHPKFGKVFAYEIDGFGSSLLMDDANIPSL
                     LSLPDLGFLDVDDEIYQNTRRMITCKEGNPYYIKGTHFEGIGGPHIGIHNAWPMSLLV
                     AIRTSENDKEIERLLDMVLQSTGGLGLIHESVQAFKEGGSTYTRPWFAWANSEFAKTI
                     LQLAQTKPYLIFRDEYAAEGFTLQNFLLSLPQQAGSD"
     gene            <203725..>204525
                     /locus_tag="KLTH0C02288g"
                     /db_xref="GeneID:8291187"
     mRNA            <203725..>204525
                     /locus_tag="KLTH0C02288g"
                     /product="KLTH0C02288p"
                     /transcript_id="XM_002552281.1"
                     /db_xref="GeneID:8291187"
     CDS             203725..204525
                     /locus_tag="KLTH0C02288g"
                     /note="similar to uniprot|P36039 Saccharomyces cerevisiae
                     YKL207W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02288p"
                     /protein_id="XP_002552327.1"
                     /db_xref="GeneID:8291187"
                     /db_xref="GOA:C5DDM8"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:C5DDM8"
                     /translation="MHFSTALTHLSVGTAGAVAELVLDPKLKYWVLFPISIVMILVGV
                     MRQYIMVILGPKVKSIPRKKLTEFQYISKAQALLGNGTNLNRHSFNMRQEYLAEVLAE
                     GKFLAQQGKPETPPNPLTDPNASDAMMGMVKGNLANYIPQTIIMWWVNHFFAGFLLMK
                     LPFPLTVKFKEMLQSGIMTSDLDPRWVSSISWYFISTLGLNPVNNLLFGNSEGDALGV
                     VQQQQQIETMPGGPTPDVIMKSLANDITIAQHESCFDNIEDRVLELYQ"
     gene            <204734..>205891
                     /locus_tag="KLTH0C02310g"
                     /db_xref="GeneID:8291188"
     mRNA            <204734..>205891
                     /locus_tag="KLTH0C02310g"
                     /product="KLTH0C02310p"
                     /transcript_id="XM_002552282.1"
                     /db_xref="GeneID:8291188"
     CDS             204734..205891
                     /locus_tag="KLTH0C02310g"
                     /note="highly similar to uniprot|P47122 Saccharomyces
                     cerevisiae YJR072C NPA3 Cytoplasmic protein required for
                     cell viability identified by association with
                     pre-ribosomal particles"
                     /codon_start=1
                     /product="KLTH0C02310p"
                     /protein_id="XP_002552328.1"
                     /db_xref="GeneID:8291188"
                     /db_xref="GOA:C5DDM9"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDM9"
                     /translation="MPLKTVICIGMAGSGKTTFMQRLNSHLHAAKSPPYVVQLDPAVL
                     NVPYGANIDIRDSVKYKKVMENYNLGPNGAIVTSLNLFSTKIDQVIKLVENKRDKYEH
                     CIIDTPGQIECFVWSASGAIITESFASTFPTVIAYIVDTPRNSSPTTFMSNMLYACSI
                     LYKTKLPMVVVFNKTDVCKADFAREWMTDFEAFQDALRQDQELNGETGMGSGYMGSLV
                     NSMSLMLEEFYSQLDMVGVSSYTGEGFDEFLTAVDKKVDEYESYYKAERERILKQKEE
                     EEKTKKQKSLEHLMKDLGLKDEQNAENAKQEEADVLSDFEEGENDGIVLRDEDEGVER
                     EYTFAEGDRMSGEVNGKSTPDLQKRYEEAFQKVAKSASSETAENIARYIRQ"
     gene            complement(<205933..>206751)
                     /locus_tag="KLTH0C02332g"
                     /db_xref="GeneID:8291189"
     mRNA            complement(<205933..>206751)
                     /locus_tag="KLTH0C02332g"
                     /product="KLTH0C02332p"
                     /transcript_id="XM_002552283.1"
                     /db_xref="GeneID:8291189"
     CDS             complement(205933..206751)
                     /locus_tag="KLTH0C02332g"
                     /note="similar to uniprot|P36040 Saccharomyces cerevisiae
                     YKL206C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02332p"
                     /protein_id="XP_002552329.1"
                     /db_xref="GeneID:8291189"
                     /db_xref="InterPro:IPR016562"
                     /db_xref="InterPro:IPR019151"
                     /db_xref="UniProtKB/TrEMBL:C5DDN0"
                     /translation="MNTLLLPLVSTGNVPQLMTDLVLHSLDSEFEFVRELDSLYVYPF
                     TGPIDYVEDSDSSLYRTSPEKTFTTPVELFFNPKLKLYIIQQRSPILQPYENQFCKNV
                     IAPLIEELNIGSLVVTDATDNFGEHIAAASTRRSPYSFGVCQVSQIDDLSGEFQQKLQ
                     LHDTGATPVNNTLFQFSSQSFQSGISTEQFIFKLCYHLLHTQKVSEILKEIRYFNIYV
                     QEGDNSEDAAAACTQVPQVITGFPSITTLRAPVSWKGVYGTRDAPGTFEEGLYI"
     gene            <207522..>208490
                     /locus_tag="KLTH0C02354g"
                     /db_xref="GeneID:8291190"
     mRNA            <207522..>208490
                     /locus_tag="KLTH0C02354g"
                     /product="KLTH0C02354p"
                     /transcript_id="XM_002552284.1"
                     /db_xref="GeneID:8291190"
     CDS             207522..208490
                     /locus_tag="KLTH0C02354g"
                     /note="highly similar to uniprot|P47120 Saccharomyces
                     cerevisiae YJR070C LIA1 Protein that binds to the
                     C-terminal domain of Hyp2p (eIF5A) has four to five
                     HEAT-like repeats"
                     /codon_start=1
                     /product="KLTH0C02354p"
                     /protein_id="XP_002552330.1"
                     /db_xref="GeneID:8291190"
                     /db_xref="GOA:C5DDN1"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027517"
                     /db_xref="UniProtKB/TrEMBL:C5DDN1"
                     /translation="MSTNFEKHFEENVDNCSLEQLRDILINKSGNSKLANRFRALFNL
                     KGIAEEFEKSPEEALKATKYISECFGDSSELLKHEVAYVLGQTKNMAGAPILRDVLAD
                     NDQQCMVRHEAAEALGALGDVDSLPILETYFKEDPLLEIRQTCELAIGRIKWQHSGLA
                     DKENLQESLYSSIDPAPPLTKDTDYKIGELKQILLDQEKPLFERYRAMFRLRDIGNDE
                     ACLALAAGFDDPSALFKHEVAYVFGQIGNSVVVPHLVEVLGRENEAPMVRHEAAEALG
                     SIATYDVLPVLKDHLTDKDDVVRESAIVALDMYEYENSNELEYAPA"
     gene            <208728..>209315
                     /locus_tag="KLTH0C02376g"
                     /db_xref="GeneID:8291191"
     mRNA            <208728..>209315
                     /locus_tag="KLTH0C02376g"
                     /product="KLTH0C02376p"
                     /transcript_id="XM_002552285.1"
                     /db_xref="GeneID:8291191"
     CDS             208728..209315
                     /locus_tag="KLTH0C02376g"
                     /note="similar to uniprot|P47119 Saccharomyces cerevisiae
                     YJR069C HAM1 Protein of unknown function that is involved
                     in DNA repair mutant is sensitive to the base analog
                     6-N-hydroxylaminopurine while gene disruption does not
                     increase the rate of spontaneous mutagenesis"
                     /codon_start=1
                     /product="KLTH0C02376p"
                     /protein_id="XP_002552331.1"
                     /db_xref="GeneID:8291191"
                     /db_xref="GOA:C5DDN2"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:C5DDN2"
                     /translation="MVQKIVFITGNENKLKEVKMLLATGESEEPIFELTSANIDLPEM
                     QSGSLEEIAKIKVSEALKHIPKGQAVFVEDTALCFDEYNGLPGAYIKWFMKSMGPEKI
                     VRMLDGFENKGAEAITTVAYGDSEGKIHIFQGRTKGKIVEPRGPPTFGWDCLFEPTEG
                     TGSTYAEMEKKDKNKISQRSKAFAQLKKYLYTQAA"
     gene            <209869..>213027
                     /locus_tag="KLTH0C02398g"
                     /db_xref="GeneID:8291192"
     mRNA            <209869..>213027
                     /locus_tag="KLTH0C02398g"
                     /product="KLTH0C02398p"
                     /transcript_id="XM_002552286.1"
                     /db_xref="GeneID:8291192"
     CDS             209869..213027
                     /locus_tag="KLTH0C02398g"
                     /note="similar to uniprot|P33418 Saccharomyces cerevisiae
                     YKL205W LOS1 Nuclear pore protein involved in nuclear
                     export of pre-tRNA"
                     /codon_start=1
                     /product="KLTH0C02398p"
                     /protein_id="XP_002552332.1"
                     /db_xref="GeneID:8291192"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DDN3"
                     /translation="MIQQIQQAVDIANSSTADHALKKQALDFLEGAKADAAAPQVFSS
                     LLQDASSSDVSKFVALQVLSDLALDSNGERLGYLKNACTELLRAKSADQNSQDPEYVR
                     NKIAEMTSRLFYCMYGEVNGNMWPNFFQDLLQILNIESLQTGASPEFSSVGLDLFLKI
                     CLAINSEIGDQTFVRSKEIQLKNNELKDAMRLRDVQLLSTLWYNSLKLFQLQQHPPQL
                     ANLTLSCIGSYISWIEISLIVGPEYINVIYEFLDHPASKIACAQCLCEIISKKMKPGD
                     KLALLSMLDLTSKVISVGNDDLDVQEQLAKLASSVGFELSLILEQCSDNNSEAESQEV
                     ASAADRQIIHQVAPLVLKFMEHEYDSVTQQCFPFISQYIQFLKKFFALGGKPGSAVAL
                     NSKRLSLDSDHENFLNALMSVCMKKMIIDETCDEDSTDEIDEFNETIRSKLKIFQDSL
                     AIINPGIYLQNISKSIESSIASSDWREVEFAMYQMHNFAESIRNNLFGVNKKDIFSSE
                     PHNLMCRFMATLLDNTNIFQIQNSLIQISFFELVVRHNLFLGASNKDNDTLLNIFCSE
                     FGMFNSKERVRLRTWYLFTRFIKSTKAKLTAGPLSSLLSKVSQLLTIKAVATSPQTAD
                     IDVTFDNQLYLFDGVGMLIGASADSSYELLDGILVPLFSDLETCISAPVKSPDVVLQT
                     HHILMAIGTVARGVHSGLVPENQVNNTEVTGKLFPRSVIEKFSNVAEVILVTFSYFNK
                     FESIRDATRFSFARLIPILNEEILPFASRLIAIFLSSDLKILELNDFLGFLGQIVHMF
                     NKSDVCYQLLNNLLAPVIEKVFKSLVQSEQEADRVQTSVSIASAAKGPSEKNVVITDS
                     FRDKVVLKKAYYTFLQSFVTNNSMSLFLTESNRTALPLVLEDLMTYTPDEIHETSSMK
                     LSLNVLVNFVKFIGTGSCTDPQDPNANNFTKLEGLSEFFIAKVVPLVFEIPFKPEFGF
                     NIRDGSCRVVACDLSRLLKALYSIHAGSDRNACLIYLTENYFPQVQFPGQLSSEFVQA
                     LANADEKTFEKYFVSFITNLVG"
     gene            <213485..>215191
                     /locus_tag="KLTH0C02420g"
                     /db_xref="GeneID:8291193"
     mRNA            <213485..>215191
                     /locus_tag="KLTH0C02420g"
                     /product="KLTH0C02420p"
                     /transcript_id="XM_002552287.1"
                     /db_xref="GeneID:8291193"
     CDS             213485..215191
                     /locus_tag="KLTH0C02420g"
                     /note="weakly similar to uniprot|P36041 Saccharomyces
                     cerevisiae YKL204W EAP1 eIF4E-associated protein binds
                     eIF4E and inhibits cap-dependent translation also
                     functions independently of eIF4E to maintain genetic
                     stability plays a role in cell growth implicated in the
                     TOR signaling cascade"
                     /codon_start=1
                     /product="KLTH0C02420p"
                     /protein_id="XP_002552333.1"
                     /db_xref="GeneID:8291193"
                     /db_xref="UniProtKB/TrEMBL:C5DDN4"
                     /translation="MEHVSEMSRTEIPLDATTTVASPLAPDSENSPQESDASVLESSG
                     VSKEGSAPKLQQITNIEEFKPQSETKTYVYSMKELMKISKVVSQSAQSGATANLPKKS
                     FWRLTSRHPDIRQVESAGGNGNGHKNDGNSRGQDSGNEKKGHRNRNSRNGRRGSKFSK
                     GEKPFVEEKDIKVNNDELLALEEEIKPTGNSITDFENWRAKMKELERKKKGIASKNST
                     GSQERPPLTNNSSSISDFFNLKRESSSNFEELEPQGTSSENMKGSHSRFSSFFNSTPP
                     PGLSGAQSTVAKPPTPKEEDARPAAGSRILSFFDKMDSQKHAASSVEPNIQMAEQISQ
                     TKAAPVHEQTNSHFFQGLLNRGKASPGNTERNNSNREASGPSALISPNTIPTSKVAEQ
                     PKEQAARSPAGPPGLSKLPPNKHVMSSQPQPGFLTGMPPNVYSSNSQPMGAPPSGFQH
                     FQMPLPGVAVPQQFFANPRQTGDFTGSQQKDDNSSRPSNMQIPYMPNPRGIPPPGIPP
                     MHMMPPGISQDMPLPMNGMMPPPSFYLSQGPSFGQFNNPPMPQNGMVGQPQSQNLPPR
                     KG"
     gene            complement(<215254..>216324)
                     /locus_tag="KLTH0C02442g"
                     /db_xref="GeneID:8291194"
     mRNA            complement(<215254..>216324)
                     /locus_tag="KLTH0C02442g"
                     /product="KLTH0C02442p"
                     /transcript_id="XM_002552288.1"
                     /db_xref="GeneID:8291194"
     CDS             complement(215254..216324)
                     /locus_tag="KLTH0C02442g"
                     /note="highly similar to uniprot|P40348 Saccharomyces
                     cerevisiae YJR068W RFC2 Subunit of heteropentameric
                     Replication factor C (RF-C) which is a DNA binding protein
                     and ATPase that acts as a clamp loader of the
                     proliferating cell nuclear antigen (PCNA) processivity
                     factor for DNA polymerases delta and epsilon"
                     /codon_start=1
                     /product="KLTH0C02442p"
                     /protein_id="XP_002552334.1"
                     /db_xref="GeneID:8291194"
                     /db_xref="GOA:C5DDN5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDN5"
                     /translation="MSSEGFFAKRQKLSQPENHGDDSKPWVEKYRPKKLEDVTAQDHA
                     VNVLKKTLQSANLPHMLFYGPPGTGKTSTILALTKELYGPALMKSRVLELNASDERGI
                     AIVRDKIKSFARLTVSKPSQNDREKYPCPPYKIIILDEADSMTADAQSALRRTMENYS
                     NVTRFCLICNYVTRIIDPLASRCSKFRFKPLDSSNALSRVQYVAKEERLQYDEHVLEK
                     ILDVSQGDLRRAIMLLQSTSKIVKHLDPPQITALTVDELAGTVPTELLNELVAKIATA
                     NLETIKINVREMIKSGWSGASVVNQLHHYYINSDQYSTAFKNKASWLIFDADSKLTNG
                     SNEHIQLLNLAMKLADLYRKGL"
     gene            <216516..>216989
                     /locus_tag="KLTH0C02464g"
                     /db_xref="GeneID:8291195"
     mRNA            <216516..>216989
                     /locus_tag="KLTH0C02464g"
                     /product="KLTH0C02464p"
                     /transcript_id="XM_002552289.1"
                     /db_xref="GeneID:8291195"
     CDS             216516..216989
                     /locus_tag="KLTH0C02464g"
                     /note="similar to uniprot|P47118 Saccharomyces cerevisiae
                     YJR067C YAE1 Essential protein of unknown function"
                     /codon_start=1
                     /product="KLTH0C02464p"
                     /protein_id="XP_002552335.1"
                     /db_xref="GeneID:8291195"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:C5DDN6"
                     /translation="MPSDKKRTSRQVISMSMSSSDDDIWGSESDGAPEAIGSTETVEV
                     RKLRLIHSKRGYLDGISSSKEENLQKGFDDSFEQGAVLGKRVGKVLGGLYILGMLHGR
                     FDEKLTDDLMEAQKELKINKVLSTKHFDENCNLLGVPNPIDKWEKILTEHQKRYL"
     gene            complement(<217025..>224428)
                     /locus_tag="KLTH0C02486g"
                     /db_xref="GeneID:8291196"
     mRNA            complement(<217025..>224428)
                     /locus_tag="KLTH0C02486g"
                     /product="KLTH0C02486p"
                     /transcript_id="XM_002552290.1"
                     /db_xref="GeneID:8291196"
     CDS             complement(217025..224428)
                     /locus_tag="KLTH0C02486g"
                     /note="highly similar to uniprot|P32600 Saccharomyces
                     cerevisiae YKL203C TOR2 putative
                     protein/phosphatidylinositol kinase involved in signaling
                     activation of translation initiation distribution of the
                     actin cytoskeleton and meiosis phosphatidylinositol kinase
                     homolg"
                     /codon_start=1
                     /product="KLTH0C02486p"
                     /protein_id="XP_002552336.1"
                     /db_xref="GeneID:8291196"
                     /db_xref="GOA:C5DDN7"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:C5DDN7"
                     /translation="MLRMKHDLGRRKKLISNGQNGEIAKDSSVGSGAAGVASVVAGTS
                     GAAEAAEAAAMTVGGSLGAGDADSDTTFLAFTMIFNKLKNPSAQERSTASFELKNSLV
                     SLAREVSTEQFQRFSNDINNKIFELIHGTTSFEKLGGVLAVDTLIEFYAQSDELPNQT
                     SRLANYLRVLVPSNDVEVMRAAAATLGKLAIPGGTLTSDFVDFEVKTCIEWLTTSPEN
                     SSSNFKQELRKHASLLIITAIADNSPYLLYPYINSILDNIWRALRDTKLAIRVDAAQT
                     LYKCMAIIQERDSKLTKKWFQRLFEGCAYGLQLNGNEAIHATLLVYRQLLSLQGSHLQ
                     EQFDEMYEMTMRYKDHKYNVIRKEIYAILPLLASADPQLFTDKYLDHVMIHYLTLLKN
                     MHASPTNNSDRAAISVSIGDIAQQVGSNIAPYMDSILDNVRDGLMTKFKLRKEFEKEL
                     FYCVAKLACAVGPVLAKYLNRDLLDLMLACPLSDHMQTTFSTIIEKIPALCPTINEKV
                     LDMICLALSGEKFSPPGAPVPLKPLSPEKARHYRDHLIFKKTGELNDDSLDVHYLNQA
                     LTMLHKINYRYSLVELVRLITISYIEHENPQVRKLAALTSCDLFVKDSICKQTSLRAL
                     NTVSEVLSKLLTVAITDPVVEIRFEVLRHLDASFDPQLSQPDNVRLLFMALNDEVFAI
                     QMEAMKIIGRLSIVNPAYVIPSLRKTLLQLLSQLSHSNMSRKKEESASLISNLISSSK
                     DITKPYIEPILDVLLPKCKDASSAVASTALRAVGELAVVGGEEMTLFLDQLMPLIIDT
                     FQDQSNSFKRDAALKTLGQLSASSGYVIKPLLDYPQLLGVLISILKSESSQNIRRETV
                     RLIGILGALDPYKQREVERTSNTNITAEQNAPRIDVALLMQGMSPSNDEYYPTVVIAT
                     LMKILKDPSLSSHHTSAIQAIMHIFQTLGVRCVSFLKQIIPGIINVMRTCPPSLLEFY
                     FQQLGILISIVNQHIRPFVAEIFEVVKEFFPIVKLQITIISVIESFSKALNGEFKLFL
                     PTTLTLFLDVLEKDKSSRKSVSVRILKSLVVFDSNLEEFSHLVIPTIVRIAEYGAGSL
                     NRVAIITLGRLAKTVNLSEMSSRIVQALIRVLNSGNADLIKATMNTLSLLLLQMDVDF
                     AVFIPIINKTLVKNQIQHTVYDQLVNKLLNHEALPTNIIIDRDFDVVSKEIAEIELPS
                     KKLPVNQLVLKNAWDCSQQRTKEDWQEWIRRLAVQLLKESPSHALRACSGLAGIYYPL
                     ARELFNASFASCWTELYTQYQEDLVSSLCMALSSPNNPPEIHQTLLNLVEFMEHDDKS
                     LPIPVPTLGEYAQKCHAYAKSLHYKELAFIQEPSTSTIESLISINNQLHQTDAAIGIL
                     KHAQQHHDLQLKETWYEKLQRWEDALNAYNQRELAGEDSIEVRMGKMRSLHALGEWDR
                     LSEMAAEKWSTSSMEVKRIIAPLAAGADWGLGQWDRIGQYIDAMKSHSPDKAFFDAIL
                     CSHRNNFDEAEKHIFEARDLLVTEISALVNESYNRAYSVIVRAQMISELGEIIEYKKL
                     PPASEKRAAIRKTWNKRLLGCQKNVDVWQRILRVRSLVVKPKQDMQVWIKFANLCRKS
                     GRMGLAQKALNSLLEDGGDPDHPNTARAPPPVVYAQLKYMWATGSQKEALRHLISFTS
                     RVAHDLGLDPSNMIAQSVPQNSTIPAHHIEEYTKLLARCFLKQGEWRVSLQTNWRMEN
                     PDAILGSYLLATHFDNRWYKAWHNWALANFDVISISSRGNDDKMLQNGTGEFGMNDSA
                     LQEPESSLEVENDGNTLNKTLFPPELVQRHVVPAIKGFFHSILLSESNSLQDTLRLLT
                     LWFKFGGIPEAAQAMHEGFNLIKIDNWLDVVPQLITRIHQPNQTVSMSLLSLLSDLGK
                     AHPQALVYPLTVAIKSESVSRQKAALSIIAKMRIHSSILVDHAEIVSHELIRVAVLWH
                     ELWYEGLEDASRQFFGEHNTERMFATLEPLHEMLKRGPATLREISFQNSFGRDLNDAY
                     EWVMNYKRNKDITNLNQAWDIYYNVFRRISRQLPQLQTLELQHVSPKLLAAHDLSLAV
                     PGTYQAGKPIVRISYFEPVFYVISSKQRPRRLSVKGSDGKDYQYLLKGHEDIRQDNLV
                     MQLFGLVNTLLQNDPECFQRHLDIQRYSAIPLSPKSGLLGWVNNSDTFHVLIREHREA
                     RKIPLNIEHRIMLQMAPDYDNLTLLQKIEVFTYALDNTRGQDLYKVLWLKSRSSESWL
                     ERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRITGKVVHIDFGDCFEAAILREKYP
                     EKVPFRLTRMLTYAMEVSGIEGSFRITCENVMRVLRDNKESLMAILEAFAYDPLINWG
                     FDLPTQTIAEQTGTELPLANPSELLRKGTISIEEAAKMEIRQKAEIRNARAMLVLKRI
                     TDKLTGNDFRRFRSLDVPDQVEKLIQQATSVENLCQHYIGWCSFW"
     gene            <224722..>226077
                     /locus_tag="KLTH0C02508g"
                     /db_xref="GeneID:8291197"
     mRNA            <224722..>226077
                     /locus_tag="KLTH0C02508g"
                     /product="KLTH0C02508p"
                     /transcript_id="XM_002552291.1"
                     /db_xref="GeneID:8291197"
     CDS             224722..226077
                     /locus_tag="KLTH0C02508g"
                     /note="highly similar to uniprot|P47117 Saccharomyces
                     cerevisiae YJR065C ARP3 Essential component of the Arp2/3
                     complex which is a highly conserved actin nucleation
                     center required for the motility and integrity of actin
                     patches involved in endocytosis and membrane growth and
                     polarity"
                     /codon_start=1
                     /product="KLTH0C02508p"
                     /protein_id="XP_002552337.1"
                     /db_xref="GeneID:8291197"
                     /db_xref="GOA:C5DDN8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR015623"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:C5DDN8"
                     /translation="MSYLNNPAIVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTT
                     KQGGSGSGAGQSQGSGNPYFGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNE
                     ALAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPP
                     ENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVI
                     PVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEEDTTLRTAERIKQEYCYVCSDIV
                     KEFNKFDRDPQKFAQFIVENSEKTKRKVIDVGYERFLAPEIFFNPEIASSDFLTPLPT
                     VVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGT
                     KSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCHTKQDYEEIGPEIVRNFSLFNM
                     V"
     gene            complement(<226248..>227930)
                     /locus_tag="KLTH0C02530g"
                     /db_xref="GeneID:8291198"
     mRNA            complement(<226248..>227930)
                     /locus_tag="KLTH0C02530g"
                     /product="KLTH0C02530p"
                     /transcript_id="XM_002552292.1"
                     /db_xref="GeneID:8291198"
     CDS             complement(226248..227930)
                     /locus_tag="KLTH0C02530g"
                     /note="highly similar to uniprot|P40413 Saccharomyces
                     cerevisiae YJR064W CCT5 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="KLTH0C02530p"
                     /protein_id="XP_002552338.1"
                     /db_xref="GeneID:8291198"
                     /db_xref="GOA:C5DDN9"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012718"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DDN9"
                     /translation="MAQMQPQGMQMPDMSNAIVAQDEMGRPFIIVKDQGTKQRQHGLE
                     AKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKL
                     LVQLSKSQDDEVGDGTTGVVVLASALLDQALELIEKGIHPIKIANGFDEAAKVAVSHL
                     DSQADDIAHDSASFHDYLFKAAKTSLGSKIVSKDHDKFAQMAVDAVTSVMDLDRKDVD
                     FDLIKLEGRVGGALQDSKLIKGVVLDKDFSHPQMPKTVTAKEGHDGVKLAILTCPFEP
                     PKPKTKHKLDISTVEEYQKLQSYEQDKFKEMIEYVKNAGADVAICQWGFDDEANHLLL
                     QNGLPAVRWVGGQELELIAIATKGRIVPRFQDLSPEKLGTCGRIREVEFGTTKDRMLV
                     IEECSNSKTVTCFIRGSNKMIVDEAKRALHDSLCVVRNLVRDSRVVYGGGAAEVTMSV
                     AVSEEADKQHGIDQYAFRAFSQALDTIPMLLAENSGLDPIETLALLKSTQIKNKTSTT
                     GVDCLANDSNNMKELFVVDPLIGKKQQILLATQLCRMILKIDNVIISGKDEY"
     gene            complement(<228167..>228544)
                     /locus_tag="KLTH0C02552g"
                     /db_xref="GeneID:8291199"
     mRNA            complement(<228167..>228544)
                     /locus_tag="KLTH0C02552g"
                     /product="KLTH0C02552p"
                     /transcript_id="XM_002552293.1"
                     /db_xref="GeneID:8291199"
     CDS             complement(228167..228544)
                     /locus_tag="KLTH0C02552g"
                     /note="highly similar to uniprot|P32529 Saccharomyces
                     cerevisiae YJR063W RPA12 RNA polymerase I subunit A12.2
                     contains two zinc binding domains and the N terminal
                     domain is responsible for anchoring to the RNA pol I
                     complex"
                     /codon_start=1
                     /product="KLTH0C02552p"
                     /protein_id="XP_002552339.1"
                     /db_xref="GeneID:8291199"
                     /db_xref="GOA:C5DDP0"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:C5DDP0"
                     /translation="MSVVGSLIFCAECGNLLDNPSAVEGAQLECAQCGAEYAKAKFSN
                     LRVVTSTADDAFPSALRSKKSVVKTSLKKDELEEGATIREKCPQCGNDEMHYHTLQLR
                     SADEGATVFYTCTSCGYRFRTNN"
     gene            <230316..>233414
                     /locus_tag="KLTH0C02574g"
                     /db_xref="GeneID:8291200"
     mRNA            <230316..>233414
                     /locus_tag="KLTH0C02574g"
                     /product="KLTH0C02574p"
                     /transcript_id="XM_002552294.1"
                     /db_xref="GeneID:8291200"
     CDS             230316..233414
                     /locus_tag="KLTH0C02574g"
                     /note="weakly similar to uniprot|P40355 Saccharomyces
                     cerevisiae YJR061W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02574p"
                     /protein_id="XP_002552340.1"
                     /db_xref="GeneID:8291200"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:C5DDP1"
                     /translation="MRTQLGRNSRRLITLLLVTVLAEVVYIVVSVVLVEDGREAGIAG
                     LARGVSGGVGAGASRLERWLLGGSAAVFRADPNRMLPGLTSGSRVRLPDRDVEYVVRG
                     LRRSSDGDGDSGKASAAPSASDLVNFYRAWKFDTAVRYVLPCSAAQTLFGRLQRPVEN
                     LETLFIGAGEAAEGPAEPAVKAGGEAGDNHVTGDGAAAEGRNLQFPLRSYNYDPRLAT
                     AVYYDELLNHLEHQEVHDAESLFANLSVPFNWYDWTNSQLLNGFIDLPPAEKPACDMI
                     VRKYYPADKVLAFERRFGYKLFEEDRARGLGAAKFDSVSAFSHSTPRLPRPEELCDSD
                     QANALLPGFRMLKPLNFSRPELYGLQARATLMTTAEPPNSITFLNRNGSTLQVEVDAG
                     APLDSAGVPRGLLFNGLLRNYLRRNVPSYPEFPARDIEFDNIQKFKALKELVTKSLTR
                     PSTASAEPAEPTEPVQPTEMPYLIEMSNDEFEFDAKAKIRELEALETRTRHQQSYLES
                     LKFSINTHPMHLAKYFNEASSVSDYVHLGHHFDARFFRGGVEHTDMRARLDALVRAWL
                     NFVHSNGLNSWLSHGTMYGWLYDGLAFPWDGDHDMQMPIVHLNKLAEKFNQTLIVEDP
                     EVGNGRFFLDVTSSITSRIHGNNNNNIDARFIDVDSGLYVDITGLSVSSDGANKRFDP
                     LIKNFTTQNNISSLTHFKDPNLVEGITGLSYDEMVKAETKQYGNFTKQREHVLKSYFN
                     TVNSRQNGKDKESPDYRYNINKHIQVYNCRNNHYNHLSELSPLRLTFFHGAKAYVPNR
                     VIQILKNEYHAPSNYSYIEFQGRSFVPEFRLWIGKGGLERMAQGAGVPTRVDTDHLKN
                     LDFPETASLFQNAAVLADSEIEEFFSLATNTFHMSIFRQKELELTYDESRSPDQKVEA
                     LRGFVSNRAFTGGYKDPFQQRLETVVWYNLLDRSTISYKQLDRELKKAHLENSDKLLE
                     LNDLMIRREFDWAREAGYQYPPSDLDFNNLGSRFFAIGENSHNQIFDADPPELVQEWT
                     TI"
     gene            <233983..>235230
                     /locus_tag="KLTH0C02596g"
                     /db_xref="GeneID:8291201"
     mRNA            <233983..>235230
                     /locus_tag="KLTH0C02596g"
                     /product="KLTH0C02596p"
                     /transcript_id="XM_002552295.1"
                     /db_xref="GeneID:8291201"
     CDS             233983..235230
                     /locus_tag="KLTH0C02596g"
                     /note="similar to uniprot|P40354 Saccharomyces cerevisiae
                     YJR062C NTA1 Amidase removes the amide group from
                     N-terminal asparagine and glutamine residues to generate
                     proteins with N-terminal aspartate and glutamate residues
                     that are targets of ubiquitin-mediated degradation"
                     /codon_start=1
                     /product="KLTH0C02596p"
                     /protein_id="XP_002552341.1"
                     /db_xref="GeneID:8291201"
                     /db_xref="GOA:C5DDP2"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:C5DDP2"
                     /translation="MGLKRLTVNLRIAVVQLNPQIGHLEETVVRAHSLVRRVERYQPD
                     IVVFPEFALSGYSFHSRAEISAHLCRPQEGPAWEFCQQISRKLSCVTVMGYPERGDNQ
                     QAYNSALVVDEEGKLAFNYRKSFLYDTDEEWQCAENPAGFQAFELPLKGKARDHDGHV
                     HDVKLRSAIGICMDLSPYKFKAPFQECEFSTYQLEHGTELLIVPMAWLHASSVTRDTA
                     DPATGKAEIARTMDQLGLPLHGSQNQFQVNIKLRDGTCEEECPGNGTLTSAPSDAGVA
                     SSYSDLSRPDQQNLDYWTIRFMPFLACKWRENWFVEKALKPILAKFKGSRFTYLGSSL
                     KAPWLFENKNALLVLCNRCGAEDGATVYAGSSGFLKFNGQYGNEEEILNSSNRSVELL
                     GNLGKGYEGVIVRDVSFEIERDL"
     gene            complement(<235286..>237994)
                     /locus_tag="KLTH0C02618g"
                     /db_xref="GeneID:8291202"
     mRNA            complement(<235286..>237994)
                     /locus_tag="KLTH0C02618g"
                     /product="KLTH0C02618p"
                     /transcript_id="XM_002552296.1"
                     /db_xref="GeneID:8291202"
     CDS             complement(235286..237994)
                     /locus_tag="KLTH0C02618g"
                     /note="weakly similar to uniprot|P36044 Saccharomyces
                     cerevisiae YKL201C MNN4 Putative positive regulator of
                     mannosylphosphate transferase (Mnn6p) involved in
                     mannosylphosphorylation of N-linked oligosaccharides
                     expression increases in late-logarithmic and stationary
                     growth phases"
                     /codon_start=1
                     /product="KLTH0C02618p"
                     /protein_id="XP_002552342.1"
                     /db_xref="GeneID:8291202"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:C5DDP3"
                     /translation="MVRLHWVRRLSGLTKMRRRDVNVWAVCGVSVWLLISTWLVTSKQ
                     NLGGPFASWDPRKSWSTGWSTDNGTAAEKVDLVESYREFYYGTKFEYPDPYTLQKDLF
                     VVHVGPEKGRRLASVDELEFYDSDPRLVWSVVFEHLLQDRNGSGSLPFSWYDWADFRD
                     YNKLLSLKKTDVPCKFFFQKHFDSSKLAEIEIEIGEFLFELDRDYYFDAPSEDSSADV
                     QDRIADACVSNPRADAGARSTVVTALKDKVRPEVYRLQARNHLLNTVENPISITIMDK
                     DSGSWQFNVERIPRKNILESGLLDSYLQRKEVKNHDHVFDLSKQFAEFEKSKPARAHR
                     VNITEISEEERNAFHAPSTHIRKSDFEFDALTRIQELESKIDELTAHEKAYLNSLRVS
                     TQTHYAFAPKHFREPSDLSDFESLGWHHDARFFNGAVFQDFLDARTRLDSMIRTFQKF
                     LKAHGLICWLAHGTLYGYVYNGLSFPWDNDFDVQMPIRHLHIMAQHFNQTLVLEDPRE
                     GNGKFIIDVGSSITTRIKGNGMNNIDARFIDVDSGLYIDITGISVSSAMLSDRYAAEF
                     YKFRDSIGTEIKHADPNLIANETDIPLQVLANRMDSDAKYTEEDKKALEKLVTEANKE
                     MSSSKSPSKYYSAEQRYNLNYELDLYNCRNHHFLQYDMISPLILTRFHGVPALVPNQY
                     ITTLRKEYSVPSRYGFLAHKGNTYVPEFRYWCTSTVLKQAMNKKGTQEGIEVVNSPLN
                     SLSIEDVGLLYKNIAELREVELLSLLHNSRKQSTYRLKELELQYANGTAHQRIEELRR
                     LEEQLGSDLCPLTKDPYIQHLQREKWRALATPNDPSSEALSEVDLEVATDLLKWVELM
                     HSKQLPFLKKAVSGENPESRDYNQIDGIEGNFIFRLDPDLRTKEDD"
     gene            complement(<238703..>239491)
                     /locus_tag="KLTH0C02640g"
                     /db_xref="GeneID:8291203"
     mRNA            complement(<238703..>239491)
                     /locus_tag="KLTH0C02640g"
                     /product="KLTH0C02640p"
                     /transcript_id="XM_002552297.1"
                     /db_xref="GeneID:8291203"
     CDS             complement(238703..239491)
                     /locus_tag="KLTH0C02640g"
                     /note="some similarities with uniprot|P17106 Saccharomyces
                     cerevisiae YJR060W CBF1 Helix-loop-helix protein that
                     binds the motif CACRTG (R"
                     /codon_start=1
                     /product="KLTH0C02640p"
                     /protein_id="XP_002552343.1"
                     /db_xref="GeneID:8291203"
                     /db_xref="GOA:C5DDP4"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DDP4"
                     /translation="MAKRLLPNDVEVGNDELKRQRAEAAEQSNIDAELLKEKQDPASG
                     DEDVHRDEDEDDQDHDGTAAAAAVAAAAYGGFMGGQDDPNHELHHAHHAHHHHDVHDA
                     KVEDDEDDDDASLKDEDGKRSGRRGRKPAPVTGSAEWRQQRKDSHKEVERRRRENINT
                     AINKLSELLPVKESSKASILLRAAEYILKLKDTENANIEKWTLQKLLGEQQVSTLTKA
                     NESLQLELGNAFKQVDILKRQLRNAGIAVDPEIAKLEAEATRNE"
     gene            complement(<240347..>242674)
                     /locus_tag="KLTH0C02662g"
                     /db_xref="GeneID:8291204"
     mRNA            complement(<240347..>242674)
                     /locus_tag="KLTH0C02662g"
                     /product="KLTH0C02662p"
                     /transcript_id="XM_002552298.1"
                     /db_xref="GeneID:8291204"
     CDS             complement(240347..242674)
                     /locus_tag="KLTH0C02662g"
                     /note="weakly similar to uniprot|P47116 Saccharomyces
                     cerevisiae YJR059W PTK2 Putative serine/threonine protein
                     kinase involved in regulation of ion transport across
                     plasma membrane enhances spermine uptake"
                     /codon_start=1
                     /product="KLTH0C02662p"
                     /protein_id="XP_002552344.1"
                     /db_xref="GeneID:8291204"
                     /db_xref="GOA:C5DDP5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DDP5"
                     /translation="MASTKSAESGGSSHVVNSVVPSNMKETSAPSSEVSRRDTDIEKK
                     SKAAAELPPRSQREQHAKDLRGLNRSSSVRAMSSLRKIFHRSQSHHEPDGRSRAPVKA
                     GTGMGMLHGAFESEQKSRSRSSSLLHRKNQHAILPQQNHVPNHLIQSSSNPALSSAVS
                     HNVNPFIAHRNPGFESPFSALGKGTDIAAPRKSNTHGSNPISRKTSSNESNMVYNPYG
                     TLSKNNTSSSQHGLSFYLQDGKEELPLLPTPLKDPNEYLPEGYRQYSVQLADNFCYPE
                     RNTADDMNLGSGGSSEVRTVRSLFHKKDLYALKKFKLLRNEEPEHFYKRCSKEFILAK
                     RLSKNPHIANTFYLVKVSTTTFMTRGWAFVMEYCSGGDLYSLISRPTWKKRPLKEKFD
                     YWRQVVEGIKFVHSQGIVHRDLKPENVLIDKEGTAKITDFGISDWGHEDPDDLNSPVS
                     LFENYVGSPPYSPPEVMAFNDDNATKQDKKPYDAHKMDCWALGMLLFVLVYQCSPFLD
                     AYKTDSKFRSYVLSYNNYVDHINPQFRKPGNHRPGPGSEFQFGREFQSGGASRVAWRL
                     ADPDAKTRYTMQDLLEDPWWASISAGVHENPHAVPKAPELRHSSYESNGGFSPAANTS
                     AKASEEELAHTSNPFLSKTKNKSKSMLSIAETPAPPLVQAQAESLPTLSEEKANEDNA
                     AAPSQEHEGATIPLQDNSNANTLPQENDNLTALPQEHSSATVLPQEQAEIPAKPNGGL
                     HGDKVAELDKEVHENEDSSTKKDIWADAREKEEET"
     gene            complement(<242904..>245963)
                     /locus_tag="KLTH0C02684g"
                     /db_xref="GeneID:8291205"
     mRNA            complement(<242904..>245963)
                     /locus_tag="KLTH0C02684g"
                     /product="KLTH0C02684p"
                     /transcript_id="XM_002552299.1"
                     /db_xref="GeneID:8291205"
     CDS             complement(242904..245963)
                     /locus_tag="KLTH0C02684g"
                     /note="similar to uniprot|P24004 Saccharomyces cerevisiae
                     YKL197C PEX1 AAA-family ATPase peroxin required for
                     peroxisome biogenesis contains two 230 amino acid
                     ATP-binding AAA cassettes upregulated in anaerobiosis
                     Pex1p and Pex6p interact via their N-terminal
                     AAA-cassettes"
                     /codon_start=1
                     /product="KLTH0C02684p"
                     /protein_id="XP_002552345.1"
                     /db_xref="GeneID:8291205"
                     /db_xref="GOA:C5DDP6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:C5DDP6"
                     /translation="MTSGSGELKFQSIKLALYDGIRSNFVRLPSSIVQVLENSPIPVH
                     EYGIEISGEKYEFSVGWDGFESSQGLNGQAAIQINPVLAATYGVRDGNVVDLTIKHFG
                     ENLVAKEVYIEPQTSDDWEVVERNARFLQDDILHQTRIVAKNSILICYVERTIAKFKI
                     QRLVPETLDIARLGTDTLVVISPMLNKSRIPNGKPKNHLEAFVTHSPHILRSICWDED
                     LKGYSVGVSPGDIKSPLAFVSIVRNPLEGKVQEDRPSDDTAIECAQRIAVKVVVIEHL
                     ESSQAVVSDLAWESLGVRKKNGEKVKIEYISNHVAAATPTVFIHPVDRSQDASDVVLN
                     GENSYFDESFSEQIKTMFSGCVLTDKAYLPSKLAYFELVSEHGKHVQFCEWNENKMGI
                     KILDSAVRISRREPEQEAPKIHKEPLGFEKLIEDMAAYLTLPFVPSGTTLVTGSSGVG
                     KTLLVKELENHLKNSTSLHVSYVDCESLIESTNFAKMKQLLHRLISCCYWHGPSLLIL
                     DNSELLFPSTKSEEEQPTRNASSDASSKLSQLFAAEIERVASKDSRMVRVLLTAKNRD
                     QLNQLLFSRHTISKTWPLTPPNKDQRRIFFENFVAEKSLQLSDDLDESMMAIETEGYS
                     PQDILLFCDKLLFEHLCDQDDIGAGLTRKTFERSIATFTPSSHRGIKLQKNSGVKWTS
                     VGAMHKAKNMLLETLEWPTKYAPIFSECPLRLRSGILLYGYPGCGKTMLASAVAQQCG
                     LNFISIKGPEILNKYIGASEQNIREIFERAQAAKPCILFFDEFDSIAPKRGHDSIGVT
                     DRVVNQMLTQMDGAEGLEGVYVLAATSRPDLIDSALLRPGRLDKSILCGLPDERERLE
                     ILEAVVSSGNMELEPDCHLSSAAAATDGMSGADLQGLCYNAYLKAVHRSMASAPLKEE
                     KQTATRPSFEYFTLDETKGLPVEFLDRLQQKSANSDKPEDERAASGAPKISIQDLLEA
                     SSETKPSISSSELQKLSAIYNTFSQDRDANMPAGEASNQIGGRLTLM"
     gene            <246120..>246563
                     /locus_tag="KLTH0C02706g"
                     /db_xref="GeneID:8291206"
     mRNA            <246120..>246563
                     /locus_tag="KLTH0C02706g"
                     /product="KLTH0C02706p"
                     /transcript_id="XM_002552300.1"
                     /db_xref="GeneID:8291206"
     CDS             246120..246563
                     /locus_tag="KLTH0C02706g"
                     /note="highly similar to uniprot|Q00381 Saccharomyces
                     cerevisiae YJR058C APS2 Small subunit of the
                     clathrin-associated adaptor complex AP-2 which is involved
                     in protein sorting at the plasma membrane related to the
                     sigma subunit of the mammalian plasma membrane
                     clathrin-associated protein (AP-2) complex"
                     /codon_start=1
                     /product="KLTH0C02706p"
                     /protein_id="XP_002552346.1"
                     /db_xref="GeneID:8291206"
                     /db_xref="GOA:C5DDP7"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:C5DDP7"
                     /translation="MSIKFVICLNKQGALRLIRLFEPFSGDANSSQSTIAQIYKLISS
                     RDHRHQSNFVEFSDSTKLVYKRYAGLYFVMGVGLQDEELIYLSHIHLLVEVLDAFFGN
                     VCELDIVFNFHKAYMILDELIIGGEIQETCKDVILERVNYLDRLS"
     gene            complement(<246560..>247204)
                     /locus_tag="KLTH0C02728g"
                     /db_xref="GeneID:8291207"
     mRNA            complement(<246560..>247204)
                     /locus_tag="KLTH0C02728g"
                     /product="KLTH0C02728p"
                     /transcript_id="XM_002552301.1"
                     /db_xref="GeneID:8291207"
     CDS             complement(246560..247204)
                     /locus_tag="KLTH0C02728g"
                     /note="similar to uniprot|P00572 Saccharomyces cerevisiae
                     YJR057W CDC8 Thymidylate and uridylate kinase functions in
                     de novo biosynthesis of pyrimidine deoxyribonucleotides
                     converts dTMP to dTDP and dUMP to dUTP essential for
                     mitotic and meiotic DNA replication homologous to S. pombe
                     Tmp1p"
                     /codon_start=1
                     /product="KLTH0C02728p"
                     /protein_id="XP_002552347.1"
                     /db_xref="GeneID:8291207"
                     /db_xref="GOA:C5DDP8"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDP8"
                     /translation="MGRGKLILIEGLDRTGKSTQAGKLTERLGPDSQLIKFPDRSTKI
                     GGLINQYLTDPSFLLPDQAIHLLFSANRWEVAEEIKALLLEGRNVVLDRYVYSGVAYS
                     AAKGVPGMDLRWCLQSDVGLLKPDLTLFLTNQGSELRQGFGDERYENSAFQQKVREQF
                     STFFNDFEDPDYSQAHIKVLETSGKSIEQVHDMVWSTTSAFMQEYADIQDFMYF"
     gene            247749..247837
                     /locus_tag="KLTH0C02750r"
                     /db_xref="GeneID:8291208"
     tRNA            join(247749..247787,247802..247837)
                     /locus_tag="KLTH0C02750r"
                     /product="tRNA-Tyr"
                     /note="tRNA-Tyr (GTA) cove"
                     /db_xref="GeneID:8291208"
     gene            complement(<248009..>248497)
                     /locus_tag="KLTH0C02772g"
                     /db_xref="GeneID:8291209"
     mRNA            complement(<248009..>248497)
                     /locus_tag="KLTH0C02772g"
                     /product="KLTH0C02772p"
                     /transcript_id="XM_002552302.1"
                     /db_xref="GeneID:8291209"
     CDS             complement(248009..248497)
                     /locus_tag="KLTH0C02772g"
                     /note="some similarities with uniprot|P50263 Saccharomyces
                     cerevisiae YMR175W"
                     /codon_start=1
                     /product="KLTH0C02772p"
                     /protein_id="XP_002552348.1"
                     /db_xref="GeneID:8291209"
                     /db_xref="UniProtKB/TrEMBL:C5DDP9"
                     /translation="MVPQFGTGFNGDLGNTLKRDLQHGSDGPQQPTRKRLKASMGSFP
                     GRAAPAENTREAPPLIDDAVCAIAMSARQNSSDSATSSPYVEIEDYILEGYGSALING
                     SYNSRLSLDNITAVNYCLYDKDLEEFDDSDNGTSDGKTLVETPESQDVDMDMDMDMNM
                     DR"
     gene            <248746..>249234
                     /locus_tag="KLTH0C02794g"
                     /db_xref="GeneID:8291210"
     mRNA            <248746..>249234
                     /locus_tag="KLTH0C02794g"
                     /product="KLTH0C02794p"
                     /transcript_id="XM_002552303.1"
                     /db_xref="GeneID:8291210"
     CDS             248746..249234
                     /locus_tag="KLTH0C02794g"
                     /note="some similarities with uniprot|P47115 Saccharomyces
                     cerevisiae YJR056C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02794p"
                     /protein_id="XP_002552349.1"
                     /db_xref="GeneID:8291210"
                     /db_xref="InterPro:IPR029196"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ0"
                     /translation="MDRLNSLEKSLPPERPATDQAIDKLNQQVTQEFKIAANAVTSLY
                     RLSSERSSLSRHAGYAECLDDVLQQLESGRTAEELRQWCENRKHEIRGSAAAKTDSSA
                     PTVVARTPAAPGTPASGVAAPLGSFASRDRRAKPNRASVAQADPERKIKKPRNWSNRS
                     EP"
     gene            <250258..>251133
                     /locus_tag="KLTH0C02816g"
                     /db_xref="GeneID:8291211"
     mRNA            <250258..>251133
                     /locus_tag="KLTH0C02816g"
                     /product="KLTH0C02816p"
                     /transcript_id="XM_002552304.1"
                     /db_xref="GeneID:8291211"
     CDS             250258..251133
                     /locus_tag="KLTH0C02816g"
                     /note="similar to uniprot|P54003 Saccharomyces cerevisiae
                     YML052W SUR7 Multicopy suppressor of rvs167 mutation
                     putative integral membrane protein"
                     /codon_start=1
                     /product="KLTH0C02816p"
                     /protein_id="XP_002552350.1"
                     /db_xref="GeneID:8291211"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ1"
                     /translation="MALLSVANRTVTLLFLAGNTLLLILIILSGATTSFPVKRFYWLQ
                     ADTSGLGSAPSVSRWTFWGLCDYTNGNLSCNDLSPAYPISPKDNFGTTTNIPSDFISD
                     RNTYYYLTRFSFCFFWVALAFIGVAFLLYVISWCSYSFTKVVFILSTVGALFDIAAVC
                     LQTAASVMARNAFKDGDRDAKISATLFGIAWASVACSLYIFFGTGAAFIRRAYQSHKE
                     YVEMQKYKEQALMYQGKQQATSEIPDAESYGINEDLEHNRATVAPETQPEAHHSGIKF
                     FKIRRTQKAGDQESL"
     gene            <251842..>253116
                     /locus_tag="KLTH0C02838g"
                     /db_xref="GeneID:8291212"
     mRNA            <251842..>253116
                     /locus_tag="KLTH0C02838g"
                     /product="KLTH0C02838p"
                     /transcript_id="XM_002552305.1"
                     /db_xref="GeneID:8291212"
     CDS             251842..253116
                     /locus_tag="KLTH0C02838g"
                     /note="similar to uniprot|P04387 Saccharomyces cerevisiae
                     YML051W GAL80 Transcriptional regulator involved in the
                     repression of GAL genes in the absence of galactose
                     inhibits transcriptional activation by Gal4p inhibition
                     relieved by Gal3p or Gal1p binding"
                     /codon_start=1
                     /product="KLTH0C02838p"
                     /protein_id="XP_002552351.1"
                     /db_xref="GeneID:8291212"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ2"
                     /translation="MNNNKRSYVSTVPKANPLRVGFIGLSAYKGWAIKSHYPAILQLP
                     SQFQVTALLNLDIETSLATIKKLKLTKATAFSDVSSFASYDNVDMVVISVNVPELFTI
                     VMELLENSKANPNLKYIYSEWSLGKNLKEAEAIHKAAKERGVQTIISLQGRKSPYVVR
                     AKELVSEGCIGDINSIEIAANGGWYGYERPIKSPKYLYDAASGVSLLSIAFGHTIDIL
                     QYITASYFSEINAMIFNNIPYQVLLDEHGKKTGEKAEKTAPDHLLFQGSLSHGNVPVS
                     CSFKGGTPVKKFSKNLVIDIHGTKGDLKLEGDAGFAEMSNLVLYFCGLKKEGSMNVST
                     GSSGAETMEVYHLRNYNSVVGNILRIYEAIADFHFRTNPRTKLPPKLERQGFLFEGFP
                     TFKDALIVHQLIQRVIESSQQKTTLPTSFEAV"
     gene            complement(<253127..>253594)
                     /locus_tag="KLTH0C02860g"
                     /db_xref="GeneID:8291213"
     mRNA            complement(<253127..>253594)
                     /locus_tag="KLTH0C02860g"
                     /product="KLTH0C02860p"
                     /transcript_id="XM_002552306.1"
                     /db_xref="GeneID:8291213"
     CDS             complement(253127..253594)
                     /locus_tag="KLTH0C02860g"
                     /note="similar to uniprot|P46973 Saccharomyces cerevisiae
                     YJR055W HIT1 Protein of unknown function required for
                     growth at high temperature"
                     /codon_start=1
                     /product="KLTH0C02860p"
                     /protein_id="XP_002552352.1"
                     /db_xref="GeneID:8291213"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ3"
                     /translation="MSAKCEICNQEPSKYKCPKCAVRYCSLSCFKDQEKHVHSEKEAE
                     EKKHVSDSEGPEAKSDTGRLPTEQFDELYQNTKEIQELLSYNTVKFHLAKVYRILNIG
                     VGALGSSDTQTSAEVKQQLAVDYLNTLRYGGVHYNEAIEEFCQVSLAKLSNES"
     gene            <253835..>254833
                     /locus_tag="KLTH0C02882g"
                     /db_xref="GeneID:8291214"
     mRNA            <253835..>254833
                     /locus_tag="KLTH0C02882g"
                     /product="KLTH0C02882p"
                     /transcript_id="XM_002552307.1"
                     /db_xref="GeneID:8291214"
     CDS             253835..254833
                     /locus_tag="KLTH0C02882g"
                     /note="similar to uniprot|Q04689 Saccharomyces cerevisiae
                     YML050W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C02882p"
                     /protein_id="XP_002552353.1"
                     /db_xref="GeneID:8291214"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /translation="MFRVRAPWLKTLVELRQGTTQRRALHSKYRHVGFGASAQLQQSC
                     ECFIQKLNRELPRDAQLDASIDLPKKTPSYHKHLMLISPPDEAGKDPEWKGSWQAKLE
                     LNPEWPYSAIAEVKKHLKETKRGEGILINAISVMRSKSLGDPSSEKKARFLALPDMKV
                     YEVSQSELKDFAYFVGEGMVQQPRGRAVAFADYLKGADAISKELEHREVASTAAAGMK
                     QFAAQSYQNNLVLVCGHHQRDERCGQIAPRLIKEFEAKVEEDLDLAIVSHIGGHKFAG
                     NVIFYKFLGFEADGKATVDSLWFGKILPSAVPTLLEHLGRNEIITPWFRGGCLLES"
     gene            complement(<254875..>258741)
                     /locus_tag="KLTH0C02904g"
                     /db_xref="GeneID:8291215"
     mRNA            complement(<254875..>258741)
                     /locus_tag="KLTH0C02904g"
                     /product="KLTH0C02904p"
                     /transcript_id="XM_002552308.1"
                     /db_xref="GeneID:8291215"
     CDS             complement(254875..258741)
                     /locus_tag="KLTH0C02904g"
                     /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
                     YML049C RSE1 RNA splicing and ER to Golgi transport
                     involved in secretion and RNA splicing"
                     /codon_start=1
                     /product="KLTH0C02904p"
                     /protein_id="XP_002552354.1"
                     /db_xref="GeneID:8291215"
                     /db_xref="GOA:C5DDQ5"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ5"
                     /translation="MIVDSADPVLYHLTLQRQSNFVHSCVGHFVDYKHHQLVRARDAG
                     KRRKGRRDYQVCAATETHIELYDVEDGSLKRLVSIPFFATITAMQSLPIDSSYSFVVL
                     LTDAGNLSVLQFVYNSGCFRLHTLLNEPFARSGIRRLSPQKHLSVDLHGRCIFLSATE
                     RNKLCFLTDFKDNALSISSPLVLNKPNSITLSTAVCDVAFDNPVFASLEIDMSDGSKS
                     LIFYVLDLGLNHVVQRSEHELPRDANFVISVPNLEKYGISTKGPEGSQDGDDLVNPFV
                     LIGLQDRLLLKDSHGLYSLEVQLPTRENEASPTIIITATLHKLKKEFFILLQTNTGDL
                     FKVKIIPNETTRSSPKLTVTFFDTIPCSSGLHIFRNGLMLALGEFVALSLYEFEGLGN
                     DEDFSSILTSDDPQRKLKLRPVEELQNLSLLDQFRGSNPVLSQKVVGTTPLTILSQQK
                     NTLETLTTGVNFSELISSPLPPNPDNVWTIKLPSELGHRLVFLSLPKATMVLKIEDGS
                     LEELENASESFKTENDRTIFVGLMGESSIIQVCENSLSQIALAKKPPVLNSKLEWLPP
                     AGIKIVEATCSSTQLALGLSNNEIVWFELDTSNGGEVLNEYQDRVEMPDKITALSLPQ
                     TFKSDFLAVGCQDSSVKIIGLKSTSRDSFLEVLSMQVVLSPPSDLKLVYSKGLLFLHL
                     GLDAGVYIRSNIDKTDGQLFDIRTKYLGSKPVKVSVLSEIELKASLEEAGEGESDEDE
                     SESEDEGTNQPKGVEGSSCAVLHSDKTWLSYNTANLMLVRPLIINGKQSLSSVAMFRT
                     NDIKTNGCCAVSTSGSLLIGRFDKFTTEDKWFQQKRIEKTDEESDKSGEGVSLSGHQP
                     FQGRRIVADKFDRKTYFVIENNHKNSSCRISVYRSGKLLNFGTDEAFISITDCVCLDA
                     QSVRFGGDESHLVMSTSNGKLKTFVVNIEKTTKGRRYNLTFLHDTAVEEKVYSMIAFK
                     DKLLISLFGNLVLYGLGRSQLLKKTITPMPPSVTKVTSIAQWEDSRVAVGDIHESVTL
                     FLYDKRADRFISIADDITKRHVTALEFLDRSTVVGGDRFGNIWVLRLPSIHERLVSDE
                     FPFFLSKFHNNVNNSIAKNIMECPFKWDLVNHFYANDIPVSLNVVKNMHSSDKVSILY
                     LGLQGSVGCLLPLATKKEAEFLEKLQGGLSEADEAFYMDFEAQKASEESEHTDDWSMD
                     YNQGTKLKHKSPRPIVEGAFSLVGRDHTVYRSYYAPVRKVIDGDLCEQFYQLYPSEQE
                     FLTKKLGFKDVAFVKSRLAEFRANHV"
     gene            <259431..>260588
                     /locus_tag="KLTH0C02926g"
                     /db_xref="GeneID:8291216"
     mRNA            <259431..>260588
                     /locus_tag="KLTH0C02926g"
                     /product="KLTH0C02926p"
                     /transcript_id="XM_002552309.1"
                     /db_xref="GeneID:8291216"
     CDS             259431..260588
                     /locus_tag="KLTH0C02926g"
                     /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
                     YML048W GSF2 ER localized integral membrane protein that
                     may promote secretion of certain hexose transporters
                     including Gal2p involved in glucose-dependent repression"
                     /codon_start=1
                     /product="KLTH0C02926p"
                     /protein_id="XP_002552355.1"
                     /db_xref="GeneID:8291216"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ6"
                     /translation="MEICVRINDDCENDYTFQVSKEDTFESKIMKVFDKNEGLSRFMV
                     LRPSIFYKKQPTGLSKSMHPGFLTENGCLLFHYDADERKYREPLELKNKKIWEQMWPG
                     QLVLPEWELSYRNIAVFAAILLGWLYTDLPDVISPTPGICFTNQLSKRIMVVARWYGY
                     NAIADKLAEEVQVNSAGVVAQWLFFALHFVKVIFVALVFYSGLVNPVSFNFLDFYSTR
                     KVVITKNADKLKETLRSVGWIGAKRATYDEYRDTYYNYRLEKAGGLVPAYKSGIMQVA
                     ANPGVNLEKGEGFQTPLDKRFTESTFKTMEKSRKFVLSEEYLIQLEKDLKEVIKKCEG
                     DVPAINQQIRKFRRLGLFESGPELTRLVELRKEVAPEPETGAADADAKKTQ"
     gene            complement(261889..261960)
                     /locus_tag="KLTH0C02948r"
                     /db_xref="GeneID:8291217"
     tRNA            complement(261889..261960)
                     /locus_tag="KLTH0C02948r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (CCT) cove score=69.32"
                     /db_xref="GeneID:8291217"
     gene            complement(<262224..>263774)
                     /locus_tag="KLTH0C02970g"
                     /db_xref="GeneID:8291218"
     mRNA            complement(<262224..>263774)
                     /locus_tag="KLTH0C02970g"
                     /product="KLTH0C02970p"
                     /transcript_id="XM_002552310.1"
                     /db_xref="GeneID:8291218"
     CDS             complement(262224..263774)
                     /locus_tag="KLTH0C02970g"
                     /note="some similarities with uniprot|P47114 Saccharomyces
                     cerevisiae YJR054W Vacuolar protein of unknown function
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0C02970p"
                     /protein_id="XP_002552356.1"
                     /db_xref="GeneID:8291218"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ7"
                     /translation="MFRNDWKLSINSKTFDALDCSLFRNFKFMTVVNYAFFVLFLTAM
                     KIALFISDVYTCIKLLAFNSWSNNVVPPYIPFRISKWLFSGCILASIVLIAWEIINGI
                     RIYRTRNISLTYVNNFSRGAYSLSQYNKFCVYNRISPSGAYQKIAFFTFFELKDCLRL
                     LVADTPRQVINGLTLWSVVVTVDQSSDLGRVESFSGLVAKIKTIAQTNHEEAVLLSFM
                     LFSFVIWAFFITKFVAACLCSIYVYYRIFNERNASGLKEYVCVTVSEHIDYLVDKYQR
                     RKQFNMVNQSHGLSSSSLLQTDDLEAGPWKSAAHTNVESLELEDRSESRVNSSTANLL
                     AKEFAAPVAPRLNKWASVDSLPTIGTADPVQAASPIANMHQTAPQKRTAFDPIARSET
                     FESSRPVKENPFAPRLINANTFNSVKTSNTVPSYYFDRDASPETPGAPEASRDEPDPA
                     QRRQRPPPPAPGKVNTPEQAYFGEFAASSDSLAQRNASVLARRDRIEREDYEFYTQSR
                     HASGGARP"
     gene            complement(<264520..>266127)
                     /locus_tag="KLTH0C02992g"
                     /db_xref="GeneID:8291219"
     mRNA            complement(<264520..>266127)
                     /locus_tag="KLTH0C02992g"
                     /product="KLTH0C02992p"
                     /transcript_id="XM_002552311.1"
                     /db_xref="GeneID:8291219"
     CDS             complement(264520..266127)
                     /locus_tag="KLTH0C02992g"
                     /note="similar to uniprot|P47113 Saccharomyces cerevisiae
                     YJR053W BFA1 Component of the GTPase-activating
                     Bfa1p-Bub2p complex involved in multiple cell cycle
                     checkpoint pathways that control exit from mitosis"
                     /codon_start=1
                     /product="KLTH0C02992p"
                     /protein_id="XP_002552357.1"
                     /db_xref="GeneID:8291219"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ8"
                     /translation="MSIRPVNIDEFTETSFEDIEASVSPTNWKKRSQQSSPLRDVAAA
                     PSTASSESTTFSNDKKRYSTHTESDEDGGAFLDDFEEFHGKASRGEIVKSHFENVNLE
                     PTFRPSTEAQESEGDDELQELTRRFGNKFDIKSRHLSGAQRPRSAFKTFKQPQSMMDL
                     RESTTRPSSRSSHELTNSKSATNLRSGSRLGPRGIQYKKSVPALSKYDMIREEDEQDN
                     YNDEFEDELKFEKSLLQPQFLPKEDEGSLLDLSPSQYTITADDSILTPQLHKRHRDWV
                     RPSQLEMFREPLRHEKPAVKHRDSRKLSVSHRLKTIKQEIDHNTPMKKGRMVYNPETL
                     KWEGNEQALAKFRDVDSFDKKALVIQGRPDLQPPRERSSSTRSGTRKHGKVVGRMMFD
                     QDNLRWIRLDGDEKDPFAEIPDYIPPVSFSEPSLKKKLPTKRSQSQFAPSRDQCGGRY
                     PSSATTRYHSLNTPSSSSDPTFNIDSKSLERFYHEENKWSKKVGGWFILRDAEAEGYG
                     ADQELPDPKNNSYMYEIRNMVMSSARN"
     gene            <266161..>268185
                     /locus_tag="KLTH0C03014g"
                     /db_xref="GeneID:8291220"
     mRNA            <266161..>268185
                     /locus_tag="KLTH0C03014g"
                     /product="KLTH0C03014p"
                     /transcript_id="XM_002552312.1"
                     /db_xref="GeneID:8291220"
     CDS             266161..268185
                     /locus_tag="KLTH0C03014g"
                     /note="similar to uniprot|P39682 Saccharomyces cerevisiae
                     YML046W PRP39 U1 snRNP protein involved in splicing
                     contains multiple tetriatricopeptide repeats"
                     /codon_start=1
                     /product="KLTH0C03014p"
                     /protein_id="XP_002552358.1"
                     /db_xref="GeneID:8291220"
                     /db_xref="GOA:C5DDQ9"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:C5DDQ9"
                     /translation="MFYLFTLSGIYDHFLFTTCNDFYLQTSISRKDNRREAQPMDLRT
                     SMDEALDTKTGPKGEEVPESIFEGLEVGFLKDNEQWVSKVKALNWDDVASLEEMVKAT
                     EQLVLKYSNPNQHIKHSIKKVFEKVLGRYPLLFGYWKRFTAVQYQLNGLQSSIDVLSQ
                     AVDAFPNSLELWCDYLSVLLANNPDQVDQIRVNFLIAKDLVGLQFLSHPFWDKFIEFE
                     SRHQQWKNVLAIYREVSKIPLHQYSKYYTAYKQLAERTDTGIRIEEDIDQVFANTQKL
                     VNEVWTYESQIAQSFFNIGPVRQKELDNWDQYLEFVINSEHFHASLVKSTFMRCLVPC
                     RNYEHFWLRFTKWMEENSSLEECLDVYQKGVNAISQEMRTLRQQFLDYMKLRLKDDED
                     KVLELYLLTLSEFSRIYQQDASFMVEFLAAVRRTSFSSDLSQTDQEILRQQTSYASYL
                     EKNVRCYTNQTPDGDVKLQGILNDKNLSVAVVELIKVTHLNLRNVSQSRKYFKEFESL
                     PQIRNSTAFWLLYYKILKVSVELNELERFVARLGTEIFLPTLVVNDILDDFKSFFLTN
                     VNYPDYEHEVYKGRYTSGIDPLTDLYFKVNNPLWTKQKSTDRQRNEIKDNGHIGLYLE
                     KPEISNTIIESHSKSFSNGPPSLPTFKNLDKANKQASFKDFLSTDYTNVV"
     gene            complement(<268209..>270011)
                     /locus_tag="KLTH0C03036g"
                     /db_xref="GeneID:8291221"
     mRNA            complement(<268209..>270011)
                     /locus_tag="KLTH0C03036g"
                     /product="KLTH0C03036p"
                     /transcript_id="XM_002552313.1"
                     /db_xref="GeneID:8291221"
     CDS             complement(268209..270011)
                     /locus_tag="KLTH0C03036g"
                     /note="similar to uniprot|P06779 Saccharomyces cerevisiae
                     YJR052W RAD7 Protein that recognizes and binds damaged DNA
                     in an ATP-dependent manner (with Rad16p) during nucleotide
                     excision repair subunit of Nucleotide Excision Repair
                     Factor 4 (NEF4)"
                     /codon_start=1
                     /product="KLTH0C03036p"
                     /protein_id="XP_002552359.1"
                     /db_xref="GeneID:8291221"
                     /db_xref="UniProtKB/TrEMBL:C5DDR0"
                     /translation="MYRGRNRSKTNKDADDGSVRGPNSALTQFLKEQGISAESIRQRW
                     LKSREKEGGSETDGVKKEGSEEDERSLSASTRPKSEESGTESGDEYDRSDEENEEDND
                     DDADETESQEITRSRLKANGSPRENRLKRFAAESEDSDEEEYDEGMSSRTISETPVPL
                     QQEDHALKIKKSKQQLQQRRRKKKRAAELLDRKTRRISTLQDICISQISANISKLQKE
                     TSSSDETLSQQIRQTLGGISTENMNKLARTLSKNRALNDHTLQLFLRTDLESLTFHDC
                     SKVSYEGYKLLAIFAPHLSELSLQMCGQLNNEALLYIAQKLPNLNALYLDGPFLINES
                     TWDEFFSLMKNRLKAFHVSNTHRFTDHSLRNLLENCGESLVSLRLSRLDAVFDYSLVS
                     QYLRNPNFEHLSLEYPNKEELVSDDIVIDALKQVGPTLKHLSLNGCFALTDATFISAK
                     DALSSENSHSSMLENLQLEELDQITTDGMVYFFSNIQMPNLKNCSLRRCFQLQDMAVS
                     ELFLNEASKSLTDLSLNSLKDVKGECFEAMECPKLKRLDVGFMGCVNDKLVKNLGERN
                     PDLEILEVFGDNLVSRNAVIRPGLTVIGRQSDTL"
     gene            complement(270149..270219)
                     /locus_tag="KLTH0C03058r"
                     /db_xref="GeneID:8291222"
     tRNA            complement(270149..270219)
                     /locus_tag="KLTH0C03058r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=56.01"
                     /db_xref="GeneID:8291222"
     gene            270870..270940
                     /locus_tag="KLTH0C03080r"
                     /db_xref="GeneID:8291223"
     tRNA            270870..270940
                     /locus_tag="KLTH0C03080r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (CCC) cove score=65.85"
                     /db_xref="GeneID:8291223"
     gene            <271196..>272773
                     /locus_tag="KLTH0C03102g"
                     /db_xref="GeneID:8291224"
     mRNA            <271196..>272773
                     /locus_tag="KLTH0C03102g"
                     /product="KLTH0C03102p"
                     /transcript_id="XM_002552314.1"
                     /db_xref="GeneID:8291224"
     CDS             271196..272773
                     /locus_tag="KLTH0C03102g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C03102p"
                     /protein_id="XP_002552360.1"
                     /db_xref="GeneID:8291224"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DDR1"
                     /translation="MLEPAVDKTGSTAYHLVVLVHGLWGNRSHLEYISNALKTEFDSR
                     NRSNSGEQLFVYTAHLNEGYKTYDGIDVCGVRVASEIEEQISALGSVTKFSICGYSLG
                     GLISRYALGVLYKRQVFKKRDIKLVNFTTFCTPHVGVYAPGKNAAVKLFNAVVPLVLG
                     NSGKQMFLKDKSKLAGGLPLVLAMSMENSVFYKALQEFESKSLYANVINDKRTAWWTS
                     GISRNDPFFDIDENNGHHRFCYVSGYGPIVVDHTKPVKISRIEDFNERAEEKARPRQS
                     GENMKVDKQEYFFLNYWIAKLGRWLMVLINLLLIAPLWALWFVISGTTETIKSTIRVT
                     KFVKGYSHQFIQEIYDIPSSPDHEDDMIETLPDTPGEYELQFQQSLQDQTDTFIESVL
                     SAIERKNTLSAVVDEAEPCDEKNMSDEGDTGKDFSMRTTLKELELYSVEAIKARHSRS
                     ASNEKLPSLENLHLELGPAQLQIIDSLNKIPWSKFPVYIRNTPSTHACAIVRHGDPKF
                     GEGKVIVKHWVSEVFSF"
     gene            complement(<272830..>273255)
                     /locus_tag="KLTH0C03124g"
                     /db_xref="GeneID:8291225"
     mRNA            complement(<272830..>273255)
                     /locus_tag="KLTH0C03124g"
                     /product="KLTH0C03124p"
                     /transcript_id="XM_002552315.1"
                     /db_xref="GeneID:8291225"
     CDS             complement(272830..273255)
                     /locus_tag="KLTH0C03124g"
                     /note="similar to uniprot|P32613 Saccharomyces cerevisiae
                     YEL048C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C03124p"
                     /protein_id="XP_002552361.1"
                     /db_xref="GeneID:8291225"
                     /db_xref="GOA:C5DDR2"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:C5DDR2"
                     /translation="MTEVKPCFISLIDDGDRPLLIHVVEGANDEIDNVLKFNSFSNMA
                     LDYLESDLFEWMSSNQESRDIKNLFQLEGVSVYGKLIKQTSLKIVIGFSSNLDCKDEL
                     ILHYFNEVSKLYVKCKFNPFVTSNDELKEQLHKRFAERF"
     gene            complement(<273504..>275009)
                     /locus_tag="KLTH0C03146g"
                     /db_xref="GeneID:8291226"
     mRNA            complement(<273504..>275009)
                     /locus_tag="KLTH0C03146g"
                     /product="KLTH0C03146p"
                     /transcript_id="XM_002552316.1"
                     /db_xref="GeneID:8291226"
     CDS             complement(273504..275009)
                     /locus_tag="KLTH0C03146g"
                     /note="similar to uniprot|P32614 Saccharomyces cerevisiae
                     YEL047C Fumurate ReDuctase Soluble"
                     /codon_start=1
                     /product="KLTH0C03146p"
                     /protein_id="XP_002552362.1"
                     /db_xref="GeneID:8291226"
                     /db_xref="GOA:C5DDR3"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:C5DDR3"
                     /translation="MLTTRRLLVGLFGVFVVLLLRSSNNSNSNNQLPDMSSKFSTPVV
                     IIGSGLAGLSTANQLVLKHKVPIVLLDKASSLGGNSIKASSGINGAFTSTQKKLAVED
                     SAAAFYQDTVSSAKSAGVPSLMSKLAKDSASAISWLQAEFGLKLDLLAQLGGHSAPRT
                     HRSSGKLPPGFEIVQALSNSLKSLSESDPALVQIRLNSQVFDVEIIHNKVQAVKYYDS
                     DGVSQRVDTNNVVFCSGGFGFSKKMLKKYAPELESLPTTNGAQTTGDGQELLENLGGQ
                     LIDMTQVQVHPTGFIDPNDRQKGWKFLAAEALRGLGGILVNPTTGRRFVNELSTRDLV
                     TEAIQSQCPKDDNRAYLVMSEAVYQNYKNNIDFYMFKKLVRKTTVGEFAEELPISAAE
                     LAAELRDYSSAQQDKFARVSRINAFGTGADASTVVYVGEITPVVHFTMGGARINELAE
                     VLNKDGKPVAEGLYAAGEVSGGVHGANRLGGSSLLECVVFGRTAADSVAKL"
     gene            complement(<275449..>276714)
                     /locus_tag="KLTH0C03168g"
                     /db_xref="GeneID:8291227"
     mRNA            complement(<275449..>276714)
                     /locus_tag="KLTH0C03168g"
                     /product="KLTH0C03168p"
                     /transcript_id="XM_002552317.1"
                     /db_xref="GeneID:8291227"
     CDS             complement(275449..276714)
                     /locus_tag="KLTH0C03168g"
                     /note="highly similar to uniprot|P37303 Saccharomyces
                     cerevisiae YEL046C GLY1 Threonine aldolase catalyzes the
                     cleavage of L-allo-threonine and L-threonine to glycine
                     involved in glycine biosynthesis"
                     /codon_start=1
                     /product="KLTH0C03168p"
                     /protein_id="XP_002552363.1"
                     /db_xref="GeneID:8291227"
                     /db_xref="GOA:C5DDR4"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:C5DDR4"
                     /translation="MALAYIRLATAGHRRPAQHAGVSATHTHLHLLLLHSMSDLPEPY
                     TSAENDFRSDTFTTPTAEMMQAACSASIGDAVYNEDLDTLALERQVAQLAGKPAGLFC
                     VSGTLSNQIALRAHLYQPPYSVLCDYRAHVYTHEAAGLAILSQAMVTPVVPSNGNYLT
                     LEDIRRAYIADDGDIHGAPTRVVSLENTLHGIVHPVDELVRIKAWCVENQIRLHCDGA
                     RLWNAVIESGVPMKQFGEIFDSISICLSKSLGAPMGSVLVGDAKFIKKCNHFRKQQGG
                     GVRQSGMMCRMASVAVQGDWRAHLARSHRMAHELAAFCATHGIPLESPADTNFVFIDL
                     RRARMDPDVLVKKGLKYHVKLMGGRVSFHYQISDASLERVKIALLEAFQHAQEHPFDT
                     DGPTKIYRSESTEVDIEGNAIGELQTYKY"
     gene            <277658..>278062
                     /locus_tag="KLTH0C03190g"
                     /db_xref="GeneID:8291228"
     mRNA            <277658..>278062
                     /locus_tag="KLTH0C03190g"
                     /product="KLTH0C03190p"
                     /transcript_id="XM_002552318.1"
                     /db_xref="GeneID:8291228"
     CDS             277658..278062
                     /locus_tag="KLTH0C03190g"
                     /note="similar to uniprot|P32617 Saccharomyces cerevisiae
                     YEL044W IES6 Protein that associates with the INO80
                     chromatin remodeling complex under low-salt conditions"
                     /codon_start=1
                     /product="KLTH0C03190p"
                     /protein_id="XP_002552364.1"
                     /db_xref="GeneID:8291228"
                     /db_xref="GOA:C5DDR5"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:C5DDR5"
                     /translation="MPPSNSPGPMDRIEFLREVAASNSTDGLHLKRASWKKPHRRHKA
                     TRQLVTDEWKRLSNTPSEANRLTYFNVEAPPSIYPAKKYCDITGLKASYRAPGNGLRF
                     YNSEVYSLVIKPMAPGVDQQYLRLRGDDIVLK"
     gene            <279223..>279819
                     /locus_tag="KLTH0C03212g"
                     /db_xref="GeneID:8291229"
     mRNA            <279223..>279819
                     /locus_tag="KLTH0C03212g"
                     /product="KLTH0C03212p"
                     /transcript_id="XM_002552319.1"
                     /db_xref="GeneID:8291229"
     CDS             279223..279819
                     /locus_tag="KLTH0C03212g"
                     /note="highly similar to uniprot|P40892 Saccharomyces
                     cerevisiae YJL218W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C03212p"
                     /protein_id="XP_002552365.1"
                     /db_xref="GeneID:8291229"
                     /db_xref="GOA:C5DDR6"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR024688"
                     /db_xref="UniProtKB/TrEMBL:C5DDR6"
                     /translation="MEALQKIVPGELYDANYDPQILEIRRQAKIKIHEINHLSPAEGE
                     KRESMIRELFGSVGKNLVIESPFYCDYGPNIHIGDDVAINHNLVILDGAEVRIGNSVF
                     IAPNVGLYTAGHPIDVERRSKGLEFASPIIIEDYVWIGGGVSIVPGVTIKKGSVIAAG
                     SVVIRDIPEGVVAGGNPCKVIRKITDEDKKTTNFIKRQ"
     gene            <280513..>282954
                     /locus_tag="KLTH0C03234g"
                     /db_xref="GeneID:8291230"
     mRNA            <280513..>282954
                     /locus_tag="KLTH0C03234g"
                     /product="KLTH0C03234p"
                     /transcript_id="XM_002552320.1"
                     /db_xref="GeneID:8291230"
     CDS             280513..282954
                     /locus_tag="KLTH0C03234g"
                     /note="weakly similar to uniprot|P32618 Saccharomyces
                     cerevisiae YEL043W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C03234p"
                     /protein_id="XP_002552366.1"
                     /db_xref="GeneID:8291230"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:C5DDR7"
                     /translation="MLPYAAFTLIAIVWLIYRLALFLSIPVWRIVSTLGLQVPHTTRV
                     SIDEVTSDTITIRWENEPSEVEKDTPSISRYILYLNNVKVGTFPNIGTSLYTCCSLKD
                     LLPHTQYQLDFVCVNQDGFMNKVPSTYVMTKNAASSSSDSVPFLTVDDAESNPLTAQN
                     FPADMKWRKTQVVVSTDSPTSYASLTSLQDLDDYSINDLKNILVCAQEDLHEVLQQQA
                     SVFQDFRESEIQLRLELDNLKAQWAHEIDLRKSLKSSIKSLENSKLLYDLKKGKLDKN
                     INQSRNKINKMKNDIVKWDQERAPHLRQDLLKQKFSNEKSSLIERIDKVSCQIRELHA
                     QLTSQEEENKKLNSVKKSLDSTKPVATTAHVPAASASTSKRNSPVDSMSVPPPNLASV
                     IKKINDYTNEKTGMLTSPGHEFLNALSENSQLVSVIKEEIRKDVDLENQWRARRSKLA
                     KRNDLLEKMWADISINNQKLRDSLAAQPYTSPPASASNAVPAPQLTLHDPATYSTNEG
                     LHEPSTFGSGSFHASPPPPPPPHSVPYNNWDINQERRQPIEYNGEDQNFDYDDSHHLL
                     SGLQNMISEADYQATNVSTSKLYTTDQLDNYWSRQNVSEAAAHMGQSSPLAQPSHMPL
                     LSPAFVYEVQGISPSGPMLRTDSFAPMSVPNDEEVPGLIPAQVVQRDEVASFGSGFNN
                     DPVMRTSPLSLPLKEEFTKDNLFSSGHYNNIWGAPQGKETPISSPLGETGTPKALHSR
                     SSSHGSWGLPQFMHKSPNSNKTDSKAENSQSSTDNKDKETTHSNGRRISRLLSKSGMN
                     HLFRSPTHESSHSNA"
     gene            complement(<283032..>283832)
                     /locus_tag="KLTH0C03256g"
                     /db_xref="GeneID:8291231"
     mRNA            complement(<283032..>283832)
                     /locus_tag="KLTH0C03256g"
                     /product="KLTH0C03256p"
                     /transcript_id="XM_002552321.1"
                     /db_xref="GeneID:8291231"
     CDS             complement(283032..283832)
                     /locus_tag="KLTH0C03256g"
                     /note="similar to uniprot|P21374 Saccharomyces cerevisiae
                     YJR050W ISY1 Component of the spliceosome complex involved
                     in pre-mRNA splicing auxiliary splicing factor that may
                     modulate Syf1p activity and help optimize splicing isy1
                     syf2 double mutation activates the spindle checkpoint
                     causing cell cycle arrest"
                     /codon_start=1
                     /product="KLTH0C03256p"
                     /protein_id="XP_002552367.1"
                     /db_xref="GeneID:8291231"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:C5DDR8"
                     /translation="MSRNVDKANSVLVRFQELEAEKNGGYKDYTRFKRPTRVGSVSKS
                     QEAQQWRRQVISDINTRLTRMHDPSLNEFQLRELNDELNDLFSEKARWERHIHRNLKG
                     PDFSRDKSFKHTGTVLDGRRYFGRALALPEVQQLAKNAADWRKKSQSARQRQKTLQDR
                     VRVWKKSLGPEYYGFVPEDSASLRVPLHLTVETVKEILTSKPASRSHFCQLEEDKTQE
                     LQAEAGGQGSVMAPKRIIPQFSQLPDLKDMEEWLVQRRKSQLQRQLNL"
     gene            <285155..>286954
                     /locus_tag="KLTH0C03278g"
                     /db_xref="GeneID:8291232"
     mRNA            <285155..>286954
                     /locus_tag="KLTH0C03278g"
                     /product="KLTH0C03278p"
                     /transcript_id="XM_002552322.1"
                     /db_xref="GeneID:8291232"
     CDS             285155..286954
                     /locus_tag="KLTH0C03278g"
                     /note="similar to uniprot|P00724 Saccharomyces cerevisiae
                     YIL162W SUC2"
                     /codon_start=1
                     /product="KLTH0C03278p"
                     /protein_id="XP_002552368.1"
                     /db_xref="GeneID:8291232"
                     /db_xref="GOA:C5DDR9"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018053"
                     /db_xref="InterPro:IPR023296"
                     /db_xref="UniProtKB/TrEMBL:C5DDR9"
                     /translation="MAFSSLKKSDSVGSTPHRKQNHPNKRKPFSKMQLLGSALGALVI
                     AAGVTASQSNSRSRGKNTDSQPQFNASSGTRPLVHLTPNKGWMNDPNGLFYDSEASIW
                     HAYYQYNPNDNVWGLPLYWGHATSEDLTVWEDHGAAIAPQNDESGAFSGSIIIDANNT
                     SGFFNDSTKPAQRIVAFYTEHNATTESQYAAYSLDGGFTFEQYEHNPVLDIGSDQFRD
                     PKVFWHEESERWVMTLALSQEYTIQIFTSENLKDWELQSNFSHHGILGYQYECPGLAK
                     VRVERDIPLNVTSNGKTNLTTQDDGAEYKWVMFLSINPGSPAGGSVNEYFIGDFDGKT
                     FTPQDSAARIVDHGKDFYALQTFTNAPNGDTIGIAWASNWDYCAFVPTEAWKSSMSIA
                     RNFTVRPYNPNPQSTELNLYSTPILNSTDLQTKRYLKKSSLEIGADEALKYNLGNDAQ
                     GLLEFTATWKVNGSSIPSVGDFADLSFWFTGKEDDDEYLRLGYAVNAAGFFVDRGNTD
                     VDFVNDNPFFNNRQTQNIETYKIGTDGLPIYKVHGIIDRNIIELFFNDGSSTSTNLFF
                     LSDGNYIGGVEITAGVEGVFTILDFEIKQLARK"
     gene            <287614..>289185
                     /locus_tag="KLTH0C03300g"
                     /db_xref="GeneID:8291233"
     mRNA            <287614..>289185
                     /locus_tag="KLTH0C03300g"
                     /product="KLTH0C03300p"
                     /transcript_id="XM_002552323.1"
                     /db_xref="GeneID:8291233"
     CDS             287614..289185
                     /locus_tag="KLTH0C03300g"
                     /note="similar to uniprot|P32621 Saccharomyces cerevisiae
                     YEL042W GDA1 Guanosine diphosphatase located in the Golgi
                     involved in the transport of GDP-mannose into the Golgi
                     lumen by converting GDP to GMP after mannose is
                     transferred its substrate"
                     /codon_start=1
                     /product="KLTH0C03300p"
                     /protein_id="XP_002552369.1"
                     /db_xref="GeneID:8291233"
                     /db_xref="GOA:C5DDS0"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:C5DDS0"
                     /translation="MAGLGSLVRNYRFLIAMLSAVMMILLLRSSASTAGISEQVSTKI
                     GQTDIDDVYKTQPIKQEPGYLEDESIKKADKKLEDAVKQSQQNPEYSTGTKCTEEHQY
                     VVMIDAGSTGSRVHIYEFDMCTKPPTLLHETFEMLKPGLSSYGSDPAGAAQSLDKLLD
                     LAVEVIPEKRRKCSPVAVKATAGLRKLGDEKSAKILEAVRAHLEKDYPFPVVENGAVV
                     MTGDEEGVYAWITANYLLGNIAGREKVPTAATFDLGGGSTQIVFEPAFPPNEKMIEGE
                     HKYPLQFGDEKYTLYQFSHLGYGLMEGRNKVNSLLVENAIKDKKISKDDKVAKLFSPC
                     LPPGAIAEDVEVEMPDKTSKTVTFEGPVTPAGPQCRALAEKVLHKDAKCSEPPCSFNG
                     VHQPSLVRTFKESNDLYVFSYFYDKTQPLGLPSSFTLQELADLARMVCNGESVWESVF
                     SGIPGSIEKLEKEPQWCLDLSFQVALLHTGYDIPLYRELKTAEKISDYELGWCLGASL
                     PLLEGKDWKCKIEQT"
     gene            <289514..>291112
                     /locus_tag="KLTH0C03322g"
                     /db_xref="GeneID:8291234"
     mRNA            <289514..>291112
                     /locus_tag="KLTH0C03322g"
                     /product="KLTH0C03322p"
                     /transcript_id="XM_002552324.1"
                     /db_xref="GeneID:8291234"
     CDS             289514..291112
                     /locus_tag="KLTH0C03322g"
                     /note="similar to uniprot|P21373 Saccharomyces cerevisiae
                     YJR049C UTR1 NAD kinase active as a hexamer enhances the
                     activity of ferric reductase (Fre1p)"
                     /codon_start=1
                     /product="KLTH0C03322p"
                     /protein_id="XP_002552370.1"
                     /db_xref="GeneID:8291234"
                     /db_xref="GOA:C5DDS1"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:C5DDS1"
                     /translation="MARHGDAPFSVPLSRELSPLSRTLTDGGEKKSHGTNSKGKGEIT
                     NKSKRSKSVSHLADRNKILGSRMTPIKPEEQKVPEEPLEDPLEEPHRVDTAEKVFRRL
                     SVGSNDMRRATSHAQLSSTAHGMRLLSKDIQKSMVVLQVNRLMIVTKKQDSSLVYLTR
                     EMVEWILVNYPEIEIYVDETIECSNRFDTKGIIRDSRCGSNRIKTWSPELVAKKDDFF
                     DLVITLGGDGTVLYVSSLFQRSIPPVMSFSLGSLGFLTNFNYENFRQSLPRVLNSKIR
                     SKMRMRLCCRVFRKRKPNKENNNSRSRKKFTMIGEYHVLNELTIDRGPSAFISMLEVF
                     GDNSLLTVAQADGLIIATPTGSTAYSLSAGGSLVYPSVNAIAVTPICPHTLSFRPIIL
                     PDSMKLKVKVPLNSRATAWAAFDGKNRVELFKGDYVCITASPHSFPTLESSPTEFIDS
                     ISRTLNWNAREPQKSFAHMLSQKNQKNYVSDTEKQKQDQPEVRAPSDEEEEEGESDSE
                     SPSQFRPKAASSAASPKLKPNFQL"
     gene            <291335..>292738
                     /locus_tag="KLTH0C03344g"
                     /db_xref="GeneID:8291235"
     mRNA            <291335..>292738
                     /locus_tag="KLTH0C03344g"
                     /product="KLTH0C03344p"
                     /transcript_id="XM_002552325.1"
                     /db_xref="GeneID:8291235"
     CDS             291335..292738
                     /locus_tag="KLTH0C03344g"
                     /note="similar to uniprot|P32623 Saccharomyces cerevisiae
                     YEL040W UTR2 Putative glycosidase
                     glycosylphosphatidylinositol (GPI)-anchored protein
                     localized to the bud neck has a role in cell wall
                     maintenance"
                     /codon_start=1
                     /product="KLTH0C03344p"
                     /protein_id="XP_002552371.1"
                     /db_xref="GeneID:8291235"
                     /db_xref="GOA:C5DDS2"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:C5DDS2"
                     /translation="MAGSKLFFLSAISALTSVVAAATTEKVVYCNETLAACPEDKPCC
                     SQYGVCGSGSYCLGGCNPRYSHNITACMPMPVCKDFQTVFSNYSGDLQSQYTYLGDAE
                     KHDWIYEGYTMDYDKEDALVLAMPKNSGGTVLSSTRYVWYGKVGARLKTSHDAGVVTA
                     FIMFSSVQDEIDYEYVGNNLTQVQTNYYFEGVQNWTHSTNVSTTDTFDNYHLYEVDWH
                     EDHIDWLIDGEVSRTLLKNSTFNATSGEYMFPQTPARIQISIWPGGNATNPVGTRSWA
                     GGEINWDSSDIQDYGYYYALLQGVNVTCYDPPAGTVKNGSVSYEYISSENFTQNYVAI
                     TNGTTVMGSADDTGYNPEDGKSSSSSSSSSSSSPAASKSTQKGSSSTDKSSSTESGLK
                     VATGSSSVSSAKQSGFVQNINSASSSATGKSSATSTGSSATSTGGAAGLSYAPISNNG
                     LMHIAMGLFGAAFAFLY"
     gene            complement(<293119..>293451)
                     /locus_tag="KLTH0C03366g"
                     /db_xref="GeneID:8291236"
     mRNA            complement(<293119..>293451)
                     /locus_tag="KLTH0C03366g"
                     /product="KLTH0C03366p"
                     /transcript_id="XM_002552326.1"
                     /db_xref="GeneID:8291236"
     CDS             complement(293119..293451)
                     /locus_tag="KLTH0C03366g"
                     /note="highly similar to uniprot|P00044 Saccharomyces
                     cerevisiae CYC1 Cytochrome c isoform 1 and to YEL039C
                     uniprot|P00045 Saccharomyces cerevisiae CYC7 Cytochrome c
                     isoform 2"
                     /codon_start=1
                     /product="KLTH0C03366p"
                     /protein_id="XP_002552372.1"
                     /db_xref="GeneID:8291236"
                     /db_xref="GOA:C5DDS3"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:C5DDS3"
                     /translation="MPAPYKKGSEKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFG
                     RNSGQAEGYSYTDANIKKNVQWSEQTMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLI
                     TYMVKACK"
     gene            <294499..>295200
                     /locus_tag="KLTH0C03388g"
                     /db_xref="GeneID:8291237"
     mRNA            <294499..>295200
                     /locus_tag="KLTH0C03388g"
                     /product="KLTH0C03388p"
                     /transcript_id="XM_002552327.1"
                     /db_xref="GeneID:8291237"
     CDS             294499..295200
                     /locus_tag="KLTH0C03388g"
                     /note="similar to uniprot|P32626 Saccharomyces cerevisiae
                     YEL038W UTR4 Protein of unknown function found in both the
                     cytoplasm and nucleus"
                     /codon_start=1
                     /product="KLTH0C03388p"
                     /protein_id="XP_002552373.1"
                     /db_xref="GeneID:8291237"
                     /db_xref="GOA:C5DDS4"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR027511"
                     /translation="MDDPMISYIIVEPRFEMAYAAVLLDIEGTVCPISFVKESLFPFF
                     LKQVDTLCSSQDLQVQRLLTQFQVDDVAGHIRSLVARDVKDPILKQLQGLVWENGYKD
                     GQIKAPVYDDAIKFIKNSDVPVYIYSSGSVKAQKLLFQYVESRSNTLDLRPFIKGYFD
                     INTSGVKTQSESYARIANNVGIKPNGVLFISDNPFELDAAKITGMQTMLAVRPGNSEV
                     RDALKYNPVTNFDDL"
     gene            complement(<295299..>296474)
                     /locus_tag="KLTH0C03410g"
                     /db_xref="GeneID:8291238"
     mRNA            complement(<295299..>296474)
                     /locus_tag="KLTH0C03410g"
                     /product="KLTH0C03410p"
                     /transcript_id="XM_002552328.1"
                     /db_xref="GeneID:8291238"
     CDS             complement(295299..296474)
                     /locus_tag="KLTH0C03410g"
                     /note="similar to uniprot|P32628 Saccharomyces cerevisiae
                     YEL037C RAD23"
                     /codon_start=1
                     /product="KLTH0C03410p"
                     /protein_id="XP_002552374.1"
                     /db_xref="GeneID:8291238"
                     /db_xref="GOA:C5DDS5"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DDS5"
                     /translation="MVKINFKDFKKQVLALELDSGSTISEAKQRLAENKDCDESQIKL
                     IYSGKILQDDRTIADYKLNDGDQVIFMISKKKSTTTKTTVPPSEQKPAEPSAPSSSAA
                     SAPSGENAGTSEQTSAPAAAAPASSTAPTDPAFVTGSRRDETVQRIMEMGYDREQVER
                     ALRAAFNNPDRAVEYLLMGIPEHLQQTQQPQQQQQQQQQQQQQPEPQAQESHETQQPQ
                     EHEEQQASSDDLFAQAAASAGGEEGGDSARAPGTIGLTMEDLLSLRQVVTGNPEALPP
                     LLESLSTRYPELREQIMTNPEMFISMLLEAVGGSLPEGIMEGDAGMEAGAEGALAGAD
                     VEGAEQAPQLEISPQDQEAISRLCELGFERTLVVQVYFACDKNEEIAANMLFSEYAD"
     gene            complement(<297214..>298683)
                     /locus_tag="KLTH0C03432g"
                     /db_xref="GeneID:8291239"
     mRNA            complement(<297214..>298683)
                     /locus_tag="KLTH0C03432g"
                     /product="KLTH0C03432p"
                     /transcript_id="XM_002552329.1"
                     /db_xref="GeneID:8291239"
     CDS             complement(297214..298683)
                     /locus_tag="KLTH0C03432g"
                     /note="similar to uniprot|P32629 Saccharomyces cerevisiae
                     YEL036C ANP1 Mannan 8 Protein of the endoplasmic reticulum
                     with a role in retention of glycosyltransferases in the
                     Golgi also involved in osmotic sensitivity and resistance
                     to aminonitrophenyl propanediol subunit of
                     mannosyltransferase complex"
                     /codon_start=1
                     /product="KLTH0C03432p"
                     /protein_id="XP_002552375.1"
                     /db_xref="GeneID:8291239"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DDS6"
                     /translation="MKYTTQASIAGLVLTAFLLVRLLLGNYSAIRLAWPPLVVFKAYV
                     PSFENVPNVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHN
                     LIDLSFLVSDSSDDTMGVLLEYLQKAQSKPDRTQRFGNIEIYEKDFGQAIGQSFSDRH
                     GFAAQGPRRKLMGRARNWLGSVALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIV
                     PNVWRPLPDWLGNIQPYDLNSWQESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYM
                     RDPSGDPEDEMELDGIGGVSILSKAKVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYS
                     VVGLPHYVIWHIYEPSSDDLKHMAWMAEEEKRKIEENKIREFYDRVWQVAFDDVRDDW
                     EMERLQVMKNIDPNVLDRRIVVDWDDDEAEDESQGAAKKDSDSSKEAPKEPADKAGGN
                     PGAQEDTKGNTDEGKAAGADKNLKNRPQGVEQLDFNPDS"
     gene            <300040..>300513
                     /locus_tag="KLTH0C03476g"
                     /db_xref="GeneID:8291240"
     mRNA            <300040..>300513
                     /locus_tag="KLTH0C03476g"
                     /product="KLTH0C03476p"
                     /transcript_id="XM_002552330.1"
                     /db_xref="GeneID:8291240"
     CDS             300040..300513
                     /locus_tag="KLTH0C03476g"
                     /note="highly similar to uniprot|P19211 Saccharomyces
                     cerevisiae ANB1 Translation initiation factor eIF-5A, and
                     to YEL034W uniprot|P23301 Saccharomyces cerevisiae YEL034W
                     HYP2 Translation initiation factor eIF-5A"
                     /codon_start=1
                     /product="KLTH0C03476p"
                     /protein_id="XP_002552376.1"
                     /db_xref="GeneID:8291240"
                     /db_xref="GOA:C5DDS7"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:C5DDS7"
                     /translation="MAEEEHTFETADAGSSLTFPMQCSALRKNGFVVIKGRPCKIVDM
                     STSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMDVPNVKRTEFQLLDIDDGYLSL
                     MTMEGDTKDDVRAPEGELGDQIQSGFDEGKDLMVTIISAMGEEAAISCKEAPRSD"
     gene            <300823..>301584
                     /locus_tag="KLTH0C03498g"
                     /db_xref="GeneID:8291241"
     mRNA            <300823..>301584
                     /locus_tag="KLTH0C03498g"
                     /product="KLTH0C03498p"
                     /transcript_id="XM_002552331.1"
                     /db_xref="GeneID:8291241"
     CDS             300823..301584
                     /locus_tag="KLTH0C03498g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C03498p"
                     /protein_id="XP_002552377.1"
                     /db_xref="GeneID:8291241"
                     /db_xref="GOA:C5DDS8"
                     /db_xref="InterPro:IPR003656"
                     /db_xref="UniProtKB/TrEMBL:C5DDS8"
                     /translation="MAASANVDPVIAAMAAAVAYGRESESPEPHAAPAAPKPKSQHLG
                     AKKRNWCWNWFAQDPNDKQLAVCDYCGRKVRRLKSDRGSPKKLLEHLHTHKITPEVEN
                     PARSSNPAKPEFTAGVQSFYKSIKRRRKPAANKTQPAPLPPVAGTASTTSPTNESDDI
                     ASDDNALSAPPVPPEGPSAVSKFAFRALQFLLENQLYLSVIFSSSFGDIAQRRSRPEI
                     DAFLRHLEAVRDAEGDSKCMKVLTHRAQLQDMDPS"
     gene            <301635..>304619
                     /locus_tag="KLTH0C03520g"
                     /db_xref="GeneID:8291242"
     mRNA            <301635..>304619
                     /locus_tag="KLTH0C03520g"
                     /product="KLTH0C03520p"
                     /transcript_id="XM_002552332.1"
                     /db_xref="GeneID:8291242"
     CDS             301635..304619
                     /locus_tag="KLTH0C03520g"
                     /note="similar to uniprot|P24279 Saccharomyces cerevisiae
                     YEL032W MCM3 Protein involved in DNA replication component
                     of the Mcm2-7 hexameric complex that binds chromatin as a
                     part of the pre-replicative complex"
                     /codon_start=1
                     /product="KLTH0C03520p"
                     /protein_id="XP_002552378.1"
                     /db_xref="GeneID:8291242"
                     /db_xref="GOA:C5DDS9"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5DDS9"
                     /translation="MASVTNARLPVRVLKLETSIFSHRSTPQLIVETERVPLVFLLPR
                     NPTFESMESINDTPDAVFGDRVRRFQEFLDTFSSYKDAIRFVQLHNLSDQAFSQDPTK
                     LKSEVEGKVSQRITVSLDDLREFDRSFWAGILNMPAQYVPAAERALSETAMTLEESPA
                     GNLGNLLAQQWKLSFRGSFGAHALSPRTLNSHHLNKLISVEGIVTKVSLVRPKLLRSV
                     HYAEKTGRFHYRDYRDATTTLTTQIPTPAIYPTEDPEGNRLTTEYGYSTYVDHQRITV
                     QEMPEKAPPGQLPRSIDVIMDEDLVDKAKPGDRINIVGIYKSLGGGGLSAGSGGKDQT
                     GALSGFRTVILANTAYPLHARSTGVAARQALSDSDIRNINKLSKKDDIFDLLSQSLAP
                     SIYGHEQIKKAILLMLMGGVEKNLENGSHLRGDINLLMVGDPSTAKSQLLRFVLNTAS
                     LAIATTGRGSSGVGLTAAVTMDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVA
                     IHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDLNKDPHYNIALPDSLLSRF
                     DLLFVVTDDINENTDRAISEHVLRTHRYLPPGYLEGEPIREAINLSLSVGEDTEANNE
                     EEDDDDDEGRVFEKFNPLLHAGAKLARNKGNRQGTELPQIVCIPFLRKYVQYAKERVV
                     PVLTQGAVSLIVKAYTELRNDQNTKKSPITARTLETLIRLSSAHAKVRLSKTVNRADA
                     RVASQLLRFALLGEDDLGAEFDTDDNNERSPTKSPRKRQRVRNATAAARDLQSSPTRA
                     PNLSTSTPTRTDLRRRLYSDDESEQEIQASGIQEDDEFMQQDESDMTALPADQEEDLQ
                     QRLQRGLRVSPRRQESQRASTPVTEDGRHVLLPSENFRSRPILAADQSIDDQDLVSAE
                     EMAPGAISTSRLSLFSGIIARLMQTDLFEDESYPVASLLDKINEELSEEDKFSAPEYL
                     AGLKVMSDRNNLMVAEEKVWRV"
     gene            <305204..>308830
                     /locus_tag="KLTH0C03542g"
                     /db_xref="GeneID:8291243"
     mRNA            <305204..>308830
                     /locus_tag="KLTH0C03542g"
                     /product="KLTH0C03542p"
                     /transcript_id="XM_002552333.1"
                     /db_xref="GeneID:8291243"
     CDS             305204..308830
                     /locus_tag="KLTH0C03542g"
                     /note="highly similar to uniprot|P39986 Saccharomyces
                     cerevisiae YEL031W SPF1 Sensitivity to a killer toxin (SMK
                     toxin) produced by Pichia Farinosa P-type ATPase"
                     /codon_start=1
                     /product="KLTH0C03542p"
                     /protein_id="XP_002552379.1"
                     /db_xref="GeneID:8291243"
                     /db_xref="GOA:C5DDT0"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DDT0"
                     /translation="MAPRSPVDSPLVKDSRLLIKKDVFFRPYVLPFMPLYATFAHLYF
                     KDYERYISGGEWTFVYLGGIVSLNILVMLLPYWNVNIASYFNYANASSLAEASFILIH
                     TTPNNGADDIVEIQRVQEGGHLQVFFQFQKKRFLLNADEGVFTSPKFVVDESPKIGVF
                     QDCKGHSGDLTHLKRLYGPNSFDIPVPSFTELFKEHAVAPFFVFQIFCVCLWLLDDLW
                     YYSLFNLFMIIAMEAAAVFQRLTTLREFRTMGVKPYPIHVFRNGKWSSVETTELLPMD
                     LVSITRTAEDSAIPCDLVLLEGSCIVNEAMLSGESTPLLKESIKLRPHDDLLDLEGLD
                     KNSVLHGGTKALQVNASEKLSSIPAPPDDGALAVVTKTGFETSQGSLVRVMIYSAERV
                     SVGNKEALYFILFLLIFAIAASWYVWTEGTKMGRIQSKLIVDCILIITSVVPPELPME
                     LTMAVNTSLAALSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGINEE
                     SEKVDALSPADDASLKTTLVVGAAHALVLLEDGEVVGDPMEKATLKACNWKVGAKDTV
                     QKENIGKIEILRRFQFSSALKRSSSVAKHNNKMFVAVKGAPETIRERLTTVPSNYDHI
                     YKHFTRAGSRVLALASKDLSNLSSKQVENLDRKDMEVDLEFSGFLVFQCPLKEDATET
                     IKMLNESSHRCIMITGDNPLTAVHVAKEVGIAERECLIVDEPVDGSNHSLVLRNVNET
                     IMMPFNPESDTFEHAEIFAKYDLAVTGHALAKLSGHHQLNELIRHTWIYARVSPAQKE
                     FILNSLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGTEEGLKKLNDQRRIDGMKGM
                     YDKQCQFMERWGQPNPPVPEPIAHLYPPGPSNPNYLKALEKKGLQITPEMRKLAAEAA
                     SKPVVTKKAEPSNPKASDLADMVMGSLGEADGEDAPSLKLGDASCAAPFTSKLANVSA
                     VTNIIRQGRCALINTIQMYKILALNCLISAYSLSVIYLAGVKFGDGQATTSGLLLSVC
                     FLSISRGKPLEKLSKERPQPGIFNIYIMGSILGQFAVHIATLVYITLEIYKLEPREPQ
                     IDLEKTFTPSLLNTGIFMIQLTQQVSTFAVNYQGEPFRESIRSNKGMYYGLLAVGGLA
                     LAGATEFSPELNATMKFVPMEDLFKIKLTATLLIDFFGSWAVELVFKYFFMDSKAADI
                     AARD"
     gene            complement(<308883..>310586)
                     /locus_tag="KLTH0C03564g"
                     /db_xref="GeneID:8291244"
     mRNA            complement(<308883..>310586)
                     /locus_tag="KLTH0C03564g"
                     /product="KLTH0C03564p"
                     /transcript_id="XM_002552334.1"
                     /db_xref="GeneID:8291244"
     CDS             complement(308883..310586)
                     /locus_tag="KLTH0C03564g"
                     /note="similar to uniprot|P47112 Saccharomyces cerevisiae
                     YJR046W TAH11 (DNA replication)"
                     /codon_start=1
                     /product="KLTH0C03564p"
                     /protein_id="XP_002552380.1"
                     /db_xref="GeneID:8291244"
                     /db_xref="UniProtKB/TrEMBL:C5DDT1"
                     /translation="MLKVVDLNVITTEDELLPIMKSVLRNESVILLKNYANMETLRTL
                     SGILAKDSPDDLAGFDSNFVGCTKLENGVSVEQFIGSADSVGVQNTALSKMSSRLVKI
                     AIFFARICLAAVNFEKEEAVLNEHNSAVKVTRYHKPISKSVLDLEFDYEDEYVLHNSP
                     GIITVFPVAHGVQFKEHGKWAPLQDPDSILIQTGTLLSHFSNGMHASDSVKISTTNTT
                     YLTIFPALESFVNGQTVSRLLLLNQLQEFPQVAEVLYPKEMAQQNLVKRVDFCKGIFN
                     VTDSVMSLYCVSRSLTSSNPELDKLLPQISNMLKKKVSQDDFLRMMYIWDEAYILEVG
                     NDHEITIGLPPSGLLNTLTNKSRKLRYTELADKWLSDAILQPQILANVPALKIRKRRA
                     SSTSDIQGGQVQELHAPRALAQPKKNRTRGYIANTKEKFMFKELSNNENGESLLERIR
                     EKERRAAALLSQRERQYEQFLNVKTFQVFDILNSLTPDRPYTTTHLISLIVDSLVDSN
                     NPIGERETYDILLRLQALLKDKIKIIEAEGSLKVFRWPSLDRLVLEKRIKESNEQLFN
                     G"
     gene            <311969..>313705
                     /locus_tag="KLTH0C03586g"
                     /db_xref="GeneID:8291245"
     mRNA            <311969..>313705
                     /locus_tag="KLTH0C03586g"
                     /product="KLTH0C03586p"
                     /transcript_id="XM_002552335.1"
                     /db_xref="GeneID:8291245"
     CDS             311969..313705
                     /locus_tag="KLTH0C03586g"
                     /note="similar to uniprot|P32807 Saccharomyces cerevisiae
                     YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
                     binds chromosome ends and is involved in maintaining
                     normal telomere length and structure in addition to
                     participating in the formation of silent chromatin at
                     telomere-proximal genes"
                     /codon_start=1
                     /product="KLTH0C03586p"
                     /protein_id="XP_002552381.1"
                     /db_xref="GeneID:8291245"
                     /db_xref="GOA:C5DDT2"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:C5DDT2"
                     /translation="MDATVGNEGKDSESKYKKFEVHEGIIFCVELSEAMFKEPFDLNK
                     VQLLEILETLLELMTQVIIILPGTGIGCFFFQCSHEGAKGGIYEFLPLLDVNARSMKK
                     LNDLLDDLKMNITTLNEQFPFNDKQNTSLEAVFVLLQEQFSRSVQGQKAYNNKKIFLF
                     TDNDRPKESDDREAKNRLRKVIDDLDDSFINIIPFFVGSEQRPFDQSFYSDILKLGAK
                     KKASDGPFKYEGPNTTPISAKLIKSRVLRKKEIKRVRFQCSLILNEASDFQVSIKGYT
                     TISHERAGSKYKQVYDHDGLRKEALSHRKYLDANTGEDVTERVVKVFKFAEVDIELSE
                     DEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFNNISNSSFVVPDDSVFKGSIKTMASL
                     FRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFNDHNEGFYLTRVPFIDEIRKFPPTA
                     YHGNLSKTKTFEQMCKITETLISYFSLRHSYRPSDFENPTLQKHFELLHDYLLQVEVD
                     PTSGSKEHLLKKDDTLLKLHQVRAKILESAESDDPVQARLSNYVKAWNSMYNRELNGD
                     LEPETTSKKSKK"
     gene            complement(<313729..>315216)
                     /locus_tag="KLTH0C03608g"
                     /db_xref="GeneID:8291246"
     mRNA            complement(<313729..>315216)
                     /locus_tag="KLTH0C03608g"
                     /product="KLTH0C03608p"
                     /transcript_id="XM_002552336.1"
                     /db_xref="GeneID:8291246"
     CDS             complement(313729..315216)
                     /locus_tag="KLTH0C03608g"
                     /note="similar to uniprot|Q03264 Saccharomyces cerevisiae
                     YMR285C"
                     /codon_start=1
                     /product="KLTH0C03608p"
                     /protein_id="XP_002552382.1"
                     /db_xref="GeneID:8291246"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DDT3"
                     /translation="MEEERLADKVNTQIKQDKERHSGEKGHKSKKKGEKPPKVSPEHI
                     AEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYN
                     CLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEF
                     EKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLA
                     IALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINV
                     LQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKA
                     RDGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIY
                     SVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQ
                     DENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELELKI"
     gene            <315520..>315774
                     /locus_tag="KLTH0C03630g"
                     /db_xref="GeneID:8291247"
     mRNA            <315520..>315774
                     /locus_tag="KLTH0C03630g"
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /transcript_id="XM_002552337.1"
                     /db_xref="GeneID:8291247"
     CDS             315520..315774
                     /locus_tag="KLTH0C03630g"
                     /note="similar to uniprot|P20084 Saccharomyces cerevisiae
                     YMR286W MRPL33 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /protein_id="XP_002552383.1"
                     /db_xref="GeneID:8291247"
                     /db_xref="GOA:C5DDT4"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:C5DDT4"
                     /translation="MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIA
                     GSIAKVKEVVRVEVTEHALTKEQQRELRKSNPGFTVEKRV"
     gene            complement(<315850..>316680)
                     /locus_tag="KLTH0C03652g"
                     /db_xref="GeneID:8291248"
     mRNA            complement(<315850..>316680)
                     /locus_tag="KLTH0C03652g"
                     /product="KLTH0C03652p"
                     /transcript_id="XM_002552338.1"
                     /db_xref="GeneID:8291248"
     CDS             complement(315850..316680)
                     /locus_tag="KLTH0C03652g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C03652p"
                     /protein_id="XP_002552384.1"
                     /db_xref="GeneID:8291248"
                     /db_xref="UniProtKB/TrEMBL:C5DDT5"
                     /translation="MQNPQYSGVMGQSTLRNNMVRTVPSPNQITMIPVPHLQAHKGEK
                     RTLRNTSPLRKSQDFEGSKPTNTGKSGAGANGHSNSRQRWVDVKIIDDIKCPTSNSEK
                     PRYLTVPGKFDVKRGRSGLIIGSSSRVAYYRLAEVPFQGKNTKNELLRSIIDAAQPGF
                     FRKQPIGVSDDPKYLVSTLKELPNAVHEYADRVSGFTLKNSKANPLARLALQESAEVN
                     ESVDLSFDGKAMNKSDIFKMVDSFSLFPDDDTDEDEAPHFHMGSILPPEITNSTVPDL
                     "
     gene            complement(<317119..>319965)
                     /locus_tag="KLTH0C03674g"
                     /db_xref="GeneID:8291249"
     mRNA            complement(<317119..>319965)
                     /locus_tag="KLTH0C03674g"
                     /product="KLTH0C03674p"
                     /transcript_id="XM_002552339.1"
                     /db_xref="GeneID:8291249"
     CDS             complement(317119..319965)
                     /locus_tag="KLTH0C03674g"
                     /note="similar to uniprot|P39112 Saccharomyces cerevisiae
                     YMR287C MSU1 RNase component of the mitochondrial
                     degradosome along with the ATP-dependent RNA helicase
                     Suv3p the degradosome associates with the ribosome and
                     mediates turnover of aberrant or unprocessed RNAs"
                     /codon_start=1
                     /product="KLTH0C03674p"
                     /protein_id="XP_002552385.1"
                     /db_xref="GeneID:8291249"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="UniProtKB/TrEMBL:C5DDT6"
                     /translation="MIELISGSMDFTQQKTMVRHFHRALRALKKSPETLKSLDNIPGP
                     AKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLN
                     MDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLC
                     MCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRI
                     GAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPW
                     QMSIFKLCELVALLDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDAS
                     DFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELKKDNYA
                     ALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQN
                     NDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDIS
                     RRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK
                     EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNNVEI
                     LEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQ
                     NAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRD
                     RGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAE
                     KHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVV
                     LRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKL
                     KPEASSTVAIGDVVHNCRITRLDCLDSIMELEMQ"
     gene            <320129..>321553
                     /locus_tag="KLTH0C03696g"
                     /db_xref="GeneID:8291250"
     mRNA            <320129..>321553
                     /locus_tag="KLTH0C03696g"
                     /product="KLTH0C03696p"
                     /transcript_id="XM_002552340.1"
                     /db_xref="GeneID:8291250"
     CDS             320129..321553
                     /locus_tag="KLTH0C03696g"
                     /note="similar to uniprot|P23796 Saccharomyces cerevisiae
                     YMR283C RIT1 Modifies initiator methionine tRNA to
                     distinguish it from elongator methionine tRNA Initiator
                     methionine tRNA 2'-O-ribosyl phosphate transferase"
                     /codon_start=1
                     /product="KLTH0C03696p"
                     /protein_id="XP_002552386.1"
                     /db_xref="GeneID:8291250"
                     /db_xref="GOA:C5DDT7"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="UniProtKB/TrEMBL:C5DDT7"
                     /translation="MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAV
                     FPDYPIIPNERCGVWYCDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGG
                     IVVVDSTRRGKRMPDALSKTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERI
                     KSRIPDLVAKFKKMNILTGADIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQK
                     WHTAELENFIPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHIS
                     ILSNINLSDQELESFVEDKIHPQEPNSAENGLSLDQILYTDILTEELHLGKISSNVHL
                     GEHLVKELRLKYSLVIILSNTVTLSEDEAAIKIFKLQSECKKSSKALRTELIKICPLA
                     EAYLPNSLPMLVCCNTGKDMSVCVSLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKI
                     ITKLEGRNVNPPRASLNSVNAYLM"
     gene            <321675..>323330
                     /locus_tag="KLTH0C03718g"
                     /db_xref="GeneID:8291251"
     mRNA            <321675..>323330
                     /locus_tag="KLTH0C03718g"
                     /product="KLTH0C03718p"
                     /transcript_id="XM_002552341.1"
                     /db_xref="GeneID:8291251"
     CDS             321675..323330
                     /locus_tag="KLTH0C03718g"
                     /note="weakly similar to uniprot|P22136 Saccharomyces
                     cerevisiae YMR282C AEP2 Mitochondrial protein likely
                     involved in translation of the mitochondrial OLI1 mRNA
                     exhibits genetic interaction with the OLI1 mRNA
                     5'-untranslated leader"
                     /codon_start=1
                     /product="KLTH0C03718p"
                     /protein_id="XP_002552387.1"
                     /db_xref="GeneID:8291251"
                     /db_xref="GOA:C5DDT8"
                     /db_xref="InterPro:IPR024319"
                     /translation="MLSRKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAAS
                     KYANKPAKTLNDAVRERSERFRSRVYTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDY
                     MAFLVELTLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSG
                     TEMVFSLYQLYLKTVTPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQ
                     LPCDSATATHYLQLRCGALPRNWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSV
                     LTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVT
                     DASFTSPSSEVLVAVLTSYASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTR
                     VWSEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVV
                     EQCYSSFFQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTL
                     RAYFEKHRNAYSARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW"
     gene            complement(<323371..>324135)
                     /locus_tag="KLTH0C03740g"
                     /db_xref="GeneID:8291252"
     mRNA            complement(<323371..>324135)
                     /locus_tag="KLTH0C03740g"
                     /product="KLTH0C03740p"
                     /transcript_id="XM_002552342.1"
                     /db_xref="GeneID:8291252"
     CDS             complement(323371..324135)
                     /locus_tag="KLTH0C03740g"
                     /note="weakly similar to uniprot|P23797 Saccharomyces
                     cerevisiae YMR281W GPI12 ER membrane protein involved in
                     the second step of glycosylphosphatidylinositol (GPI)
                     anchor assembly the de-N-acetylation of the
                     N-acetylglucosaminylphosphatidylinositol intermediate
                     functional homolog of human PIG-Lp"
                     /codon_start=1
                     /product="KLTH0C03740p"
                     /protein_id="XP_002552388.1"
                     /db_xref="GeneID:8291252"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:C5DDT9"
                     /translation="MRILKVVCKLLAVLCILYFASSARIKASNEQAFTTLFSVLNPTS
                     INLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVH
                     LLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQVVGDQPLFLTFDDHGVSSHINHI
                     SCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVPSLITVLRGSRQAVFMSTFKQYL
                     LALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF"
     gene            <324666..>328286
                     /locus_tag="KLTH0C03762g"
                     /db_xref="GeneID:8291253"
     mRNA            <324666..>328286
                     /locus_tag="KLTH0C03762g"
                     /product="KLTH0C03762p"
                     /transcript_id="XM_002552343.1"
                     /db_xref="GeneID:8291253"
     CDS             324666..328286
                     /locus_tag="KLTH0C03762g"
                     /note="similar to uniprot|P39113 Saccharomyces cerevisiae
                     YMR280C CAT8 Zinc cluster transcriptional activator"
                     /codon_start=1
                     /product="KLTH0C03762p"
                     /protein_id="XP_002552389.1"
                     /db_xref="GeneID:8291253"
                     /db_xref="GOA:C5DDU0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DDU0"
                     /translation="MGERENESFGPRFIRTLGSQSISVINPLSSQPSSISQSPAQPKA
                     NTNTQTTATASISPTASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK
                     VSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPS
                     STEEEQMLEQLSSSNGGSLRVSSTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHL
                     HEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEI
                     LFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDD
                     PMRFFKDSCKFNLGSDNDVELLSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFK
                     ESLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSR
                     IMAYYNNAILALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMA
                     QQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIE
                     CALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQ
                     QVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLM
                     VLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLAFDDASSGADRSSSSYVLLQQATNT
                     FLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKEL
                     ETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSAN
                     VASTKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKVGETPVGVENTGQPN
                     GNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFSTDNGMPNLSGGA
                     SMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLKDYYRVPGASS
                     SQLNLMLMGSGSSGSNQRQAKQQQTNTTDPGFGFTVDASLGLAPLLAWSPEAAQEPIA
                     ETSDHDTRNDSGLRRKSGAETAGVLVAGHSQLADSSTDPASQQQRRVGSYDHTYAQDQ
                     SVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETDENLQDLFRWQNS
                     GF"
     gene            <328834..>331827
                     /locus_tag="KLTH0C03784g"
                     /db_xref="GeneID:8291254"
     mRNA            <328834..>331827
                     /locus_tag="KLTH0C03784g"
                     /product="KLTH0C03784p"
                     /transcript_id="XM_002552344.1"
                     /db_xref="GeneID:8291254"
     CDS             328834..331827
                     /locus_tag="KLTH0C03784g"
                     /note="similar to uniprot|Q03735 Saccharomyces cerevisiae
                     YML117W NAB6 Putative RNA-binding protein based on
                     computational analysis of large-scale protein-protein
                     interaction data"
                     /codon_start=1
                     /product="KLTH0C03784p"
                     /protein_id="XP_002552390.1"
                     /db_xref="GeneID:8291254"
                     /db_xref="GOA:C5DDU1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR018835"
                     /db_xref="InterPro:IPR018885"
                     /db_xref="UniProtKB/TrEMBL:C5DDU1"
                     /translation="MSSYTPSAHRSMGKHPKGLYAEQRSHVALPEGSREYSGYYHGNR
                     VPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSYHTPN
                     FGSTQLRMPPPTEKRNFKHGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRSLL
                     FSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVLQKLS
                     EFKKELKSKELTLNFASLRDVKTGPTLQEIKIEVLRAGATRSLILEFQDKVDLALLSK
                     SLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKL
                     AGLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTSDSDISGGESVASLGSKLQQTS
                     LGEQTLVVDPTQYGRPLVEERSEHLPHVTISKALNSKSSLNDLTSNTTSPQPQEVLVN
                     DHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMNMSKPLGQTLQQQYTTTAQVATAM
                     GGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFF
                     ANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKD
                     PEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDAN
                     NPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQ
                     QKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRDSDEEQKLEEDELLRLSDL
                     NNTGGGLGISLASSTGEETNTPVSDESSKEESVSSESSDVDILVSAPGSADTSQLESK
                     TAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPSTLSRQYTATSKHNSR
                     RGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYA
                     ANILGVDDGETVFYDENGPTTDPLI"
     gene            <332195..>333772
                     /locus_tag="KLTH0C03806g"
                     /db_xref="GeneID:8291255"
     mRNA            <332195..>333772
                     /locus_tag="KLTH0C03806g"
                     /product="KLTH0C03806p"
                     /transcript_id="XM_002552345.1"
                     /db_xref="GeneID:8291255"
     CDS             332195..333772
                     /locus_tag="KLTH0C03806g"
                     /note="similar to uniprot|P13090 Saccharomyces cerevisiae
                     YML116W ATR1 Multidrug efflux pump of the major
                     facilitator superfamily required for resistance to
                     aminotriazole and 4-nitroquinoline-N-oxide"
                     /codon_start=1
                     /product="KLTH0C03806p"
                     /protein_id="XP_002552391.1"
                     /db_xref="GeneID:8291255"
                     /db_xref="GOA:C5DDU2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDU2"
                     /translation="MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYF
                     DKQWKEYLFVISSMLSQLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGS
                     FILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFV
                     LPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAY
                     TIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSA
                     YIIVLLVISVILLLIFIIFEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTY
                     YYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVG
                     CIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTM
                     INYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWT
                     RRRERSVRIKLDEKHQE"
     gene            complement(<334500..>335714)
                     /locus_tag="KLTH0C03828g"
                     /db_xref="GeneID:8291256"
     mRNA            complement(<334500..>335714)
                     /locus_tag="KLTH0C03828g"
                     /product="KLTH0C03828p"
                     /transcript_id="XM_002552346.1"
                     /db_xref="GeneID:8291256"
     CDS             complement(334500..335714)
                     /locus_tag="KLTH0C03828g"
                     /note="similar to uniprot|P23642 Saccharomyces cerevisiae
                     YML115C VAN1 Mannosyltransferase with a role in protein
                     N-glycosylation"
                     /codon_start=1
                     /product="KLTH0C03828p"
                     /protein_id="XP_002552392.1"
                     /db_xref="GeneID:8291256"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DDU3"
                     /translation="MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEH
                     YDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDC
                     SEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVK
                     DAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA
                     NALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNS
                     WIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSI
                     LAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLI
                     QIAEREREKKRS"
     gene            complement(<336417..>337406)
                     /locus_tag="KLTH0C03850g"
                     /db_xref="GeneID:8291257"
     mRNA            complement(<336417..>337406)
                     /locus_tag="KLTH0C03850g"
                     /product="KLTH0C03850p"
                     /transcript_id="XM_002552347.1"
                     /db_xref="GeneID:8291257"
     CDS             complement(336417..337406)
                     /locus_tag="KLTH0C03850g"
                     /note="highly similar to uniprot|Q08985 Saccharomyces
                     cerevisiae YPL273W SAM4 S-adenosylmethionine-homocysteine
                     methyltransferase functions along with Mht1p in the
                     conversion of S-adenosylmethionine (AdoMet) to methionine
                     to control the methionine/AdoMet ratio"
                     /codon_start=1
                     /product="KLTH0C03850p"
                     /protein_id="XP_002552393.1"
                     /db_xref="GeneID:8291257"
                     /db_xref="GOA:C5DDU4"
                     /db_xref="InterPro:IPR003726"
                     /db_xref="UniProtKB/TrEMBL:C5DDU4"
                     /translation="MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIP
                     FISDSFWTANDSSSKDRQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEE
                     YDALLSRIVSFSRSCIGDDKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQL
                     DNFTVNDDLDLIGFETIPNIHELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHE
                     VAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTV
                     KKIWNPKGDHTLTWDQVVKSYIDSGARIIGGCCRTSPKDIAAINAAVNKYRPN"
     gene            complement(<337765..>339630)
                     /locus_tag="KLTH0C03872g"
                     /db_xref="GeneID:8291258"
     mRNA            complement(<337765..>339630)
                     /locus_tag="KLTH0C03872g"
                     /product="KLTH0C03872p"
                     /transcript_id="XM_002552348.1"
                     /db_xref="GeneID:8291258"
     CDS             complement(337765..339630)
                     /locus_tag="KLTH0C03872g"
                     /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
                     YMR278W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C03872p"
                     /protein_id="XP_002552394.1"
                     /db_xref="GeneID:8291258"
                     /db_xref="GOA:C5DDU5"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:C5DDU5"
                     /translation="MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTE
                     LRNRLNFRITFGTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHD
                     HRFNSKDFAEVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMI
                     TASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSE
                     MLIDAKKVLVDQYVDTVRRSLVITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLG
                     QGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFS
                     VAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMA
                     EVEGFHYEDTLTGFKWLGNRARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVV
                     FLQMLWSWKAQALTPFDVLQRAYQKYGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ
                     PTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSES
                     VRFTARGSGTEPKLKVYIEAVSSSEELASALAKKAWDVLRREWFKPEQTGLATNF"
     gene            complement(<339897..>342134)
                     /locus_tag="KLTH0C03894g"
                     /db_xref="GeneID:8291259"
     mRNA            complement(<339897..>342134)
                     /locus_tag="KLTH0C03894g"
                     /product="KLTH0C03894p"
                     /transcript_id="XM_002552349.1"
                     /db_xref="GeneID:8291259"
     CDS             complement(339897..342134)
                     /locus_tag="KLTH0C03894g"
                     /note="similar to uniprot|Q03254 Saccharomyces cerevisiae
                     YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase"
                     /codon_start=1
                     /product="KLTH0C03894p"
                     /protein_id="XP_002552395.1"
                     /db_xref="GeneID:8291259"
                     /db_xref="GOA:C5DDU6"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011947"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DDU6"
                     /translation="MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQD
                     IITAPNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHE
                     VTYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHL
                     REHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFY
                     MGPRPPPRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELF
                     GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVG
                     DINSNFLPRQQNSMLHLGRRNRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNK
                     INEENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHL
                     SNILLNVHKTYYDKLAEQGQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADI
                     VLWTSMFGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWV
                     RVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQEATQELNLLTGNDLW
                     LDNDDDEMDEFLNDEDANDDNEDGGEDLDEQQEYRSPSSDSSESSTRDVHTTGLSSDS
                     ASEHNGGEPENAELDAQHQATKRSFEPAEAETPPKRRNLNARDPANENDDEDLEAELL
                     LELEG"
     gene            complement(<342430..>344142)
                     /locus_tag="KLTH0C03916g"
                     /db_xref="GeneID:8291260"
     mRNA            complement(<342430..>344142)
                     /locus_tag="KLTH0C03916g"
                     /product="KLTH0C03916p"
                     /transcript_id="XM_002552350.1"
                     /db_xref="GeneID:8291260"
     CDS             complement(342430..344142)
                     /locus_tag="KLTH0C03916g"
                     /note="weakly similar to uniprot|Q03750 Saccharomyces
                     cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved in
                     RNA polymerase II transcription initiation"
                     /codon_start=1
                     /product="KLTH0C03916p"
                     /protein_id="XP_002552396.1"
                     /db_xref="GeneID:8291260"
                     /db_xref="InterPro:IPR019473"
                     /db_xref="UniProtKB/TrEMBL:C5DDU7"
                     /translation="MTKSAPDSPSSSSSELKGVQLRHLPNLEEIPRTALDDPLRKLLE
                     KAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNMLVDLHKMVNIQRRHCISKKDLLL
                     IIDGYNLTCADLMVELERSQYVRSHNLERVRKVREESEVVEAKEKTPLSEKELLESKH
                     LEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLA
                     EEADLSEKALIHLSKLSHEESPSEGADSDEIFKESQQDTQLIFGPAKKTKIAAINGAS
                     DLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRN
                     CKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAEENRRLREEQIRQEREERLKN
                     SKDYDVLDLDNLNEDPFFGGLGSSDTEDEKEPPQQEGTNKSGNTAPSATPEISDRANT
                     MSADIPGRSVLDEAESQDLTREADMEFDSEKNKDDTSNEYSFQTAGNPRLSPGGPSSA
                     LHDFTSTPPALPSSDNREIHEGTPSTSAPQVPDNGEQQRQKAPEASVNVNDASAEPQE
                     PRTN"
     gene            complement(<344354..>345484)
                     /locus_tag="KLTH0C03938g"
                     /db_xref="GeneID:8291261"
     mRNA            complement(<344354..>345484)
                     /locus_tag="KLTH0C03938g"
                     /product="KLTH0C03938p"
                     /transcript_id="XM_002552351.1"
                     /db_xref="GeneID:8291261"
     CDS             complement(344354..345484)
                     /locus_tag="KLTH0C03938g"
                     /note="some similarities with uniprot|P48510 Saccharomyces
                     cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
                     polyubiquitin-binding protein required for spindle pole
                     body (SPB) duplication and for transit through the G2/M
                     phase of the cell cycle involved in proteolysis interacts
                     with the proteasome"
                     /codon_start=1
                     /product="KLTH0C03938p"
                     /protein_id="XP_002552397.1"
                     /db_xref="GeneID:8291261"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DDU8"
                     /translation="MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRL
                     IYSGKILKDDQTVESYKILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPA
                     AQPQQSAPANLSTGQGNGFNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVL
                     RMLENPVMQSQMNEMLSNPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMI
                     RQSMQFSSMLGGDSAAGGGSSFPAPGTPAEADAPSQPAANPSAAPSAGTANPFASLLG
                     GQAGASGASPAANPFLSMLGGGSAGTPPALDPMVLSSILGGAGAANQQPQDTRPPEER
                     YEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV"
     gene            <346440..>347108
                     /locus_tag="KLTH0C03960g"
                     /db_xref="GeneID:8291262"
     mRNA            <346440..>347108
                     /locus_tag="KLTH0C03960g"
                     /product="KLTH0C03960p"
                     /transcript_id="XM_002552352.1"
                     /db_xref="GeneID:8291262"
     CDS             346440..347108
                     /locus_tag="KLTH0C03960g"
                     /note="weakly similar to uniprot|P13483 Saccharomyces
                     cerevisiae YML113W DAT1 DNA binding protein that
                     recognizes oligo(dA).oligo(dT) tracts"
                     /codon_start=1
                     /product="KLTH0C03960p"
                     /protein_id="XP_002552398.1"
                     /db_xref="GeneID:8291262"
                     /db_xref="UniProtKB/TrEMBL:C5DDU9"
                     /translation="MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRKPGSKGQVTKK
                     SAAANAMALAAEPVGPVELSLSESPGAPQIQKLNQVNRLPSVHDDFTHVTGDLRAHSS
                     RIPSIEMFHAGRMAHMGATPPASSPPPPPLPLQLQPSMSSFLPLQPWAASAAPSSLLP
                     GFPAFMPPTLPQQQPATRPGAMQGSSLDPMRATKLFATDRFHGSPDPDSLSSFASSSH
                     SSRE"
     gene            <347354..>348259
                     /locus_tag="KLTH0C03982g"
                     /db_xref="GeneID:8291263"
     mRNA            <347354..>348259
                     /locus_tag="KLTH0C03982g"
                     /product="KLTH0C03982p"
                     /transcript_id="XM_002552353.1"
                     /db_xref="GeneID:8291263"
     CDS             347354..348259
                     /locus_tag="KLTH0C03982g"
                     /note="similar to uniprot|P46963 Saccharomyces cerevisiae
                     YML112W CTK3 Gamma subunit of C-terminal domain kinase I
                     (CTDK-I) which phosphorylates the C-terminal repeated
                     domain of the RNA polymerase II large subunit (Rpo21p) to
                     affect both transcription and pre-mRNA 3' end processing"
                     /codon_start=1
                     /product="KLTH0C03982p"
                     /protein_id="XP_002552399.1"
                     /db_xref="GeneID:8291263"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="UniProtKB/TrEMBL:C5DDV0"
                     /translation="MDAFEARLQFLQVIKNLHKTLNAAKDNSPLSGASQQQNDPVQFY
                     LRHYEHHYEDFQQCLLDSAQKMDSLDRLNVLIYWSRLVSMLWPRCRKELDGEQNTASK
                     VVYNHLLGQLDQIFALVLPAEDWKSLTNLKVCVDIFVFLNRLCQVLESPSEEPLLFCG
                     GQELLQSLGTSYSSPLPEAAAELPWFRPQGFPKDYKQALSDTLTLLIDRRKHAAFLQE
                     VYRVNGVCAIPTSTTNSTILHRMESDRERHKKSKEHMWFTERDFMLDPREFDLLWGSL
                     DGMSKNDFADVRDINNIAQNSYMYN"
     gene            <348548..>351199
                     /locus_tag="KLTH0C04004g"
                     /db_xref="GeneID:8291264"
     mRNA            <348548..>351199
                     /locus_tag="KLTH0C04004g"
                     /product="KLTH0C04004p"
                     /transcript_id="XM_002552354.1"
                     /db_xref="GeneID:8291264"
     CDS             348548..351199
                     /locus_tag="KLTH0C04004g"
                     /note="similar to uniprot|Q03758 Saccharomyces cerevisiae
                     YML111W BUL2 Component of the Rsp5p E3- ubiquitin ligase
                     complex involved in intracellular amino acid permease
                     sorting functions in heat shock element mediated gene
                     expression essential for growth in stress conditions
                     functional homolog of BUL1"
                     /codon_start=1
                     /product="KLTH0C04004p"
                     /protein_id="XP_002552400.1"
                     /db_xref="GeneID:8291264"
                     /db_xref="InterPro:IPR007519"
                     /db_xref="InterPro:IPR007520"
                     /db_xref="InterPro:IPR022794"
                     /db_xref="UniProtKB/TrEMBL:C5DDV1"
                     /translation="MHNERRPRFELGKQDPSTGRGRSSSPSLFFKSSSSSNLLRLRKA
                     HSPSKEPRSTSSSRATLDSLVCNKEQNSASSSSSNMMVDVLPSFELYNTLHRHIPQGN
                     VNPDLHDYPPTYQEVQSRAPTLTPDSHETTTVANASSTSVDSTAHGGRSSISGDQLLN
                     LEALSTLHEPIQDDLGDSDNIYIDKLYSLPKLTTPIEISIRVTKEPAVADRKVDDESI
                     LKEYTSGDIIHGYVVIENRSTQRQKFEMFYVTLEGRATSVDRECGKRTVKRFLRMVDI
                     SASWSYSNIDVSNGVSYVPGRRDFENCVIGLNNNRVLEPHVRYKKYFMFKLPTHLLDV
                     SCKHQQFSHCLVPPAFGIDVTKASGKYSSIKVNPMLGYGHLGTKGSPILTNDLSTEDV
                     SINYTIDTKVVGKDSKSKKLNILKEREYNLRFIPFGFCRPFSGERAPLNQLQDMSKLI
                     QERIEALKKVFKRLDTNECITSEDLHNTDISGTAVDPTDVDSEDIMRRKLDQLYVSNR
                     VDPVCSSFPLRSSKINKDKDKKVEVEFKYNYKDKQKSANKLKKGIFGSFGPSTQSHST
                     QPTSSNKSGIIIITSKIPKRGLPYVEPSLLKKTNKLESKSEQNQENWYNLQASLPDKE
                     KEILSSFDIGLRCIQANNCKSHLPPQIQTVTTELICITAKSINSIPIKLNADLLLKKE
                     RLDDIQKVFKAFKAEMVELKAKFDENFEQLNELFSKSRRSSIHQELKFTDFLSEQLMT
                     NIESICTLRTDVRSLHNIFKKQSQTLENDDKISDSAPNKSASTASILSNTFSGSSSNS
                     SVHTSTAEKLKNQLLHEWVKTGDGEYERTVTVNLHMNDDIKETLIPTFESCLISRLYC
                     IRVNIKFEGQLGVATVDVPVQIRMLEP"
     gene            <351697..>352644
                     /locus_tag="KLTH0C04026g"
                     /db_xref="GeneID:8291265"
     mRNA            <351697..>352644
                     /locus_tag="KLTH0C04026g"
                     /product="KLTH0C04026p"
                     /transcript_id="XM_002552355.1"
                     /db_xref="GeneID:8291265"
     CDS             351697..352644
                     /locus_tag="KLTH0C04026g"
                     /note="similar to uniprot|Q03530 Saccharomyces cerevisiae
                     YMR274C RCE1 Type II CAAX prenyl protease"
                     /codon_start=1
                     /product="KLTH0C04026p"
                     /protein_id="XP_002552401.1"
                     /db_xref="GeneID:8291265"
                     /db_xref="GOA:C5DDV2"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:C5DDV2"
                     /translation="MALAPLLISLYVSVSYVAAIHLWSKKVTDYKIRRDDPKVIKTRM
                     RRVVLATVVNLALVPFLNSQFSTRGTSFKEGVLELGLIPGVYSGTNVVFDFHSFLVDS
                     GCAFKLACILYCGPLLDNVLYYVLVPGVSLREAVQDIKNELCDIWGVRNYVFGPITEE
                     LFYTSMLVNSFLLTSRDDVTYSTVLLLPPLFFGLAHLHHGWEMYTLGIYSVTQVVSTA
                     LLQMTYTTLFGIFTNFVYIRTGRNFWCCCLLHSFANYMGLPKMSELRDQLEAHHPSPT
                     SALFCKLWKWSYVALLFIGIIGFKNNLWGLTDSKHAIEL"
     gene            <352955..>355762
                     /locus_tag="KLTH0C04048g"
                     /db_xref="GeneID:8291266"
     mRNA            <352955..>355762
                     /locus_tag="KLTH0C04048g"
                     /product="KLTH0C04048p"
                     /transcript_id="XM_002552356.1"
                     /db_xref="GeneID:8291266"
     CDS             352955..355762
                     /locus_tag="KLTH0C04048g"
                     /note="similar to uniprot|P54786 Saccharomyces cerevisiae
                     YML109W ZDS2 Protein that interacts with silencing
                     proteins at the telomere involved in transcriptional
                     silencing paralog of Zds1p"
                     /codon_start=1
                     /product="KLTH0C04048p"
                     /protein_id="XP_002552402.1"
                     /db_xref="GeneID:8291266"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:C5DDV3"
                     /translation="MSVVSQKQENQALKVGDVQGRGSNKGSEQPGRSEKRKSEVLIAA
                     QSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQLYNSHSD
                     HDSDDDLSYVNDSIDITSTEYLQESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGK
                     TRMNNNLSAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEG
                     GNDEKIVHAPAAASANLPPSNQLRSGLNSLVRRPSGLRKSFTELEDLLLQEAQDTSGG
                     DENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMAS
                     SYYTDEDGESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGST
                     APSNLRSPSAEHNELDRSPIRVDQKNAQLQSPTSVNDFNEIYDHYRQSSFDSSLGAYP
                     HEHQNAHTSNFHSIASKRPKDDTLLDSESSLHDLHKGSLNKALDDEQQASFRGHVEAT
                     NNDEKDDHKHASSQAPRKKSGWSWFGKKSSKDQESSPEHTQRVSSDFLGVSSSAKPTN
                     VPTEKINHSRHRHYSIDDTANSSTESTTSNTVSSSQSPTKKQRKEKKFIQLFKRNRTT
                     STNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLRKNRLSPKKTRLSGDGRRESVKE
                     DFGSTQDYKVVREEKEPLAKLQPSVSLTPKSRPPLTQDKPKQNNVGEDLRLNNQDKHR
                     ADSVLDSDSEPELEADEEAGPRTDAIHEGITESNTQAEADTVTAYAPEETAAASADDS
                     FTKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTV
                     STVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ
                     LDEEGPTGVDAAGMDGMTASL"
     gene            <355923..>356264
                     /locus_tag="KLTH0C04070g"
                     /db_xref="GeneID:8291267"
     mRNA            <355923..>356264
                     /locus_tag="KLTH0C04070g"
                     /product="KLTH0C04070p"
                     /transcript_id="XM_002552357.1"
                     /db_xref="GeneID:8291267"
     CDS             355923..356264
                     /locus_tag="KLTH0C04070g"
                     /note="similar to uniprot|Q03759 Saccharomyces cerevisiae
                     YML108W defines a new subfamily of the split
                     beta-alpha-beta sandwiches."
                     /codon_start=1
                     /product="KLTH0C04070p"
                     /protein_id="XP_002552403.1"
                     /db_xref="GeneID:8291267"
                     /db_xref="InterPro:IPR015080"
                     /db_xref="UniProtKB/TrEMBL:C5DDV4"
                     /translation="MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDEL
                     ILPFEIDDMDKLNEWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRK
                     FVEAESGDEIN"
     gene            complement(356377..356458)
                     /locus_tag="KLTH0C04092r"
                     /db_xref="GeneID:8291268"
     tRNA            complement(356377..356458)
                     /locus_tag="KLTH0C04092r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=80.04"
                     /db_xref="GeneID:8291268"
     gene            <357195..>358331
                     /locus_tag="KLTH0C04114g"
                     /db_xref="GeneID:8291269"
     mRNA            <357195..>358331
                     /locus_tag="KLTH0C04114g"
                     /product="KLTH0C04114p"
                     /transcript_id="XM_002552358.1"
                     /db_xref="GeneID:8291269"
     CDS             357195..358331
                     /locus_tag="KLTH0C04114g"
                     /note="highly similar to uniprot|Q03529 Saccharomyces
                     cerevisiae YMR272C SCS7 Required for the hydroxylation of
                     the very long chain fatty acid (VLCFA) located in the
                     endoplasmic reticulum desaturase/hydroxylase enzyme"
                     /codon_start=1
                     /product="KLTH0C04114p"
                     /protein_id="XP_002552404.1"
                     /db_xref="GeneID:8291269"
                     /db_xref="GOA:C5DDV5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="InterPro:IPR014430"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5DDV5"
                     /translation="METKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPG
                     GAELIEEYAGKDVTEIMKDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHP
                     VEVKLEEDYDSTVFVPEVPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKE
                     FYLDQVHRPRHYGRGSAPLFGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVL
                     AVFLFCLGVFVWTLIEYGLHRFLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLV
                     MPPTLFVVLCTPFYKLVFALLPKYWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRK
                     LKKYHMEHHYKNYELGFGVTSWFWDKVFGTYLGDNAPLSQMKFD"
     gene            complement(<358455..>359393)
                     /locus_tag="KLTH0C04136g"
                     /db_xref="GeneID:8291270"
     mRNA            complement(<358455..>359393)
                     /locus_tag="KLTH0C04136g"
                     /product="KLTH0C04136p"
                     /transcript_id="XM_002552359.1"
                     /db_xref="GeneID:8291270"
     CDS             complement(358455..359393)
                     /locus_tag="KLTH0C04136g"
                     /note="weakly similar to uniprot|Q03760 Saccharomyces
                     cerevisiae YML107C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     nuclear periphery"
                     /codon_start=1
                     /product="KLTH0C04136p"
                     /protein_id="XP_002552405.1"
                     /db_xref="GeneID:8291270"
                     /db_xref="GOA:C5DDV6"
                     /db_xref="InterPro:IPR012935"
                     /db_xref="UniProtKB/TrEMBL:C5DDV6"
                     /translation="MDDALLARFEAAKRKIDAPAVPWQALRPRNRASHIVNKYKYASR
                     AHGVERNAYLTENELQGRRLYEKRSAGASGLSSRQEFMQAVRELVQVTRHSTVLWNSQ
                     RVNVVQMASKGWHVHKVQKGGSHGAALHCKNCRGSFYLELDDYLESEQLEARFNALLT
                     ERHVPGCYWRSKTYNLAHNYYLTDVSLYLEFERINKELGKYKDSGVMPDVPHNDDTIA
                     LARTFGASGVSLGPLALALRGYTSIDSEIAECTGCFRRTFVATLREPNANNHASWCKF
                     ADEQLLIKMLLKHLKPQKNSSIGDRLQDLESRLHGL"
     gene            <359809..>360483
                     /locus_tag="KLTH0C04158g"
                     /db_xref="GeneID:8291271"
     mRNA            <359809..>360483
                     /locus_tag="KLTH0C04158g"
                     /product="KLTH0C04158p"
                     /transcript_id="XM_002552360.1"
                     /db_xref="GeneID:8291271"
     CDS             359809..360483
                     /locus_tag="KLTH0C04158g"
                     /note="highly similar to uniprot|P13298 Saccharomyces
                     cerevisiae YML106W URA5 Fifth step in pyrimidine
                     biosynthesis pathway Orotate phosphoribosyltransferase 1"
                     /codon_start=1
                     /product="KLTH0C04158p"
                     /protein_id="XP_002552406.1"
                     /db_xref="GeneID:8291271"
                     /db_xref="GOA:C5DDV7"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DDV7"
                     /translation="MPAVLEDYQKNFLDLALESQALKFGTFTLKSGRQSPYFFNLGQF
                     NTGKLLSNLATAYAIAIIQSDLKFDVVFGPAYKGIPLAAIVCVKLAEIGGTKFQNVQY
                     SFNRKEAKDHGEGGTIVGASLEEQRVLIIDDVMTAGTAINEAFQIIAQNKGNVVGTIV
                     SLDRQEVLSTESKEPLSATQAVTQKHGIPVLSIVTLADIISYLDGKIPAEEKRKMEEY
                     LQIYGV"
     gene            complement(<360879..>361646)
                     /locus_tag="KLTH0C04180g"
                     /db_xref="GeneID:8291272"
     mRNA            complement(<360879..>361646)
                     /locus_tag="KLTH0C04180g"
                     /product="KLTH0C04180p"
                     /transcript_id="XM_002552361.1"
                     /db_xref="GeneID:8291272"
     CDS             complement(360879..361646)
                     /locus_tag="KLTH0C04180g"
                     /note="similar to uniprot|P29478 Saccharomyces cerevisiae
                     YML105C SEC65 signal recognition particle subunit
                     homologue of mammalian SRP19"
                     /codon_start=1
                     /product="KLTH0C04180p"
                     /protein_id="XP_002552407.1"
                     /db_xref="GeneID:8291272"
                     /db_xref="GOA:C5DDV8"
                     /db_xref="InterPro:IPR002778"
                     /db_xref="UniProtKB/TrEMBL:C5DDV8"
                     /translation="MPKLEEIDDFDDIDNLEMDLAEIDPNLKTPVAPKIVPEIKRSQD
                     DEPPLFPASGMQNSASTSAQPPVVQFTEEQKQQLKKFQILYPCYFDKNRSHKQGRRVP
                     AQYAVENPLVQTLADAVSKLKVPCVLEADKCHPQDFGNPGRVRLFLKDEGQSTTPSLF
                     QNKRMLMKLVGKFMQEHPTMLEKLKEIPLGPDAEGYEPRMVPKVKGFVMNEIVPIHSP
                     FSMGHPMVKSIYDAPAPVAASEKPLKAPKNKYKVVRR"
     gene            <361915..>363057
                     /locus_tag="KLTH0C04202g"
                     /db_xref="GeneID:8291273"
     mRNA            <361915..>363057
                     /locus_tag="KLTH0C04202g"
                     /product="KLTH0C04202p"
                     /transcript_id="XM_002552362.1"
                     /db_xref="GeneID:8291273"
     CDS             361915..363057
                     /locus_tag="KLTH0C04202g"
                     /note="similar to uniprot|P53437 Saccharomyces cerevisiae
                     YMR270C RRN9 Upstream activation factor subunit"
                     /codon_start=1
                     /product="KLTH0C04202p"
                     /protein_id="XP_002552408.1"
                     /db_xref="GeneID:8291273"
                     /db_xref="InterPro:IPR019622"
                     /db_xref="UniProtKB/TrEMBL:C5DDV9"
                     /translation="MNSSASEDDGPNKTSSTPSESRQLDRVEREVLKEANELLESLEH
                     THRGDLALHLYSTHLLKSVLKAANRKKFALETNTFIKTQIKDNWTSWPNPSTVIDPRT
                     NSLFEDDVMHQGASRSLETGEISPAGLEHASSMVRAELNAVWQRSLAAMSSNAGITLD
                     VDKMDVPPAIAHSIMDKMDLFFKGLHTTVAAPNKLKLSQLANSSQLQISEAQKTRDPV
                     SMNRKIKLDYRDIIIRGCQMQEDMYEIYMKSLELYRDIPSKYRKEEFKLPKRELRKYS
                     SRSRRVTEGSLIRKHDSRAGFVNAGKLLKQSGLDFETRTKLRLLLQKEADRSKDRKTF
                     LWVKGYRKEQDEESGKDQDYSVDDLYVPLRRSVSREVRKSFGENEV"
     gene            complement(<363016..>366363)
                     /locus_tag="KLTH0C04224g"
                     /db_xref="GeneID:8291274"
     mRNA            complement(<363016..>366363)
                     /locus_tag="KLTH0C04224g"
                     /product="KLTH0C04224p"
                     /transcript_id="XM_002552363.1"
                     /db_xref="GeneID:8291274"
     CDS             complement(363016..366363)
                     /locus_tag="KLTH0C04224g"
                     /note="weakly similar to uniprot|Q01846 Saccharomyces
                     cerevisiae YML104C MDM1 Intermediate filament protein
                     required for nuclear and mitochondrial transmission to
                     daughter buds"
                     /codon_start=1
                     /product="KLTH0C04224p"
                     /protein_id="XP_002552409.1"
                     /db_xref="GeneID:8291274"
                     /db_xref="GOA:C5DDW0"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:C5DDW0"
                     /translation="MAKGRLRRTITFTFYAAIFLLCFSSLCRKLLLCAAVFQLAVKIP
                     CGYKFELVREPSPKECPRPHGSAIHTSTSRAARQPIFPNNPEVSHEVELIIDSIVRDF
                     VASWYQSISSDPQSPFLEELKSVLYTVFINLETAVSKVDLPEFAVLKVLPLVTKHFKA
                     FRVAREKVTSRLLLKSSPSEGDVSFAVAVEFGRYYRVHPAISLGSEPLGVSLERYSRE
                     KALFILQRTLNDAELSSKFVQILGREILCCNVICPMLQRFVNADFWNDTVESVATTIL
                     RERTQVKEIRRVLSTQLDAPKFDIERRSLSQLESVDFPMNISIETNSKGFEKFLKCIN
                     SESTEQSLRAIKFSVLSQLLNLGQAKKAGKEEQLFKSRLLLSLNLLESRLEYLRKGSS
                     EAPVLLNELASTQIDAFKRFLSSMSIDDVLSDEFCCNVFYEFLKENNKKGECCLKFWM
                     RIDEFKNPLEDPSTDDLAMMSEGDVKGLHDACSDFFSSSNMPVMQTLNEQYAQDISDF
                     CKAQICSNLRTAGELYPAARKSAMRMQALAHEYLQENCLPNFKASQSFSNMISTDSFH
                     NTRLYTNFVFGSEGGRSRQEYRKFVAFPQQEVNDLDKVKESQEGEDEALHLKVKKSFS
                     DIFGRNEEGVIFESKIFEDESSENENDSSEDYEQSDFSEEGNEISNSRVEISWPSSSM
                     HGNRADLKSSIAELTISIDRLRKQLSLLDHLCLKADLTDSGSQLRLLKKSERSVTKEI
                     YQKELLRQQLIVQENSNSLFRKCQVSIKSHLSDISQDTGKEVVYYIISVSHSNNDVIT
                     SWDTPRRYSEFYELNAYLRKRFSGLVKHLQNKDYFPEKIKMSLVYHVSKTFLYKERSV
                     KLEKYLRNLLLISEVCQDQHFRRFLTQAGSTFRIKSTSKINEDRHSLLSRIDSVSSKM
                     CDAKIASTASPNHVKSPELELKLEDEMFKVPGQGGAETDQIKKGNFIKPICDLFITLF
                     SLNHSRSSWLRGRALLIVIQQLLGGTIEKYVKESIERISEKDNILKTVSKLRLTLWPD
                     GVFYKKTQTQERPQKGGDELLASQKDAKAKLEMLLSETCGRVVGIRSSKKAGAEINAM
                     FQNEYLNASFFLEVLDLVFAEAFANFA"
     gene            complement(<367003..>367701)
                     /locus_tag="KLTH0C04246g"
                     /db_xref="GeneID:8291275"
     mRNA            complement(<367003..>367701)
                     /locus_tag="KLTH0C04246g"
                     /product="KLTH0C04246p"
                     /transcript_id="XM_002552364.1"
                     /db_xref="GeneID:8291275"
     CDS             complement(367003..367701)
                     /locus_tag="KLTH0C04246g"
                     /note="some similarities with uniprot|Q03525 Saccharomyces
                     cerevisiae YMR269W Nucleolar protein of unknown function"
                     /codon_start=1
                     /product="KLTH0C04246p"
                     /protein_id="XP_002552410.1"
                     /db_xref="GeneID:8291275"
                     /db_xref="UniProtKB/TrEMBL:C5DDW1"
                     /translation="MPYYSKKQINRAEKFRAMTWLRSKNFIINTQTESPNMDSKGYLQ
                     SYGWIEGEALRDGGLKRPILVKHKKDKKGLGSAPGHDDSEAWWERLFDGHLKGLNVSD
                     TKDGNIRFEQKEVVAAGVSKKDSPLYRWFVQGEGLKGTIESAKEASRKRVRDESDENK
                     GKKHRPTGEDKRDKNEKKHKEDKKHKKDKKVEKDKKDKKDKKDKKDKKDKKDKKDKKV
                     KKVKKGKKEKKVKK"
     gene            <367879..>369231
                     /locus_tag="KLTH0C04268g"
                     /db_xref="GeneID:8291276"
     mRNA            <367879..>369231
                     /locus_tag="KLTH0C04268g"
                     /product="KLTH0C04268p"
                     /transcript_id="XM_002552365.1"
                     /db_xref="GeneID:8291276"
     CDS             367879..369231
                     /locus_tag="KLTH0C04268g"
                     /note="similar to uniprot|P49960 Saccharomyces cerevisiae
                     YMR268C PRP24 Splicing factor that reanneals U4 and U6
                     snRNPs during spliceosome recycling"
                     /codon_start=1
                     /product="KLTH0C04268p"
                     /protein_id="XP_002552411.1"
                     /db_xref="GeneID:8291276"
                     /db_xref="GOA:C5DDW2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DDW2"
                     /translation="MSADELTEPQLKRRLSDASNTDETSTEKKPRAEPKKYREYTTVI
                     VRNLPQSYNFHKVRKLFNSCGKVGHVDVHTSTDGQCKVARIEFENYSDVLSALTKSGK
                     VLGGNEIEVEELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRF
                     AYIDMASKQEASLALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLN
                     YNTNEAALSAIFAKFGHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASC
                     ARSSLSLNGTEIDNRILDVTLADRRPYLERQKVKHIMASKNQDGSVLGIYPLSDKIPT
                     PQIRCFIVEQAKVKKEDIKKIYLVPDHEGALVVARSGPIAAKISLSIHGSLFNKRTIM
                     CCSPKELQRQVHARYGRSSTKQRTHEDSKDIEITRSAPPLEGEKKMNNEDFRKLFLGA
                     "
     gene            complement(<369283..>374151)
                     /locus_tag="KLTH0C04290g"
                     /db_xref="GeneID:8291277"
     mRNA            complement(<369283..>374151)
                     /locus_tag="KLTH0C04290g"
                     /product="KLTH0C04290p"
                     /transcript_id="XM_002552366.1"
                     /db_xref="GeneID:8291277"
     CDS             complement(369283..374151)
                     /locus_tag="KLTH0C04290g"
                     /note="similar to uniprot|P52593 Saccharomyces cerevisiae
                     YML103C NUP188 Subunit of the nuclear pore complex (NPC)"
                     /codon_start=1
                     /product="KLTH0C04290p"
                     /protein_id="XP_002552412.1"
                     /db_xref="GeneID:8291277"
                     /db_xref="InterPro:IPR018864"
                     /db_xref="UniProtKB/TrEMBL:C5DDW3"
                     /translation="MCISHLCFSSVCDFIKSYKESSQDSPEVFELLSKFLKDNKPLLL
                     EPAKFNELGAEVPSKTTPLVIGSAKYNISVENWKDASRLSRALNVSYEQSLRIVAQSD
                     ARSCLEKDRMFLYAQRILQERNAIVDAAFLILNWDCKYVPAKEDLISTISIEKTTLCS
                     HLISLLSDVAANFGSLDKNNSIWSQPLQDLKDCQDVFYAIRIMELLTLLIMNSDTPVG
                     IVSSWCSVLKTTNYFQCFSEVATMPREVPDKLEALATINTVLMLGFDVSTFTIKVESP
                     FFNDPECFKTVNKTLLDQPSSAIILYYWSFVLSLKSYLFEEYPEKNAKFLDNVFGTVP
                     VSHLISLMVKRSEELDVLASFTKFSGCLEQDKLWSVTLSSLMALSLNFINITPQAAKT
                     VKELLTKNPRSFVEKFLTNNEVEKKVALLRAKVPLLEEGLLPLIHFSTVHPDFANFEW
                     KELNTYTEKLRLSSLSYDLADLPGPTSESSDIIVLKQELLVKPPLESQSNVMMPIPKE
                     TRGKIIPITSTAEDAVVFMHDYNGWSLLGRILQNICDTYTQSEEDEAKREKSELAVAI
                     IDLVANTMGAETPIERSTEILQHLSGYVEDDDIISVLFKLFELALHSRNLPIINAGLN
                     LMIELTPNFSHFVWTHLARSYLIDRNGKEGLAISILGNIERTSGVFQSSILLIKLASC
                     LVSESLTATDIFPERMKKEILGHLMAHLINIYEGFQFQTYTMQWQYLEIGLQLTSLIS
                     KVLFAVYGVDFTTSPSKKVTGVLADAAQIAVGAFLGASTSEMRAANSLITIVTFAKNT
                     NVPLHRGLPFGEMRHSLIDQSFELANLLISVRSLLHLPPSSLERSFFIHSATLVDIYA
                     SHLGLRVEVIKLLTHLVRAPFDTDAPSLLAYLGDDHSKMLLNCIAYDLKAPLLNQKLS
                     KSLYSFFSAIMEGKQDGLAILFLTGKLITLNKGEELEAKNMNASNSILTILKNNALKL
                     DDLPEAVNSHLLDAIAYACNSWTAARTSENDEDFIRILVRRLELFQPHPVDSSDSIEK
                     VISLSNQYKVISRIAEILALSLFTSTANNEIIMKALNRPELASTVKSVFHIDGYNTKL
                     QSGLQEKFRARWPQLELYMFTSSPLLKSNNSFHTSIFDIPLMDQYFEQDENWSGGEGL
                     VGFRSEVIAASVNLQFVTYQISAAKSWGALLTSFIKKTPTPLSETYVDIAEYLLQANP
                     VIGADPSIFKEVYLARIELAFYILYSFAKTKKSVPDSKLTSLLLGATDTIKSKEVAFL
                     QSVVNPVRCSYYRPLIRSILIIFSLVKNKTIFVESLSDHILEYFELTFGKGVNLVLSS
                     LLSEINTFVSHGKKPVIVNLADKIQDLFLLLSTFTKIKDLHPPSSFEMVMASSLNEVG
                     TIKTILNLYSSSHLLDFEKEPVLCDLSLTFITELCSVESVAEKMINNGLFSVLLESPI
                     SVAIQQGKITPQHQPRLHTIWSDGLLTIVLQLLSKFGKRVLPECCLFVSYFSQQISSA
                     IASWSDQSLAVSTAVIKETSQLIMLQQLFNALDYQEYLTDSNMRTKVVDNTEIIELFF
                     GLDTDAEKRELSASFRHLLTHPKYLNSRIVPTTLEEHRLLESEDTRSQFVKRIVLGIK
                     DLQEGLFAGDAC"
     gene            complement(<374543..>375460)
                     /locus_tag="KLTH0C04312g"
                     /db_xref="GeneID:8291278"
     mRNA            complement(<374543..>375460)
                     /locus_tag="KLTH0C04312g"
                     /product="KLTH0C04312p"
                     /transcript_id="XM_002552367.1"
                     /db_xref="GeneID:8291278"
     CDS             complement(374543..375460)
                     /locus_tag="KLTH0C04312g"
                     /note="similar to uniprot|P28239 Saccharomyces cerevisiae
                     YMR267W PPA2 Mitochondrial inorganic pyrophosphatase
                     required for mitochondrial function and possibly involved
                     in energy generation from inorganic pyrophosphate"
                     /codon_start=1
                     /product="KLTH0C04312p"
                     /protein_id="XP_002552413.1"
                     /db_xref="GeneID:8291278"
                     /db_xref="GOA:C5DDW4"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:C5DDW4"
                     /translation="MIRSINAVKAPLRRLLMTKSHLEVPSYGKVIQGSKYTPEYAQYL
                     RLPNGEVGSFFHDVPLDLDREQQTVNMVVEISRWTNAKFEISRNRPFNPIIQDQKNGK
                     VRFVDNIFPSHGFIHNYGAIPQTWEDPTVESSHEGVRGIKGDNDPLDCCEIGSSVLSM
                     GDVKKVKILGSLALIDNGELDWKVLVIDVNDPLASKINNIDDIEIHFPNLLEATRNWF
                     RDYKIPTGKPPNEFAFDGQYRGLTETMNVIQECHGSWRKLLRDSETNDSLPQIVRAGS
                     GVVIKPEELPDAPVPKAVGTWHFIKKEKD"
     gene            complement(<375721..>378420)
                     /locus_tag="KLTH0C04334g"
                     /db_xref="GeneID:8291279"
     mRNA            complement(<375721..>378420)
                     /locus_tag="KLTH0C04334g"
                     /product="KLTH0C04334p"
                     /transcript_id="XM_002552368.1"
                     /db_xref="GeneID:8291279"
     CDS             complement(375721..378420)
                     /locus_tag="KLTH0C04334g"
                     /note="similar to uniprot|Q03516 Saccharomyces cerevisiae
                     YMR266W RSN1 Overexpression rescues sro7/sop1 in NaCl.
                     Encodes a membrane protein."
                     /codon_start=1
                     /product="KLTH0C04334p"
                     /protein_id="XP_002552414.1"
                     /db_xref="GeneID:8291279"
                     /db_xref="GOA:C5DDW5"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:C5DDW5"
                     /translation="MTTTTTTTSTSGVVSSLVFNLALFGGFVAAFVILRLKLKRIYEP
                     KSSFDLINEEKKPEPLPRGIWQWFLPLVKKSDNFVIQQAGLDGYFFIRYLFILASFFA
                     TISLLVLPILLPINAANGREKSGLEMLAYNNVDDAHRSRYYAHVFVGWVFYWGFLFVV
                     YRELVYYTSLRQAVLSSPRYAKKLSSRTVLFQSVPRQYLVESEFSKLFDGVRNVWIAR
                     GAGDLGSKVNERNKMAMKLEAAETVYLKTAVKNIAKLKKKNPDFKPTSNISDYVPQKK
                     RPQHRLKFLIGKKVDTIDYLKEELPKLNEEIKDLQRGHMEHAPFNSVFVEFDSQHSAQ
                     IASQSIIHHEPLAMVPSYIGIAPKDVLWFNMRMHWFERALRKYGALSFIIALVVLWAF
                     PVAFVGAISNIQNLTNTLTWLRFIYKLPKKLLGILTSVAPTVALAVLMMLLPIVIRKM
                     ALVAGAPSVQLVEAFTQQAFFAFQVIQVFLVTTLASSATAAVTQIIENPSSAMSLLSK
                     NLPLSSNFYISYIILQGLSVSSGALLQLVALIMFYILSFLLDNTARKKWNRFVNLGSM
                     AWGTTYPVYTNLAVIVFSYAIIAPIILVFAAVAFFLLYVAYLYNLTYVFQESPDSRGI
                     HYPRALFQTFVGLYIGQICLLGLFVVGKGWGPIVLQAICLGVTTFVHLNFNTAFDTLM
                     AHVPVDTMKPLDGVSNTPSFSNNKTRSLEKDEIQELPHFPIKKYQPRVSTSIDQKTMS
                     VKSENTIEYNGNIAYDNENNLATVPLLADGESVDMPAAPFWKRYFQPHIYLSYKAVKH
                     VLPEIYGLPEPIPEVEKDNQKHAYDYPAVSAKCPYLWIPRDPYGFSTIEISNLQSTVD
                     ITDQGAYLSEEGHVLWEGAPPSLDDSERKYDNPFREEDEDEFE"
     gene            <379281..>380711
                     /locus_tag="KLTH0C04356g"
                     /db_xref="GeneID:8291280"
     mRNA            <379281..>380711
                     /locus_tag="KLTH0C04356g"
                     /product="KLTH0C04356p"
                     /transcript_id="XM_002552369.1"
                     /db_xref="GeneID:8291280"
     CDS             379281..380711
                     /locus_tag="KLTH0C04356g"
                     /note="weakly similar to uniprot|Q03508 Saccharomyces
                     cerevisiae YMR265C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04356p"
                     /protein_id="XP_002552415.1"
                     /db_xref="GeneID:8291280"
                     /db_xref="InterPro:IPR018812"
                     /db_xref="UniProtKB/TrEMBL:C5DDW6"
                     /translation="MTNISPQDETWVQIDHRPLFQWNSCAEFLDPPKTVKKHEIRRID
                     IYDFDNTLFKSPAPNPNLLSSFMINVLTDPNKLSNGGWWSEKRFLQESIDEWIAAKKN
                     AGTDTDEVDATYWNKDVVELTRLSQQDPHTLSILMTGRKELLFQSALSCVLEQPVFGP
                     KKLHFNGVFLKKPNFETTMLYKTTCLTDLLKHYNNCDEITIYDDRVRQLQGFKKFLNE
                     FVEALRPSLQFNLIHVAGLIKYLNPPRERSTITTIFDEHNAAVTKCIYQQQESKTGSF
                     YMGKMYVKEKRLGAAYILTTLSRQKVLKLTMRKFGHMKELFNDRTHFTAKFIPCTPHG
                     TITSQKVATMVLEGSHEEPTEETIETTMSLMNSGKEDPRIQFRLTRFGRSARGIFVYD
                     AEPVPSSRFVYSDFPALRLAVTAAADQESETASELYDDDQFQWTALDNDDTTIETNFG
                     YEFVITAVMGKKPKRSKKQTTFKMRQ"
     gene            <381355..>382860
                     /locus_tag="KLTH0C04378g"
                     /db_xref="GeneID:8291281"
     mRNA            <381355..>382860
                     /locus_tag="KLTH0C04378g"
                     /product="KLTH0C04378p"
                     /transcript_id="XM_002552370.1"
                     /db_xref="GeneID:8291281"
     CDS             381355..382860
                     /locus_tag="KLTH0C04378g"
                     /note="similar to uniprot|Q04199 Saccharomyces cerevisiae
                     YML102W CAC2 Component of the chromatin assembly complex
                     (with Rlf2p and Msi1p) that assembles newly synthesized
                     histones onto recently replicated DNA required for
                     building functional kinetochores conserved from yeast to
                     humans"
                     /codon_start=1
                     /product="KLTH0C04378p"
                     /protein_id="XP_002552416.1"
                     /db_xref="GeneID:8291281"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DDW7"
                     /translation="MEASNLQIYWHESQPIYSLCFQSTGPPKARRLVTAGGDNKIRVW
                     QLNFEERNAFRVDSIDFLSSLTQHEQAVNVVRFNSTDDILATAGDDGQLLLWKKNDSM
                     AKEFGVDEEEFADFKESWHVWKRLRPATTGGASEIYDLCWSPDDNYIVTGSMDNSVRV
                     FDVNEGSCVASAVDHNHYVQGVAWDPQNEFILSQSADRSVHLHKLVRDAGGAISGLKF
                     SSKITKGDLPCRKAPNSTELELDNVKSAFLFHNETLPSFFRRLAISPCGNLVCVPAGI
                     FKNCDSQSESGNGNDELANAVYLFTRAYLEKHNNRPSLVIPFLKKPALVISFNPHLYQ
                     LSKQDHPCVKLPYKLLFAVATSDEVLIYDTETAKPVCIVGNLHYTPITDLSWSKDGAM
                     LMISSTDGFCSYISFKNEMLGNLYDNEVQKGIQTNEAISTAPIKKPSIVNILPIKRKS
                     SPRDKNPSEQITSAQVESKVQVQQVSNISKPSDSHDETKPTKRRVKPTLLL"
     gene            complement(<383002..>383586)
                     /locus_tag="KLTH0C04400g"
                     /db_xref="GeneID:8291282"
     mRNA            complement(<383002..>383586)
                     /locus_tag="KLTH0C04400g"
                     /product="KLTH0C04400p"
                     /transcript_id="XM_002552371.1"
                     /db_xref="GeneID:8291282"
     CDS             complement(383002..383586)
                     /locus_tag="KLTH0C04400g"
                     /note="similar to uniprot|P38428 Saccharomyces cerevisiae
                     YMR264W CUE1 Endoplasmic reticulum membrane protein that
                     recruits the ubiquitin-conjugating enzyme Ubc7p to the ER
                     where it functions in protein degradation contains a CUE
                     domain that binds ubiquitin to facilitate intramolecular
                     monoubiquitination"
                     /codon_start=1
                     /product="KLTH0C04400p"
                     /protein_id="XP_002552417.1"
                     /db_xref="GeneID:8291282"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:C5DDW8"
                     /translation="MDSYSLTFFVIVIATFISVKWLLKSESHPSAQRAEASVSATSSS
                     RSTNQSSSTRRRKRRTVTDNMIEVVQSLAPNLHIEQIRYNLEQTGSVEETVEAFLRGD
                     EFSFPPGYTPEVPEPTSHQNTNGSETADPRKKSNIHPDNLLAKYKVDPSEDMSNVDYL
                     SLSIEERKRFLVWQARRDMARTLQQDETLSALLK"
     gene            complement(<385542..>386348)
                     /locus_tag="KLTH0C04422g"
                     /db_xref="GeneID:8291283"
     mRNA            complement(<385542..>386348)
                     /locus_tag="KLTH0C04422g"
                     /product="KLTH0C04422p"
                     /transcript_id="XM_002552372.1"
                     /db_xref="GeneID:8291283"
     CDS             complement(385542..386348)
                     /locus_tag="KLTH0C04422g"
                     /note="weakly similar to uniprot|P53133 Saccharomyces
                     cerevisiae YGL117W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04422p"
                     /protein_id="XP_002552418.1"
                     /db_xref="GeneID:8291283"
                     /db_xref="UniProtKB/TrEMBL:C5DDW9"
                     /translation="MVESVPKALSSNRLLLSQIANELCASLAKPTLELIDILIEALMY
                     PRGNGNSLMDWTLDAENHSVLAEKHQYVHEDLGYGCILELVHARQLLAKLNTRMPTPS
                     PDFTVTLLTISEEIHDVLVHLLAHLKGQANRSTESDLYKNIVRENLPHFRHSFCNFNT
                     LDNILRQLREFSENTSSSNGEGFQIAPKTMESIKTFSSDNSHWFEELMLGSQALREYL
                     LLQDYHTDYLDRINTSSIPRGISSEIHSSDFGIFLQVRKSKLKISHRKVF"
     gene            complement(<387195..>387707)
                     /locus_tag="KLTH0C04444g"
                     /db_xref="GeneID:8291284"
     mRNA            complement(<387195..>387707)
                     /locus_tag="KLTH0C04444g"
                     /product="KLTH0C04444p"
                     /transcript_id="XM_002552373.1"
                     /db_xref="GeneID:8291284"
     CDS             complement(387195..387707)
                     /locus_tag="KLTH0C04444g"
                     /note="similar to uniprot|P38429 Saccharomyces cerevisiae
                     YMR263W SAP30 Subunit of a histone deacetylase complex
                     along with Rpd3p and Sin3p that is involved in silencing
                     at telomeres rDNA and silent mating-type loci"
                     /codon_start=1
                     /product="KLTH0C04444p"
                     /protein_id="XP_002552419.1"
                     /db_xref="GeneID:8291284"
                     /db_xref="InterPro:IPR024145"
                     /db_xref="InterPro:IPR025718"
                     /db_xref="UniProtKB/TrEMBL:C5DDX0"
                     /translation="MPPKSHNSNSESESRTRSGAANHTGANSSAGTRNNGKQRLTTAQ
                     QQYLRDLIKTHVHNNHPCNFEKPHPVDFEAYSDDFLRRYKDHFQLPLEDNLSLPGYLL
                     GSKLGEKTYSSKRNAPNIPDARVTKKQLATEVKRHFMSYGVKETECIPAFIYKVKNQK
                     RRFRMEFKPT"
     gene            complement(<387790..>388725)
                     /locus_tag="KLTH0C04466g"
                     /db_xref="GeneID:8291285"
     mRNA            complement(<387790..>388725)
                     /locus_tag="KLTH0C04466g"
                     /product="KLTH0C04466p"
                     /transcript_id="XM_002552374.1"
                     /db_xref="GeneID:8291285"
     CDS             complement(387790..388725)
                     /locus_tag="KLTH0C04466g"
                     /note="similar to uniprot|P38430 Saccharomyces cerevisiae
                     YMR262W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04466p"
                     /protein_id="XP_002552420.1"
                     /db_xref="GeneID:8291285"
                     /db_xref="GOA:C5DDX1"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:C5DDX1"
                     /translation="MGALYVDAHCHVTTSVERQNVALKVPEVAIERCFMSNNTFDWHQ
                     VKCLGSSDQKGLSSIGFGVHPWYSHLYYTGEVPATAQGHYQQVLQGGSAEELEQVIAQ
                     LPPPTGLSEYIANEFDPARVCCVGEIGLDKLFRLPGNGFYQGDQRAPLGRVRVRIEHQ
                     VQIFKKLCALAVKHSLPVSVHCVKCPSLMYDLCKEHLLPHAGVKICLHSFTGSLETLE
                     SFWLAQFPHERLFVSVSRYINFKAVESGLQLLQKLPLKCVLTETDFTWDTTEPDRLLQ
                     ELEFLVQQVAEAYQLDSPEVAKGAIYQNFQRFKGH"
     gene            <388986..>392303
                     /locus_tag="KLTH0C04488g"
                     /db_xref="GeneID:8291286"
     mRNA            <388986..>392303
                     /locus_tag="KLTH0C04488g"
                     /product="KLTH0C04488p"
                     /transcript_id="XM_002552375.1"
                     /db_xref="GeneID:8291286"
     CDS             388986..392303
                     /locus_tag="KLTH0C04488g"
                     /note="similar to uniprot|P38426 Saccharomyces cerevisiae
                     YMR261C TPS3 115 kD regulatory subunit of
                     trehalose-6-phosphate synthase/phosphatase complex and to
                     YML100W uniprot|P38427 Saccharomyces cerevisiae YML100W
                     TSL1 123 kD regulatory subunit of trehalose-6-phosphate
                     synthase/phosphatase complex; homologous to TPS3 gene
                     product"
                     /codon_start=1
                     /product="KLTH0C04488p"
                     /protein_id="XP_002552421.1"
                     /db_xref="GeneID:8291286"
                     /db_xref="GOA:C5DDX2"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DDX2"
                     /translation="MVVIVVSLFLPFQPQFEIDASEGDAAALIESQPVKLPSNSYAGP
                     ESGDSLRKNRANSVHSNSPFLGSDLGDSEHANPGVSREADGTPAKGPVTDISSEKFME
                     NLTANAHNTGATGTPVNPIHNHANTSVEEFFSSHSSAAPLANLNQSGASSKNYSATST
                     PGTEAIFSPVPTHDPTANLLRNVNKSLYQNVVSGGASPVLPAAFEGNTPPQASQPSGT
                     VITPKSRELPDLNSSVVDLPKAKQQQYSLPAMRRVHRKSSNASPPPVEAKEFKAQPHL
                     AKHALVPSALKNEVIEESDSDNFLSDNEGDERSRVPQFGGYSNTARTRSALLRGSKNI
                     FGRVPWKIVASGKGNGGLKNAITTAAAEKTIPEPVKWIGTMGIPTDSVPGNVLKDVSN
                     ELSSNYNSVAIISDDITFKGAYKNFCKQILWPTLHYQIPDNPKSKAFEDHSWNYYQDL
                     NQSFADKIVETYNDGDIIWIHDYHLMLVPGMVRQKIPDAKIGFFLHVSFPSSEVFRCF
                     AQRESILNGIVGANYVGFQTEEYARHFLQTANRLLMTDVDTKTLKYRGRVIEVGSAPI
                     GIDAFILESELRSEQVQNWRQLIRGRWAGKKLIIGRDQFDRIRGLRKKLLAYERFLRA
                     NPDYVSRVVLIQICLGSDKDPDLEREIMIVVDRINALSPDISVSQPVVFLHQDLEFAQ
                     YLALNCEADMFLITTMREGMNLTCHEFIVCSREKNAPLLLSEFTGSASTMKDGAFLIN
                     PWDTKQIAQDIKTALDLSPEEKRRRWKELYKSIMRNDSDFWIKHSLSEINTSWDFNQE
                     RSTVFNLSLDSLLSSYKSSKKRVFILKLSEPPTARIISILSDLSATNIVYAFSSFSRN
                     MMERLYTRTPNVGLVAENGAFVRLNGHWFNIVEDNSWKDDVIKVIEDKVERLPGSYYK
                     AGESLVRFHAENAEDQDRVSGVVGEAITHINTLFGDRGIHAYLHKNIVFVQQVGLALK
                     AVQFLMGYFNSISSTTNTTPQHSVENSPLLSPMMSQGMANDVTSPGAQSSGSSYFSLG
                     RNVTHVDFLAITGSSSPVIEPLFDYVNDLAKKRSIKTGYSVVYGISSLSTYAKDHVEG
                     LNELFSMLEKLIESHQN"
     gene            <392581..>393042
                     /locus_tag="KLTH0C04510g"
                     /db_xref="GeneID:8291287"
     mRNA            <392581..>393042
                     /locus_tag="KLTH0C04510g"
                     /product="KLTH0C04510p"
                     /transcript_id="XM_002552376.1"
                     /db_xref="GeneID:8291287"
     CDS             392581..393042
                     /locus_tag="KLTH0C04510g"
                     /note="highly similar to uniprot|P38912 Saccharomyces
                     cerevisiae YMR260C TIF11 Translation initiation factor
                     eIF1A"
                     /codon_start=1
                     /product="KLTH0C04510p"
                     /protein_id="XP_002552422.1"
                     /db_xref="GeneID:8291287"
                     /db_xref="GOA:C5DDX3"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018104"
                     /db_xref="UniProtKB/TrEMBL:C5DDX3"
                     /translation="MGKKNTKGGKKGRRGKNDSDGPKRELIYKDEGQEYAQITKMLGN
                     GRVEASCFDGNKRMAHIRGKLRKRVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEART
                     LKNQGELPENAKINETDNFGFESDEDVNFEFGNADDDDDDEDDDELDIDDI"
     gene            complement(<393219..>394286)
                     /locus_tag="KLTH0C04532g"
                     /db_xref="GeneID:8291288"
     mRNA            complement(<393219..>394286)
                     /locus_tag="KLTH0C04532g"
                     /product="KLTH0C04532p"
                     /transcript_id="XM_002552377.1"
                     /db_xref="GeneID:8291288"
     CDS             complement(393219..394286)
                     /locus_tag="KLTH0C04532g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C04532p"
                     /protein_id="XP_002552423.1"
                     /db_xref="GeneID:8291288"
                     /db_xref="GOA:C5DDX4"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="UniProtKB/TrEMBL:C5DDX4"
                     /translation="MEDKYIGLVLAITSSLAIGSSFILTKMGLNAASERNNNEGAGYE
                     YLKNPIWWGGMATMAVGEVANFAAYTFAPAIMVTPLGALSVIIGAVLAAIFLKEELGT
                     LGKLGCAICLLGSVIIILHAPSDKDIETVDEILGYAMQPAFVLYALLVTAFAVFMISR
                     VVPVYGTKNPMVYISICSTVGSISVMAIKAFGIALKLTLSGNNQFTHLSTYVFIIVVV
                     VCIMTQMNYFNKALDQFDTSIVNPLYYVTFTTATLTASFILFRNFDESNTKDSASLIC
                     GFLIIFSGVYLLNLARKKNHSRLFSHQQDVENIPLDNNIGGFVRKSFQGTHHRVASQT
                     YQSEEMVHLTGEDEDVERFRV"
     gene            <394461..>398741
                     /locus_tag="KLTH0C04554g"
                     /db_xref="GeneID:8291289"
     mRNA            <394461..>398741
                     /locus_tag="KLTH0C04554g"
                     /product="KLTH0C04554p"
                     /transcript_id="XM_002552378.1"
                     /db_xref="GeneID:8291289"
     CDS             394461..398741
                     /locus_tag="KLTH0C04554g"
                     /note="similar to uniprot|Q03496 Saccharomyces cerevisiae
                     YMR259C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04554p"
                     /protein_id="XP_002552424.1"
                     /db_xref="GeneID:8291289"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019442"
                     /db_xref="UniProtKB/TrEMBL:C5DDX5"
                     /translation="MSNEDGCKAIKQFLIGLKPQQVKNDTTISEKLCSCFISVITALR
                     NENAINDSERLVLTDSISIWFLRSRQLLEMEQDQQGCSPFLQKLRTDILTIENCTFLF
                     HYVIDYWNEGGAALANSLSDLFTKLLQLMKLVHSTAVFQETLDGWLSQVLDIPASMRV
                     LYYLLDVFASETSMYKVLQSKPNFVADSLGLMWTESLATPIGKCVTSVLLNVYEGHYR
                     KCKRREDLEEWFLLWEGPTLRYFQDPRISKRIEICILVPIFKSLSNNIFGQFVNRNFE
                     SEAPALIPLLKIGQELSIEEEPFDGDKLVSLKFVEELLQQDAYKLSAFELLTFSAKKS
                     KVIAPYIYDVIKRNIHVFFVDIEVRTRNAFHSVLKHFIDRVRDSSYSLNRDFISLHAK
                     NKFPDEQAQKLQQIDDAIDFLQWLTGFLKTQLLPGSQYQRKILSTKILKTLASSSIDP
                     SIGQPYLDPRLRTPFPFSCKLSEDETLQRLLIDNLTDNYNDIRENCLQLLTMFAYSKT
                     PTGTENLEAVSRKSWELLKSYKNCDGGAKLIEFLVEISDDKSTLVYVLVKELQKKIIK
                     SGASFKEAIKTPISGYFLALSYILQKSDAIPETVTLRSIIDECISLMNNNWKVVEFAL
                     CDDPFEKNTQTQHDICEVSDPLVISYAFRSIKESAGLLAALIRLPGLTIKQLTACGEL
                     MLAQMSTIRHSGAFQSLIPSFAACCRRSNTDIPQQLQVWLEEILNRLETKTQFITRRS
                     GGLPHIITSILGAEDNKNRPLLKVTFDKLFSIASLPVSEHEEQVDLPQVNAFNCIKAL
                     FVESSLSAACSPYVYPSLVLCLQSFTSPLWSIRNCSYMLFSALQNRLFGKAGKSVSAR
                     LFFSRFSGIREILLDQFKSSVKNSLCYQDTAEGSSLSSGMDSQIVSIFLVMTILSRLK
                     QTPGFEGLKEFESLVIKCLGSHNWTLRQLAARTLPSMSDNTIDLAKLLLKKLTLASTN
                     QNMMHGCILAVSELIKITMESSNSCSLPDELSQLVERGISRAITSNNCFVTANAYVGL
                     VELLYSSGSISKTCVSSWLPKLGEHFVKLNTSYSVDGTRQLCLRSLLLFLLRHENEDN
                     LQDVLLLGLYSPYFKVQIAAAQYICTNDKAAHVKTNAIADRLLEILFEDNAWDYVKLS
                     VLRSLIVLEKEVDTSALMKLVISARNDELRAVALEYLGFFVDKNNSQYDYYVKHFSRD
                     QSPFELRKSALKSLINFSKRNSDIRASFLISRFLYDDDQELRMLSASFINQCVLGLKG
                     FRQSTTSAVTADLFFDTMESYPQLPNGFDTVILEALQRDVGTISFQKYVGAGKEDLFE
                     VEPENQFRNTIEEASRFIGVLKCFFKESSSVQAYISTLLDELIAQISDVGISDAPLGW
                     GSDFRIFTQIVLARKIAIEFGVEGLQKLDKLLIAVNCNPLIFEITSLV"
     repeat_region   399913..400173
                     /rpt_type=long_terminal_repeat
     gene            400233..400306
                     /locus_tag="KLTH0C04598r"
                     /db_xref="GeneID:8291291"
     tRNA            400233..400306
                     /locus_tag="KLTH0C04598r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:8291291"
     gene            <400445..>402091
                     /locus_tag="KLTH0C04620g"
                     /db_xref="GeneID:8291292"
     mRNA            <400445..>402091
                     /locus_tag="KLTH0C04620g"
                     /product="KLTH0C04620p"
                     /transcript_id="XM_002552379.1"
                     /db_xref="GeneID:8291292"
     CDS             400445..402091
                     /locus_tag="KLTH0C04620g"
                     /note="similar to uniprot|Q04847 Saccharomyces cerevisiae
                     YMR258C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04620p"
                     /protein_id="XP_002552425.1"
                     /db_xref="GeneID:8291292"
                     /db_xref="UniProtKB/TrEMBL:C5DDX6"
                     /translation="MTSREMHDGLWPAVMEFLNQNDLLILAQTSKKLSKVSLQNLYGR
                     IVISKEPVMRSDEWFLDCSANYVSGYRSTKKTPDQNDIFLYDRIKRLTESSHLALVKE
                     LVIQEDVFYDRESGLPVLQALIDRLLELDQVEVLDIRDSALFEHNYSKILELTHLRKC
                     RVVNIGDLGKLRSLPRIKSLEISLTHPDFKPRCLSDDVKKSLSDTVVELTVDDLEHSS
                     LRLFQYFHKEGMRLGHVTSLKFNHVHGIHDYNKTMRELTTIFLKDVFDLKKIESLELE
                     GSCEASDCTCFNDFLMDMAPELVSVRSLGLIEKNFVTQGDHNTEEEWDLTINRFILHI
                     PKVSERLKNLTVRHNPPLNGITVDSVEGNYIRRRTLYDNVLPILTNLQTLVGPTFLKS
                     LSAYEILVCDLLWNGCECSFCAKVLPVIDQYIMNHQYYSFPDGSFKDVIPTVFFAYTG
                     DALSRRFITETDWDLKTLATCPVSHVWDLHGYESLQHFKNFDCFFDESVFMALTKCVS
                     HFFNTYMDHLVKFMPNMRTCVLSGVYYSVDEQGKYKSIYD"
     gene            <402533..>404860
                     /locus_tag="KLTH0C04642g"
                     /db_xref="GeneID:8291293"
     mRNA            <402533..>404860
                     /locus_tag="KLTH0C04642g"
                     /product="KLTH0C04642p"
                     /transcript_id="XM_002552380.1"
                     /db_xref="GeneID:8291293"
     CDS             402533..404860
                     /locus_tag="KLTH0C04642g"
                     /note="weakly similar to uniprot|P08468 Saccharomyces
                     cerevisiae YMR257C PET111 Specific translational activator
                     for the COX2 mRNA located in the mitochondrial inner
                     membrane"
                     /codon_start=1
                     /product="KLTH0C04642p"
                     /protein_id="XP_002552426.1"
                     /db_xref="GeneID:8291293"
                     /db_xref="UniProtKB/TrEMBL:C5DDX7"
                     /translation="MSSVKSPHGFLQFLRPFRLRESCIQRGIFLRRYNPPQNDRSKDV
                     LREWAKSVLHESSPESASECSFDKEIQLSTQIDRATETSLKNGSVFPDHQERAKEPSA
                     RAIAQSTRGSSPLKTFSMSTLSNIASSLQKSHKFQEIDSIYKTHRNWLSSGVVDRSSR
                     AYNEFVQAVFAAEYRLQNFTLCENLFSECLKFRPVSPEVIDMGLITFVKNNNLTLAKE
                     FYVQILKNPETFPMTPNTLHAFAFEIFKTSDLATMERVISLWLENSSSPKTYPFHKTL
                     ALFHRLLLKLGDEEGIAKLLSHSGVIKTKYEGSTEFDLCLLHHEVAARMLTDHVKIGH
                     RMDEISSKMSNEKRSKVYIEVLKLGVAKNDFSLIKLATVKAQEDSFVNLNDEFHKHVC
                     RYFVKNGLLKSLVQYLNDAVLPKADCRFGQIYIEQLWNCALQNYPMLSREFTNDIQLL
                     LNKEELIREHEWLEYTTLRKLKNFSSNHGLQKSPTQTLSSLCCRLGPEFANAIQTSLA
                     DGDASAIRSLILNELQRGVRPDFTVFYSLLKLLMPDYIDSAKLVDQIMRETYREIPLK
                     IDILWLKHNALEATKSIRTNASTPAGKQQAALVAATKIKDFENQHSGRLNFQNYMQLS
                     SLFLVLRDARNASHLLEKGKKLINSSNKRDWYIYYSNALKVYTRARDPGKFLSVLKDW
                     NANDSAWLITPDTIRSCKGYMKYFERNQGLTAHNSATLFEIHSEIDSMLARYVNFKFQ
                     GLNDMKMVSSFLQRWIEQDLKKKKENHLSDVQSEA"
     gene            <405366..>406286
                     /locus_tag="KLTH0C04664g"
                     /db_xref="GeneID:8291294"
     mRNA            <405366..>406286
                     /locus_tag="KLTH0C04664g"
                     /product="KLTH0C04664p"
                     /transcript_id="XM_002552381.1"
                     /db_xref="GeneID:8291294"
     CDS             405366..406286
                     /locus_tag="KLTH0C04664g"
                     /note="some similarities with uniprot|Q12161 Saccharomyces
                     cerevisiae YOL054W PSH1 Nuclear protein putative RNA
                     polymerase II elongation factor isolated as
                     Pob3p/Spt16p-binding protein"
                     /codon_start=1
                     /product="KLTH0C04664p"
                     /protein_id="XP_002552427.1"
                     /db_xref="GeneID:8291294"
                     /db_xref="GOA:C5DDX8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C5DDX8"
                     /translation="MYVPVMTSCGHNYCYECISNWLVSNNANELTCPQCRSPLKEPPA
                     LNVALQNLLNYVVDNYAISSLQTDGTRAESVDQYRDDNFSGRLFKNVFNNTAMAIVDD
                     DDGVARCSNCHWEVEGDVCPHCSARMRNRAVEEEEFPSDEYSEDEIERIQYGANRALG
                     VRDEQGADEHSESDSESDESNFERRNGTLANISGHAQLGRSRRRFDGSQHGSEDLMNS
                     EGAMESEDAEDSDLDSFIVNEEEEDEIGGEQEEPEQVELDGSDHDSDFYEHHDIDGFV
                     SGDSLDNDSEDGHKKRKRRIQVVLDSDEDD"
     gene            <406899..>407081
                     /locus_tag="KLTH0C04686g"
                     /db_xref="GeneID:8291295"
     mRNA            <406899..>407081
                     /locus_tag="KLTH0C04686g"
                     /product="KLTH0C04686p"
                     /transcript_id="XM_002552382.1"
                     /db_xref="GeneID:8291295"
     CDS             406899..407081
                     /locus_tag="KLTH0C04686g"
                     /note="highly similar to uniprot|P10174 Saccharomyces
                     cerevisiae YMR256C COX7 Subunit VII of cytochrome c
                     oxidase, which is the terminal member of the mitochondrial
                     inner membrane electron transport chain"
                     /codon_start=1
                     /product="KLTH0C04686p"
                     /protein_id="XP_002552428.1"
                     /db_xref="GeneID:8291295"
                     /db_xref="UniProtKB/TrEMBL:C5DDX9"
                     /translation="MANRIIELQKLFQSSQKPLWWRHPRSAFYMYPFWALFTVAVVGP
                     FLYIPNTIRGIKDKRN"
     gene            <407666..>408628
                     /locus_tag="KLTH0C04708g"
                     /db_xref="GeneID:8291296"
     mRNA            <407666..>408628
                     /locus_tag="KLTH0C04708g"
                     /product="KLTH0C04708p"
                     /transcript_id="XM_002552383.1"
                     /db_xref="GeneID:8291296"
     CDS             407666..408628
                     /locus_tag="KLTH0C04708g"
                     /note="weakly similar to uniprot|Q05667 Saccharomyces
                     cerevisiae YOL053W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04708p"
                     /protein_id="XP_002552429.1"
                     /db_xref="GeneID:8291296"
                     /db_xref="GOA:C5DDY0"
                     /translation="MLTRSWRQRNLASLLYSLSHRRLLSQKIPDPKHVFTDPSNNEIV
                     DSKHFFTNPSRDNLIEEEAIAKSIEASIKNQRRRRGKQVSSALAAALFATIFGYTIGY
                     KVLYLHEHSFIPAYPVPKARNFSSNELKHINVDEIKHLAEYKLLEKLSMHPMIKEQYG
                     VPLHKSQGISLESRQFSVWRQDVDPCIAGILIAPIDSPKDEHTWHNVPPLCKWRITNR
                     SVNFRSFADQVLGRVGIDSSDLIQVIKPEKDCGDFKYGRPPHHSDGPRTMHICFLGEM
                     KLGNEDLIIFRGTCHIDLKLQQVDLLRKENDKLVRYVLYHETKE"
     gene            complement(<408668..>409342)
                     /locus_tag="KLTH0C04730g"
                     /db_xref="GeneID:8291297"
     mRNA            complement(<408668..>409342)
                     /locus_tag="KLTH0C04730g"
                     /product="KLTH0C04730p"
                     /transcript_id="XM_002552384.1"
                     /db_xref="GeneID:8291297"
     CDS             complement(408668..409342)
                     /locus_tag="KLTH0C04730g"
                     /note="some similarities with uniprot|Q04839 Saccharomyces
                     cerevisiae YMR255W GFD1 Coiled-coiled protein of unknown
                     function identified as a high-copy suppressor of a dbp5
                     mutation"
                     /codon_start=1
                     /product="KLTH0C04730p"
                     /protein_id="XP_002552430.1"
                     /db_xref="GeneID:8291297"
                     /db_xref="InterPro:IPR020401"
                     /db_xref="UniProtKB/TrEMBL:C5DDY1"
                     /translation="MSLNSSIWASPSTDSEDRSALDSKTNGLGSSMWASASVSSTQRK
                     SRRKSSSCNRKKEPSRTNKQEKPSKPSTGNALAARLGMLDLNKPLDSPQKQEGPKKNR
                     RASPPQEKKSSNSLAARLGMVEDSESSGDSDSEDVTRPSTSDKKSIFDRIKPKRETKN
                     DSSLERGSGAGKQAAKHGSKMELLKQKVEEQKRIKETNQHKSQQTELLKDFLNDDASF
                     NWEDEL"
     gene            <410449..>411567
                     /locus_tag="KLTH0C04752g"
                     /db_xref="GeneID:8291298"
     mRNA            <410449..>411567
                     /locus_tag="KLTH0C04752g"
                     /product="KLTH0C04752p"
                     /transcript_id="XM_002552385.1"
                     /db_xref="GeneID:8291298"
     CDS             410449..411567
                     /locus_tag="KLTH0C04752g"
                     /note="similar to uniprot|Q04835 Saccharomyces cerevisiae
                     YMR253C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="KLTH0C04752p"
                     /protein_id="XP_002552431.1"
                     /db_xref="GeneID:8291298"
                     /db_xref="GOA:C5DDY2"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:C5DDY2"
                     /translation="MTEVPRSETAGNKSNDSRLQRLSSEYLKPNIGLLYLLISNLFNS
                     VMVVSTKLLETDPELEEPITPLQILVVRMFITYIGTLIYMLYNRDRIDHVPWGPPDMR
                     KWLILRGCTGFFGVFGMYYSLMYLSVPDATIITFLGPSFTGLLAWAILRERYSKVEAT
                     GALVSLMGVILIVRPSFLFGSSATDDSGGTAESRDPHARLVATIVALVGVIGASNVYI
                     IIRYIGQRAHAIMSVSYFALIACCVSLVGICVIPSMGFQIPQTSKQWFLFTLIGFSGF
                     FMQLLLTMGIQRERAGRGAIMSYSQIIYAIFWDVFIWHHLPGLWSWCGIIVILGSAIW
                     VVKCKPKSEFIATATTDQESQVIQMEDFEIHDDEDDIK"
     gene            <411715..>412092
                     /locus_tag="KLTH0C04774g"
                     /db_xref="GeneID:8291299"
     mRNA            <411715..>412092
                     /locus_tag="KLTH0C04774g"
                     /product="KLTH0C04774p"
                     /transcript_id="XM_002552386.1"
                     /db_xref="GeneID:8291299"
     CDS             411715..412092
                     /locus_tag="KLTH0C04774g"
                     /note="similar to uniprot|Q04814 Saccharomyces cerevisiae
                     YMR252C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04774p"
                     /protein_id="XP_002552432.1"
                     /db_xref="GeneID:8291299"
                     /db_xref="UniProtKB/TrEMBL:C5DDY3"
                     /translation="MFRFQAPFATLSRRQSTFAYKKWVDLETSQRQQFIKGFVENYRK
                     QYPGSKTNVSLKGLALGMEDHADAPTVFGIFYDDIWGLCKKSKESLYSGEKSAAQRND
                     IKQTGRFGHESFYDLLVGKEGDH"
     gene            complement(<412133..>413842)
                     /locus_tag="KLTH0C04796g"
                     /db_xref="GeneID:8291300"
     mRNA            complement(<412133..>413842)
                     /locus_tag="KLTH0C04796g"
                     /product="KLTH0C04796p"
                     /transcript_id="XM_002552387.1"
                     /db_xref="GeneID:8291300"
     CDS             complement(412133..413842)
                     /locus_tag="KLTH0C04796g"
                     /note="weakly similar to uniprot|P22580 Saccharomyces
                     cerevisiae YDR242W AMD2 Putative amidase"
                     /codon_start=1
                     /product="KLTH0C04796p"
                     /protein_id="XP_002552433.1"
                     /db_xref="GeneID:8291300"
                     /db_xref="GOA:C5DDY4"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR015830"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C5DDY4"
                     /translation="MTQQKFPAQDAAKFSKYEPLIEEYKKEAVAQMQQFDPAFYEKCV
                     ATIPSENELDTEPIDARQFLSFLTNEEASIVNDLTISDLTRKQLDGELTATVITKAFI
                     KAAIIAQLATNCVMQFLIPEALARAQELDDYLKENKKLVGPLHGVVVSLKEHMNFKGK
                     VTNASYVAYLENIPDNEAVSITILRKLGAVFHTRTAQPQGIMHLDTWNNITGRTRNPL
                     STRLSPGGSSGGESAIVAMHGSVIGHGSDIGGSVRAPAAFTDIFGLRPTTKRISLLNG
                     LSSGKGQESIVAVQGPLARSIDELDAYMRAYINEGQPWTYDPNCIPIAWREPSLPPKI
                     KIGVLYDDNLVTPFPAVTRAISETVAKLSKNPAFEIVNLKPDWFSEEEMLDIYTANLK
                     LYTCDGNEIQLSMWTPSGEPLLPLTEHYMKFGGGKKLSIYENRMLNAQRDALKLQMQQ
                     KYFSELDFILSPTYNGPSEIPGESLYWGYTSFWNLLDYPNVTFPVDVAHDKEKDAGIP
                     ELRKNEYEKMVWYKENGDVRYDPESYIGGPVALQLTGKRFCDEDVVAATKQIISALGV
                     ERR"
     gene            <416167..>416994
                     /locus_tag="KLTH0C04818g"
                     /db_xref="GeneID:8291301"
     mRNA            <416167..>416994
                     /locus_tag="KLTH0C04818g"
                     /product="KLTH0C04818p"
                     /transcript_id="XM_002552388.1"
                     /db_xref="GeneID:8291301"
     CDS             416167..416994
                     /locus_tag="KLTH0C04818g"
                     /note="highly similar to uniprot|P14682 Saccharomyces
                     cerevisiae YDR054C CDC34 Ubiquitin-conjugating enzyme or
                     E2 together with Skp1p Rbx1p Cdc53p and an F-box protein
                     forms a ubiquitin-protein ligase called the SCF complex
                     which regulates cell cycle progression by targeting key
                     substrates for degradation"
                     /codon_start=1
                     /product="KLTH0C04818p"
                     /protein_id="XP_002552434.1"
                     /db_xref="GeneID:8291301"
                     /db_xref="GOA:C5DDY5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5DDY5"
                     /translation="MSNRKNTAASLLLRQYRELTDAKKAIPSFHIELDDDSNIFLWNI
                     GVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPTFRFTPAIYHPNVYRDGRLCISILHTS
                     GDPTSEEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNIEQYKQRV
                     QLEVERSKQDIPEGFVMPTSRTAYVAQRQAEPEETRDLGDNFWYDSDDEDDADIYGYD
                     HNEEQEDNDIQFDDSENENDDDDDVSVDNDSVMDRKQPNKAEDESDDLEDGELKLEK"
     gene            <417074..>417811
                     /locus_tag="KLTH0C04840g"
                     /db_xref="GeneID:8291302"
     mRNA            <417074..>417811
                     /locus_tag="KLTH0C04840g"
                     /product="KLTH0C04840p"
                     /transcript_id="XM_002552389.1"
                     /db_xref="GeneID:8291302"
     CDS             417074..417811
                     /locus_tag="KLTH0C04840g"
                     /note="some similarities with uniprot|P38247 Saccharomyces
                     cerevisiae YBR077C SLM4 Protein with a potential role in
                     actin cytoskeleton organization, possible component of the
                     TOR nutrient signaling pathway"
                     /codon_start=1
                     /product="KLTH0C04840p"
                     /protein_id="XP_002552435.1"
                     /db_xref="GeneID:8291302"
                     /db_xref="InterPro:IPR020233"
                     /db_xref="UniProtKB/TrEMBL:C5DDY6"
                     /translation="MGSWSGELIALRSLPRLLQKATHGPARCTPGFCLALRACILFSN
                     CSLFPSTSFVVSLAITCVMLYLIWETFNLLGSVVLLHEPHAPSTIIMLHGKNIHHLLE
                     LTLSPVQTVVAEHEPLFSSLLVSCTNGSIISYANSDTAPTTYNNSSNNLKMMALLVRD
                     KWNEDQQDPSAQATHSCYQCEAEDGEVTRVYTYELEDLHACVAQIPRSDLLLLFIASS
                     DYPYGLLVKKMKAALRAFSSMYGYKLD"
     gene            <418871..>420571
                     /locus_tag="KLTH0C04862g"
                     /db_xref="GeneID:8291303"
     mRNA            <418871..>420571
                     /locus_tag="KLTH0C04862g"
                     /product="KLTH0C04862p"
                     /transcript_id="XM_002552390.1"
                     /db_xref="GeneID:8291303"
     CDS             418871..420571
                     /locus_tag="KLTH0C04862g"
                     /note="weakly similar to uniprot|P32325 Saccharomyces
                     cerevisiae YDR052C DBF4 Regulatory subunit of Cdc7p-Dbf4p
                     kinase complex required for Cdc7p kinase activity and
                     initiation of DNA replication phosphorylates the Mcm2-7
                     family of proteins cell cycle regulated"
                     /codon_start=1
                     /product="KLTH0C04862p"
                     /protein_id="XP_002552436.1"
                     /db_xref="GeneID:8291303"
                     /db_xref="GOA:C5DDY7"
                     /db_xref="InterPro:IPR006572"
                     /db_xref="InterPro:IPR013939"
                     /db_xref="UniProtKB/TrEMBL:C5DDY7"
                     /translation="MMSPSKGSMATRRSPLKETNANLKTGTDMVKRRAVEKLELQHRK
                     RAKTAETGRRTIEGAVQTQRQAEFKKVGESAKVTPRDLLEWQTNWKRIMRRDTKIYFD
                     TTEVADAKFKPDKRKELMRRGFVSLGAEITPFFDTDVTIVITQRAVKDCDRLPETDVL
                     AKASKRYMKVWNYDKAVRFLKNLDVDLDALDTKAPAAPSTLSNLLQNEKLYGPSDRDP
                     KARRDDVHYFKYPHVYLYDLWQVWAPIITAEWRPQDFANPDRLPYPVVKPGTFGRCPF
                     IGDGHCDESSAKRIIKRYKRDALNERYALHLRVLYQHSAEPRNLVFKEEDSRPLILPN
                     SFPNSYKSYRGLLSANQPAEEAKNNRSPEPVSAKSTTSVTLKPPSKAIWRAPQLNQPA
                     LLLSRQDTEELADDLCRKKPRIPQEIKASGVNPSNDGAAGAGNGLAPTKASVMNKNMK
                     SLNRLVVDKKFANTSTGSAAEPHAAAGPKPACASPRTGDDADKQKQKELKQQQDLRRN
                     DTRLGSGYCENCRVKYECLAHHINSEKHQHFAHDDINFEAIDSLIEKLAASRALSCSY
                     "
     gene            complement(<422344..>423372)
                     /locus_tag="KLTH0C04884g"
                     /db_xref="GeneID:8291304"
     mRNA            complement(<422344..>423372)
                     /locus_tag="KLTH0C04884g"
                     /product="KLTH0C04884p"
                     /transcript_id="XM_002552391.1"
                     /db_xref="GeneID:8291304"
     CDS             complement(422344..423372)
                     /locus_tag="KLTH0C04884g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C04884p"
                     /protein_id="XP_002552437.1"
                     /db_xref="GeneID:8291304"
                     /db_xref="GOA:C5DDY8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DDY8"
                     /translation="MAKSQLHEEPQRVPAFWETYQPLDGSRVAGDLFTSFKSSEEVLS
                     LTSHHALFQQDQMHMYTDGLATNPLVFGDSHFQFQDHGEHGGHDSCDAHDARDSYAYI
                     SGSSSCDELPPAHAQPHGAGASAGPLTFSDLEESDSTDADALFVAEPCGRSRCALPAR
                     SDSFDLAQLLYSHSSSPSRPPWSLVDAQKRNKSTNDVASGRRSSHCRAKRPSFATLDA
                     GKTASEDARAVSKLKLQPRYVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQ
                     FNARSNMTRHYKLHFKTEGGTYLLPNGEVTRARPPMRQLVGMQSNVAASDLISFSETS
                     EDLPLAGP"
     gene            <426008..>429853
                     /locus_tag="KLTH0C04906g"
                     /db_xref="GeneID:8291305"
     mRNA            <426008..>429853
                     /locus_tag="KLTH0C04906g"
                     /product="KLTH0C04906p"
                     /transcript_id="XM_002552392.1"
                     /db_xref="GeneID:8291305"
     CDS             426008..429853
                     /locus_tag="KLTH0C04906g"
                     /note="some similarities with uniprot|P53753 Saccharomyces
                     cerevisiae YNR067C"
                     /codon_start=1
                     /product="KLTH0C04906p"
                     /protein_id="XP_002552438.1"
                     /db_xref="GeneID:8291305"
                     /db_xref="GOA:C5DDY9"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:C5DDY9"
                     /translation="MLSALQVLALLLAGTHAKNSSHPIYSNSSAIVHETDRTLALNYT
                     TLDYGEPYVDAATSRPARFSASQAAASATSASLSHVTVAGDTPLPASTAGAETIYTVS
                     AGPGSTGTGASLAASAPGRATASSKYSAASSGVVSGGSDGFSSDLPSGSQKPAPSAAD
                     DAAATQGASQARDSSTVSTPSLGTSFAADSSETFAHSSDASMLSSRETPAHGSVGSST
                     SSSHETSAHGSGVFPTPSSSQAPAHSSDASSALSSLQTSADGARETPAQSSDASSTLG
                     SSQTPARYSGTSQLRSGAASTETASSEGTRSAAHSASSTARFQTLSSSSFSPVSELLT
                     ATASTSTSVLYSATSPYTSATAKGSIVTSVPSHSANPLVTQSLSSSKLSQSISTTYTA
                     SKTVDTESLLPASNFTSSSVVIGSSSNSSASATGTSLSAPGQLNASASQGTTSSPARS
                     SVILSTSVVTHSTVNTTTMVVPVTSTYSNRTTVLSKPTTARFTLVGTSNVVSNQTATL
                     QPSGASSSSLATPSASSSAYTSSSSSAAMTTESTASSTSETPVVSIVSETVTTVDLFQ
                     AVATDEPPSVFARHSNPMDLSSGVSNNGSPYGTNKFYTNLIVGDQTSAAFVYPYSVWK
                     YSSNGVNGFAVSHTSKDQYSYGNYDSDGNSEYLVNPLGIASLIFSAESFGSACNMYVS
                     DMTTSSCDVTINDGSVSNILQVPLVQGMGFASGIYHGSLKPEIRTSAAFISLEQQTSD
                     ILPAGVQKYRVGLNSGSTWLVYVTLPDGYSDDDFTLSFSDSSTLSGSQAIDGLIVQFA
                     AAPEDSTYDSFYDNAAGMYATDFKLEGSSDGASASYSFDYQTEGRSASGKTMIFALPH
                     HLDALSAESTAARTGVQLQSTTKGTMEALLATSLVFTEILNTQLGWLPWTSQLGSRNL
                     TYSAEQLQLLAETANDEINIDVWGSVGGLNTYYLGKVLDKYAYILLTVADVLQDSAVT
                     AAALENLKQAFAKLMQNQQLYPLYYDTKFGGVVSSGDWASTATGYDFGNTYYNDHHFH
                     YGYIVHAAAVVGHVDAQQGGSWAQDNKAWINTLVRDVANPSAADAYFPVSRMFDWFHG
                     HSWAAGLFANANGKNQESSSEDYNFAYGMKLWGAVVGDRAMERRADVMLAVMQRSMNA
                     YYLFADDNAVEPSEILGNKVAGILFDNIIDYTTYFGTETQYKNGIHMIPVTPASGVIR
                     GPTFVQQEWEEKLASVAATLTDGWGGLLRLNQALYDPASSYAFFADSGFSSAALDNGL
                     SRTWALAFSGGLANSLGLL"
     gene            complement(<429938..>430450)
                     /locus_tag="KLTH0C04928g"
                     /db_xref="GeneID:8291306"
     mRNA            complement(<429938..>430450)
                     /locus_tag="KLTH0C04928g"
                     /product="KLTH0C04928p"
                     /transcript_id="XM_002552393.1"
                     /db_xref="GeneID:8291306"
     CDS             complement(429938..430450)
                     /locus_tag="KLTH0C04928g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C04928p"
                     /protein_id="XP_002552439.1"
                     /db_xref="GeneID:8291306"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ0"
                     /translation="MLRYAVLRCAQKHARPRNRCLRASGRGEARSPPRQGRRGHVPIH
                     VRYFVRCLLSMVYVMYMRCRVRLRASAPRRAVGCYNTTGRSDAIWRRRLRNAAVCASA
                     VLAEHQGGSPRSRGPTSSKTPEVAPTVSHGGQKDTRHPYAGVRRRKLRGGFRRRGGSH
                     AFRATKSARR"
     gene            <431617..>433491
                     /locus_tag="KLTH0C04950g"
                     /db_xref="GeneID:8291307"
     mRNA            <431617..>433491
                     /locus_tag="KLTH0C04950g"
                     /product="KLTH0C04950p"
                     /transcript_id="XM_002552394.1"
                     /db_xref="GeneID:8291307"
     CDS             431617..433491
                     /locus_tag="KLTH0C04950g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C04950p"
                     /protein_id="XP_002552440.1"
                     /db_xref="GeneID:8291307"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ1"
                     /translation="MSALNQKYKKPRLQQAETAGAVAPAAPATPEAPETPATPAKYAA
                     TAESSVLDAALSDADSALGESYAACGRLAATMGLHQLAVVNLAKSMQKLPRDVGVLVD
                     FAKALGAKANQESIVVSTLADAVQRSPELSDPRVWLQLASSYYHLLKPDEAFHSVSRA
                     IAAQEIQGIKDAGTWALQARILLLWMDSDAKMTLETLTPYFIGAIEMAIAAGDTQLEL
                     QSRVSLAQLYHRFACYPESQAEVSRAFVLVRSDPSSGMPRPSTVNTLCYLYNFLGIIQ
                     FKMNYKASAYSVIQEAMSALPQVSATARLLATLAQFYMIDENLPQLRAILPALLVEKT
                     ALTEKELIRLYLMNWLLGRVYDMLDDTKQSYHFYQQAVNCKPQSASLWVGIGSLYLRM
                     RQFEDAHIAFSHALNYASKLENFEQPFFLRFNRLFAAFAWVGLSQVFVATFQKQSALD
                     ALRQASVLFTAEGDLVHSSQVDQLYNDVLATPPQNPMYVIMNVPPQILLELFLYYDTG
                     VFANQTEGNFPKISSCEPVAHIMPLYDHQASPVATLPHGPAVTPSVPPPPPQQVYNDL
                     ATRPALSQQHPSTVFLAYPQPAVTVPATSALNIKPIAKNMPGVNYGFPAQPYQNPPVP
                     "
     gene            complement(<433703..>436591)
                     /locus_tag="KLTH0C04972g"
                     /db_xref="GeneID:8291308"
     mRNA            complement(<433703..>436591)
                     /locus_tag="KLTH0C04972g"
                     /product="KLTH0C04972p"
                     /transcript_id="XM_002552395.1"
                     /db_xref="GeneID:8291308"
     CDS             complement(433703..436591)
                     /locus_tag="KLTH0C04972g"
                     /note="similar to uniprot|P38244 Saccharomyces cerevisiae
                     YBR074W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C04972p"
                     /protein_id="XP_002552441.1"
                     /db_xref="GeneID:8291308"
                     /db_xref="GOA:C5DDZ2"
                     /db_xref="InterPro:IPR007484"
                     /translation="MLAQFLRSLFRFRKTTVSVLLVATYVVVFLLNVWDRIRYQYSLP
                     EDNKHHKQLLDASWIDLQSITRKPHPYTSRENDAVHDFLLHRVTELVEGAPHAEVSDD
                     YKEGNHLVFKQPDVFNSSSTESRIVSFESSNIVVKITGSQPELPGLLISAHFDSVPTA
                     LGATDDGVGIVTLLALITRYAKKQPRRTLVFNLNNNEEFGLLGASAFLNHRWRPLVDY
                     VLNLEGTGAGGKAVLFRTSDTNTASIYKNAVKTQPFGNSIYQQAFYDRYISSETDYKV
                     YEQAGLRGWDIAFYKPRALYHTIKDSTQFTSQASLWNMMHASLQLADFIAFESFEDEP
                     KDRSPAVYFDIIGTFFVTASTKDLFTLNCVVLSVIPVIILVLEFVIQRRKTRERNPLL
                     VWLRLPFSMFISYLVTATFRSSLFRVNPLIFSRDYVSPTIGFSFTFLILNYLVLSLLE
                     YLAPSRDLKTVSFVELFFGMWIALLWATIRLCTSKYTATGVYPITVLYLLMSFGAIVG
                     LVCSAFKRKHSVVKAKDSEETAAPNTYSSIEESPQQATNTEAPNENSPEEHDERAPLL
                     RASNSSQVSSVTNVSEAPSSALKAFVVSALNYDWSVQFLAVVPLASFFVIMCLSLILD
                     GIYQTCQEGFQATWNVSKISMLGGMLLAIPVLPFCYKLNYFVSMVLLFAAASAGIFSF
                     ERAPFTESSPLKLRFSQELNLHDELGFSTVNVFGRQGAGIEQILRNIPSTQNAHSNVE
                     CTSNGQGSETCRYAGPRPHLVSSSSIPELSDILSIKVLSNNRKSSGRSSYEPINAELV
                     INVKENRLCTIGFNSSQFAEHDYGQSPVKQVTIFGNAHHDNRTRSQLSTLDGLSRDDE
                     ENRIFKWNRGINSLQLHKLDFERNYYHVGIQWMPTILSQDADEESSDALGLKIRCFWG
                     EYDSVSIINGEVKRKVPALDELLAYSPKEVSFSNREAGLVIVNDYIEL"
     gene            <437593..>438699
                     /locus_tag="KLTH0C04994g"
                     /db_xref="GeneID:8291309"
     mRNA            <437593..>438699
                     /locus_tag="KLTH0C04994g"
                     /product="KLTH0C04994p"
                     /transcript_id="XM_002552396.1"
                     /db_xref="GeneID:8291309"
     CDS             437593..438699
                     /locus_tag="KLTH0C04994g"
                     /note="highly similar to uniprot|P32347 Saccharomyces
                     cerevisiae YDR047W HEM12 Uroporphyrinogen decarboxylase
                     catalyzes the fifth step in the heme biosynthetic pathway
                     localizes to both the cytoplasm and nucleus activity
                     inhibited by Cu2 Zn2 Fe2 Fe3 and sulfhydryl-specific
                     reagents"
                     /codon_start=1
                     /product="KLTH0C04994p"
                     /protein_id="XP_002552442.1"
                     /db_xref="GeneID:8291309"
                     /db_xref="GOA:C5DDZ3"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ3"
                     /translation="MQLLDRSKFPELKNDLILRAALGQPVERPPCWIMRQAGRYLPEY
                     HKVKDGRDFFETCRDAEIASEITIQPVRRYAGLLDAAIIFSDILVIPQALGMRVEMLE
                     GKGPHFPELIRTEEDMKKVLDYHTDVLKELDWAFRAITVTRHKLGGQVPLLGFCGGPW
                     TLLVYMTEGGGSRLFRFAKQWLNESPELCHKLLQKITDVAVEFLAQQVVAGAQMLQVF
                     ESWGGELGPRDFDEFSLPYIRQISKRLPHRLKELGIEEQIPLTIFSKGSWYALDKLCD
                     SGYNAVSLDWLWDPKDAVKVNAGRVTLQGNLDPGVIYGTDEVISKRVEEMITGFGGGK
                     KQYIVNFGHGTHPFMDPEKIKFFLQECHRVGSKK"
     gene            <438918..>440783
                     /locus_tag="KLTH0C05016g"
                     /db_xref="GeneID:8291310"
     mRNA            <438918..>440783
                     /locus_tag="KLTH0C05016g"
                     /product="KLTH0C05016p"
                     /transcript_id="XM_002552397.1"
                     /db_xref="GeneID:8291310"
     CDS             438918..440783
                     /locus_tag="KLTH0C05016g"
                     /note="similar to uniprot|Q66RH0 Saccharomyces cerevisiae
                     YDR049W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C05016p"
                     /protein_id="XP_002552443.1"
                     /db_xref="GeneID:8291310"
                     /db_xref="GOA:C5DDZ4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ4"
                     /translation="MEGSSKTIKKNDLYAFELPKEILESLELMVFDASVAEVQVETKT
                     HRAEPEAKQPVEADSSYTRACRTCGEEFSSEILQKSHYKTDYHRFNIKRKLNDMPALS
                     LDEFEVMTENNDVESISGSDTESESEKDEDIYKEDKDKLSAILENQVTKLDIQGDLSE
                     SKSHLNTRSPHIFFKSSFLPENEVFSAFKALFSKATISKPLETIISWNSNNESKNAVD
                     APFSALFMVGGGHFAGAIVSHKRLNIKGHMTKGNETLQERAVQFLEHKTFHRYTTRRK
                     QGGAQSTMDNSKGKANSAGSSLRRYNETALRMDIQQLLRQWEPYLKNCENIFIRAKST
                     SDQKIFVDSNTCIKKEDPRLRSFPFTTKRPTGHELKRAWCELSYLHIESKPKAVVTKE
                     STPEVAVRKEQKTQDASVQKQNPEVVHTREIVALLKKSRAPMLISYIKKNNLDVNFIL
                     QPSLEYAQTPTMLHYASQQGLKNMVLILLNNLKCDPTLKNINGRTPWDLTKKKEVHQA
                     FQIARFNLGESFTNWEASNVGEALSREQVDALNEKELKQKEAERADAIKVELEAAKAK
                     QELDKEAKRGSGRTLLPQMSSTQQTMNSLSENQRMRLMREQRARAAEARMRQNMG"
     gene            complement(<440815..>443499)
                     /locus_tag="KLTH0C05038g"
                     /db_xref="GeneID:8291311"
     mRNA            complement(<440815..>443499)
                     /locus_tag="KLTH0C05038g"
                     /product="KLTH0C05038p"
                     /transcript_id="XM_002552398.1"
                     /db_xref="GeneID:8291311"
     CDS             complement(440815..443499)
                     /locus_tag="KLTH0C05038g"
                     /note="similar to uniprot|P38086 Saccharomyces cerevisiae
                     YBR073W RDH54 DNA-dependent ATPase stimulates strand
                     exchange by modifying the topology of double- stranded DNA
                     involved in the recombinational repair of double-strand
                     breaks in DNA during mitosis and meiosis proposed to be
                     involved in crossover interference"
                     /codon_start=1
                     /product="KLTH0C05038p"
                     /protein_id="XP_002552444.1"
                     /db_xref="GeneID:8291311"
                     /db_xref="GOA:C5DDZ5"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ5"
                     /translation="MRVPQYVNKPFKSPVICKKSVSTTESPTPTQQMKAPAVVRPLSK
                     RAPSDVAPSINKKAAQGVAYYSIMYRKRSTKKHKTWDGDGTAIEMSNGSFRFYKDDGR
                     FFGSGSLGKGEDKFERIFTCSGCEVQLDHQIEDEQEVSKLEEILGSSTKSTNQIVKPS
                     LGHKIKQGTSSRSPSPGIQVVHYLPTQKFKPVYRNSQSDSFESTPGAANARRFPPIFD
                     PSQIEDPLIMNTFTGAECDVIVDPILSKHLRPHQRVGVKFMYDCVMGLSRPSQHEDDG
                     KTSCLLQKTDEVQGCLLADEMGLGKTLMTIALIWTLLKQTPTPSKETTSQFGIPLQGL
                     CNKVLVVCPVTLIANWKREFSKWLGLNRIGILTLDSKSTPEKDKLHVRNFLRVQRTYQ
                     VLILGYEKLLSVTEALQQESSSIGLMVCDEGHRLKNGQSKTLSALNSLDISRKVLLTG
                     TPIQNDLTEFFTIIDFLNCGIMGNFSQFKRDYINPITRARDVNNKYNETIQTRGKDRT
                     DELIDATKKFTLRRTADTISKFLPPKTDVVLFCKPTKSQIQAFEKILTNAQLDLSSIT
                     PSSSLALITLFKKICNSPSLISQDSYYLENIKSKSDLTGCLGLDSGKLRVLLALLENI
                     RSSYPQEKVVIVSNYTQTLDIIQNILTSNRFAFTRLDGNTPTKERDRIVRAFNTVPSL
                     FAFLLSAKSGGVGLNLIGASRLVLFDNDWNPAIDLQAMSRIHRDGQRRPCFIYRLLTT
                     GCIDEKIFQRQLMKISLSFRFMGDQESSSSIKADDNLFETDDLKDLFTVLTSTKSNTH
                     DLICACHGQKEHVSDSKVTAATMAETGAKGWTSAMDLMASMEKAESEKIAEKAALVQQ
                     CLVDYEHIETLKAHEIISEAALESQTDVTFAFIKSSKI"
     gene            complement(<443879..>444421)
                     /locus_tag="KLTH0C05060g"
                     /db_xref="GeneID:8291312"
     mRNA            complement(<443879..>444421)
                     /locus_tag="KLTH0C05060g"
                     /product="KLTH0C05060p"
                     /transcript_id="XM_002552399.1"
                     /db_xref="GeneID:8291312"
     CDS             complement(443879..444421)
                     /locus_tag="KLTH0C05060g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C05060p"
                     /protein_id="XP_002552445.1"
                     /db_xref="GeneID:8291312"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ6"
                     /translation="MLSKSSSVRRIKTDKKRHSMVLTPSSLDLSSIYGTKNSNKSMDA
                     LVPERSSTQRKSNGKSRMKRSTVLLDDNMVREYNLAIQELNNFGSGAGTALPRSGAST
                     ANSSVSTSTSMSSLFSRESSMSIHDLMYQDCGEDETSTGNALEKGEVVTLNSHTAQSW
                     SRAIDDVPLEGSQRTQLDFF"
     gene            <444707..>445393
                     /locus_tag="KLTH0C05082g"
                     /db_xref="GeneID:8291313"
     mRNA            <444707..>445393
                     /locus_tag="KLTH0C05082g"
                     /product="KLTH0C05082p"
                     /transcript_id="XM_002552400.1"
                     /db_xref="GeneID:8291313"
     CDS             444707..445393
                     /locus_tag="KLTH0C05082g"
                     /note="similar to uniprot|P38242 Saccharomyces cerevisiae
                     YBR070C ALG14 Essential protein required for the second
                     step of dolichyl-linked oligosaccharide synthesis;
                     involved in N-linked glycosylation; similar to bacterial
                     glycosyltransferases"
                     /codon_start=1
                     /product="KLTH0C05082p"
                     /protein_id="XP_002552446.1"
                     /db_xref="GeneID:8291313"
                     /db_xref="InterPro:IPR013969"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ7"
                     /translation="MGYTLCLFALVFLQALVVRTLWVIPIFGIREGAELSEKRGLQAG
                     RALRLFVFLGSGGHTGEMLRLLDNYRTALLRPGTQLYVGFSDEASLRKFQTTVGANLS
                     GVEVQFLRFSKAREVGASWLASTRSVAFSFVQSLWCLTWLKWQFVGQQHLVLLNGPGT
                     CCIIASWLKMLEIVTLTRSKIVYVESLARTDTLSLSGKLLYPLVDEFVVQWDELYERY
                     DRARCYGILV"
     gene            complement(<445672..>446418)
                     /locus_tag="KLTH0C05104g"
                     /db_xref="GeneID:8291314"
     mRNA            complement(<445672..>446418)
                     /locus_tag="KLTH0C05104g"
                     /product="KLTH0C05104p"
                     /transcript_id="XM_002552401.1"
                     /db_xref="GeneID:8291314"
     CDS             complement(445672..446418)
                     /locus_tag="KLTH0C05104g"
                     /note="highly similar to uniprot|P00942 Saccharomyces
                     cerevisiae YDR050C TPI1 induced under stress conditions
                     triosephosphate isomerase"
                     /codon_start=1
                     /product="KLTH0C05104p"
                     /protein_id="XP_002552447.1"
                     /db_xref="GeneID:8291314"
                     /db_xref="GOA:C5DDZ8"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020861"
                     /db_xref="InterPro:IPR022896"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ8"
                     /translation="MARTFFVGGNFKLNGNKQSIKEIVERINKASIPQNVEVVLCPPA
                     PYLDYAAGLVSKPQVSVGAQNAYYKAAGAFTGENSVEQIKDVGAKWVIIGHSERRTLF
                     KETDEEVAEKTKFALDQGLGVILCIGETLEEKKAGVTLKVVETQLNAVIAQVKDWSNV
                     VVAYEPVWAIGTGLAATPEDAQDIHASIRKYLSEKLGADVAEKTRILYGGSANGSNAV
                     TFKDKKDVDGFLVGGASLKPEFVDIINSRN"
     gene            complement(<446965..>447897)
                     /locus_tag="KLTH0C05126g"
                     /db_xref="GeneID:8291315"
     mRNA            complement(<446965..>447897)
                     /locus_tag="KLTH0C05126g"
                     /product="KLTH0C05126p"
                     /transcript_id="XM_002552402.1"
                     /db_xref="GeneID:8291315"
     CDS             complement(446965..447897)
                     /locus_tag="KLTH0C05126g"
                     /note="similar to uniprot|Q7LHX4 Saccharomyces cerevisiae
                     YDR051C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C05126p"
                     /protein_id="XP_002552448.1"
                     /db_xref="GeneID:8291315"
                     /db_xref="GOA:C5DDZ9"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DDZ9"
                     /translation="MGHHKPRLIILVRHGESVSNKDKSVNQHMPNHLIPLTDNGWKQA
                     RRSGSELLQLLNVDDPQIVKDLAEKFAWEGDHRKPLKQDYRNVNKNLDSNIVFYTSPY
                     RRTRETLRGMLDVLDEYNKRNCGVSARDNDGYQPSVKSRLAHWQCPEFPHGFYENTES
                     RDLIASLNRTAAHKTYVHYRVKDEPRIREQDFGNFQELSSMRDVMSTRANYGHFFFRF
                     PQGESAADVYDRCSSFQETLFRHFNQPDRKPRDVVVLVTHGIYLRVFLMKWFRWTYEE
                     FEAFTNVPNGSLVVMELDTELDRYVLRTTLPKWC"
     gene            <448044..>448568
                     /locus_tag="KLTH0C05148g"
                     /db_xref="GeneID:8291316"
     mRNA            <448044..>448568
                     /locus_tag="KLTH0C05148g"
                     /product="KLTH0C05148p"
                     /transcript_id="XM_002552403.1"
                     /db_xref="GeneID:8291316"
     CDS             448044..448568
                     /locus_tag="KLTH0C05148g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C05148p"
                     /protein_id="XP_002552449.1"
                     /db_xref="GeneID:8291316"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DE00"
                     /translation="MLTPSVLNGAATGHMMRPAASVFLRNSSWFSKILYPFSRPDQSI
                     PDSYKPSSQNGNQCFLPVRSDNELDETLLANNRTPLILNFTVRGDETCNKLTGALNRI
                     VLLETDKRVNIADVETDFMDTRNSMLRFGVKQIPTLVAVRKTFPTDSYCVPDLARSQV
                     DWAALKRWIEKNAD"
     gene            <449510..>451306
                     /locus_tag="KLTH0C05170g"
                     /db_xref="GeneID:8291317"
     mRNA            <449510..>451306
                     /locus_tag="KLTH0C05170g"
                     /product="KLTH0C05170p"
                     /transcript_id="XM_002552404.1"
                     /db_xref="GeneID:8291317"
     CDS             449510..451306
                     /locus_tag="KLTH0C05170g"
                     /note="similar to uniprot|P38084 Saccharomyces cerevisiae
                     YBR068C BAP2 High-affinity leucine permease functions as a
                     branched-chain amino acid permease involved in the uptake
                     of leucine isoleucine and valine contains 12 predicted
                     transmembrane domains and to YDR046C uniprot|P41815
                     Saccharomyces cerevisiae YDR046C BAP3 Amino acid permease
                     involved in the uptake of cysteine, leucine, isoleucine
                     and valine"
                     /codon_start=1
                     /product="KLTH0C05170p"
                     /protein_id="XP_002552450.1"
                     /db_xref="GeneID:8291317"
                     /db_xref="GOA:C5DE01"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DE01"
                     /translation="MGKIGDKSSSPQPVWSSTKSESVTASELYDSRPHAQHEEHEGAW
                     CRFRDSFKRAQKRSVPQGGDLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLL
                     VANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKP
                     FGFASVWLYCLQWLTVFPLELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRG
                     YGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAFAVGDPASKFK
                     GFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFL
                     VPHTSDELMGSGGKSATHASPYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGP
                     RVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIA
                     GLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILVFVAQF
                     WVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRC
                     VYDEERIEQEKLEHKTMLQNSNWLGRLKHFWC"
     gene            <451632..>453407
                     /locus_tag="KLTH0C05192g"
                     /db_xref="GeneID:8291318"
     mRNA            <451632..>453407
                     /locus_tag="KLTH0C05192g"
                     /product="KLTH0C05192p"
                     /transcript_id="XM_002552405.1"
                     /db_xref="GeneID:8291318"
     CDS             451632..453407
                     /locus_tag="KLTH0C05192g"
                     /note="highly similar to uniprot|P15180 Saccharomyces
                     cerevisiae YDR037W KRS1 Lysyl-tRNA synthetase also
                     identified as a negative regulator of general control of
                     amino acid biosynthesis"
                     /codon_start=1
                     /product="KLTH0C05192p"
                     /protein_id="XP_002552451.1"
                     /db_xref="GeneID:8291318"
                     /db_xref="GOA:C5DE02"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5DE02"
                     /translation="MSQEEAVKSANDAIANLHLDEVTGEMVSKSELKKRAKQRQVEAK
                     KAAKKASAQPKPEPKKKSNDAFADLDPSQYFEARSRQIQELKNTQSPNPYPHKFHVST
                     GLSDFLKKYAHLQRGETLPEEKVSIAGRVHAKRESGSKLKFYVLHGEGVEVQLMSQLQ
                     DYHSEASYEADHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVSRIQLLTPCLHILP
                     ADHFGFKDQETRYRKRYLDLIMNKDARPRFITRSKIISFIRRFLDERNFIEVETPMMN
                     VIAGGATAKPFVTHHNDLNMDMFMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMT
                     HNPEFTTCEFYQAYADVYDLMDMTEMLFSEMVKEITGSYVIKYHPDPRDPTKELELNF
                     SRPWKRINMIEELENRLNVKFPPGDQLHTAETGNFLKKVLKENNLECPPPLTNARMLD
                     KLVGELEDTCINPTFIFGHPQMMSPLAKKSRDVPGLCERFEVFVATKEICNAYTELND
                     PFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSN
                     TIREVLLFPTLKPDAQREAEEEKAN"
     gene            complement(<453821..>454732)
                     /locus_tag="KLTH0C05214g"
                     /db_xref="GeneID:8291319"
     mRNA            complement(<453821..>454732)
                     /locus_tag="KLTH0C05214g"
                     /product="KLTH0C05214p"
                     /transcript_id="XM_002552406.1"
                     /db_xref="GeneID:8291319"
     CDS             complement(453821..454732)
                     /locus_tag="KLTH0C05214g"
                     /note="highly similar to uniprot|P38238 Saccharomyces
                     cerevisiae YBR061C TRM7 2'-O-ribose methyltransferase
                     methylates the 2'-O-ribose of nucleotides at positions 32
                     and 34 of the tRNA anticodon loop"
                     /codon_start=1
                     /product="KLTH0C05214p"
                     /protein_id="XP_002552452.1"
                     /db_xref="GeneID:8291319"
                     /db_xref="GOA:C5DE03"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DE03"
                     /translation="MGKSSKDKRDLYYRKAKEEGYRARSAFKLLQLDEQFHFLDNVTR
                     VVDLCAAPGSWSQVLSRRLFDDDTENNSSKRIVAVDLQPMFPIDNVTTIQADITHPKT
                     LNKIMDLFEGEKADFVCSDGAPDVTGLHDLDEYVQQQLILSALQLTTCLLREGGVFVA
                     KIFRGRDIDMLYSQLSFLFERVVCAKPRSSRGTSLESFIVCLGYRPPSDWKPRLDVNM
                     SVEDFFQGCDIGRLTIDDEIPNYREEPRSIAEFISCGGLDSFDSDATYHDVPENTTAL
                     DPVQPPTNPPYKRALELKRQGKLTRAV"
     gene            <455011..>455622
                     /locus_tag="KLTH0C05236g"
                     /db_xref="GeneID:8291320"
     mRNA            <455011..>455622
                     /locus_tag="KLTH0C05236g"
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /transcript_id="XM_002552407.1"
                     /db_xref="GeneID:8291320"
     CDS             455011..455622
                     /locus_tag="KLTH0C05236g"
                     /note="similar to uniprot|Q03201 Saccharomyces cerevisiae
                     YDR041W RSM10 Mitochondrial ribosomal protein of the small
                     subunit, has similarity to E. coli S10 ribosomal protein;
                     essential for viability, unlike most other mitoribosomal
                     proteins"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /protein_id="XP_002552453.1"
                     /db_xref="GeneID:8291320"
                     /db_xref="GOA:C5DE04"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:C5DE04"
                     /translation="MFRSAFSPVLKQSARFQSNHAAGEASNVAKKLPINVEAVYHAPL
                     RVPVKHGDLIADLQLRSYDHENLDFFSDFILRAGFYLGMPLTGPKPLPTRRERWTVIR
                     SPFAQAKSKENFERHTHKRLVRVWDTNPEVVELWLSYISKYSIPGVGMKCNLYKKEGL
                     KLSQGPEQSTLLASPERSKSLDEAVGEKVLELLNSEDFKKHMQ"
     gene            complement(<455688..>456205)
                     /locus_tag="KLTH0C05258g"
                     /db_xref="GeneID:8291321"
     mRNA            complement(join(<455688..456130,456190..>456205))
                     /locus_tag="KLTH0C05258g"
                     /product="KLTH0C05258p"
                     /transcript_id="XM_002552408.1"
                     /db_xref="GeneID:8291321"
     CDS             complement(join(455688..456130,456190..456205))
                     /locus_tag="KLTH0C05258g"
                     /note="similar to uniprot|P38239 Saccharomyces cerevisiae
                     YBR062C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C05258p"
                     /protein_id="XP_002552454.1"
                     /db_xref="GeneID:8291321"
                     /db_xref="GOA:C5DE05"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DE05"
                     /translation="MSTYEEEHNTSGNSNSRRDLRAQIRNLYQEDGSSTALLQLLAQL
                     IPESMQEELLNEKEEGCPETFIDSLPRVNKCDLKGADACSICCCGYLDDTHPLVVKLP
                     HCSHRFDLECVAVWLSKSRTCPLCRDDVLSHKPKVDISNVELEEDWGMYG"
     gene            complement(<456545..>457561)
                     /locus_tag="KLTH0C05280g"
                     /db_xref="GeneID:8291322"
     mRNA            complement(<456545..>457561)
                     /locus_tag="KLTH0C05280g"
                     /product="KLTH0C05280p"
                     /transcript_id="XM_002552409.1"
                     /db_xref="GeneID:8291322"
     CDS             complement(456545..457561)
                     /locus_tag="KLTH0C05280g"
                     /note="similar to uniprot|P38241 Saccharomyces cerevisiae
                     YBR065C ECM2 Pre-mRNA splicing factor facilitates the
                     cooperative formation of U2/U6 helix II in association
                     with stem II in the spliceosome function may be regulated
                     by Slu7p"
                     /codon_start=1
                     /product="KLTH0C05280p"
                     /protein_id="XP_002552455.1"
                     /db_xref="GeneID:8291322"
                     /db_xref="UniProtKB/TrEMBL:C5DE06"
                     /translation="MEPAICKSCLGEQERLTRAVNGAECKICTLPFTVYHFKAHHRIN
                     RTVICYNCSKQRNVCQCCLLDLQWQIPVELRDRVLSLIQGSEVATHEAQNEMMKRFIA
                     LKDGDSFKMGGASITSSASATADALKQIRDTVEAVEKSGKAADAAGPGRDVPLPKNLA
                     DLDITHLLKKLPLKGSLSDGTSFFLYNIDPSIPEWAIVDAVTELVGTASWKGPVSAST
                     IINHTARCGGIRFKTLELAQKFIDQVPTFKTEAGSIKGKLLVQNSRIHVVSWSQFNRA
                     ALGTKNAECLKLAASLDKLVQKDLNSPAASNTMLTKKQGKVTKRAPSSKDKKRNRRVK
                     DIEL"
     gene            complement(457728..457834)
                     /gene="SNR47"
                     /locus_tag="KLTH0C05302r"
                     /db_xref="GeneID:8291323"
     ncRNA           complement(457728..457834)
                     /ncRNA_class="snoRNA"
                     /gene="SNR47"
                     /locus_tag="KLTH0C05302r"
                     /product="snR47"
                     /note="C/D snoRNA monocistronic SNR47"
                     /transcript_id="XR_002432180.1"
                     /db_xref="GeneID:8291323"
     gene            complement(<458911..>460110)
                     /locus_tag="KLTH0C05324g"
                     /db_xref="GeneID:8291625"
     mRNA            complement(<458911..>460110)
                     /locus_tag="KLTH0C05324g"
                     /product="KLTH0C05324p"
                     /transcript_id="XM_002552410.1"
                     /db_xref="GeneID:8291625"
     CDS             complement(458911..460110)
                     /locus_tag="KLTH0C05324g"
                     /note="similar to uniprot|Q12406 Saccharomyces cerevisiae
                     YPR034W ARP7 Actin-related protein involved in
                     transcriptional regulation subunit of the chromatin
                     remodeling Snf/Swi complex"
                     /codon_start=1
                     /product="KLTH0C05324p"
                     /protein_id="XP_002552456.1"
                     /db_xref="GeneID:8291625"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:C5DE07"
                     /translation="MSVVIHNGTHTTVAGFSNVDMPQIVCSSSYVQRQDGSLEFVVEG
                     MLIGEDGPVYTMMDAQGVPYNWDALEKQWRWICEERLGCRLEETPVVATVAPDLPDAV
                     RAQYLEMALGRLKIPVFQLVVEPLAVALSLGRNTALVVDVGAAKSTVTPIIDGTVVQT
                     AVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNRKDPSLTLWRNSRTWIQEFKTY
                     MLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTISLTQKQCCELAEGLFQPRSVSQ
                     QFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTPEQTHAALLTNILITGSSSLISGL
                     EQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQGGVTMANLPSWDLGDWVSQSDYEA
                     RNERGSN"
     gene            <460241..>460549
                     /locus_tag="KLTH0C05346g"
                     /db_xref="GeneID:8291324"
     mRNA            <460241..>460549
                     /locus_tag="KLTH0C05346g"
                     /product="KLTH0C05346p"
                     /transcript_id="XM_002552411.1"
                     /db_xref="GeneID:8291324"
     CDS             460241..460549
                     /locus_tag="KLTH0C05346g"
                     /note="similar to uniprot|P47128 Saccharomyces cerevisiae
                     YJR082C EAF6 Esa1p-associated factor subunit of the NuA4
                     acetyltransferase complex"
                     /codon_start=1
                     /product="KLTH0C05346p"
                     /protein_id="XP_002552457.1"
                     /db_xref="GeneID:8291324"
                     /db_xref="InterPro:IPR015418"
                     /db_xref="UniProtKB/TrEMBL:C5DE08"
                     /translation="MDEAHQHYQKLKQELQEALVDRETLEKQWDQIQQEIFDKESAYL
                     TGNSSSQYGTIVKGFDAFGKHIHDSAHAFSDKDRIFSLSSARFVKQQEGDDKGGDGQA
                     "
     gene            <461904..>463112
                     /locus_tag="KLTH0C05368g"
                     /db_xref="GeneID:8291325"
     mRNA            <461904..>463112
                     /locus_tag="KLTH0C05368g"
                     /product="KLTH0C05368p"
                     /transcript_id="XM_002552412.1"
                     /db_xref="GeneID:8291325"
     CDS             461904..463112
                     /locus_tag="KLTH0C05368g"
                     /note="weakly similar to uniprot|P47127 Saccharomyces
                     cerevisiae YJR080C FMP26 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0C05368p"
                     /protein_id="XP_002552458.1"
                     /db_xref="GeneID:8291325"
                     /db_xref="GOA:C5DE09"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /translation="MKAAALRLGHASVAKRSISLVRPVAATVVPAQMAQKPDAEPIFG
                     QEDNSDIQDAQFRVLGQPPTLCSVHVPASVSLHVRRGCLVSLHGVGEQNAVAISQEWI
                     GLAWNLAKHGSWRAALFHQLVAPRAFSALVAPNVNGGKIASWFGVSAQQFRTLCLLDL
                     DGTQDWCVLGKHSLIAYEGNTSLRIQRSSVWPSWLHFNRGDSALPSTYQLIQGRGNAL
                     LSGAGSVYTIELPNENEELILKGEHLLAISGRTPRDIAEAVTEYSFPAVSVPAIPETA
                     VSKGRTPMPTSSLSAFSTALASYSRNAVSWLRHAYTSYINGTTKYLRIRGPRFLLVQS
                     AHNAFMPATSPSAVQPPSSPVSVKAPASTPNSKDYLSYVTVGKDASVSFQSTPDFNKK
                     VAEIEALKHK"
     gene            <463262..>464902
                     /locus_tag="KLTH0C05390g"
                     /db_xref="GeneID:8291326"
     mRNA            <463262..>464902
                     /locus_tag="KLTH0C05390g"
                     /product="KLTH0C05390p"
                     /transcript_id="XM_002552413.1"
                     /db_xref="GeneID:8291326"
     CDS             463262..464902
                     /locus_tag="KLTH0C05390g"
                     /note="highly similar to uniprot|P07263 Saccharomyces
                     cerevisiae YPR033C HTS1 Cytoplasmic and mitochondrial
                     histidine tRNA synthetase encoded by a single nuclear gene
                     that specifies two messages efficient mitochondrial
                     localization requires both a presequence and an
                     amino-terminal sequence"
                     /codon_start=1
                     /product="KLTH0C05390p"
                     /protein_id="XP_002552459.1"
                     /db_xref="GeneID:8291326"
                     /db_xref="GOA:C5DE10"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:C5DE10"
                     /translation="MGSMIDENIDIICWMSIAAINSTLLRQSGRAARRLSIMASTQQE
                     KVGKSKVQFSLKTPKGTKDWSDKDVVIREEIFSRLSGLFKRHGGITLDTPVFELREIL
                     AGKYGEDSKLIYNLEDQGGELCSLRYDLTVPFARFVAMNNIQSMKRYHIAKVYRRDQP
                     AMTKGRMREFYQCDFDIAGSYDSMIPDAEVLSIVVEGLSNLGIKDYKIKLNHRKILDG
                     IFQVAGVSDENVRKISSAVDKLDKSPWEAVKHEMVVEKGQTEETADKIGEYVKLNGTL
                     QEIYALLSQDSSITSNEKAKQGLDEMATLIKYSEALEIDSHISFDLSLARGLDYYTGI
                     IFEAVTSASAPPKNAAELKKKAKGVEDASEYVGVGSIVGGGRYDNLVNMFAESTGKKS
                     GQIPCVGLSFGVERIFSILKQRAEQASAIRPTATKVYVMAFGGGKDWAGYLPERMKVT
                     KQLWNAGIATEFVYKAKSNPRKQFDAADKCGCPLAVILGKEEYLDNKLRVKRLGPEFA
                     NDDGELVDAADLVVVVKRKLDEIYQDDADEVTKLFRQL"
     gene            complement(<465827..>467314)
                     /locus_tag="KLTH0C05412g"
                     /db_xref="GeneID:8291327"
     mRNA            complement(<465827..>467314)
                     /locus_tag="KLTH0C05412g"
                     /product="KLTH0C05412p"
                     /transcript_id="XM_002552414.1"
                     /db_xref="GeneID:8291327"
     CDS             complement(465827..467314)
                     /locus_tag="KLTH0C05412g"
                     /note="similar to uniprot|P47125 Saccharomyces cerevisiae
                     YJR078W BNA2 Tryptophan 2 3-dioxygenase required for
                     biosynthesis of nicotinic acid from tryptophan via
                     kynurenine pathway"
                     /codon_start=1
                     /product="KLTH0C05412p"
                     /protein_id="XP_002552460.1"
                     /db_xref="GeneID:8291327"
                     /db_xref="GOA:C5DE11"
                     /db_xref="InterPro:IPR000898"
                     /db_xref="UniProtKB/TrEMBL:C5DE11"
                     /translation="MSQEIPIPRLEEYGIGASNGFLPTEFPVTKLSDPYYKSWESVVE
                     KLPSLLLSKKIRCVVDRLPILDVKESLLSDVRELRRAYSVLCFITNAYVWGYDEPSDV
                     LPDCVAQPLLKISEKLGLPPLATYASLVLWNFQPIVDDLDLAGDAMDLQNLTTINTFT
                     GGIDESWFYLVSVFFEKVGGKCLSAGLEAIEAVREKNEKTLLKSLEEIAQGIDQLGSL
                     LMRMEEMCDPHVFYYRIRPYLAGWRNMADAGLPKGVKYGLDGQYQQYAGGSNAQSSLI
                     QALDILLGVEHFSMGQKPSQGNSMSAKSGSNPFINEMRKYMPLEHREFLICLTKVSNV
                     KDYVFNHKSNEKLTLAFDACLAMLKSFRDKHIQIVSRYVVLQANKKPLPGKSKTLRSG
                     LSKGQGKKEQKGTGGTSLIPFLKQCRDETGSVAASDWGRKILSTGVLTVQNSSSITGI
                     RKRSSSSEEGEAITTKRVKLGLAGDWGSADDDDDDDIVSRSGGHW"
     gene            complement(<467681..>468277)
                     /locus_tag="KLTH0C05434g"
                     /db_xref="GeneID:8291328"
     mRNA            complement(<467681..>468277)
                     /locus_tag="KLTH0C05434g"
                     /product="KLTH0C05434p"
                     /transcript_id="XM_002552415.1"
                     /db_xref="GeneID:8291328"
     CDS             complement(467681..468277)
                     /locus_tag="KLTH0C05434g"
                     /note="similar to uniprot|P38162 Saccharomyces cerevisiae
                     YBL107C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C05434p"
                     /protein_id="XP_002552461.1"
                     /db_xref="GeneID:8291328"
                     /db_xref="InterPro:IPR016805"
                     /db_xref="InterPro:IPR019171"
                     /db_xref="UniProtKB/TrEMBL:C5DE12"
                     /translation="MLDHLTLKTPAGIIETDLKTGKNDNVTIEALTMTREKCMSRELV
                     DSFFRLLRHNSDDVIKQKLNNIDNLSSKAKEARCGDFVQRELFPSWDLRHEAINFCER
                     EAQLMKKEIDGRFGSSHTVERPVLDARMDPYAAADSLSQKESYYHDWRELTRWIQNQR
                     EIEEILQKNGASVLNRACDPDVAYIDAFKKFQLSLGKK"
     gene            complement(<468453..>471500)
                     /locus_tag="KLTH0C05456g"
                     /db_xref="GeneID:8291329"
     mRNA            complement(<468453..>471500)
                     /locus_tag="KLTH0C05456g"
                     /product="KLTH0C05456p"
                     /transcript_id="XM_002552416.1"
                     /db_xref="GeneID:8291329"
     CDS             complement(468453..471500)
                     /locus_tag="KLTH0C05456g"
                     /note="similar to uniprot|P38163 Saccharomyces cerevisiae
                     YBL106C SRO77 Suppressor of defect in the small GTPase
                     Rho3p yeast homolog of the Drosphila tumor suppressor
                     lethal giant larvae or similar to YPR032W uniprot|Q12038
                     Saccharomyces cerevisiae YPR032W SRO7 Suppressor of rho3
                     yeast homolog of the Drosphila tumor suppressor lethal
                     giant larvae"
                     /codon_start=1
                     /product="KLTH0C05456p"
                     /protein_id="XP_002552462.1"
                     /db_xref="GeneID:8291329"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DE13"
                     /translation="MFRSRKLKVVSNAIKSASSSDVSAGLNSKMFEVREISRYGMNGS
                     VKTFAFDPVQSLLAIATDAGEIHVFGKQQVEVVFTLDSKTIIRELRFVKGIYLIARDS
                     KDSILILSLYSKKVLTAFYAPGKISCVETDPSLEWILIGLQSGATVIYDIDKDCLSPL
                     RIENLQKAYMPKAHLSPVVSIQWNPRDYGTILISYRLVTVIYSLVENNVKQHFVYELP
                     PYAPGGDLTGNLDVCRTPPVTQSLYHPNSLHVMTVHEDGSLVFWDANSGKLIQARTLF
                     DTDVNEPRNAINRATVKPSPILQVSWICKANPEYTSLLIAGGSIDGEQSCHNLTMIDL
                     GVTPMYSMTSYEKMSTYYANPIQQKIFPIPNEASVVGFLPLARKSCHFSGNHDPAVIL
                     VLLDDGEIETLLYPSGSVSYKASLFPQSISWIRPVATKCVATSVPKKLWLGMMSSTYN
                     KDFLLKGGAPVKKPLRVHDTRSALATGHKNGSVRIWDASHGELDDSSVFDVSVSHALN
                     KADGVAISDISFASETAELAVSTEEGDVVLFKFQANQFFGASESTNEMEINFRRFSLS
                     KTKEVIVDISDRAPRKLREGFMPICAIHAEIGKVSSLKNSNIGFVGIGYEDGTFMVID
                     RRGPALIFSSNIRKTTQEKSSFVTCIDFSIAQFGEEKYSSILISCGTDAGEVLIFKIL
                     PDPSGRFMVQYVDLMKTNDNGPIVALESTSKETGASCSATIPLMQELSKGIPVPAFTM
                     ACGAYDIRLFTAGRSRDTHRVYKCPIATAGQSFIRLPQGEKSTKQFATVIVCLLTNGE
                     IKILNVPELRELKSTAMPMPVQAKYIRESSILRNGDIVVRVGKCEASLLTALKQTASN
                     ADGSDMDLANGATDSLYNPVLRIECRPQVNSLQWVRGSIHVKRSDLDKLMGTDVKPAK
                     YEEATIANGTISHDPQEKVENSHQLSPTSSTHHYKAPVRHATRGEGYVNMKSLSRAME
                     NGMDNLEGRFNDYAAATSESINQALEQTGSDLVKGAFKAKMGF"
     gene            complement(<471760..>475254)
                     /locus_tag="KLTH0C05478g"
                     /db_xref="GeneID:8291330"
     mRNA            complement(<471760..>475254)
                     /locus_tag="KLTH0C05478g"
                     /product="KLTH0C05478p"
                     /transcript_id="XM_002552417.1"
                     /db_xref="GeneID:8291330"
     CDS             complement(471760..475254)
                     /locus_tag="KLTH0C05478g"
                     /note="similar to uniprot|P24583 Saccharomyces cerevisiae
                     YBL105C PKC1 Protein Kinase C"
                     /codon_start=1
                     /product="KLTH0C05478p"
                     /protein_id="XP_002552463.1"
                     /db_xref="GeneID:8291330"
                     /db_xref="GOA:C5DE14"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C5DE14"
                     /translation="MLTQVEQEIRRKIERELNIIQGASQLKKKTDNVMVIQKCNTNIR
                     EAQQNIQYLEETLKKLQISSDQVERNPSQQRASQVYGQLSTIAPDEHSFSRLDLMKYD
                     CPSLSQRIQYMLQQLEFKLQVEQQYQEANEKLTKLYQIDGDQRSSSAAEGGSRESKQR
                     INLLKKSLKKYQAINVDLDQFRHQGESSHATQPKFRRKQLTGVLSIGVTAIRDVDHVQ
                     SPLFSRKPDTFITIKIDDTVKAKTKPSRNGRWHESFNINVGKGNEVELTVYDRVNDQT
                     VPVAQMWLLLSDIAEEIRKKKAEQSAPIDWNPAAGVTSSSEHSTKQANAGAENADRRL
                     GATSEDIASPSQEAALSQPVTTSLWFVLEPAGQILLNLGFSKSSAPTDKHLIGGLHRH
                     GAIINRKEEVYEQHGHHFVQKSFYNIMCCAYCGDFLRYSGFQCQDCKFLCHKKCYNHV
                     VTKCIAKSSSDTDPDEAKLNHRIPHRFEPISNRGTKWCCHCGYILPWGKKNLRKCSEC
                     GIMCHVQCAHLVPDFCGMSMGMANKILTAIQDTKRSQEQRQKLQVSPPKHQYPGAELS
                     KKTSRVSERSFETKQLPVSPTQKNLSDVRLGRIDVAAEDQRSDKQRFTETAQKTKIKP
                     TASETERNGVINERLNNFIEENADYEAFTQGAGSLQLQDLDTKTRSLDPSLASGLASD
                     KPDLSTQENDLSRDNETSILLEQQRDAQLERARDHQGFTEFDDSYDDAMVPLETKRSS
                     FNNTMSTQVDPGAQLPQKWQITPEPEEIPQKTEEHTTKAYKEQRHQDLSDAKLVQITP
                     QQSADALTKSQQSSPEAPQTGGRHKRKAPKRRKISLDDFVLLKVLGKGNFGKVLLAES
                     KNNERLCAIKVLKKDHIIKNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIY
                     FAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTP
                     EGHIKIADYGLCKDEMWFGNKTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQM
                     LLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPERRLGAGPRDAA
                     EVMAEPFFRNINFDDILHKRVQPPYIPEIKAADDTSYFEKEFTSAPPTLTPLPSVLSS
                     SLQEEFRGFSFMPDDLLL"
     gene            complement(<475687..>478644)
                     /locus_tag="KLTH0C05500g"
                     /db_xref="GeneID:8291331"
     mRNA            complement(<475687..>478644)
                     /locus_tag="KLTH0C05500g"
                     /product="KLTH0C05500p"
                     /transcript_id="XM_002552418.1"
                     /db_xref="GeneID:8291331"
     CDS             complement(475687..478644)
                     /locus_tag="KLTH0C05500g"
                     /note="similar to uniprot|P38164 Saccharomyces cerevisiae
                     YBL104C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C05500p"
                     /protein_id="XP_002552464.1"
                     /db_xref="GeneID:8291331"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DE15"
                     /translation="MGLIKRALNWSQDGYYDYLSVNPTREEVAHYRVDPESDSDQSIS
                     KLTVVKDFDNITCLDFSETEMGLVGVGEKNGMVRVMNMIYGFSGEDNSQLRVRAKQQR
                     AVNALGISPNGMVAIGLDRNRHDPSLQVWDVNYQSTNSNIVNPSFSYCMNESVISLKF
                     LNDTTLITATTKLLKEVDLRAPNPSYQHPTRLCNDIKVNPFNHWQFTTYSDDGTLAIW
                     DRRRLGHSSTSSDSLEAQSLLCFDKLMGTGAASRRYANSCFRWSAVRSNEFTTLHGGQ
                     VIRRWRLGSFPISIADEKQSEDSEFPFELDSLFISTVHDIKTTFDRVTTFDYIPRSNG
                     RTNFICMRQSGTIYRMSLKGGMSRAVFNSDNNMLMTNNDLSEATELRFADTNDKINTD
                     KTSTSLKNLSFEDLDISDEDYQPEEETSNGFSSDTENSEASSKASFEQDIEGHPLSDQ
                     GYQVLLKPEKLLRNDISMIMKRRALLNYGLDPVKTVELIDSSKALQNNAYIRNTWRWL
                     SIAKASVDDGTMVSGELDLGYEGILGIWNGLDGLSKQNRCREGAILTEKQLNRELEKI
                     IKMRGKNKSRMGESKGLLTFTNSNKTVQRKLCMVISGWDLNPSDYEEKYRNLIKANHY
                     EKAAGWAVFFGDVTKAIEILSSAKKERLRLIATAIAGYLAYKNQPGNNAWRQQCRRMS
                     SDLDDPYLRVIFGFIADNDWWDILSESAISLRERLGVALRFLNDKDLTRFLERTACTV
                     IENGELEGLILTGITPSGIKLLQSYVNKTSDVQTAALLSIYGCPRYFKSLQVDEWIGT
                     YRAMLNSWELFTARAKFDVLRGKMSRTSRNPAPQGARPRQLYIQCLKCNKNINNPVDP
                     SVSRGSTSGGMMKNFVANKKFGFNNASPSGNSHQKHSCPHCGTPFPRCAICLLPLGTS
                     NLPIVINGGTIEPSPDRGSTESLAESRRLRLNEWFSFCLSCNHGMHAGHAEEWFEKHY
                     ICPVPGCVCHCST"
     gene            complement(<478791..>480956)
                     /locus_tag="KLTH0C05522g"
                     /db_xref="GeneID:8291332"
     mRNA            complement(<478791..>480956)
                     /locus_tag="KLTH0C05522g"
                     /product="KLTH0C05522p"
                     /transcript_id="XM_002552419.1"
                     /db_xref="GeneID:8291332"
     CDS             complement(478791..480956)
                     /locus_tag="KLTH0C05522g"
                     /note="similar to uniprot|Q12311 Saccharomyces cerevisiae
                     YPR031W NTO1 Component of the histone acetyltransferase
                     complex"
                     /codon_start=1
                     /product="KLTH0C05522p"
                     /protein_id="XP_002552465.1"
                     /db_xref="GeneID:8291332"
                     /db_xref="GOA:C5DE16"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DE16"
                     /translation="MSSSQATQLKDEGPKLREEKHFADFYPELDQQEPLPIIVTNEIK
                     DDANLRNVETKEARHIKQMIFKERVTLESINIGANRAKFKKCRFKVSSQGINNHPRIS
                     KNYQKFGYISGSLADKFNEHDTPYIKKTDSLALIKDNPLGHISRYQSNFRVEYDMDEQ
                     DELYLRFLNESKSITPNNKLTHEIFEIAMTALENEWFFLEKKIPPRISTTSEVSTRET
                     RAAWAHYEAFGSDDGTGHTIDQPCAVCGGTECDNSNAIVFCDGCDVAVHQECYGVVFI
                     PEGQWLCRRCMISRNRKINCLFCPSHTGAFKQTDTGSWGHVVCGLWIPELYFVNSHYM
                     EPIEGVDLIPRSRWKLTCYICRKKVGACIQCSNKNCFCAYHVTCAKRSALCMDFGSCS
                     IIEASSNAIPPGLKLLSFCDKHSPPGWPSCEEGIQKTRLYFASADNDANSGSGSQASY
                     PHSSTKAKWTTNRGTPIAPSTFASVVQRILEMFQVENSAKVSADLCKYWSMKRELKRG
                     APLVRKFDPTSFSTFTVEQLGKRIEFADRLSKDLEMLQDMAQLLVERQMTTRRRNKAE
                     EKIQNLYHHPSRFILQESVIKKFQNSAPYKALLREKPIGARMSAILRDCTSSDSHDEI
                     TQFKKGMTEFLDRIETEQNVPRRVKIEAKKLRAHIAVLLASVEGFDYRSWISEDFTIE
                     GGRVKAVPWKGPALMERENLDAVEELSQAEMRKLRSLLN"
     gene            complement(<481394..>482584)
                     /locus_tag="KLTH0C05544g"
                     /db_xref="GeneID:8291333"
     mRNA            complement(<481394..>482584)
                     /locus_tag="KLTH0C05544g"
                     /product="KLTH0C05544p"
                     /transcript_id="XM_002552420.1"
                     /db_xref="GeneID:8291333"
     CDS             complement(481394..482584)
                     /locus_tag="KLTH0C05544g"
                     /note="some similarities with uniprot|P38165 Saccharomyces
                     cerevisiae YBL103C RTG3 Basic helix-loop- helix-leucine
                     zipper (bHLH/Zip) transcription factor that forms a
                     complex with another bHLH/Zip protein Rtg1p to activate
                     the retrograde (RTG) and TOR pathways"
                     /codon_start=1
                     /product="KLTH0C05544p"
                     /protein_id="XP_002552466.1"
                     /db_xref="GeneID:8291333"
                     /db_xref="GOA:C5DE17"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024099"
                     /db_xref="UniProtKB/TrEMBL:C5DE17"
                     /translation="MEFQQDENDFINELLGHAGLGELTATTQPASEALDPGGSFEAAG
                     RAPGFEQVHMRHPYAGSTPAKQQELLQRREQQDLGSYGSEFLIDEHLAQAQANAFFQE
                     SFQDPPHASSFQNEVQEDHLSRLAEDPVSSLGSSVATSDFLSPSTSFSFHSQGPLDSV
                     DSPSYSQYLSSSLRSPSNSFRQGNYLSTSLRAQQLNPRFSSVGSTAANTPGDLGNSSA
                     LSQEEKLRRRREFHNAVERRRRELIKQKVKELSKMIPPSLLNYNEQGKEIKANKGVIL
                     NRSVDYMDYLQQVLEIQDRKHQFLLKKVRELESFQHAMNTSRSRGPASKNTASDSPDQ
                     VIDTRGAPVAGENSSSTPSTTFQDDLQQFLSGDIIEAEDNAKLMFGGEGEGTAADFLL
                     SFGK"
     gene            <482829..>483464
                     /locus_tag="KLTH0C05566g"
                     /db_xref="GeneID:8291334"
     mRNA            <482829..>483464
                     /locus_tag="KLTH0C05566g"
                     /product="KLTH0C05566p"
                     /transcript_id="XM_002552421.1"
                     /db_xref="GeneID:8291334"
     CDS             482829..483464
                     /locus_tag="KLTH0C05566g"
                     /note="similar to uniprot|P38166 Saccharomyces cerevisiae
                     YBL102W"
                     /codon_start=1
                     /product="KLTH0C05566p"
                     /protein_id="XP_002552467.1"
                     /db_xref="GeneID:8291334"
                     /db_xref="GOA:C5DE18"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:C5DE18"
                     /translation="MPQQQESGLRESLDRWNQSRTQHSQGFNEGAKTIFASWADSLNG
                     RAQDIYQRLPLTQQDLEQDQEPEWFSLSRTERLVLFVCCILGSAGCFTLCVFLFPVLA
                     AKPRKFGLLWSMGSLLFVGAFGVLQGPAAYVKHITSRERLPFSLFFFTTCFLTIYFAA
                     FMKSALLTIPCAILELIAVIYYAVSYFPFGASGLRMVSAVGVNQARGVLRI"
     gene            complement(<483483..>486344)
                     /locus_tag="KLTH0C05588g"
                     /db_xref="GeneID:8291335"
     mRNA            complement(<483483..>486344)
                     /locus_tag="KLTH0C05588g"
                     /product="KLTH0C05588p"
                     /transcript_id="XM_002552422.1"
                     /db_xref="GeneID:8291335"
     CDS             complement(483483..486344)
                     /locus_tag="KLTH0C05588g"
                     /note="weakly similar to uniprot|P38167 Saccharomyces
                     cerevisiae YBL101C ECM21 Non-essential protein of unknown
                     function promoter contains several Gcn4p binding elements"
                     /codon_start=1
                     /product="KLTH0C05588p"
                     /protein_id="XP_002552468.1"
                     /db_xref="GeneID:8291335"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:C5DE19"
                     /translation="MPFGSSKESGSNEFKSESAKGAANVPRRRSSSIKQAFTNMMRSG
                     SSDSGSAARNGSSYNNVGSSSVPNSRSGPSSAYNPLMAMGGLPHVFYNSDDFGVARNE
                     QALAENFRPVFNDDECEEADVESDGNMSEAEDLHSYLGSSVPRQPQLLPSGQRYLLEY
                     LAERGFLEPKHLTCNKGISMFVATSSEVVFLPTTSSSQEDEYLNHLAMLNGTEVSLEE
                     PTLPQTSNEQNTACDEVEGSGEAVNAPPLDADGKNVLFNIAVVLSFKKATIASAVKAE
                     LYSRIRVYWQHGVPPEKTHNEEYYTLGELNWELSNQNYNLYVPNHLSTKNKIIEQPES
                     ITKPLVFKTNHDLSNQQYLDRRKSENQLCSSLESLSNHQTFQPGDYVFLLPTFFSNSI
                     PETVYLPSGRVSYNFRCATKVLGNSSGNIDSRSDASSSNSGISHGSEDYHPESSSHLK
                     FSGNKLLRKVKGQFQSSSNESDSSDKRNVLRGDHPIQVVRVPPVISESTADKPIYINR
                     VWNDALSYEVSLLKKYVPIGSEVPIKIKLAPISKKVSIKRIRVGVLEKITYVSKNLEY
                     EFDQTEALANDPYNPYYSEFVCRRKQERILSLWEIRTKEKGSRAMREDVIENCRSENI
                     FSYTSCPSGGKNGEPVDIVDPLTIHSTLKFPKYAVLDKRTSKNVPPYGIDEFTSTHNL
                     SSSQSTTAPRRNSAASGVIGFLSGRRTSTSFRSRHNSIAAGPEPNRSRTIFKSSSDVE
                     VQSHSRINEPKRGLYLDCVSMKNIHVKHKLEIMLRISKPDTKNPSVEKHYEVLIDTPI
                     FIVSDLCGSSNIELPTYDMAVRENTTEDFLPPTFEEAVSVSGSPLASPLNSPMGSPNL
                     MASYDPDELSIQQLSLSRSTTYNNSNNVEPSTPAVPGSAGRRYSNIDSLMNQRKTGQE
                     QPIFRKNYRLGNRDLSALEGSALSDGDEPPDYEESKQNN"
     gene            <486702..>489095
                     /locus_tag="KLTH0C05610g"
                     /db_xref="GeneID:8291336"
     mRNA            <486702..>489095
                     /locus_tag="KLTH0C05610g"
                     /product="KLTH0C05610p"
                     /transcript_id="XM_002552423.1"
                     /db_xref="GeneID:8291336"
     CDS             486702..489095
                     /locus_tag="KLTH0C05610g"
                     /note="similar to uniprot|Q12028 Saccharomyces cerevisiae
                     YPR029C APL4 Gamma-adaptin large subunit of the
                     clathrin-associated protein (AP) complex"
                     /codon_start=1
                     /product="KLTH0C05610p"
                     /protein_id="XP_002552469.1"
                     /db_xref="GeneID:8291336"
                     /db_xref="GOA:C5DE20"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:C5DE20"
                     /translation="MGSLRSFIKDVRAAKTLAEERSIVTKESARIRTKLKDDHLPQEK
                     RRKNIHKLLYLHILGEKTHFAQVECINLIASEDFRDKRLGYLAAMILLDENQEILTLL
                     TNMLNNDLNHPNRYVVSLALSTLGSLMSPELARDLYSDVENILAHSKDDFLVKKALQC
                     AAKLIQKDTSLVEVFFPYINSRLVSNQQSSHGVLLGVAKLCQAAITAKEKYEYDNYPE
                     ILQSMVQSIPEFFALLQDMNFTSFNPEYDVGGTCDPFLQVELLYTIRLLFELAPQETE
                     SYKDKLNDLLTKIATNSDGAKNSAHAVLYECVRTIFALQLDQSLKVLGVNVLAKFLSG
                     KDNNTKYVALNTLLHVVPQEPQAVQKHRKFISKCLFDPDISIKTRAVELTFAILNDSN
                     IKELIEELTAFLKLTSEDDKDLATYVVEHMIGLFEQYKLGDEKWALEATVNILMIVGE
                     HISLERLSDILIMINNARDLDHKIQVIRRILDVSFAKSGESVSSANLGWKLVSAWCIG
                     EYGDTLLESNIYLDTELTGYLRTLDGLYSDDCKIIGYVLTAALKLSSRLQNPSCIEEL
                     RQVIKGHNKDTNLMIQTKSVQYGILFNLPAKEKHDILGAMPLFEKKPKSGAAPAARPK
                     FGTKPQEPDLLLELLDDDYPKKSTTSNAAGSLLDIFGSAPQSSAKPENGKGNDTAGLT
                     QNLMTIPKDAPEAFRSTDLDVHMKLKSLNDYEAHVEMFIHANASINSLQVLAAVSKSK
                     KLTLGSLSASTLAPRENCRQEMIITGGGKPKLRIKLTFNTGSPSITKTEQFDYKFDQ"
     gene            complement(<489189..>489865)
                     /locus_tag="KLTH0C05632g"
                     /db_xref="GeneID:8291337"
     mRNA            complement(join(<489189..489689,489815..>489865))
                     /locus_tag="KLTH0C05632g"
                     /product="KLTH0C05632p"
                     /transcript_id="XM_002552424.1"
                     /db_xref="GeneID:8291337"
     CDS             complement(join(489189..489689,489815..489865))
                     /locus_tag="KLTH0C05632g"
                     /note="similar to uniprot|Q12402 Saccharomyces cerevisiae
                     YPR028W YOP1 Protein that regulates vesicular traffic in
                     stressed cells either to facilitate membrane turnover or
                     to decrease unnecessary secretion"
                     /codon_start=1
                     /product="KLTH0C05632p"
                     /protein_id="XP_002552470.1"
                     /db_xref="GeneID:8291337"
                     /db_xref="InterPro:IPR004345"
                     /db_xref="UniProtKB/TrEMBL:C5DE21"
                     /translation="MGDYVKAFQDELNTLDKKFAGNGVLEQFEAKTKLPKSYGVLGAA
                     SLYLLLIFINVGGIGEILSNFIGFVIPTYYSLVALKTPGGADDTELLTYWVVFAFLNV
                     IEFWSKAILYWVPFYWFMKTLLLVYLALPQTSGAKYVYNAVLEPVTSKYIKVPQAQAG
                     GVSSKMEGLSTSGKTTGFASHSN"
     gene            490079..490171
                     /locus_tag="KLTH0C05654r"
                     /db_xref="GeneID:8291338"
     tRNA            join(490079..490115,490136..490171)
                     /locus_tag="KLTH0C05654r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8291338"
     gene            complement(<490279..>493737)
                     /locus_tag="KLTH0C05676g"
                     /db_xref="GeneID:8291339"
     mRNA            complement(<490279..>493737)
                     /locus_tag="KLTH0C05676g"
                     /product="KLTH0C05676p"
                     /transcript_id="XM_002552425.1"
                     /db_xref="GeneID:8291339"
     CDS             complement(490279..493737)
                     /locus_tag="KLTH0C05676g"
                     /note="similar to uniprot|P48016 Saccharomyces cerevisiae
                     YPR026W ATH1 Vacuolar acid trehalase required for
                     trehalose utilization"
                     /codon_start=1
                     /product="KLTH0C05676p"
                     /protein_id="XP_002552471.1"
                     /db_xref="GeneID:8291339"
                     /db_xref="GOA:C5DE22"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:C5DE22"
                     /translation="MSVRHKTRKHTATSLIARSLPGLRAIFVILATCVAAAGWRWLLT
                     GELPRKPHLPCKVFRTHRHHDTRIEWRRRSSESLYELLTDSQDTYYDEDNWTVGTVFF
                     SENTYSRQPYVANGFLGSRIPNVGFGYAPDTYNIWTPDPSIPGALNNGWPLRNQRFAG
                     AFVSDFYSLQPHLNSTNFPELDADGYSTILSAIPQWTDMKISVKNDTVRFTAQDVLPQ
                     HVSNYHQNLSLLTGTVTTELDWMGLLHIKSTVLAHRILHPLGVLKLELSLIPDSGLKT
                     LDLQVSDIFNHSTSRRTFLRDLGYDSRGIYMEVEPDNVPYSSAALYSSLRFDGPAEAD
                     GCIFQLSDMNTTVSRKNFLTLSCEKPSITIQKYVAVVSTEYDRYNKTASNMEAAKDIV
                     HSQCGQYDLITQAHHNEWVSLYDNASIEIPSDSLLELSAKSSLFHLLANTRRFNISSS
                     RGLPLPSSGLSSDSYGGMIFWDADIWILPALLPFFPDIARHMVDYRKNTHEQARLNAQ
                     QYGYPGALYPWTSGRYANCTSTGPCVNYEYHINIDIAMASFLVYLNGAPGVDDEYLRE
                     TTWPLVRDAAQFFTAYVKFNSSLDAYETHNMTDPDEYANFINNGAFTNAGIKTLLKWA
                     TDVGNHLQEEIDPRWVEVSDKMFIPIAESNITLEYSGMNASVEIKQADVMLMTYPLGY
                     ITDETILDNAIRNLYYYSERQSPSGPAMTYPVFVAAAAGLLNHGCSSQSYLYKSVLPY
                     LRAPFAQFSEQSDDNFLTNGFTQPAFPFLTGNGGYLQSLLFGLTGLRYSYEVDKQTKK
                     ITRLLKFNPIKLPLLQGGIAINNFKYMGQVLDIIIGDEKATIVHKIGDEPINLKLIDR
                     SFIHDRDVTGPHMTHVHEGEEVPVQWITLQPGQNLTVDLFRPLLNIDGNLIEGKQVSN
                     FTAGVPGDVIYSVIDGNNFTHWQPLDKNVCAKILIDLGPGNEQNLTGGMILWGRRPAR
                     NISVAMVPYKGDIEQALQKASSVMESSGPDKRVEILGYTAPASELASRLSETEDRFFE
                     EDYRLLLSSQRLDIEQLSKLSPESSLLKSKFVTILHNLQISPSEPYAEENQRGSKIVI
                     PRSNSTHFTFDYSNYTSDKAFEHPVSKESGASWPPPRFVLVCIQGTYDDDDDPKGATI
                     KEIALM"
     gene            <495922..>497568
                     /locus_tag="KLTH0C05698g"
                     /db_xref="GeneID:8291340"
     mRNA            <495922..>497568
                     /locus_tag="KLTH0C05698g"
                     /product="KLTH0C05698p"
                     /transcript_id="XM_002552426.1"
                     /db_xref="GeneID:8291340"
     CDS             495922..497568
                     /locus_tag="KLTH0C05698g"
                     /note="highly similar to uniprot|P07251 Saccharomyces
                     cerevisiae YBL099W ATP1 Alpha subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="KLTH0C05698p"
                     /protein_id="XP_002552472.1"
                     /db_xref="GeneID:8291340"
                     /db_xref="GOA:C5DE23"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DE23"
                     /translation="MLSRSALRSAARSIAAVNVARTMNKVARPALMVAGRRYASAKAQ
                     PTEVSSILEERIRGVSEETNLNETGRVLSVGDGIARVFGLNNVQAEELVEFSSGVKGM
                     ALNLEPGQVGIVLFGSDRLVKEGEVVKRTGQIVDVPVGPDMLGRVVDALGNPIDGKGP
                     IEAAGRSRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAV
                     ALDTILNQKRWNNGSDESKKLYCVYVAVGQKRSTVAQLVQTLEQHDAMKYTVIVAATA
                     SEAAPLQYIAPFTAAAIGEWFRDNGRHALIVYDDLSKQAVAYRQLSLLLRRPPGREAY
                     PGDVFYLHSRLLERAAKMSEKNGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFL
                     EAELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDL
                     DASTKQTLARGERLTQLLKQSQYSPMAAEEQVPLIYAGVNGYLDNIELSRIAEFEGSF
                     LAYLKSNHDEIISAIREKGELSKELLGALKSATESFVATF"
     gene            <498103..>499230
                     /locus_tag="KLTH0C05720g"
                     /db_xref="GeneID:8291341"
     mRNA            <498103..>499230
                     /locus_tag="KLTH0C05720g"
                     /product="KLTH0C05720p"
                     /transcript_id="XM_002552427.1"
                     /db_xref="GeneID:8291341"
     CDS             498103..499230
                     /locus_tag="KLTH0C05720g"
                     /note="similar to uniprot|P37366 Saccharomyces cerevisiae
                     YPR025C CCL1 Cyclin associated with protein kinase Kin28p
                     which is the TFIIH-associated carboxy- terminal domain
                     (CTD) kinase involved in transcription initiation at RNA
                     polymerase II promoters"
                     /codon_start=1
                     /product="KLTH0C05720p"
                     /protein_id="XP_002552473.1"
                     /db_xref="GeneID:8291341"
                     /db_xref="GOA:C5DE24"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR027081"
                     /db_xref="UniProtKB/TrEMBL:C5DE24"
                     /translation="MTTTPKPSNGADAKAKEQGSLRVTDDDLYRHSSQYRVWSFTPEQ
                     LTQRRAEVNARATAKIEQNLRAFRETHLALTAEELAAIEEKAVPVSTEEELLLVSYFA
                     RMILSFAGKMNLPTEVAATAVSFFRKFYLSNSVSEISPKEVFHTALFFSCKSENYFIG
                     VESFAKKAKTNPSAVLKHEFKLLESLNFTLMNHHPYKALHGFFLDIQSVLAGKVDMNY
                     MGQVYTDCKKIITDALLTDAVYFYSPPQITLAALLIADEALTMRYLQMKFMITEEGPT
                     ENSQGEKQDSKEGASISIPGQKLLEIIKECKEIISNKVAPPKEDAVKVTAKIHYSQNP
                     LTVLDRLKRQRESNSTGATPGQTPIPEDSQTKRPKTDGATN"
     gene            complement(<499428..>501662)
                     /locus_tag="KLTH0C05742g"
                     /db_xref="GeneID:8291342"
     mRNA            complement(<499428..>501662)
                     /locus_tag="KLTH0C05742g"
                     /product="KLTH0C05742p"
                     /transcript_id="XM_002552428.1"
                     /db_xref="GeneID:8291342"
     CDS             complement(499428..501662)
                     /locus_tag="KLTH0C05742g"
                     /note="highly similar to uniprot|P32795 Saccharomyces
                     cerevisiae YPR024W YME1 Mitochondrial inner membrane
                     protease of the AAA family responsible for degradation of
                     unfolded or misfolded mitochondrial gene products mutation
                     causes an elevated rate of mitochondrial turnover"
                     /codon_start=1
                     /product="KLTH0C05742p"
                     /protein_id="XP_002552474.1"
                     /db_xref="GeneID:8291342"
                     /db_xref="GOA:C5DE25"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DE25"
                     /translation="MSLSRVIVNSLLINGGIIRPIASRLPLLAACGMRRTLLMRRGFV
                     QRHRYSTVGSGPDNNPSTQKGSQAGPGSLGGAAASNTSGTPQGGEASDSSPVSHAILA
                     QNEQLANKDLNNPTAQAEFYRLLLRSDYPQYVVSRFETPGIASSPECMKFYMEALQKI
                     GRHADAEVVKQSLLNGTTSRLGSASGGAEFQKQTASASTGGATGYNPYFGSRKEPIHV
                     VVTESTFTIVSRWVKWLVVFGLVTYGVTEGFKYITENTTLLKSSEVADKSVDVAKTNV
                     KFDDVRGCDEARAELEEIVDFLKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARATAG
                     EAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKDQ
                     AYAKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDVRG
                     RTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH
                     FEWAKDKILMGAERKTMVLTEATRKATAFHEAGHAIMAMYTPGATPLYKATILPRGRA
                     LGITFQLPEMDKVDITKKECLARLDVCMGGKIAEEIIYGKENTTSGCGSDLQGATNTA
                     RAMITQYGMSEQVGPVNLADKWESWSGKIRDIADNEVIEVLKASEERTRKLLNERSKE
                     LHRLAQGLVEYETLDSKEMDLVCKGEPLSKAKMMTNKVIEGPDSDERKELGDKSKVPV
                     LIKA"
     gene            complement(<502173..>504551)
                     /locus_tag="KLTH0C05764g"
                     /db_xref="GeneID:8291343"
     mRNA            complement(<502173..>504551)
                     /locus_tag="KLTH0C05764g"
                     /product="KLTH0C05764p"
                     /transcript_id="XM_002552429.1"
                     /db_xref="GeneID:8291343"
     CDS             complement(502173..504551)
                     /locus_tag="KLTH0C05764g"
                     /note="similar to uniprot|P38170 Saccharomyces cerevisiae
                     YBL097W BRN1 Essential protein required for chromosome
                     condensation likely to function as an intrinsic component
                     of the condensation machinery may influence multiple
                     aspects of chromosome transmission and dynamics"
                     /codon_start=1
                     /product="KLTH0C05764p"
                     /protein_id="XP_002552475.1"
                     /db_xref="GeneID:8291343"
                     /db_xref="GOA:C5DE26"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:C5DE26"
                     /translation="MALNVLYQAVLVRGFGNTPSSIRTIMADTIVADDDDRGLFTNKS
                     TMMANFEQWIKMATDNKINSRNSWNFALIDYFHDLNVLKDAEDNINFQKASATLDGCV
                     KIYSSRVDSVANETGILLSGLAQRKNQQQQGDDESGAEGAKTIENVVEGGVTIDPSTG
                     LPISNEVDTTSRKRNYNRVLETTLVDFETLRMRELDQELSIDPLFKKALADFDEGGAK
                     SLLLNTLHIDSSARVVFDATASHSQRNSGKPDLVEQHETSNISGEMDEDSVVSDSSHE
                     EAEGSVLGGSGPVEQASNSHDSNMSTNHGSDHETIDVEDEILALGMDFIDFKLINEAE
                     ICPSMKSLKDVVEDINKAKSFIDDVNSKFDNFLTEKDLQSAIPDPQEDEGASYDLHDD
                     GSLGADAGLYEDAGAMEDDQIDDPVGDHSGATDGDRSTVDPITAVMDRDVMAYFDETM
                     KKSWRGREHWKVRNFKDRFLPKTNDNATNDTHGDAQGSEKGRDTNKPKKPPKQKFTLD
                     FFNFNNIEEQIFDNKRKANIEMPQKLRTNPTRYLLPDDYQFSTQKVTRLFIKPQQHMS
                     FFSHRKSKADNQRPGGILKFDEIDAHEDSQVAELADQNFWAQNYQMREQEKNVMEEEI
                     DRPDMTAGLQNPFDDGEVDFNQAFGSEALDEFDSGSIDPPPGGSAGLTQPFGMPEGKV
                     TYSRVSKKVDVKRLKDNIWKSISTTLQAQQKENSEQQVNEEDAAGRSTLKFTDIAENI
                     STMYNGERKKDLSTSFCFICLLHLANEHGFEINPTEDFTDLAVEFQAEKDNT"
     gene            complement(<504634..>506025)
                     /locus_tag="KLTH0C05786g"
                     /db_xref="GeneID:8291344"
     mRNA            complement(<504634..>506025)
                     /locus_tag="KLTH0C05786g"
                     /product="KLTH0C05786p"
                     /transcript_id="XM_002552430.1"
                     /db_xref="GeneID:8291344"
     CDS             complement(504634..506025)
                     /locus_tag="KLTH0C05786g"
                     /note="similar to uniprot|P38169 Saccharomyces cerevisiae
                     YBL098W BNA4 Kynurenine 3-mono oxygenase required for
                     biosynthesis of nicotinic acid from tryptophan via
                     kynurenine pathway"
                     /codon_start=1
                     /product="KLTH0C05786p"
                     /protein_id="XP_002552476.1"
                     /db_xref="GeneID:8291344"
                     /db_xref="GOA:C5DE27"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR027545"
                     /db_xref="UniProtKB/TrEMBL:C5DE27"
                     /translation="MPETVAVIGAGLVGCLAAVALAKRGYEVTLFDYRLDPRLATTQD
                     RNLRSINLAISARGITSLEYVDKGISKRVLKDIIPMQGRMIHNLRGHQEAQNYGLFGE
                     CINSIDRGVLNNSLLDEVDNLQNVALKFGHKLSQIKFTPNAKQTCVFTTNAASAAKEY
                     AFDFVLGCDGAYSSTRSQMQRELRMDFSQEYIDCCYIELYVPPAKEHNPKFNGKFAIS
                     PNHLHIWPRGNYMLIALANGDGSFTSTFFGPWSLVEGLDTRSKIQDFLTNNFPDAVEI
                     IGLKQAVDAFENHPRGALMCVECSPYHLSQGRAIILGDAAHSMVPFYGQGMNCGFEDV
                     RVLMQLLDKHSGNRAAAFEEYSSKRHTDLVSIIKLAKNNYKEMSHGVISNLYLLRKKL
                     DTLLGRVLKDRWLPLYTMVSFRADIPYHKAIQIEQRQKKILAYLQAFILALTSLGGLG
                     LYKVLRRALKNRK"
     gene            complement(<506792..>508741)
                     /locus_tag="KLTH0C05808g"
                     /db_xref="GeneID:8291345"
     mRNA            complement(<506792..>508741)
                     /locus_tag="KLTH0C05808g"
                     /product="KLTH0C05808p"
                     /transcript_id="XM_002552431.1"
                     /db_xref="GeneID:8291345"
     CDS             complement(506792..508741)
                     /locus_tag="KLTH0C05808g"
                     /note="weakly similar to uniprot|P30605 Saccharomyces
                     cerevisiae YDR497C ITR1 Myo-inositol transporter with
                     strong similarity to the minor myo-inositol transporter
                     Itr2p"
                     /codon_start=1
                     /product="KLTH0C05808p"
                     /protein_id="XP_002552477.1"
                     /db_xref="GeneID:8291345"
                     /db_xref="GOA:C5DE28"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DE28"
                     /translation="MPASPPSISSSDDKGAMSHHDVAPPLLEKNAESGSFADSEKATT
                     GAGALGDAAIPDNVLAEYSEEQVAQMGRAFARKYELPNEDDIFARAAVLARSPEHYDH
                     MSLLTEEERLACYDEQYHPLRNMPPKLIAIICAAAMGAAVQGMDETVINGAQLFYPKV
                     MSLGEETQRNDWLKGLINGAPYLCCAGVSCFMTDFLNNWLGRKRVIFWTCVISAVTCL
                     LQAFAPTGTRGWHYLFAMRFLLGLGIGPKSATVSIYLAECSTKKLRGIICMNWQAFTA
                     FGIMWGYVFSLIFYRVGSGAVHGGLNWRLMLASAMIPAVLVLFQIPYCPESPRWLMGK
                     GRYREAYESTVQIRPHRLLACRDLFYQHVLLLEEESLDKPYIKRLGELFTVRRNRNAM
                     LAAFICAFMQQFCAINIIAYYSSAIFLQSGFSEISSLCSSLGFGLINFFFAIPAFFMI
                     DRFGRRFLLLSTFPAMALFLFVTGFAFWIPDQQTRVGIVSMGIYVFSAIYSFGCGVVP
                     FVVAGEVFPLYVRAIGASFFTIVLWGFNFILSVTWPRMLNALHPQGAFGFYAGWNIVG
                     WFLVYFLLPETKQLTLEELDEVFDVPLRKRISYQFLELWPNFQEYVLRRKNVIRQPPL
                     GRHHRLAVKNAEWNDKAEVEQVENI"
     gene            <510023..>510763
                     /locus_tag="KLTH0C05830g"
                     /db_xref="GeneID:8291346"
     mRNA            <510023..>510763
                     /locus_tag="KLTH0C05830g"
                     /product="KLTH0C05830p"
                     /transcript_id="XM_002552432.1"
                     /db_xref="GeneID:8291346"
     CDS             510023..510763
                     /locus_tag="KLTH0C05830g"
                     /note="similar to uniprot|P38172 Saccharomyces cerevisiae
                     YBL095W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C05830p"
                     /protein_id="XP_002552478.1"
                     /db_xref="GeneID:8291346"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5DE29"
                     /translation="MSRPFLARYIAVPAAGFALGFATFLRAWPTPHAGDDGPDNETLQ
                     SATLKRPAEQQRLDILEHLQQHRIYADLIRRDNIQQWSQSERITRPHRDYHVGQGLLY
                     GPGSLEIDPLVLHDPDAQELVVFYHLGRNLANEKGAVHKGVISLLLDEALCYCGFPSL
                     PSKSGVTARLDLQFHQDVPTDCTVVLKARVQEARGRKCIITGSLHTLPSRPWYRPFGG
                     ESSKTLATATCVLVEPKWFKYVKWLNAI"
     gene            <510994..>512418
                     /locus_tag="KLTH0C05852g"
                     /db_xref="GeneID:8291347"
     mRNA            <510994..>512418
                     /locus_tag="KLTH0C05852g"
                     /product="KLTH0C05852p"
                     /transcript_id="XM_002552433.1"
                     /db_xref="GeneID:8291347"
     CDS             510994..512418
                     /locus_tag="KLTH0C05852g"
                     /note="similar to uniprot|P38682 Saccharomyces cerevisiae
                     YER122C"
                     /codon_start=1
                     /product="KLTH0C05852p"
                     /protein_id="XP_002552479.1"
                     /db_xref="GeneID:8291347"
                     /db_xref="GOA:C5DE30"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:C5DE30"
                     /translation="MSDSSGDVYCSKEETSKVFQRLASKQDNRVCFDCGTKNPTWTSV
                     PFGVMLCIQCSAVHRNLGVHITFVKSSNLDKWTVTNLRRFKVGGNHKARDFFMKNNGK
                     QFLGTNVDARMKYTSSVARNYKAHLDKRVAQDAEQHPGEIVLSAEDDAGDTSSASNSA
                     PSSKNNSVDDFFSSWEKPAAATPSPKVLTPSSTGNSRNGSKTSILSGSSSRRRTTAAP
                     AAGAKKHSILSSSRKTTRVSAQKLGKGEASDLFDDFEKAAKQEEAEQKAAPLGAAAGA
                     TRAAASEKTVYSQPKPVKMGSTYDDPEISEYNDGIAFDQVKAGSSAATVESVQPQLAK
                     LGFGMTMNDANTLAAKAKEAKRAASGPKYTGQVAAQFGGQKAISSDMLFGRGSYDEEA
                     SKEAKDKLKTNFNNATSISSSSYFGEEDEQDEFGRPAARSQTGGAGFVEFNNDADDDF
                     QVLRDAVEQGAQKLGNYLRDYLRN"
     gene            complement(<512656..>513267)
                     /locus_tag="KLTH0C05874g"
                     /db_xref="GeneID:8291348"
     mRNA            complement(<512656..>513267)
                     /locus_tag="KLTH0C05874g"
                     /product="KLTH0C05874p"
                     /transcript_id="XM_002552434.1"
                     /db_xref="GeneID:8291348"
     CDS             complement(512656..513267)
                     /locus_tag="KLTH0C05874g"
                     /note="similar to uniprot|P25046 Saccharomyces cerevisiae
                     YBL093C ROX3 RNA polymerase II holoenzyme component"
                     /codon_start=1
                     /product="KLTH0C05874p"
                     /protein_id="XP_002552480.1"
                     /db_xref="GeneID:8291348"
                     /db_xref="GOA:C5DE31"
                     /db_xref="InterPro:IPR013942"
                     /db_xref="UniProtKB/TrEMBL:C5DE31"
                     /translation="MTTVDDHISPAYYYYVDPATVYQAQEPNPLEDLISVYGLQDLSR
                     QVARTNPDGSKAVKLRKSYKNQISDLSAKFSVIPTRENGKGGDISHMLFQNNADMMAQ
                     VRRTPEMTAEQWRQLMAERDAGLFDGHNMDWEICQTVLSQFERSYPAEFQANGFQAED
                     LAFDLDGSGNTLKSRKRKNKSSGSSMATPNSDLQDDMKRRRLE"
     gene            complement(<513373..>514191)
                     /locus_tag="KLTH0C05896g"
                     /db_xref="GeneID:8291349"
     mRNA            complement(<513373..>514191)
                     /locus_tag="KLTH0C05896g"
                     /product="KLTH0C05896p"
                     /transcript_id="XM_002552435.1"
                     /db_xref="GeneID:8291349"
     CDS             complement(513373..514191)
                     /locus_tag="KLTH0C05896g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C05896p"
                     /protein_id="XP_002552481.1"
                     /db_xref="GeneID:8291349"
                     /db_xref="UniProtKB/TrEMBL:C5DE32"
                     /translation="MSCLRFNVLLCDPLALPGSFNVSVPTYLSCYFTGPVLTLRRLRF
                     PVQASNVFPISVRALPGHGLCAGAGARRARASACAYRSAYSPRRRARTARGSQPSTMP
                     DACLGPASSPPTNTLRPARAPRRAVSSSSAATHAKKDPLKPPKSFSTPEKSEHQKPTP
                     TPTHQGHSHHVTEQSHVRRPRPDHVILRIVLCASLAARSHMPVRIRATGPTERGRSWA
                     RQEGEGIRPPFDIHASGRAGSASSLKRAIVDSNSVGLLQRLTSVEGRQDPKALH"
     gene            <514317..>514712
                     /locus_tag="KLTH0C05918g"
                     /db_xref="GeneID:8291350"
     mRNA            <514317..>514712
                     /locus_tag="KLTH0C05918g"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_002552436.1"
                     /db_xref="GeneID:8291350"
     CDS             514317..514712
                     /locus_tag="KLTH0C05918g"
                     /note="highly similar to uniprot|P38061 Saccharomyces
                     cerevisiae YBL092W RPL32 Protein component of the large
                     (60S) ribosomal subunit has similarity to rat L32
                     ribosomal protein"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_002552482.1"
                     /db_xref="GeneID:8291350"
                     /db_xref="GOA:C5DE33"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="InterPro:IPR018263"
                     /db_xref="UniProtKB/TrEMBL:C5DE33"
                     /translation="MAASLPHPKIVKKHTKKFKRHHSDRYKRVSENWRKQKGIDSVVR
                     RRFRGNIPEPTIGYGSNKKTRFMAPSGHKTFLVANVKDLEMLMMHTRTYAAEIAHNVS
                     SKNRVTLLARAKALGVKVTNPNGRLGLQA"
     gene            complement(<514929..>515941)
                     /locus_tag="KLTH0C05940g"
                     /db_xref="GeneID:8291351"
     mRNA            complement(join(<514929..515626,515905..>515941))
                     /locus_tag="KLTH0C05940g"
                     /product="KLTH0C05940p"
                     /transcript_id="XM_002552437.1"
                     /db_xref="GeneID:8291351"
     CDS             complement(join(514929..515626,515905..515941))
                     /locus_tag="KLTH0C05940g"
                     /note="similar to uniprot|P40075 Saccharomyces cerevisiae
                     YER120W SCS2 Protein likely to be involved in regulating
                     INO1 expression suppressor of a dominant nuclear mutation
                     that is inositol-dependent in the presence of choline
                     involved in inositol metabolism regulator of INO1
                     expression"
                     /codon_start=1
                     /product="KLTH0C05940p"
                     /protein_id="XP_002552483.1"
                     /db_xref="GeneID:8291351"
                     /db_xref="GOA:C5DE34"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016763"
                     /db_xref="UniProtKB/TrEMBL:C5DE34"
                     /translation="MIEIKPSVLEYKPPLTAQATEYVTVTNNTDQAVAFKVKTTAPKF
                     YCVRPNAALVAPGEQVQVQVILLGLAEEPAPDFKCKDKFLVITLPAPYDLGASSVTEA
                     WPQLESEFKQHAVSKKIKVKYLLGDEAPVRAEESSAAVKREEPVGAKAAGASSSAPQA
                     EEPQETKAVTLKPEEPAQKPALGAVQEDVKPEAAPEPEPVSKAAAATAGGASEKHVAQ
                     KQEAAINPAIIALVLLIALVLGWKFH"
     gene            complement(<516175..>517437)
                     /locus_tag="KLTH0C05962g"
                     /db_xref="GeneID:8291352"
     mRNA            complement(<516175..>517437)
                     /locus_tag="KLTH0C05962g"
                     /product="KLTH0C05962p"
                     /transcript_id="XM_002552438.1"
                     /db_xref="GeneID:8291352"
     CDS             complement(516175..517437)
                     /locus_tag="KLTH0C05962g"
                     /note="highly similar to uniprot|P38174 Saccharomyces
                     cerevisiae YBL091C MAP2 Methionine aminopeptidase
                     catalyzes the cotranslational removal of N-terminal
                     methionine from nascent polypeptides function is partially
                     redundant with that of Map1p"
                     /codon_start=1
                     /product="KLTH0C05962p"
                     /protein_id="XP_002552484.1"
                     /db_xref="GeneID:8291352"
                     /db_xref="GOA:C5DE35"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /translation="MSDAIAKDAVNTSSEKEPVSATPELKTSGSPDAAVSSGDKKKKK
                     KKKKTNNIKNIALLYPDEKYPEGEWMDYHQDFNLQRTTDEEKRYLTRDAENQQRWNDM
                     RKGAEIHRRVRKNLQNKLKPDMTLTEVVNIVENATRKFTGVDENGDHVDRPKSQGVGF
                     PTGVSLNHCAAHFTPNAGDQTVLRYEDVMKVDIGVQVNGYIVDSAWTVAFDPKYDNLL
                     QAVREATNTGVREAGIDVRLTDIGEAIQEVMESYEVELNGKTHQVKPCRNLCGHNIAP
                     YRIHGGKSVPIVKNGDQTKMEEGEHFAIETFGSTGRGFVVPGGEVSHYAKSAEADGLP
                     APSLSRAKSLLKTIDENFGTLPFCRRYLDRLGEDKYLFALNSLVKHGIVQDYPPLNDV
                     QGSYTAQFEHTILLHPHRKEVVSRGEDY"
     gene            <517472..>518128
                     /locus_tag="KLTH0C05984g"
                     /db_xref="GeneID:8291353"
     mRNA            <517472..>518128
                     /locus_tag="KLTH0C05984g"
                     /product="KLTH0C05984p"
                     /transcript_id="XM_002552439.1"
                     /db_xref="GeneID:8291353"
     CDS             517472..518128
                     /locus_tag="KLTH0C05984g"
                     /note="weakly similar to uniprot|P38175 Saccharomyces
                     cerevisiae YBL090W MRP21 Mitochondrial ribosomal protein
                     of the large subunit MRP21 exhibits genetic interactions
                     with mutations in the COX2 and COX3 mRNA 5'-untranslated
                     leader sequences"
                     /codon_start=1
                     /product="KLTH0C05984p"
                     /protein_id="XP_002552485.1"
                     /db_xref="GeneID:8291353"
                     /db_xref="GOA:C5DE36"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="UniProtKB/TrEMBL:C5DE36"
                     /translation="MGRFHQHFVMEFIGHYSLIYILNLKNFKKWCYANTEETTTLSVS
                     QRSKMLSSRGVRLSQSVRTISSSLRLLNSSNSPIFDPSQLNPLSNTKVGTGASSKLQF
                     EIPSPQNSSAPQDQGQRFAAASFIASPKEDALTSRLTGVRAGRTVDVYNGDTAGAFRQ
                     LNSVVFSNRIAQDRRNQRFHLKRGKAKEIRSSQRHRREFMKGFKRLIEVVKDAKRKGY
                     "
     gene            <518793..>520130
                     /locus_tag="KLTH0C06006g"
                     /db_xref="GeneID:8291354"
     mRNA            <518793..>520130
                     /locus_tag="KLTH0C06006g"
                     /product="KLTH0C06006p"
                     /transcript_id="XM_002552440.1"
                     /db_xref="GeneID:8291354"
     CDS             518793..520130
                     /locus_tag="KLTH0C06006g"
                     /note="similar to uniprot|P40074 Saccharomyces cerevisiae
                     YER119C AVT6 Vacuolar transporter exports aspartate and
                     glutamate from the vacuole and to YBL089W uniprot|P38176
                     Saccharomyces cerevisiae YBL089W AVT5 Putative
                     transporter, members of a family of seven S. cerevisiae
                     genes (AVT1-7) related to vesicular GABA-glycine
                     transporters"
                     /codon_start=1
                     /product="KLTH0C06006p"
                     /protein_id="XP_002552486.1"
                     /db_xref="GeneID:8291354"
                     /db_xref="GOA:C5DE37"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DE37"
                     /translation="MSSSLGSGVLTLLHTACGAGILAMPYAFRPFGVLLGFGMIAFCG
                     ACSLAGLMIQGRVSKYAAERNASFFALAQVTYPQLSVIFDLAIAVKCFGVGVSYLVVV
                     GDLMPRIFATFTSHGLLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYL
                     CVLVLVHYVWPSDEIRELRGHVSLGKPVGSFAALLSCFPIFVFAYTCHHNMFSIVNEL
                     RDNSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYPQSAATTVGRVA
                     IALLVMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVE
                     EGGPRQLAVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILP
                     GIFGFQLIGSEDQPGQSSTKTKFLKYLSLTLACWGMAVLVTCLSATLLLGATH"
     gene            <520445..>521473
                     /locus_tag="KLTH0C06028g"
                     /db_xref="GeneID:8291355"
     mRNA            <520445..>521473
                     /locus_tag="KLTH0C06028g"
                     /product="KLTH0C06028p"
                     /transcript_id="XM_002552441.1"
                     /db_xref="GeneID:8291355"
     CDS             520445..521473
                     /locus_tag="KLTH0C06028g"
                     /note="similar to uniprot|P40073 Saccharomyces cerevisiae
                     YER118C SHO1 Transmembrane osmosensor participates in
                     activation of both the Cdc42p- and MAP kinase-dependent
                     filamentous growth pathway and the high- osmolarity
                     glycerol response pathway"
                     /codon_start=1
                     /product="KLTH0C06028p"
                     /protein_id="XP_002552487.1"
                     /db_xref="GeneID:8291355"
                     /db_xref="GOA:C5DE38"
                     /db_xref="InterPro:IPR001452"
                     /translation="MAVPNRVEAKQMRDHPHRIHEFRLANLVTDPFAISSLSLALIAW
                     IIAFAGSVVAASNSKKYPAFSWWGIVYQILLMVLVLILYCYDLIDYYKSFLSGALAVA
                     FVYTTNSAAEMLYQDGSRMGAASAGVILLSMINIIWMFYFGSDNASPSNRWIDSYSLR
                     GIRHSVLESSIAMSSRPPLVSRNVSKYSASPQMDLYNATPAPHSQGFYPDTHSQHYVS
                     STALNGFENAGPPTAPALHGNMGHGNNTSTFVTDTTNGNTETTMGDTLGLYSDAGDEL
                     TSFPYVAKALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYV
                     ELVGENSI"
     gene            complement(<521583..>530027)
                     /locus_tag="KLTH0C06050g"
                     /db_xref="GeneID:8291356"
     mRNA            complement(<521583..>530027)
                     /locus_tag="KLTH0C06050g"
                     /product="KLTH0C06050p"
                     /transcript_id="XM_002552442.1"
                     /db_xref="GeneID:8291356"
     CDS             complement(521583..530027)
                     /locus_tag="KLTH0C06050g"
                     /note="similar to uniprot|P38110 Saccharomyces cerevisiae
                     YBL088C TEL1 Protein kinase primarily involved in telomere
                     length regulation contributes to cell cycle checkpoint
                     control in response to DNA damage functionally redundant
                     with Mec1p homolog of human ataxia telangiectasia (ATM)
                     gene"
                     /codon_start=1
                     /product="KLTH0C06050p"
                     /protein_id="XP_002552488.1"
                     /db_xref="GeneID:8291356"
                     /db_xref="GOA:C5DE39"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /db_xref="UniProtKB/TrEMBL:C5DE39"
                     /translation="MFPFYIIYLYTSIISEFSFPSRQYPSLKQNRRHVTLFAPCFSSM
                     DSSQLPTILESLSSGKLKLRGQALDELTTRLKQDSTPFPPKYLYPTIEALVDILEAEK
                     IKYENLSADGAASSESKLTAVENRLSSASYVLRILVQTTNPSFKPKHLKFLLLLLPDL
                     MVFHGTDSLLPSTSTHLLSALESLIESEIFQLKFEPLQWITLTKKLLSFLSIQLDSSM
                     SSKNVMHLLSLLASLLSLDCAFIEEVQTTFIDPLAKFLTKAEGENSNTKALLQLINLY
                     ILKVHLTDYFGCCKLLELTMRFLTRVGKLSTPGVDYELSMFNIFLSKLLCHQIPPGQL
                     PGAFDQEYLAQLFEDYLVVALTNYDPSHLGFGDFLFRSLTKRIEWLEFDEFQLHPQSD
                     VNYWLQVHSLAQMVRTYFTKRGKQKPEESLLFKKAKTSQTFSTILRDTLSPASFIVRC
                     VESTSKLNQLTGVQLSAFISATTNQETADINEVVEAIIMKWEDIHMEGWVLIALLPLI
                     SDHNSEIPKKTVQKAFRLSIPLLKSTKLCQPACALQVALMKHYKDFLLADTALVHQAS
                     DLYEESELNGPALLTDVAFAFWEHMHWLIATSKPELHESAHSKTVSWLLSKASQLLLK
                     RPDQSSFSSFTAWLAGIRANKIQDCLFTQFIQWDYRYYPQWVKFSAERNFLLQLRGSL
                     TKITKKPVEASPVSISTQSMSQIFTLILSSIRSSTKDADLAYRWCCEGTRILNALAGV
                     NNYADFLEELKHEICSVVSELRELAKVPSTSSLFEVTQVPMDGIYSEALFSNIGIQAL
                     SDRYKEQLLSLSTNSQKVHFDLFEGRKKVTNTAFSVGQKDESSFQYCFSSIGAVVYFL
                     LNNWRFTAGHEEAESLHKVAEFLDGLPERYMIDCLPTITYALQALDQKRSFLKPLEHI
                     TQKLGSNLLSARFNTSNLSVTYLSLYLNAVRWSWLAGGNSFQEADCKDIFEWIISKLS
                     ENSFGGLQALGCFAKLLLNILRHHDLSGGLIKGGKQRVFGTLVSCIQRLPPFAVISAL
                     EGFGKYMAKISGKNQSIVFSELSETFRDDLSVERQAFHFMILSRIGSSSRSQLIKCTL
                     QILNIGRISISATYVKSSLDALALSNKMKNTKELFHLLRFDIINYWYESSIRNQDSSF
                     DFWNVSLFGFATIPDFLNQYSKEVSGFHFSKKVALSFVPQGLIDATGKDEKILLEQCL
                     HLSIPLSYISSDQPELVLRTFKDTLGRRYNHLLKNLAREIFYWTLCFTKWDCLEELKG
                     TFNELYPGSKLSVALFSRSSSILKDYSELRIAPVISMSLLKACISTHHLDERELVLLL
                     ARLACELDECSPASFCLPILRKIKAILLLFEPFLSKCEYLPVLAQVLAGCLKSPELNN
                     EVCDIIRSIIAFGVGPEYCTTEMYSAVFASLLAEQPLLNLSSNEVIVDSLTSAAVSSG
                     TAYSDTWECCLKVLKGEKLEELVYLKDDLLRVDHATENRISLLSRLFDFHKEPAPFDP
                     EFDFSPVTVRNLMRVPELEAETSSNFNLWKGYYIGGYYMKHTHLPSLLMDNHAWKQPL
                     SSETSSLEWILNNLYEQLNVTTNPKSYLALVSVVGFLYERISHLGPFFSRADFAEKPL
                     CIPHTVRLSEREFQLLHSIELTFDDSHDLRLLNQQNVVSYKNWLSTLLQSLSKELGEI
                     SPDLLAFQVLDRDSPAFVESVSLGLFSLLDQANGKLGASIMLQFLRTYEFPPESYNKD
                     FRLKASFALRLFSVIRSKSREGNVRLSKVYEDLNLECFFHLASKIGKMKLAYMLFEEC
                     YPSLNLCDTQKLYPVFEGIKNEDLIRALPREASLDAAVLSVSKFQPRSLKSFMFNNCK
                     FDVDTIMHLDPDEEEVIQSSNSNGFNGLAEILGGINRARHPKKKEEAYQWSIKLGKWD
                     LAMPGDHSTSAEVLYSLLKDVHSKPSEGLAAPRKLLKTIAHQSRLFPEKDQWASSLCA
                     ILTAELISKHSGVLPECARTMAIIDAFDQKAVESSSFLAHHLVMRSRQMFLNCLSSPS
                     LTSQCNVDMRVCEIKELIKYTRMAREAQHRQESLTSAMLLDRKVNILSGLLKSDCWNQ
                     YAIVEGAQALWLQGESDIATSMLETLLHNRIHLESNDSVQVGTYPQIPNVQLKSTLVE
                     WTSSCRKENAHTIYREYIADSSSEMAAVSDFNDRAEIFFKFGEFCYQQVKRLSADKTI
                     DERRKRSSKGSAELSSLLEIIKDASVPDQDRLEAKKHYNKLKLQLAQDHDILANLSKE
                     FKLFTWKSLHFYLSTLVYSCQKDDVVLDKFCGLWFQYAEDGELNSKLYQEISSIPSFK
                     FLPWVNQMTSRLSIESSPFQRTLQLTLKRVMFKLPNETLYPLISLRLYKKLQSAGDPS
                     ISARVKAVEKLFAELEKYDNGKFLIDFLDPIQKFCEMCVELSCMKLSKSCRQINLENL
                     KSGNYWLQGISKKGVSLPVKPVRITSSADGRKPRPTITHMGPIVEVSASGLSLPKIAT
                     FYLSDGTSHKVLLKGSNDDLRQDAIMEQVFKQVNQILLRNSLTGKHELRIRTYEVVPL
                     GPQAGLIEFVSNSTSLHEILRGLHKDDDLPFDRARKMMKAAQSKSGDERVEVYLEITN
                     SVNPKLRQLFFNSFLDAQAWLDAKFTYTKGVVTTSIIGYVLGLGDRHLNNILLDTSTG
                     EPVHIDFGVAFDQGKLLPIPELVPFRLTRDMVDGFGVTGVEGVFRKNCERVFSVLRAD
                     RERVMNVLNVLKWDPLYSWVVSPLRKRKLQANMSDDSEDYQASVPVATMLEDNNESLR
                     ALKGVQSKLEGSGLSVEATVQELIQQATDLGNLATIYMGWSPFY"
     gene            complement(<530038..>530680)
                     /locus_tag="KLTH0C06072g"
                     /db_xref="GeneID:8291357"
     mRNA            complement(join(<530038..530409,530639..>530680))
                     /locus_tag="KLTH0C06072g"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_002552443.1"
                     /db_xref="GeneID:8291357"
     CDS             complement(join(530038..530409,530639..530680))
                     /locus_tag="KLTH0C06072g"
                     /note="highly similar to uniprot|P04451 Saccharomyces
                     cerevisiae YER117W RPL23B and highly similar to
                     uniprot|P04451 Saccharomyces cerevisiae YBL087C RPL23A
                     Proteins component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_002552489.1"
                     /db_xref="GeneID:8291357"
                     /db_xref="GOA:C5DE40"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:C5DE40"
                     /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNTGARNLYIMAVKGSGS
                     RLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKPWRRKDGVFLYFEDNAGVI
                     ANPKGEMKGSAITGPVGKECADLWPRIASNSGVVV"
     gene            <531296..>531883
                     /locus_tag="KLTH0C06094g"
                     /db_xref="GeneID:8291358"
     mRNA            <531296..>531883
                     /locus_tag="KLTH0C06094g"
                     /product="KLTH0C06094p"
                     /transcript_id="XM_002552444.1"
                     /db_xref="GeneID:8291358"
     CDS             531296..531883
                     /locus_tag="KLTH0C06094g"
                     /note="some similarities with uniprot|P40072 Saccharomyces
                     cerevisiae YER116C SLX8 Protein containing a RING finger
                     domain that forms a complex with Hex3p mutant phenotypes
                     and genetic interactions suggest a possible role in
                     resolving recombination intermediates during DNA
                     replication or repair"
                     /codon_start=1
                     /product="KLTH0C06094p"
                     /protein_id="XP_002552490.1"
                     /db_xref="GeneID:8291358"
                     /db_xref="GOA:C5DE41"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:C5DE41"
                     /translation="MSDRSDQEDSPRRVDGSPEGRAPKRRHISHSERTQGSSDLEDED
                     YRRLEDELRGELASDHVANDEDAVRSSTAGPADADTSLDVIEIGPASDADPDSDSDAR
                     LQQVVEISDDEAPRSPRPEHKRALDYRCPICFDPPEAALVTPCGHVFCTECLFQMVNS
                     SRGQRSAGHCALCRRDVRFKDVRLIIMRKKRIRKT"
     gene            <532040..>532357
                     /locus_tag="KLTH0C06116g"
                     /db_xref="GeneID:8291359"
     mRNA            <532040..>532357
                     /locus_tag="KLTH0C06116g"
                     /product="KLTH0C06116p"
                     /transcript_id="XM_002552445.1"
                     /db_xref="GeneID:8291359"
     CDS             532040..532357
                     /locus_tag="KLTH0C06116g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C06116p"
                     /protein_id="XP_002552491.1"
                     /db_xref="GeneID:8291359"
                     /db_xref="UniProtKB/TrEMBL:C5DE42"
                     /translation="MIRDPLSRKRTPRFFKKTPTIQFLKRVESRPHRLKRFVRVSVLG
                     PLVIRYGALHGTPDLRPIKCRYRGINHGDLVQPGTWCICRTLSLRPSPLHNDISKIME
                     KVP"
     gene            complement(<532436..>533704)
                     /locus_tag="KLTH0C06138g"
                     /db_xref="GeneID:8291360"
     mRNA            complement(<532436..>533704)
                     /locus_tag="KLTH0C06138g"
                     /product="KLTH0C06138p"
                     /transcript_id="XM_002552446.1"
                     /db_xref="GeneID:8291360"
     CDS             complement(532436..533704)
                     /locus_tag="KLTH0C06138g"
                     /note="similar to uniprot|P38177 Saccharomyces cerevisiae
                     YBL086C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery"
                     /codon_start=1
                     /product="KLTH0C06138p"
                     /protein_id="XP_002552492.1"
                     /db_xref="GeneID:8291360"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="UniProtKB/TrEMBL:C5DE43"
                     /translation="MKSFANKSKSRRPKFLFNLKINELTNIPQSSGYCFVKWHLKDGT
                     GTTSHTIIPEIGSPQSNVKSSSQSRGATPRVLVKSHRAHWNYSLQKPVQVKLVTDKNK
                     NLNSKEMVLEVYFEFLEPTNASHGKFQHSRQLSDASSTNSSASSSNSNVYTQKVSRKM
                     LLGVVEVNIAEYVNREQHMVTSRFLLQKSKVNSILSLGIQLELTRGSFDDFQLPSAVS
                     SGQLPNTFRNGITEVFDESSDISSPVSSTFLGNSGASGSNYNGSSSPAKKTADLSGSF
                     SIAISNPFVEKLYQKTFQVPWDPRPGEFTPKECVEDILDGGDGWAKNEKGINLIDIDA
                     LHLAELERDYDAQLKGVPMNMNYGEFDKRAFLERRVGYETHTSTQDRGIGGRKKLDKS
                     SDNLCEDNLDDYDTAKPNDFKSWTIGKVLP"
     gene            <533876..>534991
                     /locus_tag="KLTH0C06160g"
                     /db_xref="GeneID:8291361"
     mRNA            <533876..>534991
                     /locus_tag="KLTH0C06160g"
                     /product="KLTH0C06160p"
                     /transcript_id="XM_002552447.1"
                     /db_xref="GeneID:8291361"
     CDS             533876..534991
                     /locus_tag="KLTH0C06160g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C06160p"
                     /protein_id="XP_002552493.1"
                     /db_xref="GeneID:8291361"
                     /db_xref="UniProtKB/TrEMBL:C5DE44"
                     /translation="MANSLLSLYSDSWTLSERPGSNLIKFDAPASDSGSSVILDRSNA
                     VEGSIDSVSPQQLRRFTADVDIQRVGDLSVLSMAQRSLETLRRVEESMHTDNVFLTEV
                     MVMHRLAWDIDVYSQTKSEFPLENVPIKCNILKTLFELLRDYQESKPELPLENVAKVL
                     HYLNKLIQASQLEVPAPQSLAPQPLAKVSSATQPLRKTRTGVSSRSSHVGGHDSYSSN
                     IVRETPVYNSRVSMHSGSGKSRIFSKFFTPARSRESMHTRSTITVQPVNNMAATANTS
                     STATTNSGSLTSGGSDSEPLAPDPVLISHKLQDIESMKNYKESIVALAKTLRSLPQTD
                     QNTIIFHFVDKSIVPFILKDCKLLLMHYLHEEVILKL"
     gene            <535274..>538351
                     /locus_tag="KLTH0C06182g"
                     /db_xref="GeneID:8291362"
     mRNA            <535274..>538351
                     /locus_tag="KLTH0C06182g"
                     /product="KLTH0C06182p"
                     /transcript_id="XM_002552448.1"
                     /db_xref="GeneID:8291362"
     CDS             535274..538351
                     /locus_tag="KLTH0C06182g"
                     /note="similar to uniprot|P39969 Saccharomyces cerevisiae
                     YER114C BOI2 Protein implicated in polar growth
                     functionally redundant with Boi1p interacts with
                     bud-emergence protein Bem1p contains an SH3 (src homology
                     3) domain and a PH (pleckstrin homology) domain"
                     /codon_start=1
                     /product="KLTH0C06182p"
                     /protein_id="XP_002552494.1"
                     /db_xref="GeneID:8291362"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:C5DE45"
                     /translation="MNNGSTRNSKIPKLGLLETSFGSEESLGSISSGPLYITITEYSK
                     RMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQEISKPSLVRAK
                     SARRVASPLANGSTTNLSALSYDDSTSELPTPQPLETAAPVKLEGSSRHPVSLDRSMS
                     VKVTMSDIDKALEEFRGDSLANISHSATEDLSANTTVNTIATGPDMSRLKLHGSSSAH
                     SLTNDTSFGTTSINGIDANELKPANARNWSPEQVTAYFIGSGFDVESSTRFQQHKISG
                     LILLELELAHLKELEINSFGIRFEIFKEIEAIKDIINTQGPVKQPSQLMPAAAVNQRS
                     YMGHARKTSQSMEELPAKTTAVPSNPLPQKSSRARPYSLALPDNEASPAPLEAHNDRT
                     TSNGKSKNHQVDDKNFLSPRKAPKPPSYPSPVQPPRSPIVQNYTPSPSSGHFSQSYKN
                     APPTIYERAPHMETRPSNGSESNSTKFQFPKTTPPQLLSEAIELGSERRERKLSSAEN
                     DERMIFNTTNYAGNRSSIIYSGQQGHRKSKSGSSFVDLFNRISMMSPAPPKAPQNDID
                     GLSVLDSQQLRPSSSIYEHSRAASQHSRTASPSHIKHPSQTNAEVKKHRRNSSLLSFF
                     SNKGEENGRSSSPTKKSHSRKTSVSHSRKNSALGFSSSTPFSPDRGSKSPTKRHSVIV
                     SPIVAPVSPVEETAETEKRRSVSAKEPSSTLGGTDSDLFFDANDDTLEDRKNKRSVSE
                     AVKSKSTRSKSNKNVPRKMKTSAFMEGIRTVSVKSAMSEADCSGWMSKKGSGAMGVWK
                     NRFFTLHGTRLSYFASTTDTRERGLIDITAHRVVPAKDDDKLVALYAASTGKGRYCFK
                     LLPPQPGSKKGLTFTQPRVHYFAVETKEEMRAWMAALIKATIDIDTSVPIISSCATPT
                     VSLNKAQEMLTQAREETRAREEQRFLNEEDEDQLLWEQQQRAELSAQQNATGGSTPNS
                     LQINSSTGPGFHSPYLLASGVLSPGAPQSNSRLSDQQGSDYFLLGSKYGNSKI"
     gene            complement(<538533..>540416)
                     /locus_tag="KLTH0C06204g"
                     /db_xref="GeneID:8291363"
     mRNA            complement(<538533..>540416)
                     /locus_tag="KLTH0C06204g"
                     /product="KLTH0C06204p"
                     /transcript_id="XM_002552449.1"
                     /db_xref="GeneID:8291363"
     CDS             complement(538533..540416)
                     /locus_tag="KLTH0C06204g"
                     /note="some similarities with uniprot|P38042 Saccharomyces
                     cerevisiae YBL084C CDC27 Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="KLTH0C06204p"
                     /protein_id="XP_002552495.1"
                     /db_xref="GeneID:8291363"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DE46"
                     /translation="MFRVGSGGLIRASDENCERLKGLIERSVEQNNLETAEFLAELLC
                     SETGRLARGARERLEAAYQYGLVLYLRGDFKSAQDVVRPFKCESMLCAYVLARCALKL
                     DQSSWHEGARALEALAETYSIQNAEPQFGMPEEATVFSVLGQLYAKMGKIKESCAAHS
                     RALELDSYLWESFKALCDMRANVRVGKLYKTAAGSPKTQPAQQHRNRKGLVLKPHTPF
                     KVPAFDSKRRAYQAQPASAMRHRPPAPTSSLLKTTNGAGVTATPTSSFSKSKLLSTPP
                     SQFSISEKPVTPEDIENNLVSAQALGLDAIFYALAKSYKSACRYDCYKAVRILNELPQ
                     HILTAMPWVLSALGKLHFELVNYEMSKKYFAALRELQPFRIPDMEIFSTLLWHLNDTT
                     GLSHLCHELLEVNRLAPETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQG
                     HEYSSNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINP
                     VNVILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALE
                     NFEKLVTIAPDEATIHFLLGQLYQIVGRKQDAVKELTIAMNLDPKGSQLIKSALEKCH
                     QLD"
     gene            <541022..>543106
                     /locus_tag="KLTH0C06226g"
                     /db_xref="GeneID:8291364"
     mRNA            <541022..>543106
                     /locus_tag="KLTH0C06226g"
                     /product="KLTH0C06226p"
                     /transcript_id="XM_002552450.1"
                     /db_xref="GeneID:8291364"
     CDS             541022..543106
                     /locus_tag="KLTH0C06226g"
                     /note="similar to uniprot|P40071 Saccharomyces cerevisiae
                     YER113C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C06226p"
                     /protein_id="XP_002552496.1"
                     /db_xref="GeneID:8291364"
                     /db_xref="GOA:C5DE47"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:C5DE47"
                     /translation="MRLKAKSGLVLAIAVVLLWSVWQSQSLRARRPREYLPPRETGWI
                     KPNVYKRGDKVDLTVNKVESEITNLPYGYYDLRFVCPPSETKKPLHLSLDEVIRGDRK
                     WESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHWLIDGDLPAATTFAST
                     RSGKKFYTAGFPLGRVDHETDKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDY
                     QCPGASKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGN
                     VSFFYWISLANSAIVVALMTLFIALIFLKIRADDFVGTLAFEWASQPVYYLTQLNLAA
                     SMGIQFLFSIIGSSTISCSLCKVHNIRSWELSTAAICFVLGAYTSSLVGSLLAPGPKM
                     NLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFL
                     GGFSARKLRSAPANGLNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLLT
                     IVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVCYVL
                     MIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKAF
                     MAGASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLW
                     FLNFVSAPHKSH"
     gene            complement(<543231..>543758)
                     /locus_tag="KLTH0C06248g"
                     /db_xref="GeneID:8291365"
     mRNA            complement(<543231..>543758)
                     /locus_tag="KLTH0C06248g"
                     /product="KLTH0C06248p"
                     /transcript_id="XM_002552451.1"
                     /db_xref="GeneID:8291365"
     CDS             complement(543231..543758)
                     /locus_tag="KLTH0C06248g"
                     /note="weakly similar to uniprot|P40070 Saccharomyces
                     cerevisiae YER112W LSM4 component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing,
                     splicing, and decay"
                     /codon_start=1
                     /product="KLTH0C06248p"
                     /protein_id="XP_002552497.1"
                     /db_xref="GeneID:8291365"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:C5DE48"
                     /translation="MLPLYLLTNAKGQQLVIELKNGETIVGQLTNVDNWMNLTLTDVT
                     HTSASDTVKLSEIYVRGNFIKYIKLQDDVIEKVKQSNAQQQSQGHHQGRDFRRRQGGG
                     RRDGDKRFHSGNPRRGDGRDSYHNNGGNRRFNNNYNRAEGGNSGNNAMGGFVRHHQTS
                     AQPGTFLGGQGQQNA"
     gene            <544802..>547510
                     /locus_tag="KLTH0C06270g"
                     /db_xref="GeneID:8291366"
     mRNA            <544802..>547510
                     /locus_tag="KLTH0C06270g"
                     /product="KLTH0C06270p"
                     /transcript_id="XM_002552452.1"
                     /db_xref="GeneID:8291366"
     CDS             544802..547510
                     /locus_tag="KLTH0C06270g"
                     /note="some similarities with uniprot|P25302 Saccharomyces
                     cerevisiae YER111C SWI4 Involved in cell cycle dependent
                     gene expression transcription factor"
                     /codon_start=1
                     /product="KLTH0C06270p"
                     /protein_id="XP_002552498.1"
                     /db_xref="GeneID:8291366"
                     /db_xref="GOA:C5DE49"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DE49"
                     /translation="MDNGTIGAEDGHLMNIDDRLMRPSGEGEIRPVIEIATYAGVDVY
                     ECYCRGQESRIVMRRCMDNWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYG
                     RFQGTWIPLENAHYLVQKYSVSDLVVSTILHFQLDPRNPPMRRSKNSVIKRQSPGTKI
                     QSPSSYNKTPKKGGPGITKKQKKKLMNSFGSTIQTTAVKKAQPQPSPLQNLAFQTPQH
                     QQHHPLHNNSTVIAPDQQTPVQPPSYETTQKPLQFFPYPQQQPAFLTFDSNNPHQQHS
                     AKRSKKLHKNTSSQFQAQHSFRVIKQQFMGQNNNLQAPQTQTMVAVHPHSSHKASHSN
                     GSNGSNGSSIECFSARDDPSPISSRSISPKSRQRQQQVQRVENDQNETHITEDDYKEL
                     LLQVLSSDCSANGADSIVLPDELFHPPPELDINFTIDDQGHTTLHWAAAMANIPLLKV
                     ILTLPVNILLCNHRGFNTITKACFYNNCYKAGVFPKVLELLKPCIITPDMNGRLPLHY
                     LVELSVNKSKDPVVINYYLDSLLDALAQEDISLLRMCLNYQDNSGNTVLHLAALNLNL
                     ELCNKLCYLGSSMDILNLEHETATSILAKFNLVPPTSQQISGPTSDTPVDGVPQQPKQ
                     LKLSTPVMTRKKNGSFVQSDEHTIDLTQELSTISSDPTSFVNSSRIKSPKDVNPLPAA
                     DPLSVSSTVAKNSKTTPAVPIIKLDRARSSQLLTKQLSHLTTSLTSSVDEEISGLELE
                     KEKTQECIGSIDGSLKHNEVQMQELLQGLSSKEELQNNVSNLTKQVNAQMLRLASSIE
                     KSQALALATLVHEEEDAVTSSSDALQKDPMTSPVRVIGSDLLRLGLQLALLQFGRKCV
                     IEKLARSKSEINSTPKVKKYRKLIGLTIDEIDTKLDDIEKDLRASV"
     gene            <547894..>551229
                     /locus_tag="KLTH0C06292g"
                     /db_xref="GeneID:8291367"
     mRNA            <547894..>551229
                     /locus_tag="KLTH0C06292g"
                     /product="KLTH0C06292p"
                     /transcript_id="XM_002552453.1"
                     /db_xref="GeneID:8291367"
     CDS             547894..551229
                     /locus_tag="KLTH0C06292g"
                     /note="highly similar to uniprot|P40069 Saccharomyces
                     cerevisiae YER110C KAP123 Karyopherin beta mediates
                     nuclear import of ribosomal proteins prior to assembly
                     into ribosomes and import of histones H3 and H4 localizes
                     to the nuclear pore nucleus and cytoplasm exhibits genetic
                     interactions with RAI1"
                     /codon_start=1
                     /product="KLTH0C06292p"
                     /protein_id="XP_002552499.1"
                     /db_xref="GeneID:8291367"
                     /db_xref="GOA:C5DE50"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C5DE50"
                     /translation="MDQQFVSQLEQLLNAVLQPSNGSLKEATKTLQTQFYTQPAALPA
                     LLHILQSGSNDGLKQLAGVEARKLVPTQWTSIDAGVQAEIKTSLLSSAFSEPTEIVRH
                     ANARAIAAIGGEELDEKKWPELVPSLIQAASGNDSKITETAVFILLSLLDNMSPELNL
                     YISDFLNLFSVTMGEGASLESRSLSAQALNQVSNLIEEEGEINPEYAAKFAALIPAVV
                     NVLEAVIKADDTTNTKLIFNCLNDFLLLDSQLTGNSVVDLIKLSLQIAVNKEVDEEVR
                     VFAVQFATSALSFRKSKIIQAKMGLEITMAALSVASEEIDVEDELNNEDEAGENEENT
                     PSLTAIRLLAFASSELPPSQVAVPIVEHLPAMLQSSNPFERRAILLAISVAVSGSPDY
                     ILSQLDKIIPATIAGLKDNHPVVQLAALKCISQLTTDLQDEVAKFHEEYLPLIMGTID
                     SAKNVVIYKYSTIALDGLLEFTAYEAISKYLEPLMNKLFHMLDTNTSSKLRAAIVSAI
                     GSAAFAAGSAFLPYFKTSVQYLQQFIQNSGQIEGMSEDDLELRALTFENISTMGRAVR
                     SEAFHEFAEPLLNSSYEAIKTDSARLRESGYAFIANMAKVYGKDFAPFLATILPEIFK
                     TLEQKEYQFNIDEEADDLAELEADDLQQKFSVNTGISYEKEVAAAALSELAVATKESF
                     LEYVEQSLKVLNEQVEESYGLRETALHTIWNIAKAILLTASAKEEDFPVGVPAGSYVD
                     NNVLAVIQSIRSTSLDNLTEEFETSMVITILEDFAEMIRKFGPIVIIDNGDSSSLERL
                     CVEVMNLLKGSHACQTIDYEEDVPKDEDFDASETEAALLDCALEVLVSSSYALGGDFA
                     KVFENFKPVVLNLFQSKSKNKRSAAVGAVSEIAEGLKEHNPFVQELLEALIVRLTSDK
                     SLEVRGNAAYGVGLLCKYASFDVSAIYEPVLRAMYELLSTADQKALTAEDDEATREIV
                     DRAFANATGCVARMTLKNESLVPLEHTLPALLGHLPLNTGYEEYGPIFELIMKLYQSN
                     NNLIVNETPRVIDFFEAVFTKEAERVRLEQESTLGREENMDRMKQFQSPEVQTKVIDL
                     LKYLNTTFSGVVSQKPVLAQVIA"
     gene            <551494..>552852
                     /locus_tag="KLTH0C06314g"
                     /db_xref="GeneID:8291368"
     mRNA            <551494..>552852
                     /locus_tag="KLTH0C06314g"
                     /product="KLTH0C06314p"
                     /transcript_id="XM_002552454.1"
                     /db_xref="GeneID:8291368"
     CDS             551494..552852
                     /locus_tag="KLTH0C06314g"
                     /note="similar to uniprot|P38179 Saccharomyces cerevisiae
                     YBL082C RHK1 Dolichol-P-Man dependent alpha(1- 3)
                     mannosyltransferase involved in the synthesis of
                     dolichol-linked oligosaccharide donor for N-linked
                     glycosylation of proteins"
                     /codon_start=1
                     /product="KLTH0C06314p"
                     /protein_id="XP_002552500.1"
                     /db_xref="GeneID:8291368"
                     /db_xref="GOA:C5DE51"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="UniProtKB/TrEMBL:C5DE51"
                     /translation="MSSSKPAVSSDLSGISNTLDGSTQETGEPEINILKDLKDAINYL
                     IFNPEANHIIMPLVVVIEFLALEWIVAHVEYTEIDYKAYMEQIWAIQAGETDYSAIEG
                     STGPLVYPAGHVWIYEMLECATSGMDNLKAGQTIFQFLYVATLILQMICYVLVQLPPW
                     CVVLAALSKRLHSIYVLRLFNDCFATFFVVSTVLLLLLSARLQRRFLCLLASFTYAMA
                     VSVKMNALLYLPGVLLSIFQLTGGHLVQTVACLAVVFGWQIFVAMPFLQEYAVQYWAA
                     AFDFKRQFMYYWSVNWQFVDEDVFQDKWFHRTLLASHLIVLLLFAVTRFFQRPIDIQK
                     SLRALLHPFTSVLGQENCPSPSHIAYTLLMSNFVGVIFARSLHYQFLSWYHWTLPVII
                     HWSGLPMALAVPWYILHEYCWNSYPPNPTSSMLLFSLNTILLVLAFWAAQVRVPRSKK
                     DQ"
     gene            <553260..>556295
                     /locus_tag="KLTH0C06336g"
                     /db_xref="GeneID:8291369"
     mRNA            <553260..>556295
                     /locus_tag="KLTH0C06336g"
                     /product="KLTH0C06336p"
                     /transcript_id="XM_002552455.1"
                     /db_xref="GeneID:8291369"
     CDS             553260..556295
                     /locus_tag="KLTH0C06336g"
                     /note="weakly similar to uniprot|P40068 Saccharomyces
                     cerevisiae YER109C FLO8 Transcription"
                     /codon_start=1
                     /product="KLTH0C06336p"
                     /protein_id="XP_002552501.1"
                     /db_xref="GeneID:8291369"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:C5DE52"
                     /translation="MSLGPGGLHMNEDYAPQAQRPVQGVRAQNGRPTPRAPAGTQQGA
                     TPASARTGTPHPTASSREDPKRLLNAYIYDFLSKSSLNETAEAFSREAVIEENGQRPT
                     QDNRFKPQNDAPQGFLYEWWQIFWDVFNARTHRGGSEMAQQYFQLQFDSRRQEHTYRN
                     VAMHAARMQQQVEQRGDYQGEVFDPMMFAMMFSGNAYAAPMYDKSTDNGMRPTAFQRQ
                     VPSQQLQNSQLQARSARPPQRQQEPQSQVHAPGQTQAHAQAQAQAQAQAQAQAQAQAQ
                     VQAQAQAQAQAQAQAQAQAQAQAQARAQAQARAQAQAQAQAQAQAQAQAQAQAQAQAQ
                     AQAQAQAQAQAQAQAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAEAQAQAQAQAQAQ
                     AQAQAQVHAQQMRQRQAPMAASHVQQHAQPQHRQQQQTMYAQLMQQQQQRQHQQLQQQ
                     QQQPQSSQMYAQQMMMNGGNPNALALQGANAPVYMGPVRNVPMKPNFQASYMPQAVQP
                     QMQQKHQLSPAHQHQQQRSPQHQQQQQQQQQQQHQQHQQHQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQHQHQNQQQQHQQPHPQQYPQQHHQNQNQNQQHQQHQQQRHQ
                     QRQQHPQQYPQQQQQVASANPSGYANPSSAKKRLPQSDGSPDTDGVVKPDAHLSSTEG
                     LYNYQKQLLMLEKENEKVVTYRSTASTPGLGGPPQQSSGAPNKPSSVAGYAGVSPLPI
                     NSINSPASLGTAPKSKEAMRRKSISTQATGPAVNAGRKNQSEPVTPIGPMTPASGSLN
                     RLAPPSALSTVTETPLKASGEQADRMAGKTTSAKRVKRLKKMPSANNLGTGARPSSPS
                     LDNVLEAKNSKRISRAKPKKSSGVSGIKVSRIARSAGTTPLTTEDVLPGSTSSNDTGS
                     NVFPASVATDPTPQTDFDPLGQNDPTLGTTNYDFEDDDIFNIDSGLLDKSAPSKAQST
                     TQSAQRPQDDLPIDEPFNLDFLDPASTMNYNDLNQLNWQ"
     gene            <556638..>557741
                     /locus_tag="KLTH0C06358g"
                     /db_xref="GeneID:8291370"
     mRNA            <556638..>557741
                     /locus_tag="KLTH0C06358g"
                     /product="KLTH0C06358p"
                     /transcript_id="XM_002552456.1"
                     /db_xref="GeneID:8291370"
     CDS             556638..557741
                     /locus_tag="KLTH0C06358g"
                     /note="highly similar to uniprot|P40066 Saccharomyces
                     cerevisiae YER107C GLE2 Component of the nuclear pore
                     complex required for polyadenylated RNA export but not for
                     protein import homologous to S. pombe Rae1p"
                     /codon_start=1
                     /product="KLTH0C06358p"
                     /protein_id="XP_002552502.1"
                     /db_xref="GeneID:8291370"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DE53"
                     /translation="MSAFWRGNGSSGVGSSVMSAEKDLANDIVINNPAEDSISDIAFS
                     PQQDFLFSVSSWDKKVRVWDINGGTAQGRAEYQHQAPVLATRWSGDGTKIASGGCDNA
                     VMVFDVGSGQAQQVGAHDAAVKALRFVQCGPTNAECLVTGSWDKTVKYWDLRQPQPIS
                     TLMMPERVYCMDSKQKLLVVGTAERHIVVIDLNNPTSIFKTTTSPLKWQTRSVACYIE
                     GNGFAVGSIEGRCAIQYVDDQEQRKSGFSFKCHRVQQQSTGAAGGRSSTESQVYPVNS
                     IVFHPVYGTFATAGGDGSFHFWDKNLRHRLKGFPSLKASIPVCNFNRNGSIFAYALSY
                     DWSQGLMGNRPDYPNVVRLHAVTDEEVKEKKKR"
     gene            <558176..>559189
                     /locus_tag="KLTH0C06380g"
                     /db_xref="GeneID:8291371"
     mRNA            <558176..>559189
                     /locus_tag="KLTH0C06380g"
                     /product="KLTH0C06380p"
                     /transcript_id="XM_002552457.1"
                     /db_xref="GeneID:8291371"
     CDS             558176..559189
                     /locus_tag="KLTH0C06380g"
                     /note="some similarities with uniprot|P38180 Saccharomyces
                     cerevisiae YBL081W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C06380p"
                     /protein_id="XP_002552503.1"
                     /db_xref="GeneID:8291371"
                     /db_xref="UniProtKB/TrEMBL:C5DE54"
                     /translation="MPGQIVSIPFLSQVEDMDKYLLEYRSLKLMPQNAASFTQHQQQL
                     RYNNSNRGASNNNGNNSMGTNLQNGRKKIMGNINGIQGYRFNKNIPKFGQQPQQQQQQ
                     QSQQQQSQQQQGVSGVSTFKQAYPQVFYGSSNNSATSLAPQVASPTMYGSSAQPNQQF
                     MTASSSSSSTPPPRLHVSVSGASSISSLGGEFDYLLPNDLNGQLMPSATAQVPQPPAL
                     NCVSSSASMSGTYLDPVPAAPSAGFKMNGGISSSNDFINGLPSSLLSEGAAASEFIGM
                     NGSNSLFNANSINSSVGAAAGLAPSNNFMMHNSKNWGTNNPSSSSTSGSFGIWNNDMS
                     VWS"
     gene            complement(<559759..>561402)
                     /locus_tag="KLTH0C06402g"
                     /db_xref="GeneID:8291372"
     mRNA            complement(<559759..>561402)
                     /locus_tag="KLTH0C06402g"
                     /product="KLTH0C06402p"
                     /transcript_id="XM_002552458.1"
                     /db_xref="GeneID:8291372"
     CDS             complement(559759..561402)
                     /locus_tag="KLTH0C06402g"
                     /note="similar to uniprot|P33893 Saccharomyces cerevisiae
                     YBL080C PET112 Protein required for mitochondrial
                     translation"
                     /codon_start=1
                     /product="KLTH0C06402p"
                     /protein_id="XP_002552504.1"
                     /db_xref="GeneID:8291372"
                     /db_xref="GOA:C5DE55"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR004413"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR017958"
                     /db_xref="InterPro:IPR017959"
                     /db_xref="InterPro:IPR018027"
                     /translation="MGCTFLPLESAFMLQFTRCFGSRTANKGFQLLPDFKLKCGLEIH
                     TQLSTQNKLFSLSTNDPFASANLPNHHTSFFDVSLPGSQPKLNPEVVLFATKLAVALN
                     SKVNLNSHFDRKHYFYADQPMGYQITQHYSPFAKGGFLELLGSLDSIDENSKRIQLVQ
                     LQIEQDTGKSVYRGSEGRSLIDLNRSNVPLIELVTQPNFTDLKQIRAFIKKFQNLVRH
                     LGISTGDLETGAMRVDVNLSVNGYSRVELKNLPNTSSILSAIKYEYQRQVGLIQSGEA
                     DKYLSSSETRGWTGSSTVKLRSKETTIDYRYMPDPELPSIKISPGTVQSVSQSMPKLP
                     DAVLHDLMSEPYGLALKDAKILAIKGNGHDQLYTQTSLLKYYLDTFSCYSTLAGQQLN
                     PRLPTNWIIHELLGNLNRLQLPLEKAAEAFPPKKFAELLMLIQDDKISKASGKLLLFH
                     ILNEINKLSLAQPVDLSALIEGFDLNVIKKIDANELREICTEIVGGISDPKLIEGIVS
                     GKKKNSLKFLIGQGMRVSQGRIKPHLFEQAFKELLKVKW"
     gene            complement(<561526..>561816)
                     /locus_tag="KLTH0C06424g"
                     /db_xref="GeneID:8291373"
     mRNA            complement(<561526..>561816)
                     /locus_tag="KLTH0C06424g"
                     /product="KLTH0C06424p"
                     /transcript_id="XM_002552459.1"
                     /db_xref="GeneID:8291373"
     CDS             complement(561526..561816)
                     /locus_tag="KLTH0C06424g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C06424p"
                     /protein_id="XP_002552505.1"
                     /db_xref="GeneID:8291373"
                     /db_xref="UniProtKB/TrEMBL:C5DE56"
                     /translation="MIKFYYVTFSFTTQTNNTNTLNELVETQMWKQAIPSQTATIGSN
                     SFEENHVSMLSSSQASQLITMPASTMSPNLCNTGESLIKLESLLPYKQAVHT"
     gene            complement(<561870..>562811)
                     /locus_tag="KLTH0C06446g"
                     /db_xref="GeneID:8291374"
     mRNA            complement(<561870..>562811)
                     /locus_tag="KLTH0C06446g"
                     /product="KLTH0C06446p"
                     /transcript_id="XM_002552460.1"
                     /db_xref="GeneID:8291374"
     CDS             complement(561870..562811)
                     /locus_tag="KLTH0C06446g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C06446p"
                     /protein_id="XP_002552506.1"
                     /db_xref="GeneID:8291374"
                     /db_xref="InterPro:IPR018847"
                     /db_xref="UniProtKB/TrEMBL:C5DE57"
                     /translation="MRVLQNKDVNVIRPSYRGKSKSKAEPSKVKKNRPPKTQNLEECF
                     EASQNQELTQSFCTPRDLIEKLDSEKLQQSPRKPNPAVAPSTAPAEVTPSRSSHNLTQ
                     YAIDQLQYRICEKEMEVGVCGHPFCHALRAVKLPLNEFRNLLLFEFEMIPPQSELELR
                     NLRDTCYAAKVYGSLLPDWRLKSGIDPEDNSQDFMLSQLFIGMPSEKAINSETNHAWF
                     GNSDRVSSRRSLMPNSSLALRNRQEVFKESVNPAELLKDSSPSDSFNGDDQLLSPFPS
                     HHHGKLNCILKRDQREMNPQESRQSCALRSLQHHNSE"
     gene            <563097..>567413
                     /locus_tag="KLTH0C06468g"
                     /db_xref="GeneID:8291375"
     mRNA            <563097..>567413
                     /locus_tag="KLTH0C06468g"
                     /product="KLTH0C06468p"
                     /transcript_id="XM_002552461.1"
                     /db_xref="GeneID:8291375"
     CDS             563097..567413
                     /locus_tag="KLTH0C06468g"
                     /note="similar to uniprot|P38181 Saccharomyces cerevisiae
                     YBL079W NUP170 Abundant subunit of the nuclear pore
                     complex (NPC), required for proper localization of
                     specific nucleoporins within the NPC, involved in nuclear
                     envelope permeability and in chromosome segregation"
                     /codon_start=1
                     /product="KLTH0C06468p"
                     /protein_id="XP_002552507.1"
                     /db_xref="GeneID:8291375"
                     /db_xref="GOA:C5DE58"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:C5DE58"
                     /translation="MSIYSTPLKSGIDYTRNVVIPSNGELAAPNNTKRVEVNNEVVAM
                     PGYNVLAPNASLGLASGEEHLRITGFASKPSLELASQYIDHLQNRDASTPVLDERSYY
                     NNGVNYNFSKEVGGLGAFTPFERTQVMNVPDGILREASRTEMKSDMGLFPELNRCWIT
                     IDNKLILWNFNNPSDFQSIDDIKHTILAVALAKPKPNTFVESVNHLLLIATPFDVYVL
                     AIQYDRSNEELSVFNTGMCVSVHGLDVSSFISCEQTGRIFFTGKSSGINIWELQYSST
                     EDWFNSRCNKVCLTQSVLSSLLPTNLISKIPGSNLVQSLFEESSKYSAEHLTQMCVDN
                     SRGILYSLSNKSVIRAYKINGKSLGSPLTIETSYIKRIMGTTSARGAAILGNKYLKIS
                     KVVAVSGRENGNLFLVAITIGGVRLYFNGSLGRTHLEALRLESIKFPPSSVTPEAIEQ
                     ELQQQQQKKSLPFYSSLTSSESVMLRFQKKSSVLLETSGASAIISPGIFLAAVTKAPN
                     QETAKNAQDQVPTQQQPQQQRQSTYGIQQKLFVSVPDYGILKKHGKYVENTTLLDTTG
                     VIKHIVPITPLFNATNKPEGYANEFATQYVSSEFKIAVLTNTSVEIYRYRTPDAVFEA
                     LAENPLPFLLNYGLTEACSTALFVTCKFNKSEALRSSALTFYAVGIPGVADIKPRYSR
                     YTASAMSSLLSRPTIASTPQRSTLDTDKTGFATSREDENCSLDDVILSPRFYGTALFI
                     ARLFREIWEKPVFGTVPDAKFDNQSHFVKSSVGDKNLINSVSVSKGDLEYYLSSVMIL
                     NDFFDTYGNSISSISIPSFQTGKNIDRTEEVANQAENIAINSLIRLVQFMKEAFSFLN
                     VLYEESDVEGYEGQFLAFKDIMKLLNLDVQSELSKLTFKDIFAPTDNTKNLLREILSS
                     IINRSISRGGSIEHIATALQERCGSFCSSSDILGFRAMEHLRKAKEVGLRDYETSTYH
                     LTCANKLFEKIVDTISIERLKDAVSTMLDLNYYPGTIEFLLNIANSMDKGKLAYQYVA
                     DGYLEQDPRKVYYEKRVLAYELVFETLVRVDELVSAAVSAGIGGMNNVEELSKLKEET
                     YSTALRYNDKLFHYQLYDWLVSQNCQDKLLQLDTDFILAYLQEKSKGSLDISNLLWVY
                     QSKRSNFYAAAQILYSLAVSDFEVPLGQRIEYLSRANGFCNGLCAPSQRQQMIHLSGM
                     IQEIFDVASIQDDILTLVRNDIRVAADTKEELIKQLDGKILPVSDLFNDYADPLDYYE
                     ACLAIFKISDFRNNEEIISKWTELFDSLRTEINANGNVEESANFINLLTSVVVRVGRN
                     VRTSEFVFPITELFPIICDLFYENLPNEHIKEGAIASIFISAGVSFDKFYYLLKNLIE
                     TADSVNNIYKKEMTWLIKEWYESDVKLRDLVSYDEIRNLKNYSIETDPIENKVKETGT
                     SI"
     gene            complement(<568138..>568494)
                     /locus_tag="KLTH0C06490g"
                     /db_xref="GeneID:8291376"
     mRNA            complement(<568138..>568494)
                     /locus_tag="KLTH0C06490g"
                     /product="KLTH0C06490p"
                     /transcript_id="XM_002552462.1"
                     /db_xref="GeneID:8291376"
     CDS             complement(568138..568494)
                     /locus_tag="KLTH0C06490g"
                     /note="highly similar to uniprot|P38182 Saccharomyces
                     cerevisiae YBL078C ATG8 Protein required for autophagy"
                     /codon_start=1
                     /product="KLTH0C06490p"
                     /protein_id="XP_002552508.1"
                     /db_xref="GeneID:8291376"
                     /db_xref="GOA:C5DE59"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DE59"
                     /translation="MKSAFKSEYPFEKRKAESERISQKFENRIPVICEKAEKSDIPEI
                     DKRKYLVPADLTVGQFVYVIRKRIKLPAEKAIFIFVNDTLPPTAALMSAIYQEHKDKD
                     GFLYVTYSGENTFGNE"
     gene            complement(<568842..>569399)
                     /locus_tag="KLTH0C06512g"
                     /db_xref="GeneID:8291377"
     mRNA            complement(<568842..>569399)
                     /locus_tag="KLTH0C06512g"
                     /product="KLTH0C06512p"
                     /transcript_id="XM_002552463.1"
                     /db_xref="GeneID:8291377"
     CDS             complement(568842..569399)
                     /locus_tag="KLTH0C06512g"
                     /note="weakly similar to uniprot|P40063 Saccharomyces
                     cerevisiae YER104W RTT105 Protein with a role in
                     regulation of Ty1 transposition"
                     /codon_start=1
                     /product="KLTH0C06512p"
                     /protein_id="XP_002552509.1"
                     /db_xref="GeneID:8291377"
                     /db_xref="UniProtKB/TrEMBL:C5DE60"
                     /translation="MQPFSSPPRVEHRSYYDQSPDSPPSYDTKLSTPTSGLDASVVDK
                     LTSERRRNYQRVKQPFSSPLKAEKHSGSRPSPQRRQQNEQRHRERESRAMKARGGAFK
                     MEKDVMDLEKKCELRLLEREAEFYQLDPDNVAALESEQEALEDEELVALLQEREEYEK
                     LLELEQQQIEEALACFTLSNSEEHV"
     gene            complement(<569680..>572898)
                     /locus_tag="KLTH0C06534g"
                     /db_xref="GeneID:8291378"
     mRNA            complement(<569680..>572898)
                     /locus_tag="KLTH0C06534g"
                     /product="KLTH0C06534p"
                     /transcript_id="XM_002552464.1"
                     /db_xref="GeneID:8291378"
     CDS             complement(569680..572898)
                     /locus_tag="KLTH0C06534g"
                     /note="highly similar to uniprot|P09436 Saccharomyces
                     cerevisiae YBL076C ILS1 Cytoplasmic isoleucine-tRNA
                     synthetase target of the G1-specific inhibitor reveromycin
                     A"
                     /codon_start=1
                     /product="KLTH0C06534p"
                     /protein_id="XP_002552510.1"
                     /db_xref="GeneID:8291378"
                     /db_xref="GOA:C5DE61"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:C5DE61"
                     /translation="MAEHTGQFSFPKEEEKILELWNEIDAFQTSLKLTEGLPEFSFFD
                     GPPFATGTPHYGHILTSTVKDVVPRYATMNGYHVERRFGWDTHGLPIEHIIDKKLGIT
                     CKEDVYKMGIDKYNDECRAIVMMYANEWRKTIGRVGRWIDFDNDYKTMYPSFMESTWW
                     AFKQLFDRDQVYRGYRVMPYSTGCTTPLSNFEAQQNYKEVNDPAVTFAVPIIGMEKTY
                     IVTWTTTPWTIPSNLAMCVNEEFEYAKIYDEKRDKYLIMLESLLKTVYKKPEKESLKV
                     VGKIMGKDLVGLKYEPPYPYFKEAFQDKAFRVISDSYVTNDSGTGIVSNAPAFGEEDY
                     RACLENGIISEDDELPNPVDDAGKFIMPVSDYVGMYVKDADKQIIKDLTASGVMLANT
                     QFRHSYPFCWRSDTPLLYRSVPAWFVRVKPIVPQFLDSVQKSHWVPSAIKEKRFSNWI
                     ANARDWNVSRNRYWGTPIPIWVSDDYEEVVCVGSVQELKTLSGVQDIKDLHRDAIDGI
                     TIPSKKGKGVLKRIEEVFDCWFESGSMPYSSQHYPFENKDKFKQRVPANFISEGLDQT
                     RGWFYTLGVLGTQLFGEVPYQNVIVCGIVLAADGKKMSKSLKNYPDPNLVLNKYGADA
                     LRLYLINSPVLKAESLKFKEEGVKEVISKVLLPWWNSFKFLEGQIALLKKTSNVDFKY
                     DPNLKSDNVMDRWILASLQTLVKNIHSEMESYKLYAVVPRLLDFIDQLTNWYIRLNRR
                     RLKGENGEQDCLKALNSLFDALFAFVRAMAPFTPFLSDNIYQRMKSFIPEEVLSGFGK
                     DSRCVHFLSYPVVDESRFDENIERSMSRMQAVIDLGRNIREKKMISLKTPLKSLVVFH
                     SDPEYLEDVKALQGYVTEELNVRDLIITSDEAKYGIEYKAAADWPVLGKKLKKDAKKV
                     KSALPTLSSADVQEYMETGSIVLDGIELVKGDLTVIRTLPENLVDEGLETRTDQNVLI
                     ILDTRIYPELKTEGLARELINRIQKLRKKCGLEATDDVLVQYELVKDTIDLEDVIKAH
                     YDMLTKTCRSQITRFEGSNDAHIADEEQSINDTIFKLKFFKI"
     gene            complement(<573847..>575820)
                     /locus_tag="KLTH0C06556g"
                     /db_xref="GeneID:8291379"
     mRNA            complement(<573847..>575820)
                     /locus_tag="KLTH0C06556g"
                     /product="KLTH0C06556p"
                     /transcript_id="XM_002552465.1"
                     /db_xref="GeneID:8291379"
     CDS             complement(573847..575820)
                     /locus_tag="KLTH0C06556g"
                     /note="highly similar to uniprot|P09435 Saccharomyces
                     cerevisiae YBL075C SSA3 heat-inducible cytosolic member of
                     the 70 kDa heat shock protein family"
                     /codon_start=1
                     /product="KLTH0C06556p"
                     /protein_id="XP_002552511.1"
                     /db_xref="GeneID:8291379"
                     /db_xref="GOA:C5DE62"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DE62"
                     /translation="MSRAVGIDLGTTYSCVAHFTNDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPANTVFDAKRLIGRKFDDPEVVNDAKHFPFKVVAAEGNKTEI
                     QVEYKGETKRFTPEEISSMVLGKMKETAEGYLGQTVTDAVVTVPAYFNDSQRQATKDA
                     GTIAGLNVLRIINEPTAAAIAYGLDKKGRSEHNVLIFDLGGGTFDVSLLSIDEGIFEV
                     KATAGNTHLGGEDFDNRLVNHLANEFKRKTKKDLTGNQRSLRRLRTAAERAKRAISSS
                     AQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLEPVEKVLRDAKIDKSNVDEIV
                     LVGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDSSSKTQDLLL
                     LDVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVFEGERTRTK
                     DNNLLGKFELSGIPPAPRGVPQIEVTFDLDANGILNVSAVEKGTGKSSKITITNDKGR
                     LSKEDIERMVSDAEKFKAEDEKEAERVQTKNSLEAYAFSLKNTAGESAFKEKVGEEDA
                     RKLTTLVEETISWLDSSQAASTEEYKDKQQELEGVANPIMTKFYQAGGAPGGVPGGAP
                     GGAPGAGFGGAGAPGAGSGSAGGDSGPTVEEVD"
     gene            complement(<576374..>577453)
                     /locus_tag="KLTH0C06578g"
                     /db_xref="GeneID:8291380"
     mRNA            complement(<576374..>577453)
                     /locus_tag="KLTH0C06578g"
                     /product="KLTH0C06578p"
                     /transcript_id="XM_002552466.1"
                     /db_xref="GeneID:8291380"
     CDS             complement(576374..577453)
                     /locus_tag="KLTH0C06578g"
                     /note="similar to uniprot|P32357 Saccharomyces cerevisiae
                     YBL074C AAR2 Component of the U5 snRNP required for
                     splicing of U3 precursors originally described as a
                     splicing factor specifically required for splicing
                     pre-mRNA of the MATa1 cistron"
                     /codon_start=1
                     /product="KLTH0C06578p"
                     /protein_id="XP_002552512.1"
                     /db_xref="GeneID:8291380"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="UniProtKB/TrEMBL:C5DE63"
                     /translation="MEVFIDQVPHAVTIGVDTYSFEVKQGQPFHGIKNIPREPALHVM
                     HFQHSENGTRYGYWLESDAQDYVEFRYDGEKEIFTPRIFASDGDRSEGHRRFEQVNAL
                     MVPYPAVDEEDSWNELTKHVRWPDVKCIAGCSDGLVYVDSAMTTSEENKNLLNALSKG
                     GRPQLNASAPTVEPTLNYTPIVFKSREAIRDDHKMEDFLDKSYYLHNVVLPRHHRNSM
                     RSLLGELQWAFLNAMLFGSYGSSLQWHNLLELVCCSSTVSEAHMSELDNALSRELRVM
                     PELYADTLLNEEVWAKCLDESFQGQRLHKTAVAARELLPALDNASDDGADYGAYEEAL
                     SHDQGLSDDDPDGPVVAERVLYRRR"
     gene            577766..577874
                     /gene="SNR56"
                     /locus_tag="KLTH0C06600r"
                     /db_xref="GeneID:8291381"
     ncRNA           577766..577874
                     /ncRNA_class="snoRNA"
                     /gene="SNR56"
                     /locus_tag="KLTH0C06600r"
                     /product="snR56"
                     /note="C/D snoRNA monocistronic SNR56"
                     /transcript_id="XR_002432181.1"
                     /db_xref="GeneID:8291381"
     gene            complement(<578157..>578762)
                     /locus_tag="KLTH0C06622g"
                     /db_xref="GeneID:8291626"
     mRNA            complement(<578157..>578762)
                     /locus_tag="KLTH0C06622g"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_002552467.1"
                     /db_xref="GeneID:8291626"
     CDS             complement(578157..578762)
                     /locus_tag="KLTH0C06622g"
                     /note="similar to uniprot|P05754 Saccharomyces cerevisiae
                     YER102W RPS8B protein component of the small (40S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_002552513.1"
                     /db_xref="GeneID:8291626"
                     /db_xref="GOA:C5DE64"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:C5DE64"
                     /translation="MGISRDSRHKRAATGAKRAQFRKKRKFELGRQPANTKIGNKRIH
                     TVRTRGGNKKFRALRIETGNFAWASEGVTRKTRIAGVVYHPSNNELVRTNTLTKSAIV
                     QIDATPFRQWYESHYGQTLGKKKSGKVEEEIVSQSKNAEKKWASRAADAKVEQAVDAQ
                     FGSGRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            <579529..>579882
                     /locus_tag="KLTH0C06644g"
                     /db_xref="GeneID:8291382"
     mRNA            <579529..>579882
                     /locus_tag="KLTH0C06644g"
                     /product="KLTH0C06644p"
                     /transcript_id="XM_002552468.1"
                     /db_xref="GeneID:8291382"
     CDS             579529..579882
                     /locus_tag="KLTH0C06644g"
                     /note="highly similar to uniprot|Q3E840 Saccharomyces
                     cerevisiae YBL071W-A KTI11 Protein required along with
                     Dph1p Dph2p Jjj3p and Dph5p for synthesis of diphthamide
                     which is a modified histidine residue of translation
                     elongation factor 2 (Eft1p or Eft2p) may act in a complex
                     with Dph1p and Dph2p"
                     /codon_start=1
                     /product="KLTH0C06644p"
                     /protein_id="XP_002552514.1"
                     /db_xref="GeneID:8291382"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:C5DE65"
                     /translation="MNKKAHRDEYDKTRIPAPAIIRAPRPLPALLQEDDMSTYDQVEI
                     EDMTFDPDTQTFTYPCPCGDKFQIYIDDMYDGEEIAVCPSCSLMIQVIFEREDLEEYY
                     QEAGTAPPEPVSVAA"
     gene            <580203..>581489
                     /locus_tag="KLTH0C06666g"
                     /db_xref="GeneID:8291383"
     mRNA            <580203..>581489
                     /locus_tag="KLTH0C06666g"
                     /product="KLTH0C06666p"
                     /transcript_id="XM_002552469.1"
                     /db_xref="GeneID:8291383"
     CDS             580203..581489
                     /locus_tag="KLTH0C06666g"
                     /note="weakly similar to uniprot|P35183 Saccharomyces
                     cerevisiae YBL069W AST1 peripheral membrane protein"
                     /codon_start=1
                     /product="KLTH0C06666p"
                     /protein_id="XP_002552515.1"
                     /db_xref="GeneID:8291383"
                     /db_xref="GOA:C5DE66"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DE66"
                     /translation="MAERILSNPDNNNLKAQTLDHDIPAPREIPQEEVVLKRVARPLR
                     HVKYIPVKSLAFFSKNNPPRFSYETRIKTPVPKDKLVVQVRNAALNPVDLKIMNSYTH
                     NMNREVGLGREYSGVITEVGGDLHSEWKEGDEVYGVFFHPNLGYGTVQSSILVSPAQD
                     VILRKPSNISFQAASGTLFCLGTAFNILDSLESKGQLNESTNVLINGGTTSVAMFAIQ
                     LLKYHYRIPKKLVVLCSEYGATLLKSHFPDLCDELIFVNYVMNARRIYKPLEDMINNR
                     ETISYEAESGQPISSPYDQGKFNLILDFVGGYQLVSHSSSLLKKNGAYVTTVGDYRAN
                     YAKDVFNSWDNPSANVRKVFGRILWTFDYTHFYFDPNAKYAKNDWPAKCAELVESEVV
                     KCVVDKVYDWKDFTQALDYLKQGHCHGKVILDIEKF"
     gene            complement(<581697..>582437)
                     /locus_tag="KLTH0C06688g"
                     /db_xref="GeneID:8291384"
     mRNA            complement(<581697..>582437)
                     /locus_tag="KLTH0C06688g"
                     /product="KLTH0C06688p"
                     /transcript_id="XM_002552470.1"
                     /db_xref="GeneID:8291384"
     CDS             complement(581697..582437)
                     /locus_tag="KLTH0C06688g"
                     /note="similar to uniprot|P33296 Saccharomyces cerevisiae
                     YER100W UBC6 Ubiquitin-conjugating enzyme involved in
                     ER-associated protein degradation located at the cytosolic
                     side of the ER membrane tail region contains a
                     transmembrane segment at the C-terminus substrate of the
                     ubiquitin-proteasome pathway"
                     /codon_start=1
                     /product="KLTH0C06688p"
                     /protein_id="XP_002552516.1"
                     /db_xref="GeneID:8291384"
                     /db_xref="GOA:C5DE67"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C5DE67"
                     /translation="MATRQAQKRLTKEYKSMVENPPPFIIAQPNEDNILEWHYVITGP
                     PDTPYEGGQYHGTLVFPSDYPFKPPAIRMVTPSGRFKEDTRLCLSMSDYHPDTWNPSW
                     SVSTILTGLLSFMTSDESTTGAITTTSDHKKKMARVSKEYNAFRNARFKAVFPELVKE
                     NIAYLNELKRSGETKEEDVDKDVLEEAAKEEAVNISDITDPEDRIRAQKELEKLKERQ
                     SGAVKPNNGRPWLYVFFAATLFMFWALS"
     gene            <582940..>583953
                     /locus_tag="KLTH0C06710g"
                     /db_xref="GeneID:8291385"
     mRNA            <582940..>583953
                     /locus_tag="KLTH0C06710g"
                     /product="KLTH0C06710p"
                     /transcript_id="XM_002552471.1"
                     /db_xref="GeneID:8291385"
     CDS             582940..583953
                     /locus_tag="KLTH0C06710g"
                     /note="highly similar to uniprot|P38620 Saccharomyces
                     cerevisiae YER099C PRS2
                     5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase
                     involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="KLTH0C06710p"
                     /protein_id="XP_002552517.1"
                     /db_xref="GeneID:8291385"
                     /db_xref="GOA:C5DE68"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C5DE68"
                     /translation="MSSGGDKNLLDIDAPKPFWMSSNSIKLLSGNSHPELAEKIARVL
                     GLSLSKIGVYQYSNKETSVTIGESIRDEDVYIIQTGSGQQEINDFLMELLIMIHACKT
                     ASARRITAVIPNFPYARQDKKDKSRAPITAKLVANLLETAGCDHVITMDLHASQIQGF
                     FHIPVDNLYAEPSALNYIKTTTDIENAILVSPDAGGAKRVASIADKLDLNFALIHKER
                     QKANEISRMVLVGDVRGKSCILIDDMADTCGTLVKASDMLFDNGAKEVVALVTHGIFS
                     GSAREKLKNSKLSRIVCTNTMPVDLQLDIFDQIDISPTLAEAIRRLHNGESVSYLFTH
                     APA"
     gene            complement(<584097..>586241)
                     /locus_tag="KLTH0C06732g"
                     /db_xref="GeneID:8291386"
     mRNA            complement(<584097..>586241)
                     /locus_tag="KLTH0C06732g"
                     /product="KLTH0C06732p"
                     /transcript_id="XM_002552472.1"
                     /db_xref="GeneID:8291386"
     CDS             complement(584097..586241)
                     /locus_tag="KLTH0C06732g"
                     /note="some similarities with uniprot|P39967 Saccharomyces
                     cerevisiae YER098W UBP9 Ubiquitin-specific protease that
                     cleaves ubiquitin-protein fusions"
                     /codon_start=1
                     /product="KLTH0C06732p"
                     /protein_id="XP_002552518.1"
                     /db_xref="GeneID:8291386"
                     /db_xref="GOA:C5DE69"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DE69"
                     /translation="MSLRKWLTRSDKPSRHKPATQGLHGEIDSAAKDTQAGGAKGDGA
                     ELSLGGKILSMITPSDGNSSSSSGPDGVTENGYPSGNRETGSHIHGSQDASDPVSEKA
                     YHSSSAISDFEDLESEYDYFPLIKPSVTPLLPYGDGSNKVFGYENFGNTCYCNSVLQV
                     IYNLPELRVNLLEFPERPSSLPRRRKSEMPGIKPRIFDDTSFTHSNNGSENAKKNSSS
                     SGSAGSLGKEPSRKTSASSLKPGMSARAQRLHNASVVHGTVMASDAITEKLHEGFTRI
                     VVGRVNGKSQKRSVQRTPPSNSASSSSSSVMESSPPNISLASSTRPEETSSEERKSSA
                     LIRGPVLNVDHSLIDYLPQGEKPSLYTALKDLYESITENKFLTGVVSPIQFVETLKRE
                     NILFSSTMHQDAHEFLNFLLNDISDYINAHSKNNIQAHETTNPMDDNHLNFVDRLFKG
                     TLTNRTKCLTCDNMTYRNEPFLDFAIEVQDDGETDIQTTLADYHQKELLNGANKFYCD
                     ECCGLQEAERVVGLKQLPFYLALHMKRFKYSEEQNCNVKLFNRIRYPLDLKVCSTFDA
                     SVCKQYELVGLVVHMGGGPHHGHYVSLCKNERFGWLLFDDETVETVNESTVLKFVGNS
                     DDLTTAYLLFYREKTAGATSGNDKSQEYAECVDELIKLDEKIRVGSESGKNDQNTTLE
                     EVPEERRGERKLSSKGLKRRSRIFSFKRSPKD"
     gene            complement(586748..586819)
                     /locus_tag="KLTH0C06754r"
                     /db_xref="GeneID:8291387"
     tRNA            complement(586748..586819)
                     /locus_tag="KLTH0C06754r"
                     /product="tRNA-His"
                     /note="tRNA-His (GTG) cove score=64.62"
                     /db_xref="GeneID:8291387"
     gene            complement(<586976..>590140)
                     /locus_tag="KLTH0C06776g"
                     /db_xref="GeneID:8291388"
     mRNA            complement(<586976..>590140)
                     /locus_tag="KLTH0C06776g"
                     /product="KLTH0C06776p"
                     /transcript_id="XM_002552473.1"
                     /db_xref="GeneID:8291388"
     CDS             complement(586976..590140)
                     /locus_tag="KLTH0C06776g"
                     /note="similar to uniprot|P34228 Saccharomyces cerevisiae
                     YBL066C SEF1 Suppressor of Essential Function putative
                     transcription factor"
                     /codon_start=1
                     /product="KLTH0C06776p"
                     /protein_id="XP_002552519.1"
                     /db_xref="GeneID:8291388"
                     /db_xref="GOA:C5DE70"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DE70"
                     /translation="MSGLPQTSRRSSEASGLKRRSSAEERDGGSARETKRKNVKSEEL
                     RLPNLTATGAGPQAGDSGSKSGGGNGGGSGGSEDKGCSSDSKAAAGSTGHRPVTSCTH
                     CRQHKIKCNASDNFPAPCSRCERMGLRCEIDPRFRPKKGSQLQSLRNDVDELKLKIEY
                     LTHNESLIAQALQRTALSGAGQHTHAGGENGAVSGAAAEKTAEKAAETSQSPHSKVSV
                     QTYLASEPRLLSNSVHASGDSPSPPALRIKDFPSARVSLATKTIQLTGAMPTSAANGD
                     ALPPVLQIALKRHSASYASPPNAPSSQGSPCLTPDNTGSKENSSSKTPIVATTNTIAP
                     LPSPQANIDEFVLGEVTISIAKANELHAVFVDKFLPYFPIMYTNSATELYSQSQLLFW
                     TVMLTACLSEPEPTLYIQLASLIKQLAIETCWIRTPRSTHISQALLILCNWPLPNQKV
                     LDDCSYRFVGLAKSLSYQLGLHRGRFMSEFTRTQTSMPDAEKWRTRTWLGIFFTEQCW
                     ASILGLPPTSQNDYLVERARLEEDEDAVPRRFRQLIILANFQAKLCNMMGSSVMSPDG
                     LTDARERAGCLAILERELKRLNTKFSFEEDTVVEMYYLYVKLMICCFAFLPGTPTEDQ
                     SKYVTEAYLCATKVVTLLTKLLESANLIQLPIYVRQSVTYSALILFKLQLTPLLLDKY
                     VDSARQSIVTVHRLYRNQLTAWTASVENDISRTASVLEKLNFVLISQPEIFIEEEGII
                     TRMRSHLTGTLFYDLVWCIHEARRRQNDPHYREELSKRLERMADSKNNNDSSSKERKL
                     FPLPFYNQISKEDFETITQTTPGGTTVTTLIPTKNAIQQAKQLAERQGDQMGPIRYIN
                     GIPISVLEETGSVKLDPSLTAQDQNAVSAADSRNATAPPNSLKASVTTEDIMPKSPLL
                     FEQPMQRSASTPSAETPGTARRAANVSSSIATGNTDSLFSMNTSAPLAASLAKAIPLE
                     AVAGSPPLHTNSYSSLNMFLAGDGSEKNESAAAALMQPQQSQNQQASDLDNFFQQQSA
                     GWIEGNSSNDDFLGWFDINMAPEF"
     gene            complement(<590991..>591740)
                     /locus_tag="KLTH0C06798g"
                     /db_xref="GeneID:8291389"
     mRNA            complement(<590991..>591740)
                     /locus_tag="KLTH0C06798g"
                     /product="KLTH0C06798p"
                     /transcript_id="XM_002552474.1"
                     /db_xref="GeneID:8291389"
     CDS             complement(590991..591740)
                     /locus_tag="KLTH0C06798g"
                     /note="similar to uniprot|P34227 Saccharomyces cerevisiae
                     YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx) with
                     thioredoxin peroxidase activity has a role in reduction of
                     hydroperoxides induced during respiratory growth and under
                     conditions of oxidative stress"
                     /codon_start=1
                     /product="KLTH0C06798p"
                     /protein_id="XP_002552520.1"
                     /db_xref="GeneID:8291389"
                     /db_xref="GOA:C5DE71"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:C5DE71"
                     /translation="MFVRPLFTARKPLSQQQPMLKSAVRMIRTFKQEEQPRLRINSLA
                     PNFTAQTTQGKLNFHDYLGDSWGVLFSHPADFTPVCTTELGAFAQLKPEFEKRNVKLI
                     GLSAEEVDKHQKWIKDIEEISSLDKFAFPIVGDADREVAFLYDMVDEEGFKNLSKGVV
                     ATIRSVYVIDPAKKVRLIITYPASVGRNSSEVLRVIDALQKGDAKGVVTPINWQPGED
                     VIIPPTVSDADAKKKFGDFTTVKPYLRYTKA"
     gene            complement(<592854..>594800)
                     /locus_tag="KLTH0C06820g"
                     /db_xref="GeneID:8291390"
     mRNA            complement(<592854..>594800)
                     /locus_tag="KLTH0C06820g"
                     /product="KLTH0C06820p"
                     /transcript_id="XM_002552475.1"
                     /db_xref="GeneID:8291390"
     CDS             complement(592854..594800)
                     /locus_tag="KLTH0C06820g"
                     /note="similar to uniprot|P34226 Saccharomyces cerevisiae
                     YBL061C SKT5 Activator of Chs3p (chitin synthase III),
                     recruits Chs3p to the bud neck via interaction with Bni4p;
                     has similarity to Shc1p, which activates Chs3p during
                     sporulation"
                     /codon_start=1
                     /product="KLTH0C06820p"
                     /protein_id="XP_002552521.1"
                     /db_xref="GeneID:8291390"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DE72"
                     /translation="MAAATHPYRQNLGTVTPVTLAFKEQGDTESGDTSQTSSELKKLI
                     DEPDHPEDPRRILEGLPSPQGVRGPLLQHNKSASSPASSLTGTPSSSRSQLQGSGASP
                     SLELRGDGHAKRRPKSLDLSHLFLLSDKDTQFTSTNESAADLSHKMITEYLGEAHNST
                     LVPRLKTIEMYKQNVKKSKDPNVLFQYAQYMLQTALTIDPLAGQDETTKKEEASQEEM
                     RKQFLKEAQHYLKKLSVKGYSDAQYLLGDAYSSGAFGKVNNKDAFVLFQSAAKHGHVE
                     SAYRTAHCFEEGFGTTRDSRRAVEFLKFAASRNHPSAMFKLGLYSFYGRMGLPHDVNT
                     KQNGIKWLSRAAARANELTNAAPYELAKIYQNGFLDIIIPDTKYAMELYIQAASLGHA
                     LSSTALGQIYEAGNEIVPADTSLSVHYYTQAAMQGEPSAMLGLCAWYLMGAEPAFKKD
                     EEEAFQWALRAAKAGLPKAQFTIGYFYEKGKGCEPDAASARKWYERAAKNQDPRAISK
                     LEGEGRVLRKQKSISTLNLFSNNSSSNLLQTDDRSRSGLSPNSSFSQTGRQPSEAYTS
                     NASNTSTSRKVSANGRSDLGAGSETKNAAGPAGTLDLTDAVVTSTKKKGKSKKTTASS
                     TLPTSQGDKKGQSKKKKDKKCVIM"
     gene            complement(<595165..>596310)
                     /locus_tag="KLTH0C06842g"
                     /db_xref="GeneID:8291391"
     mRNA            complement(<595165..>596310)
                     /locus_tag="KLTH0C06842g"
                     /product="KLTH0C06842p"
                     /transcript_id="XM_002552476.1"
                     /db_xref="GeneID:8291391"
     CDS             complement(595165..596310)
                     /locus_tag="KLTH0C06842g"
                     /note="similar to uniprot|P25454 Saccharomyces cerevisiae
                     YER095W RAD51 Strand exchange protein forms a helical
                     filament with DNA that searches for homology involved in
                     the recombinational repair of double-strand breaks in DNA
                     during vegetative growth and meiosis homolog of Dmc1p and
                     bacterial RecA protein"
                     /codon_start=1
                     /product="KLTH0C06842p"
                     /protein_id="XP_002552522.1"
                     /db_xref="GeneID:8291391"
                     /db_xref="GOA:C5DE73"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DE73"
                     /translation="MSEGQEAVYRDSQGDAAFDSQRNGAPSASGGSAEAQLFVGENGE
                     QDREMAGDGEDVALVSFVPLERLQVNGITALDIKKLRENGLHTADAVAYAPRKDLLEI
                     KGISEAKADRLLNEAARLVPMGFVTAADFHMRRSEMICLTTGSKNLDTLLGGGIETGS
                     ITELFGEFRTGKSQLCHTLAVTCQIPLDMGGGEGKCLYIDTEGTFRPIRLVSIAQRFG
                     LDPDDALNNVAYARAYNADHQLRLLDAAAQMMSESRFSLIVVDSIMALYRTDFSGRGE
                     LSARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGSAMFNPDPKKPIGGNIMAHS
                     STTRLGFKKGRGCQRFCKVVDSPCLPEAECIFAIYEDGVGDPREEDE"
     gene            <596687..>598597
                     /locus_tag="KLTH0C06864g"
                     /db_xref="GeneID:8291392"
     mRNA            <596687..>598597
                     /locus_tag="KLTH0C06864g"
                     /product="KLTH0C06864p"
                     /transcript_id="XM_002552477.1"
                     /db_xref="GeneID:8291392"
     CDS             596687..598597
                     /locus_tag="KLTH0C06864g"
                     /note="weakly similar to uniprot|P34225 Saccharomyces
                     cerevisiae YBL060W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C06864p"
                     /protein_id="XP_002552523.1"
                     /db_xref="GeneID:8291392"
                     /db_xref="GOA:C5DE74"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR023394"
                     /translation="MTGLEGAQNLTVADKQLTPDEGVLTESPKMTNIHEIVEDTAASS
                     ENGDSEAKEIAAKIRAGTLENVEFTEYANYLGTPGNDQILREFLLLLDPLPSSITGTL
                     RKLSSSLYFIAEAANLDTILEALSRQWLSEHNKAHYQDNYKLCHIVMFALLMLNSTLH
                     NSEADLSFTIEEFRENTINALQKESPDIDVPSFNRELSLCYYQLDNEQLPLLRPPSQP
                     RYSLSGRRTNGNGGHSNMKKASMLSLERFQTNQSLISTQNSMATLTSRDTTANSNYRM
                     RNNKPLQKLYLDEPFDAELQDLNGTPWLMDSMVNVQEASKANNSTSQLLSSPVTRKRK
                     LMSWFRKHTKDTIFNENIHAADTDNWQHARIRIYQGRLFVYKFKGFGRERSIPRDIHK
                     WSLEMCKRSCSQFHVYNLYGTIASLVQENIVASENSNVSSASFLIDFPHGLDSTSGLS
                     FRFKTRNQDEAKQFTACCNFWSARISPIPSAQVEMISNEEYGWSPRLLEGESGAEQVN
                     LAQVKLAHWKPLVGLDAIFSELDEGIALWDFDSQLGNLRVFTELLGAQLDEHNAVKPK
                     MVELWAKKGREYQPQFEAAMENWNNKYLYLNKQYQKHLVYLKALENAVQFYERSKSVK
                     NPETKNAAKEQS"
     gene            <598854..>599599
                     /locus_tag="KLTH0C06886g"
                     /db_xref="GeneID:8291393"
     mRNA            join(<598854..598878,599007..>599599)
                     /locus_tag="KLTH0C06886g"
                     /product="KLTH0C06886p"
                     /transcript_id="XM_002552478.1"
                     /db_xref="GeneID:8291393"
     CDS             join(598854..598878,599007..599599)
                     /locus_tag="KLTH0C06886g"
                     /note="highly similar to uniprot|P25451 Saccharomyces
                     cerevisiae YER094C PUP3 Beta subunit of the 20S proteasome
                     involved in ubiquitin-dependent catabolism human homolog
                     is subunit C10"
                     /codon_start=1
                     /product="KLTH0C06886p"
                     /protein_id="XP_002552524.1"
                     /db_xref="GeneID:8291393"
                     /db_xref="GOA:C5DE75"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DE75"
                     /translation="MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVANNFEKIF
                     HYGHVFLGLTGLATDVTTLSETFRYKTNMYKLKEDRFIEPETFTQLVSSTLYEKRFGP
                     YFTGPVVAGINSRTGKPYISGFDLIGCIDEAKDFVVSGTASEQLFGMCESLYEPNLEP
                     EDLFETISQALLNAADRDALSGWGAAVYIIKKDKVIKRYLKTRQD"
     gene            complement(<599791..>600174)
                     /locus_tag="KLTH0C06908g"
                     /db_xref="GeneID:8291394"
     mRNA            complement(join(<599791..600080,600141..>600174))
                     /locus_tag="KLTH0C06908g"
                     /product="KLTH0C06908p"
                     /transcript_id="XM_002552479.1"
                     /db_xref="GeneID:8291394"
     CDS             complement(join(599791..600080,600141..600174))
                     /locus_tag="KLTH0C06908g"
                     /note="highly similar to uniprot|Q3E7A4 Saccharomyces
                     cerevisiae YBL059ca"
                     /codon_start=1
                     /product="KLTH0C06908p"
                     /protein_id="XP_002552525.1"
                     /db_xref="GeneID:8291394"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:C5DE76"
                     /translation="MHPQLESQRFHSCLDLIEALDKCHQAEYYKRALGLCNNEKEALS
                     KCLHQARYEVGKAAILENRKKQKVVEAKWKQIREEEYGEDAILKRIIQEQVAKKQKEQ
                     AKENK"
     gene            <600316..>600831
                     /locus_tag="KLTH0C06930g"
                     /db_xref="GeneID:8291395"
     mRNA            join(<600316..600469,600533..>600831)
                     /locus_tag="KLTH0C06930g"
                     /product="KLTH0C06930p"
                     /transcript_id="XM_002552480.1"
                     /db_xref="GeneID:8291395"
     CDS             join(600316..600469,600533..600831)
                     /locus_tag="KLTH0C06930g"
                     /note="similar to uniprot|P87275 Saccharomyces cerevisiae
                     YER093C-A Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C06930p"
                     /protein_id="XP_002552526.1"
                     /db_xref="GeneID:8291395"
                     /db_xref="GOA:C5DE77"
                     /translation="MASVQLSSRDISVFSNEYKERRRLQMMRFFGATAFTLISARLAF
                     RGVQSRKYVPNMFQLNHKPPTYSFQGEAVSALAFGTGLATGTFSMLVFGTCWVWDISS
                     LAEFTLKMKKLMGEPVTDQALLENTPMDEDTRKVAEALEDMLKGSRKD"
     gene            <601001..>604990
                     /locus_tag="KLTH0C06952g"
                     /db_xref="GeneID:8291396"
     mRNA            <601001..>604990
                     /locus_tag="KLTH0C06952g"
                     /product="KLTH0C06952p"
                     /transcript_id="XM_002552481.1"
                     /db_xref="GeneID:8291396"
     CDS             601001..604990
                     /locus_tag="KLTH0C06952g"
                     /note="similar to uniprot|P40061 Saccharomyces cerevisiae
                     YER093C TSC11 Binding Protein of TOR Protein required for
                     cell viability"
                     /codon_start=1
                     /product="KLTH0C06952p"
                     /protein_id="XP_002552527.1"
                     /db_xref="GeneID:8291396"
                     /db_xref="GOA:C5DE78"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:C5DE78"
                     /translation="MTSQRSSPHLTRSRSSADEILTRSRHNTVLSTSFVSTRRADEQP
                     ASPLSAHKPRRTRSGTAKSINNLKHDIHHVQQDLVRLRKSKEDTEKLKESATNDIYPG
                     NYSQEHLQRHSMVLQSNNQLRKLDQQIKKSGDLLSSLRKKLDSTTEEVRPTASTNPSF
                     ISKELRRTSDYTTADDSTTAEELSARSLSEDDVSSASLDEASNGESPGNKQVSSSDAA
                     ASEKHATWLVSDYLQSLQDKNASTDYLLETANDLTLLLKQNPTIKFDLYLPAFSSTIQ
                     QLLLSDADVTVAAAYRICRHLITGQEFIQELLKLHLEPFLIISLAKPNSCYVERLHAL
                     KLIRSFLGHDAGITLGLVQAIISCIEKPDDRLREVALETLLELCYTKPMFVRRCGGIQ
                     FLGSFIGECSSPQQAAYVLDAMLDLMTFRETRSCFIDSFDVRVVLTSLSDSQIKANFN
                     AERLKSGINLVSRCLTNYNGIILFSQDDFRPLRELLAFFQAPQLASYLVDLFLDVLRI
                     RSISPTGKKTANHNFKISPSHFHFETMPINQYVGLLAGVLYKVGFIDCLLGVLIQLAP
                     GKKDHGVAAKTRYLITEYCNIAMNLAGLKPSASAGLLSFNYSDFEKVFSEVFQYEKVT
                     NKLNKSRNTIGMSDIGSLRDIMDFSEQLKHKALINDVDEARFKRMVYDTRVLQTKDFS
                     LWNWSILSDLLEGPLLNGKRLDDLARTTKFFRRLMVFYRPMRFRFSKIRQGSRLAPKC
                     VHVGRQLFRTLTSNREGIKVLSDDTKLIPQIASLLFKAMEGHTAGNVFSRESLSKTVC
                     AGYFKIIGTFTESLRGVRILEKWNVFTVIYKMFQHTSKFTDSFLLLILPELDLEHSLH
                     CRNILNKALVHPMEEVRVEATRLLGNKIQDIPQKASTSGREKVLEKFLVELLVRQLYD
                     LSPKVIAAADKILYDYCATQDWPPRVDIPRHHLLDQLMFIRSPILLEFLKTPAGFKQL
                     NDIGFVETEREKWISHKNKEYVSRVEAFIQAEASKFSNDTSYSTPSRKKLPMHFCHSL
                     ASTEEGVNLISQKGDFVQIINIIKRYRHNNFPDLTVDEDIELKAALWCCGHIGSTEPG
                     INLLDNYSIVNDIVSISLRTSSMSIKFTSFFVLGLVAKTNEGCEILDELGWDCSLNVQ
                     KVPLGLTFPRDVLRFLRFPESNLSDDRFADQGTQINDGDAPLEYEVPTLDLDMLLNNK
                     AKAENTMGDAQEELQAEIERQTRNLEMFRLQACQISSDEALDRVMRAASKLNNHILCN
                     AAVKEITEVISTYGAARFETPKVFFWVLGLLEQYRFKPQARKFLCDLLLRKKTLEVMI
                     RKDKKKRKS"
     gene            complement(<605132..>605476)
                     /locus_tag="KLTH0C06974g"
                     /db_xref="GeneID:8291397"
     mRNA            complement(<605132..>605476)
                     /locus_tag="KLTH0C06974g"
                     /product="KLTH0C06974p"
                     /transcript_id="XM_002552482.1"
                     /db_xref="GeneID:8291397"
     CDS             complement(605132..605476)
                     /locus_tag="KLTH0C06974g"
                     /note="similar to uniprot|P40060 Saccharomyces cerevisiae
                     YER092W IES5 Protein that associates with the INO80
                     chromatin remodeling complex under low-salt conditions"
                     /codon_start=1
                     /product="KLTH0C06974p"
                     /protein_id="XP_002552528.1"
                     /db_xref="GeneID:8291397"
                     /db_xref="GOA:C5DE79"
                     /db_xref="InterPro:IPR020366"
                     /db_xref="UniProtKB/TrEMBL:C5DE79"
                     /translation="MTSSKIPVPSKEYAKQLSRREELTKQESSLKREYTTMLRKMASV
                     MAVLQELDDGQEASQQTISESALLKVPELKQYSQLLHDIDSKALEDIEIPEVLKDSYA
                     LYKQSPLLYKDL"
     gene            complement(<606308..>606895)
                     /locus_tag="KLTH0C06996g"
                     /db_xref="GeneID:8291398"
     mRNA            complement(<606308..>606895)
                     /locus_tag="KLTH0C06996g"
                     /product="KLTH0C06996p"
                     /transcript_id="XM_002552483.1"
                     /db_xref="GeneID:8291398"
     CDS             complement(606308..606895)
                     /locus_tag="KLTH0C06996g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C06996p"
                     /protein_id="XP_002552529.1"
                     /db_xref="GeneID:8291398"
                     /db_xref="UniProtKB/TrEMBL:C5DE80"
                     /translation="MQSEILVEIRTLNQLGIPTMATAPVQNVFVLRLTGSVCSFAFSM
                     KSLSKKRYLKFKHEHPEIECTDERCPERLKNWVHQQRYIYGQGIVTVVFLPLCYLFAN
                     TLIKDSVYENTPFNRARNLVILFGHVQHFFVCAVGFYRCKKWTEDLVDSIACDGKASN
                     SCSWYGYAKLERGQDKAHRFLSIMYGSQHTRRHAN"
     gene            <608415..>610721
                     /locus_tag="KLTH0C07018g"
                     /db_xref="GeneID:8291399"
     mRNA            <608415..>610721
                     /locus_tag="KLTH0C07018g"
                     /product="KLTH0C07018p"
                     /transcript_id="XM_002552484.1"
                     /db_xref="GeneID:8291399"
     CDS             608415..610721
                     /locus_tag="KLTH0C07018g"
                     /note="highly similar to uniprot|P05694 Saccharomyces
                     cerevisiae YER091C MET6 Cobalamin-independent methionine
                     synthase involved in amino acid biosynthesis also called
                     N5-methyltetrahydrofolate homocysteine methyltransferase
                     or 5-methyltetrahydropteroyltriglutamate homocysteine
                     methyltransferase"
                     /codon_start=1
                     /product="KLTH0C07018p"
                     /protein_id="XP_002552530.1"
                     /db_xref="GeneID:8291399"
                     /db_xref="GOA:C5DE81"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:C5DE81"
                     /translation="MVQSSVLGFPRIGANRELKKATEAYWQGKVSVEDLLKVGKDIRA
                     NNWKLQKEAGVDVIPSNDFSFYDQVLDLSLLFNVIPERYAKYNLSPLDTFFAMGRGLQ
                     RKATETEKAVDVTALEMVKWFDSNYHYVRPTFSHSTQFKLNGQKPVDEFLEAKALGIQ
                     TRPVLLGPVSYLFLGKADKDSLDLEPLSLLQKLVPLYAEILKKLAEAGATEVQIDEPI
                     LVLDLPQEVKAAFKTAYDFLASQSGLPAITFATYFGTVVPNLDAIKELPVAAFHFDFV
                     RNPEQFDQVAAILKDNQSLSVGVVDGRNIWKNDFAKSSALVQKAIEKLGKDRVIVATS
                     SSLLHTPVDLENEKKLNPEIKDWFSFATQKVKEVVVIAKNVSGEDVSAELKTNAKSVS
                     NRASSNITNNEEVQKRVASIDEKMSTRSSPFPARLEEQKKIFNLPLFPTTTIGSFPQT
                     KDIRINRNKFVKGTITAEEYEKFINSEIETVIRFQEEIGLDVLVHGEPERNDMVQYFG
                     EQIDGYTFTTNGWVQSYGSRYVRPPIIVGDLSRPKAMSVKESVYAQSITTKPVKGMLT
                     GPVTCLRWSFPRNDVDQKTQALQLALALRDEVNDLEAAGIKVIQVDEPALREGLPLRA
                     GDERAAYLQWAAESFRVATSGVANKTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKD
                     DPNYIAEFQNYPNHIGLGLFDIHSPRIPSTEEFISKIETIMKSYPAEKFWVNPDCGLK
                     TRGWEETKLSLTHMVEAAKHFREVYAKK"
     gene            <611631..>612896
                     /locus_tag="KLTH0C07040g"
                     /db_xref="GeneID:8291400"
     mRNA            join(<611631..611723,611832..>612896)
                     /locus_tag="KLTH0C07040g"
                     /product="KLTH0C07040p"
                     /transcript_id="XM_002552485.1"
                     /db_xref="GeneID:8291400"
     CDS             join(611631..611723,611832..612896)
                     /locus_tag="KLTH0C07040g"
                     /note="similar to uniprot|P34223 Saccharomyces cerevisiae
                     YBL058W SHP1 UBX (ubiquitin regulatory X)
                     domain-containing protein that regulates Glc7p phosphatase
                     activity and interacts with Cdc48p interacts with
                     ubiquitylated proteins in vivo and is required for
                     degradation of a ubiquitylated model substrate"
                     /codon_start=1
                     /product="KLTH0C07040p"
                     /protein_id="XP_002552531.1"
                     /db_xref="GeneID:8291400"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DE82"
                     /translation="MSDENIQQFMTLSNASLETAQSYLGEFPDLGDALNAFYAAQNDN
                     PSSQPASGTSTQEPRSRPSRSLSPKNSPALSQSSSRAAKKSGNQNPKFKSFSDILKET
                     NANDDDDEPRNTFAGGETSGLEVTDPNDPDSLIRDLLEKAKRGGQRSDDSTPDEAQRK
                     KSHFTGKGFRLGSSVDAPAHVADDIPAEPLPSRPQKVTREITFWKEGFQVNDGELYRY
                     DDPANSFYLNELNQGRAPLRLLNVEFGQEVDVNVNKRLDESFKPPKRKLQGFHGTGQR
                     LGSPIPGESLSPEATPQPPAQKSPASKEEPAKPTGDTSVQIRYASGKREVLHCNSTDT
                     VRSLYDHVKGETGNAKAFTLNHAFPVKPIENFDSSLKEEGLCHAVVVQRWV"
     gene            complement(<612938..>613573)
                     /locus_tag="KLTH0C07062g"
                     /db_xref="GeneID:8291401"
     mRNA            complement(<612938..>613573)
                     /locus_tag="KLTH0C07062g"
                     /product="KLTH0C07062p"
                     /transcript_id="XM_002552486.1"
                     /db_xref="GeneID:8291401"
     CDS             complement(612938..613573)
                     /locus_tag="KLTH0C07062g"
                     /note="similar to uniprot|P34222 Saccharomyces cerevisiae
                     YBL057C PTH2 mitochondrially-localized peptidyl-tRNA
                     hydrolase"
                     /codon_start=1
                     /product="KLTH0C07062p"
                     /protein_id="XP_002552532.1"
                     /db_xref="GeneID:8291401"
                     /db_xref="GOA:C5DE83"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:C5DE83"
                     /translation="MQPSINSLATLFGIAAVSLASGYYLGQVSTTGPLKKHHVKDILK
                     RCKAKAKKEQEMQGSDSEGYEDGDDEEDEEDEVEINSLSLNDIPGEVRMALVIRQDLG
                     MQKGKVAAQCCHAALACYRLIATDPSRESYNLPLTERWLSHGQAKITLKCPDKETMDE
                     LFAKALSLGVNSYVVHDAGRTQIAAGSATVLGLGPAPKAVLDQITGELKLY"
     gene            complement(<613733..>615253)
                     /locus_tag="KLTH0C07084g"
                     /db_xref="GeneID:8291402"
     mRNA            complement(<613733..>615253)
                     /locus_tag="KLTH0C07084g"
                     /product="KLTH0C07084p"
                     /transcript_id="XM_002552487.1"
                     /db_xref="GeneID:8291402"
     CDS             complement(613733..615253)
                     /locus_tag="KLTH0C07084g"
                     /note="similar to uniprot|P00899 Saccharomyces cerevisiae
                     YER090W TRP2 anthranilate synthase Component I"
                     /codon_start=1
                     /product="KLTH0C07084p"
                     /protein_id="XP_002552533.1"
                     /db_xref="GeneID:8291402"
                     /db_xref="GOA:C5DE84"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:C5DE84"
                     /translation="MTKVEVQPSLESLKGFVAENDESVNMYPVFCYLPAMDLTPHLAY
                     LKLAQVNNPDRKQSFLLESATSDNQLGRFSFLGTNPRKTIKTGPTAGLEVDPLTVLEK
                     ELENYKLAENIPGIPKLSGGAIGYVSYDCIKYFEPKTKRPLKNVLQLPEACLMLYDTI
                     VAFDHVYQRFQIIHNIDLRTAESLEKGYEKAQKIVRDVVSTLESSDTLENVIQPPIKL
                     NQSFTSNIGESGYKAHVTTLKEHIKKGNIFQAVPSQRVARPTSLHPFNIYKHLRTVNP
                     SPYLFYIDLLDFQVIGASPELLCQVDTKNKIITHPIAGTVKRGKTPAEDDELADVLRS
                     SLKDRSEHVMLVDLARNDVNRVCDPMTTNVDKLLTVQRFSHVQHLVSQVSGTLRKDKT
                     RFDALRSIFPAGTVSGAPKVKAMELVGELEGETRGVYAGAVGNWSYDGKSMDTCIALR
                     TMVYKDGVAYLQAGGGIVFDSDEQEEYEETLNKMRANHNTILQAEEIWAARVGTID"
     gene            complement(<615350..>615718)
                     /locus_tag="KLTH0C07106g"
                     /db_xref="GeneID:8291403"
     mRNA            complement(<615350..>615718)
                     /locus_tag="KLTH0C07106g"
                     /product="KLTH0C07106p"
                     /transcript_id="XM_002552488.1"
                     /db_xref="GeneID:8291403"
     CDS             complement(615350..615718)
                     /locus_tag="KLTH0C07106g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C07106p"
                     /protein_id="XP_002552534.1"
                     /db_xref="GeneID:8291403"
                     /db_xref="UniProtKB/TrEMBL:C5DE85"
                     /translation="MPTVTITFIPSAELDAKTDFQVLLQHYSTFVHKGLATEGVGPRG
                     SLPRTFVNTLGHPNSLYPKVTGNFEQSKASSLLSSCVISLKASVSHGLAKALALISLT
                     ICVVSLFCLFAVDFLSESSG"
     gene            <616999..>618348
                     /locus_tag="KLTH0C07128g"
                     /db_xref="GeneID:8291404"
     mRNA            <616999..>618348
                     /locus_tag="KLTH0C07128g"
                     /product="KLTH0C07128p"
                     /transcript_id="XM_002552489.1"
                     /db_xref="GeneID:8291404"
     CDS             616999..618348
                     /locus_tag="KLTH0C07128g"
                     /note="similar to uniprot|P34221 Saccharomyces cerevisiae
                     YBL056W PTC3 Type 2C protein phosphatase dephosphorylates
                     Hog1p (see also Ptc2p) to limit maximal kinase activity
                     induced by osmotic stress dephosphorylates T169
                     phosphorylated Cdc28p (see also Ptc2p) role in DNA
                     checkpoint inactivation"
                     /codon_start=1
                     /product="KLTH0C07128p"
                     /protein_id="XP_002552535.1"
                     /db_xref="GeneID:8291404"
                     /db_xref="GOA:C5DE86"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C5DE86"
                     /translation="MGQILSNPIIDKEFASGGDVLSAFGLCAMQGWRMSMEDSHVCAT
                     NISAGDADHVAYYAVFDGHGGSSVAAFCGDKAAGVVQAQPSFQKSAFARALVDAFIAT
                     DKEILKDPLLRNDHSGCTATTMLVSRAQQKLFCGNAGDSRTVLSRNKLAKALSYDHKP
                     TLVGERSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNPSLPPHSQIVTCVPDVVEH
                     PIDYELDEFVILACDGIWDCLSSQECVDLVHYGINKGNMNLQDISSRIVDVCCSPTTE
                     GTGIGCDNMSIVVVALLKDGETIDEWFTRIRNKKHSAPVSFEDRRRAIFTFYNFPKDD
                     SEVFAVSTKKTEENSNSSNGTGGNSNFSSMNDEDTDMERHEGAPGRSQMDLFSLETLL
                     GANGIQVTQGGNNVSYIHGSALSEVLASLGGRAGASQQAEEEGESDEKPEKLEEVKD"
     gene            complement(<618784..>620010)
                     /locus_tag="KLTH0C07150g"
                     /db_xref="GeneID:8291405"
     mRNA            complement(<618784..>620010)
                     /locus_tag="KLTH0C07150g"
                     /product="KLTH0C07150p"
                     /transcript_id="XM_002552490.1"
                     /db_xref="GeneID:8291405"
     CDS             complement(618784..620010)
                     /locus_tag="KLTH0C07150g"
                     /note="similar to uniprot|P34220 Saccharomyces cerevisiae
                     YBL055C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C07150p"
                     /protein_id="XP_002552536.1"
                     /db_xref="GeneID:8291405"
                     /db_xref="GOA:C5DE87"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:C5DE87"
                     /translation="MLRRMSHAIKFYDIGLNLTDPMYQGLYNGKQYHQPDIQRVLRRA
                     QQARVHAMLLTGSSIHESQEAVALAARFHSPDARLYYTLGVHPCCVNEFVLADTNSTI
                     DNPTNDPEFNARLDVADAAFTKSKLRQLYTLMRDNARDPKFRAIGEIGLDYDRFYYSS
                     QEMQLLFFEEQLKLSCLFPEMPLFLHMRNCCADFVAVLDKFVRGFADADDRFDHRELV
                     REAGASHEHLPQIRDDGAIFYRFSPVRKFVTHSFTGSPQDLQDVLSLSANSYIGMNGC
                     SFKTAENIQCAKEVPLERLLLETDAPWCDIRRTHDSYKYLFTDPSAHNLQKDDPWHSG
                     LSDAYPDIPQWFNSVKRDKLDKKSEEEREQTTVKSRNEPCFMGHVATVVARVKQLPIE
                     EVASTVWDTTCGVYGE"
     gene            complement(<620315..>621112)
                     /locus_tag="KLTH0C07172g"
                     /db_xref="GeneID:8291406"
     mRNA            complement(<620315..>621112)
                     /locus_tag="KLTH0C07172g"
                     /product="KLTH0C07172p"
                     /transcript_id="XM_002552491.1"
                     /db_xref="GeneID:8291406"
     CDS             complement(620315..621112)
                     /locus_tag="KLTH0C07172g"
                     /note="some similarities with uniprot|Q03125 Saccharomyces
                     cerevisiae YDR043C NRG1 Transcriptional repressor that
                     recruits the Cyc8p-Tup1p complex to promoters mediates
                     glucose repression and negatively regulates a variety of
                     processes including filamentous growth and alkaline pH
                     response"
                     /codon_start=1
                     /product="KLTH0C07172p"
                     /protein_id="XP_002552537.1"
                     /db_xref="GeneID:8291406"
                     /db_xref="GOA:C5DE88"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DE88"
                     /translation="MTTLASMHSPALAGAVRSSVEEFYYRGSPSTCEQRCIALDGARG
                     NQVLLPGPGSGPVTAAQRHVESDLKRALDRCAFGASTALAATTTLPPLRLARTGSVTP
                     HGSVSGPGVGSGSGSGTNLALVPGLRARAESASGSVSASGSDYDSAAGPVSPVTAALS
                     PATAPAAGETSAPRPASAMSSATTSRPTGKRARSPIEQRRRYVCKTCVKGFTTSGHLA
                     RHNRIHTGEKNHVCPHPGCGQRFSRHDNCVQHYKTHLRRNTWQDDAA"
     gene            <622607..>623590
                     /locus_tag="KLTH0C07194g"
                     /db_xref="GeneID:8291407"
     mRNA            <622607..>623590
                     /locus_tag="KLTH0C07194g"
                     /product="KLTH0C07194p"
                     /transcript_id="XM_002552492.1"
                     /db_xref="GeneID:8291407"
     CDS             622607..623590
                     /locus_tag="KLTH0C07194g"
                     /note="highly similar to uniprot|P11353 YDR044W
                     Saccharomyces cerevisiae HEM13 Coproporphyrinogen III
                     oxidase"
                     /codon_start=1
                     /product="KLTH0C07194p"
                     /protein_id="XP_002552538.1"
                     /db_xref="GeneID:8291407"
                     /db_xref="GOA:C5DE89"
                     /db_xref="InterPro:IPR001260"
                     /db_xref="InterPro:IPR018375"
                     /db_xref="UniProtKB/TrEMBL:C5DE89"
                     /translation="MPAPEDPTHLPIRKQMEELIRRKQREITQGLETLDTVKFTPDSW
                     TRGNDGGGGTSMVLQNGTTFEKGGVNVSVVYGQLSPAAISAMKHDHKNLKLPEDPATG
                     LPNTEGVKFFACGLSMVIHPSNPHAPTTHLNYRYFETWNPDGTPQTWWFGGGADLTPS
                     YLYEDDARLFHEMHKKALDKHDAALYPRYKKWCDEYFFIKHRNETRGIGGIFFDDMDD
                     RDPQEILSIVEDCFDAFLPSYLPIIARRKDMPFTEEEKQWQLIRRGRYVEFNLVLDRG
                     TQFGLRTPGSRTESILMSLPVTACWFYDHHPEPGSREDKLLKVLENPVDWV"
     gene            complement(<623707..>624090)
                     /locus_tag="KLTH0C07216g"
                     /db_xref="GeneID:8291408"
     mRNA            complement(<623707..>624090)
                     /locus_tag="KLTH0C07216g"
                     /product="KLTH0C07216p"
                     /transcript_id="XM_002552493.1"
                     /db_xref="GeneID:8291408"
     CDS             complement(623707..624090)
                     /locus_tag="KLTH0C07216g"
                     /note="highly similar to uniprot|Q04307 Saccharomyces
                     cerevisiae YDR045C RPC11 RNA polymerase III subunit C11"
                     /codon_start=1
                     /product="KLTH0C07216p"
                     /protein_id="XP_002552539.1"
                     /db_xref="GeneID:8291408"
                     /db_xref="GOA:C5DE90"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:C5DE90"
                     /translation="MSLPVDELRNQRNRGAKMLSFCPHCHNMLVISQADSGAYALQCG
                     ACPYAFPIEGVEVYDRKTLPRKEVDDVLGGGWDNVDQTAVQCPNYDECGGERAYFFQL
                     QIRSADEPMTTFYKCVSCGNRWREN"
     gene            <624255..>626153
                     /locus_tag="KLTH0C07238g"
                     /db_xref="GeneID:8291409"
     mRNA            <624255..>626153
                     /locus_tag="KLTH0C07238g"
                     /product="KLTH0C07238p"
                     /transcript_id="XM_002552494.1"
                     /db_xref="GeneID:8291409"
     CDS             624255..626153
                     /locus_tag="KLTH0C07238g"
                     /note="some similarities with uniprot|P32833 YBR060C
                     Saccharomyces cerevisiae ORC2 Subunit of the origin
                     recognition complex"
                     /codon_start=1
                     /product="KLTH0C07238p"
                     /protein_id="XP_002552540.1"
                     /db_xref="GeneID:8291409"
                     /db_xref="GOA:C5DE91"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="UniProtKB/TrEMBL:C5DE91"
                     /translation="MSSAEDIVSHEDIQVSGAQSEAQKRLLPIIWRFVGRRARRSGRA
                     GPASPAKRRTSSPVKPEMTPGLQDLESSPTRKRQRDPEKTPMAEPEPSPLKSDTGPSL
                     AMAPESPTKRPSKRGRPRKVKTEPTENIDDYAPASRSQSPLRPRKLMRDELGPDQEGE
                     PGFVTANSSPIKSSHVFSSPAKSPTKPVLKQSPFKIQLNRHFVPTPIPQEGEYKAPKE
                     KHLTYFFDGFEGYIDQKKPLRSHQKSTNTMAMAPQVTREEFSLISNTLNSLLHRSSKE
                     ALRQVQRQMFPQYWFELAQGFSLLFYGVGSKRSFLEEFVIDYLSPRLTLSDALNFGSM
                     EEKADHTDRKGEINFNGEDGDNSEGDNADDEGDIDGVPCVVINGYNPTCSYRDAFHSI
                     SQVMLQEELGKSETKYWGNHVELQINKMIEVYRDSPPLIKLVVLVHNLDGPMVRKAPF
                     QNMLSSLARVRQIALVASTDHVYAPLLWDHVRAQNFNFIFHDITNYQGYAVESSFSDI
                     MQLGKSSGTTGAEGARYVLESLTSNSKRMYKLLIETQLANMESQGKDSANKRGSHAFG
                     IEFKQFYHLCAAEFIASNEVSLRSMLSEFIEHKMAAMSKDRSGAETLYVPYVYSEMQT
                     LLKDILNV"
     gene            <626334..>629039
                     /locus_tag="KLTH0C07260g"
                     /db_xref="GeneID:8291410"
     mRNA            <626334..>629039
                     /locus_tag="KLTH0C07260g"
                     /product="KLTH0C07260p"
                     /transcript_id="XM_002552495.1"
                     /db_xref="GeneID:8291410"
     CDS             626334..629039
                     /locus_tag="KLTH0C07260g"
                     /note="similar to uniprot|P38080 Saccharomyces cerevisiae
                     YBR059C AKL1 Ser-Thr protein kinase"
                     /codon_start=1
                     /product="KLTH0C07260p"
                     /protein_id="XP_002552541.1"
                     /db_xref="GeneID:8291410"
                     /db_xref="GOA:C5DE92"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DE92"
                     /translation="MSKSEASSHEVVSGANSSRSATLPVLERLKTGSQVIVGNHRVEI
                     VKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTDENGLNEMRNEV
                     SVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMNQRLTTKLSE
                     QEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTSTCLPVAN
                     THQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYTTPFE
                     LTGQFAILHSKYEFPINNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKVENPI
                     EDKYGMGPYSFEKYSAYQAKLQKVQYQMYLAYENKQQVDILNDLFINCFEVAPKQPVN
                     VGQKGSHRESQVAAGPQVAELSETGNEGTPAGEEDIGLVQRQFPSVEDLDQYLHTETK
                     RESGRQNSSNIGSLEGSSHSSSKTDLAGAQGSISKLAGNSTNPAQPAVPNPGALSMAR
                     ESTARSSNSVKQHKPTNPFPYIQNEREVYSLDQDSNSVFHDDGLNTNTEEQFFSQEPV
                     SASAADLKLGQDQAQRSSANVQQPMPTHHFQEQIRDPNVEKIGAFSQYFSATPAPAVH
                     STTNEPNQTEVPQYYAYQGSQSKNTQPQPQPQPQPQPQPQEQQQQQIKQQQQQQQIQQ
                     QLQQQRLQQQQQQQQQQQQQQRQKLQQQQLQQQQLQNQQLQQQQLQQQQLKENEKELL
                     VDFSPAAKKEPQKLDLTYDKVDLSTPRKGGFKEDTNISQQSLASSESYSVELSKSKSE
                     SKNRGKTINEVVPQQQQQPRGRRSLDLKYQEMDFSKSPSPDLKLQKVKTITHQQRKSN
                     LGLEAKKSFSRSRKSLDLDHARREAANSSENTSSKRKSFFGKFKS"
     gene            complement(<629716..>630861)
                     /locus_tag="KLTH0C07282g"
                     /db_xref="GeneID:8291411"
     mRNA            complement(<629716..>630861)
                     /locus_tag="KLTH0C07282g"
                     /product="KLTH0C07282p"
                     /transcript_id="XM_002552496.1"
                     /db_xref="GeneID:8291411"
     CDS             complement(629716..630861)
                     /locus_tag="KLTH0C07282g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C07282p"
                     /protein_id="XP_002552542.1"
                     /db_xref="GeneID:8291411"
                     /db_xref="GOA:C5DE93"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR013866"
                     /db_xref="UniProtKB/TrEMBL:C5DE93"
                     /translation="MPISHKGLSLGTETMEPPPVDAPLKTLHNFYWSSHKEPHAIRRH
                     AILKSHPQVKKLMGHEPRTKFIVVGVVALQCTVAYLLRNTHPLSLKFWLCAYVIGATA
                     NQNIFLAIHELSHNLAFRKPLHNKLFSVFTNTPIGVPYAASFAPYHQLHHKFLGDEVY
                     DTDIPTKFEALVLSNVLGKAFFATFQIFFYALRPMFVTSIPMSLLHLLNVVYQFTFDY
                     VWIHSFGWKSFMYFLISSFLAGSLHPCSGHFIAEHYLLNLEEALAGGKLALKHTPAED
                     EEIHSTDKSKISRADVEFQHRYALETFSYYGILNVFTWNVGLHNEHHDFPFVPWSRLW
                     ELNRMCPEYYQDLPKHDSWCKVLWNFVFTDDVTLYNRVKRVNKEHMN"
     gene            <632098..>633528
                     /locus_tag="KLTH0C07304g"
                     /db_xref="GeneID:8291412"
     mRNA            <632098..>633528
                     /locus_tag="KLTH0C07304g"
                     /product="KLTH0C07304p"
                     /transcript_id="XM_002552497.1"
                     /db_xref="GeneID:8291412"
     CDS             632098..633528
                     /locus_tag="KLTH0C07304g"
                     /note="weakly similar to uniprot|P28817 YDR036C
                     Saccharomyces cerevisiae EHD3 Protein of unconfirmed
                     function plays an indirect role in endocytic membrane
                     trafficking member of a family of enoyl-CoA
                     hydratase/isomerases"
                     /codon_start=1
                     /product="KLTH0C07304p"
                     /protein_id="XP_002552543.1"
                     /db_xref="GeneID:8291412"
                     /db_xref="GOA:C5DE94"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:C5DE94"
                     /translation="MLRSSLRCHQIKRFMSEQVKFGSKGVSRVVTLSRPEKLNALSDQ
                     MCRKMIPTLQEYAKSETNNIVVIGSANAPRSLCSGGDVATVALQNIAGKRDLSLEFFR
                     NEYSLNLLLATYNKPVVVLMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPD
                     VGTTFSLPQLTTVGGTKGQLALYLCLTGDLLSGIDVYMAGLASHYVPSHNLVDLQARL
                     GELPVTNSEEMWQITGNAIEEFSVGIPEDYNFKYSNAQLDVIESCFDIGHGWKGINTA
                     LEKVVNSSSASPEEKEFARLTLQKLGTKSPVSVQVAIEQFRRNSQTDVESALKQDLVT
                     ASNMCEDPASEFSQATKHKLVDKSKSAFPWTKTSLTLEELSRLVSPRASASVSLQKFD
                     KAVTWKKYPYHSQFMLPTEQNFKDYITGNDNSGRSLAANQAEVVKYFSQYNSSSKGKT
                     GIEYLCNLVCSRKCTVGDAGELRWNN"
     gene            <633748..>636036
                     /locus_tag="KLTH0C07326g"
                     /db_xref="GeneID:8291413"
     mRNA            <633748..>636036
                     /locus_tag="KLTH0C07326g"
                     /product="KLTH0C07326p"
                     /transcript_id="XM_002552498.1"
                     /db_xref="GeneID:8291413"
     CDS             633748..636036
                     /locus_tag="KLTH0C07326g"
                     /note="weakly similar to uniprot|P38237 YBR058C
                     Saccharomyces cerevisiae UBP14 Ubiquitin-specific protease
                     that specifically disassembles unanchored ubiquitin
                     chains"
                     /codon_start=1
                     /product="KLTH0C07326p"
                     /protein_id="XP_002552544.1"
                     /db_xref="GeneID:8291413"
                     /db_xref="GOA:C5DE95"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR016652"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DE95"
                     /translation="MSELEEFGLLQIPSVIHKDDCGYCFESMYNDDQMASHALNVCLT
                     CFQSFCDTHIPVHQSVAKNDFNDKHDFLLKVSKIRKPEQKQPIEKKLKLEITEKSEDD
                     TYESLWWLTKGAVIIADYRTQGLNSSVTTKVTEILNARSSNFQNMTQAWQLEVKPCVH
                     VENLEVPNDNPQTVANRCTDCKLGSNLWMCLHCGNVGCGRQQVGIEGHSHALKHFESN
                     PGHPLAVKLGSLSNSAADIYCYSCDDEVQFADTKKWIQLLLYWGIDIQSRVAQEKTLL
                     ELQVEQNMNWDFQMVDAEGHELRHLEGSKKYGYGLQNLGNSCYLNSVLQVLLNGDLSR
                     WSLEGLGDFPGDVLYVSSNLRCQLIKMRNALKNEPEKYPHGVKPTTFKHCIGGTHEEF
                     SSGRQQDALEFFSYFVDLLDKKVFEKSSSNPNDLMKFSLQDRIECTKCHGVKYTSQVS
                     DYLQVLLSDSEEPQDLLANLAQNFQGDEVEFKCPTCNETTKANKSCGFRTFPEILVAS
                     CSRIKLVNWVPVKTSQEVLVPGTQAADTAILELGQFKSNGFDPDNETLLEKGEPAGFE
                     PKANCIIQLTEMGFSENAAVRALYHSGNSSAEVAANWLFQHMDDADLNDPFIVPSAPS
                     KAAEVNPQALENMAAMGLNPELCRKALIINQGNVSASVEWVFNNLDYCDSSIQESTVD
                     EDDKEYGITDKDKANYRLKAVVCHKGASVHSGHYVAFIKKQVENEVKWVLYNDEKIVV
                     ADSPTNIEEIKKNGYIYFFDRS"
     gene            <636295..>637245
                     /locus_tag="KLTH0C07348g"
                     /db_xref="GeneID:8291414"
     mRNA            <636295..>637245
                     /locus_tag="KLTH0C07348g"
                     /product="KLTH0C07348p"
                     /transcript_id="XM_002552499.1"
                     /db_xref="GeneID:8291414"
     CDS             636295..637245
                     /locus_tag="KLTH0C07348g"
                     /note="weakly similar to uniprot|P38236 YBR057C
                     Saccharomyces cerevisiae MUM2 Cytoplasmic protein
                     essential for meiotic DNA replication and sporulation"
                     /codon_start=1
                     /product="KLTH0C07348p"
                     /protein_id="XP_002552545.1"
                     /db_xref="GeneID:8291414"
                     /db_xref="UniProtKB/TrEMBL:C5DE96"
                     /translation="MNSSDWNSMQGFQEKGLEASLAGLALSQNALFIGGDGDKRMIGA
                     NNRNQESITAYNNTIFPPQGGIALVPRHPNTLHQGPAGGSNGNIGGNGGSRDNFYWNM
                     EHRDLNVGRENTAGNMTANSIMDSTVNTKESAYNTTVGSNHWQQETVESMQLELQLKE
                     TQIESLETEIQSLKRIFNQGLSARQEQDSRVSSASQKGRTVEMPVSLESIFHKMSSVI
                     AAKDKELEETSRRLESIVTAIALNPSNSVTKLGRYDEEALAHKMVVRLETLTKENQDM
                     AKMLGYGRSKEQHIELELIKRENQELKRKLSQVERKALKD"
     gene            complement(<637434..>638666)
                     /locus_tag="KLTH0C07370g"
                     /db_xref="GeneID:8291415"
     mRNA            complement(<637434..>638666)
                     /locus_tag="KLTH0C07370g"
                     /product="KLTH0C07370p"
                     /transcript_id="XM_002552500.1"
                     /db_xref="GeneID:8291415"
     CDS             complement(637434..638666)
                     /locus_tag="KLTH0C07370g"
                     /note="weakly similar to uniprot|P14843 YDR035W
                     Saccharomyces cerevisiae ARO3
                     3-deoxy-D-arabino-heptulosonate-7- phosphate (DAHP)
                     synthase"
                     /codon_start=1
                     /product="KLTH0C07370p"
                     /protein_id="XP_002552546.1"
                     /db_xref="GeneID:8291415"
                     /db_xref="GOA:C5DE97"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DE97"
                     /translation="MTDLQKKKFHRHIRRDAAVLLLDRVPSSRSLDFPCYPEMFIKND
                     HAGDRKRLEDWRIKGYDPLTPPDLLQHELPISEKGAKNIVDAREQVCDILNGKDDRLV
                     IVIGPCSIHDPKAAYEYCDRLSQISQKLSKDLLIIMRAYLEKPRTTVGWKGLINDPDI
                     DNSFQINKGLRISREMFTNLVEKMPIAGEMLDTISPQFLSDCFSLGAIGARTTESQLH
                     RELASGLSFPIGFKNGTDGGLQVSIDAMRAAAHAHYFLSVTKPGVTAIVGTEGNSDTF
                     IILRGGKKGTNFDAESVKQAQSELIQAKVVDENSSARRIMIDCSHGNSSKDYRNQPKV
                     AQSIFEQLTDGQNAICGVMIESNLVEGRQDITPEGGREGLKYGCSITDACIGWESTEE
                     VLTLLAKGVQNRRKALSK"
     gene            complement(639214..639285)
                     /locus_tag="KLTH0C07392r"
                     /db_xref="GeneID:8291416"
     tRNA            complement(639214..639285)
                     /locus_tag="KLTH0C07392r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=68.39"
                     /db_xref="GeneID:8291416"
     gene            complement(<639510..>640991)
                     /locus_tag="KLTH0C07414g"
                     /db_xref="GeneID:8291417"
     mRNA            complement(<639510..>640991)
                     /locus_tag="KLTH0C07414g"
                     /product="KLTH0C07414p"
                     /transcript_id="XM_002552501.1"
                     /db_xref="GeneID:8291417"
     CDS             complement(639510..640991)
                     /locus_tag="KLTH0C07414g"
                     /note="weakly similar to uniprot|P38081 YBR056w
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C07414p"
                     /protein_id="XP_002552547.1"
                     /db_xref="GeneID:8291417"
                     /db_xref="GOA:C5DE98"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DE98"
                     /translation="MFDKLKQKVQKLKISDDKEHVPNIGSSNSLSKRDIYRNRYNYGV
                     NFGSLFVLESYIFHDLFEEGGDNEHDAVAAMVKKHSAEEVSKKLQNHYDSYVSDEEWS
                     WLKNEAGVTAIRLPVGYWHVDNGKFITSSMKFHDLQKVYEAAKPWDYVRKIIQQADKH
                     DIGVLVDLHGLPGGANGDAHSGESNGGSAKFFSNHDYVKTIVDDLIPFVVKDVCTPNE
                     NVIGLQVVNEAAFSESASHEKKFYAKAIKAVQSLDESLPVVISDGWWPGQWADWLNEN
                     KLVNNVVIDSHIYRCFSDEDKKKNARQLTDELPKSIDYPHDKADYMVGEFSCVIDEES
                     WKRTKEPRDECVAAYGKKQVEVLRKKASWGWFFWTFKFQEGDGGEWGFQTMVNRGCIP
                     KRPRVDPSIDDTKVKALADEHSKYWKENGGGKLETWRFEEGLKTAANDVLAFNNFDHS
                     RVGRTNFFKNLRRSQHIDAKGDSKNVWEWEQGYEKGLSEFNKV"
     gene            complement(642030..642101)
                     /locus_tag="KLTH0C07436r"
                     /db_xref="GeneID:8291418"
     tRNA            complement(642030..642101)
                     /locus_tag="KLTH0C07436r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=69.96"
                     /db_xref="GeneID:8291418"
     gene            <642381..>645116
                     /locus_tag="KLTH0C07458g"
                     /db_xref="GeneID:8291419"
     mRNA            <642381..>645116
                     /locus_tag="KLTH0C07458g"
                     /product="KLTH0C07458p"
                     /transcript_id="XM_002552502.1"
                     /db_xref="GeneID:8291419"
     CDS             642381..645116
                     /locus_tag="KLTH0C07458g"
                     /note="similar to uniprot|P19735 Saccharomyces cerevisiae
                     YBR055C PRP6 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="KLTH0C07458p"
                     /protein_id="XP_002552548.1"
                     /db_xref="GeneID:8291419"
                     /db_xref="GOA:C5DE99"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027108"
                     /db_xref="UniProtKB/TrEMBL:C5DE99"
                     /translation="MERPAFLSQKPPPGYVAGIGRGAIGFTTRSDIGSGKTPGRVADD
                     REQGVNPGGPEDTEDAETKARINRNQRFEDTNGLSLVSHGLEPDDKDADRIYDEVEAR
                     LARKRVHKKLDVEKASSGNSQGGFLAASQQFVDLKRSLATVSEEQWDNLPEAGDITRR
                     NKRQRLEMQNERKSYAAPDTLVSGNIDLTKLTQEREKLLGRQLDESISSSATGINDPK
                     DAVEKYLEELDNSTHLANLDEQAQDLRKTRAILASYRKADPKKPQGWIASARLEEKAN
                     KFRLAKNLIEEGCNECPYDANIWLENIRLNSSDLRYCKILVANALRFNEESLELWLKA
                     IDLEREPLNKVRVLRKAIQSLPTSEKLWKLAVQYENDKQEAIKILQKATELLPHSIPL
                     ITALVNLQEHTVARQTLNTARRNNPTTFHMWMLALQLEERHSEASVDKLIKLALKGAT
                     ELSKNGITIKFEKWLQEAAKIELDFPGVYQNTVQAVVETSVQLFYHSEPLSDLLEAIE
                     NIASQCFNTKRSAYCCLLEKDPLDMSLWTKVIKHCQAQSKLDEVYRLFEKLLFSDSNE
                     VLRKNSVLALMYSKLLWKSETSIEKALEVLDKSLKVDPLNVEFWLAKAKLLVNARKFE
                     AAENLYKDGVIKLSQQPGLERVFYRYVSFLRFQNRNEEALKLLETDFLQRAHGCEKLY
                     LQWGQIYVHLGDLPQAQKCFAAGVKELPTSANLWIALAHTDKDQVGSAKARSDYDIAL
                     LKVPREKSEILLVSRIHLEKGLGNLDQARLLVTQALRDFPASSLLWVEHLRLLNKKSL
                     RKTAYQDALKSTNSGPRVLVEIGCHLFGESSYEKALKWFQKAASASPLYGDAWIWICR
                     CYKKLERDPSSIFSEVEDIEPRYGPEWVKRSKDVNNLTLSPAQVLSQCTSHDQKS"
     gene            <645219..>647546
                     /locus_tag="KLTH0C07480g"
                     /db_xref="GeneID:8291420"
     mRNA            <645219..>647546
                     /locus_tag="KLTH0C07480g"
                     /product="KLTH0C07480p"
                     /transcript_id="XM_002552503.1"
                     /db_xref="GeneID:8291420"
     CDS             645219..647546
                     /locus_tag="KLTH0C07480g"
                     /note="similar to uniprot|P40971 Saccharomyces cerevisiae
                     YDR034C LYS14 Transcriptional activator involved in
                     regulation of genes of the lysine biosynthesis pathway
                     requires 2-aminoadipate semialdehyde as co- inducer"
                     /codon_start=1
                     /product="KLTH0C07480p"
                     /protein_id="XP_002552549.1"
                     /db_xref="GeneID:8291420"
                     /db_xref="GOA:C5DEA0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DEA0"
                     /translation="MQSFAKSMVLFNDADGAKEALVSGGSPTSYLSPSSISNESNQGQ
                     SVRDSIFTQQLSSERFSGNSYSSGPSSICAERSPAVDGIAGTGSVTPLSSTKNDSPNN
                     LGMGIGTGTPDAESHQGSSATSTLASQPASSNSNGKTVKRKYSRNGCTECKRRRMKCD
                     EGKPTCWQCARLNRECVYIIRTKNRKRRPKSTEASKESAQADALVRESNAPGLTTNPS
                     GGSPFSNTSTDLHSTLHNPLNTSLPVENLSSSMPELPTVIPTNNVNAYDANLLIRNLN
                     DIVNMKLNDSMIHDDLKSMDFSDLDFPDLTAIPQQSTYAAVPISFLVDSVMTFNMSLD
                     SFKLGATHDKFLEVFYYDCLDSVAPFFQNQGNPLRDILLSFARGESYLLSAILAVGAS
                     ISHRKSNNVEDEKSYCAYLSHCLGLLTEQFKEESNVFNKIEPIILTVLMLTWDCIYTM
                     NSQWRSHLKGVTELFKKINSGSSSKVLNVAKCWFKVIETFASISTVLGGALVDETDLD
                     VIFDPYDYQYIDSLKFLNIMTPLNEFNLLRGHKEDFDLVIKEVFKALNVIRHSEKKYF
                     SEQEGIFDKNLDYLLWSNPNTDTFKQQLSYFKIQKILVEIDRQSEYVFIDKSGVIPTT
                     SPSHPKNSKIMDNAIDLVKLHSGEEIAISWYDISHQTQVLSFLLIVLLKLLGIPKESI
                     AIQQVVQKITSFFGFLDSENPPQNLRTCYCNFAILIAGLNAIDENTRKVIKSYYKLNG
                     GRFQRLTEHNLNRLEKVWYGNEKTYKLEDQDVLTW"
     gene            complement(<647606..>648883)
                     /locus_tag="KLTH0C07502g"
                     /db_xref="GeneID:8291421"
     mRNA            complement(<647606..>648883)
                     /locus_tag="KLTH0C07502g"
                     /product="KLTH0C07502p"
                     /transcript_id="XM_002552504.1"
                     /db_xref="GeneID:8291421"
     CDS             complement(647606..648883)
                     /locus_tag="KLTH0C07502g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C07502p"
                     /protein_id="XP_002552550.1"
                     /db_xref="GeneID:8291421"
                     /db_xref="GOA:C5DEA1"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:C5DEA1"
                     /translation="MKVTWVGCLTSLAGSSLAYVISDQGHFSNHRTDLLDQVFGEVLA
                     SHDGSGAAEVRQRSFNLDEDEDPEFKAMCGFYQEHPVEFPDDDLSNDLELFAGIVSFA
                     HVPIERCFGSRTDGKSPLYDIAIVGAPFDTSVSYRPGARFGPNAVRQGSRRLGGGILP
                     VRGFPGSKLRKLDPYNAGYKIVDCGDVPMTPYDNRIALNQLYRGQRAIYNKTTLKSDL
                     KAPKVITLGGDHTVTLMALKAASEHNGPLAVVHFDSHIDTWDPKVLGGGITKTQSINH
                     GTFLHFAHERGYIARDKSMHVGIRAPFIAPTDDKHDRECGFQKIVARDFDILGFQEIV
                     SQIKQRVGDLPVYITVDIDVLDLSVAPGTGTPEPGGLTSRELLTVLDGLEGLNVVGAD
                     VVEVSPAFDTNGDITSIVAAQVIDSILGLMTVG"
     gene            <649209..>650657
                     /locus_tag="KLTH0C07524g"
                     /db_xref="GeneID:8291422"
     mRNA            <649209..>650657
                     /locus_tag="KLTH0C07524g"
                     /product="KLTH0C07524p"
                     /transcript_id="XM_002552505.1"
                     /db_xref="GeneID:8291422"
     CDS             649209..650657
                     /locus_tag="KLTH0C07524g"
                     /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
                     YDR338C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C07524p"
                     /protein_id="XP_002552551.1"
                     /db_xref="GeneID:8291422"
                     /db_xref="GOA:C5DEA2"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:C5DEA2"
                     /translation="MARLIEETPRHNYASIPGSAAPEEVEVSYRDEFRQIGKNALPLI
                     VTFALQTSLSFVTVAFVGRLGALELGGVSLANVTFTATSAVFQGLATCLDTLCPQAFG
                     AKQYQLVGLYFQRGLAISLVFACPIALLWWYSELMLGAMVDDQRLVKIAARYLRVMVT
                     SIPGYVTFECGKKYLQAQNDFTTAQYILFVCAPLNVLLNYLFVFRFGLGFVGAPMATS
                     LTFTLMGASLATFIWCKTYRDGTTSCWSPLKNWKPIFANWGTMVSLAIPGIIMIEAEF
                     LAFESLTVLSAKFGTESLAAQSVIASIQSLTFQAPFSAGVAASNRIAYHIGKSRVRAC
                     QVASRATLIYIGFLIGTANLLFLVLGRTIIPSVFSNDEGVIKIASQVLPIIGINQVCD
                     VLNVLSAGILRAQGRQKIGGVLNIIAYYLVGLPMAIFLGFRCKWALQGFWVGLGCGIL
                     FLGLSELYCVWKSDWAKIIRNSRRLHKDSPAV"
     gene            <651330..>652469
                     /locus_tag="KLTH0C07546g"
                     /db_xref="GeneID:8291423"
     mRNA            <651330..>652469
                     /locus_tag="KLTH0C07546g"
                     /product="KLTH0C07546p"
                     /transcript_id="XM_002552506.1"
                     /db_xref="GeneID:8291423"
     CDS             651330..652469
                     /locus_tag="KLTH0C07546g"
                     /note="similar to uniprot|P38235 Saccharomyces cerevisiae
                     YBR053C"
                     /codon_start=1
                     /product="KLTH0C07546p"
                     /protein_id="XP_002552552.1"
                     /db_xref="GeneID:8291423"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:C5DEA3"
                     /translation="MYNSSICFKWRASFVSLLQVTIYHQQVALECILIAMVQTTEVSG
                     KPYIHDYGARLSEGVSYLKESQTLIWVDIFLSEIHLVTNIDDPKSSHKVVKINYENYI
                     GEYPCDKDLPERVGVVFPVDSASGVKDIFFASKYGIGRLSLETAQWKYEVLFSSCEQT
                     KNKDWKRLRSNDGNVAPNGDLYVGVMLDFHIDMDRSAEPEGCFLRVDLKKRAVELVMD
                     GLHIPNAINWNPKKDTIFLTDSLNYKIWTAPYDSHSGLPALAQKKSFIEFKPLNSECS
                     DPEPDGSCIDPRNGNLYSAVFSSHKVQLFDSQGTLQRNLVFPDTANVTCCCLGPGGDL
                     FVTTASRDVLHGVKTSGPNGALFRVAADLVSDSGDVPSSKPNPAF"
     gene            652621..652692
                     /locus_tag="KLTH0C07568r"
                     /db_xref="GeneID:8291424"
     tRNA            652621..652692
                     /locus_tag="KLTH0C07568r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=67.63"
                     /db_xref="GeneID:8291424"
     gene            <652890..>653507
                     /locus_tag="KLTH0C07590g"
                     /db_xref="GeneID:8291425"
     mRNA            <652890..>653507
                     /locus_tag="KLTH0C07590g"
                     /product="KLTH0C07590p"
                     /transcript_id="XM_002552507.1"
                     /db_xref="GeneID:8291425"
     CDS             652890..653507
                     /locus_tag="KLTH0C07590g"
                     /note="similar to uniprot|Q12335 Saccharomyces cerevisiae
                     YDR032C PST2 Protein of unknown function with similarity
                     to members of a family of flavodoxin-like proteins;
                     induced by oxidative stress in a Yap1p dependent manner;
                     GFP-fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="KLTH0C07590p"
                     /protein_id="XP_002552553.1"
                     /db_xref="GeneID:8291425"
                     /db_xref="GOA:C5DEA4"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5DEA4"
                     /translation="MSKVAIIIYTLYGHTAELAEAQKRGVEAAGGEADIYQVPETLSD
                     DVIKALGGQRKPSYPIASRETLEEYNFFLFGIPTRFGNFPAQWKAFWDATGGLWAKGA
                     LHGKVAGVFVSTGTGGGNETTVVNSLSVLAHHGIIYVPLGYKFAGAALSNLTEIHGGS
                     PWGAGSIAGADGSRQPSALELEVNEFQGKTFFETAKRFGAPEATV"
     gene            complement(<653652..>653987)
                     /locus_tag="KLTH0C07612g"
                     /db_xref="GeneID:8291426"
     mRNA            complement(<653652..>653987)
                     /locus_tag="KLTH0C07612g"
                     /product="KLTH0C07612p"
                     /transcript_id="XM_002552508.1"
                     /db_xref="GeneID:8291426"
     CDS             complement(653652..653987)
                     /locus_tag="KLTH0C07612g"
                     /note="highly similar to uniprot|Q07789 Saccharomyces
                     cerevisiae YDR031W Hypothetical"
                     /codon_start=1
                     /product="KLTH0C07612p"
                     /protein_id="XP_002552554.1"
                     /db_xref="GeneID:8291426"
                     /db_xref="GOA:C5DEA5"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="InterPro:IPR016611"
                     /db_xref="UniProtKB/TrEMBL:C5DEA5"
                     /translation="MSNALDQFIMEDVAKNCPQQFVEYHKCISKNKDDPGQCAFRQRD
                     LSVCIKQKVPSVQKVMAKCGQLMQKYETCVRDNMETRTINENCLGLLQEMRTCAEKQV
                     QGPSPINQL"
     gene            <654087..>655364
                     /locus_tag="KLTH0C07634g"
                     /db_xref="GeneID:8291427"
     mRNA            <654087..>655364
                     /locus_tag="KLTH0C07634g"
                     /product="KLTH0C07634p"
                     /transcript_id="XM_002552509.1"
                     /db_xref="GeneID:8291427"
     CDS             654087..655364
                     /locus_tag="KLTH0C07634g"
                     /note="weakly similar to uniprot|Q12021 Saccharomyces
                     cerevisiae YDR030C RAD28 Protein involved in
                     transcription-coupled repair nucleotide excision repair of
                     UV-induced DNA lesions homolog of human CSA protein"
                     /codon_start=1
                     /product="KLTH0C07634p"
                     /protein_id="XP_002552555.1"
                     /db_xref="GeneID:8291427"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DEA6"
                     /translation="MNRTQLQWQLGKLDNRRLYDLVLCSELEKLRDAKPIVYSHRKAS
                     FPIGTTSLDFDSTGQFLLSSGEDGSLALWALDEGHSEGKLVNKRIQFAAGESKESVNP
                     SSRRVHVTARSPGGKAPRFLTSVESRPPDSLQGPREASHAFSVTSVKWYGPDNGLFFT
                     GSNDHKVKIWDTNTFQVASSIDIAHRVAQLDTLGDLLAVASEDSHPRLIDLRSMSAAI
                     SLGVKRSDMRHGINAAKFSHTSSGAKPLLLATGDDDGNVRVWDLRMGNRWLCDLTEAD
                     TLSKSHARCCNDLCWDPSGSLKLVTTGNDGKCKMWDLHEGGAKPQLVRQLGATDLTSN
                     RFRRRTSHYLMWQGPYVFFNSDHGEILVYQSHSGLLWHAFEYPLRVAQPERLRSTPKL
                     QSMAIQTRLANTLGVRLVLGTDNTHGRILEYRV"
     gene            <656693..>659254
                     /locus_tag="KLTH0C07656g"
                     /db_xref="GeneID:8291428"
     mRNA            <656693..>659254
                     /locus_tag="KLTH0C07656g"
                     /product="KLTH0C07656p"
                     /transcript_id="XM_002552510.1"
                     /db_xref="GeneID:8291428"
     CDS             656693..659254
                     /locus_tag="KLTH0C07656g"
                     /note="similar to uniprot|Q00816 Saccharomyces cerevisiae
                     YDR028C REG1 Regulatory subunit of type 1 protein
                     phosphatase Glc7p involved in negative regulation of
                     glucose-repressible genes involved in RNA processing"
                     /codon_start=1
                     /product="KLTH0C07656p"
                     /protein_id="XP_002552556.1"
                     /db_xref="GeneID:8291428"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C5DEA7"
                     /translation="MSNNLATYFNKQAGRSSTTSGASPGDDDDMGPSVSMAVEAEDDD
                     HFTRSTFNLKRTRSMGLLDDYVGSSKKDEGSEADSEEAAEESDFEDDDNVNENAGSSA
                     LRSATPGLSESASPPVPETDNYLIPHDDNDLVHEPKRHVDYLSHQWDEGEISQSWKYI
                     ILKKKKKDEDLVNAARLENASWRTWAKARNHLQTVSPEVVNWSKDSDVTWLYGPVVRQ
                     KTDPGASSDQEFGYGSDDETSKRVRTSKNKKRGPKPILKKRSVSEILEENSLWRLNVA
                     RQHKKILSSTQDMVDGYGDTMYAPEDYDALAAKVNAQYYSSNPSAYSQGNASEPLHED
                     PGVESSVGPPSERPQSQASTLESIMTSTSKKTPKGATEQKDRHIHFNDRVEQCMAVAF
                     HSDDDNDFDDSADDSDGERSAHHEYPLTRNRTRGASDDSDYIRESYSDEDMNSSSSDE
                     DEAGLFINARYSRKTDGSRSPSTRSSIGSESALSKENLTPIIKLLPATTLNYGSDEEE
                     FDDDDEYYGNNAVSHNVNTFRGYDYMYDYNSVYTGDTSSFMAVNSCDMVDVPEGLQTP
                     IEGQGDHADMLVNPNSSPQLPSDAGKGGFSLDSDTDSYGSDGDAQFIEDSQNKDSDDE
                     LSSMPGLRRVPSHGKSSTTLIQDLRLQPAAIPTTHSFITGKPLRQTEQPWDTVKSKPV
                     PKTRSFVLDSDSDSDTSDKSESGSENSDINKTSLQAGDTPAANSSGADSKPAYSVPTH
                     ATIVSPVPKGQRITSSSPVNIACSGDSGTSLSDVAIAGYISPRSDSMQSVVAKENMVN
                     NKSSNSEVDRMNKNLENWHIDPQKDDADDASSENVQKMMSSAREIASKYLHSWKK"
     gene            <659489..>662236
                     /locus_tag="KLTH0C07678g"
                     /db_xref="GeneID:8291429"
     mRNA            <659489..>662236
                     /locus_tag="KLTH0C07678g"
                     /product="KLTH0C07678p"
                     /transcript_id="XM_002552511.1"
                     /db_xref="GeneID:8291429"
     CDS             659489..662236
                     /locus_tag="KLTH0C07678g"
                     /note="similar to uniprot|Q12071 Saccharomyces cerevisiae
                     YDR027C VPS54 Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /codon_start=1
                     /product="KLTH0C07678p"
                     /protein_id="XP_002552557.1"
                     /db_xref="GeneID:8291429"
                     /db_xref="InterPro:IPR019515"
                     /db_xref="UniProtKB/TrEMBL:C5DEA8"
                     /translation="MFENSDGNQVLRKPLKLTVGPNMSKGSSPPNTESNGHPERTLPS
                     IRTANNSGKEVAMSPSPMADDSGSLNDDLVSVYSSANRTEKFLFSSGRLSVDSASVRR
                     SFDSSSVWGKQGRLYAPGSEIHSGSMEFSPLGNNSIYELVMNTRRKNWLRHPTTDEIP
                     PVVLSKVHIPESWRESTSVYVDEIKPSYETFERTNNLETIKGFGRLQLDEIGRDGELS
                     NGQNEPENGQFVRQGNKGALDTVPQFYFDENFKLDDSHTFREIIDDIDLQLDHLYSES
                     STDRESFYQEIEERLSSYLDCIETLLVTEISRSSNSFFFALEDVEKIESKAASAVEKL
                     SKLSQKLKEADSEQVQSRISILKKMIRRKNVEKLEQGLLQAKLILQLVENCKNLYNKR
                     KFEDCLDMIGHVNNMLKGDDDNDPYVQDLTRKWPYKLSDLDSAAAFASTKEYLANALI
                     EIGGSYSIDLSDVLLNDIRSTYNPANEIQGMGLKDTSSSFSKKDTEKDTTLAQTIKPL
                     ITNLIRCEELASSFELYSERFIAELKGIIKEFLPKSQESDGSAADRSTDSKAPGSGSK
                     LSRLLRDMTPSEFQQMVITIFAREVQAFWRLSRHQKILLDVGLGAITTKQGSGDSALS
                     NAVQLDINPAFHEGIRTVQLRMGKIIAVRRDLSCKLRYDHFLELCGICFWFDRECETI
                     TGEFLTKYLRDVMTMQIKNYIASLNSKNLQTIRHGIDEEKWTPFIVDSDVQRDVNDIV
                     ACGHMSPSKWLSFMDLSIKPPEEAEPESSSGTSKGHKKSVVVNDKTFVASNALLTTIG
                     MLKGVLVLAVNLPTQFLSITEKMCYDLIMYFNGRAMASVCGPDGTPSTKNGKNLSILG
                     ESLDCLAEFAVIVQSIYQRLGSGSKDFEPLSPSAYSKLLQTFQTSSDKLYQAHAPPPP
                     V"
     gene            <663191..>663970
                     /locus_tag="KLTH0C07700g"
                     /db_xref="GeneID:8291430"
     mRNA            <663191..>663970
                     /locus_tag="KLTH0C07700g"
                     /product="KLTH0C07700p"
                     /transcript_id="XM_002552512.1"
                     /db_xref="GeneID:8291430"
     CDS             663191..663970
                     /locus_tag="KLTH0C07700g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C07700p"
                     /protein_id="XP_002552558.1"
                     /db_xref="GeneID:8291430"
                     /db_xref="InterPro:IPR015315"
                     /db_xref="UniProtKB/TrEMBL:C5DEA9"
                     /translation="MKQDIELPAFFEDYRAALGETIKECVHVNTERASTGTFDSKFGG
                     HPYFPKGEMYPVDEKGKPMRLLAQINFEQVPHIRNYPKAGILQFYLSRFDKHYGCSFG
                     RSIEQKNYRVIFFDNIETDESKLLSDFSFANADEELFPIKSEGKLTFTKDTQIITAND
                     FRFAPLFGAEDIEEHDDELEQYFEMYDPFSHLIGGYPNFVQYDPREYHHPELTELLLQ
                     VESDNTLDIMWGDCGVANFFISLKDVKNKNFSKVLYNWDCS"
     gene            <664219..>665022
                     /locus_tag="KLTH0C07722g"
                     /db_xref="GeneID:8291431"
     mRNA            <664219..>665022
                     /locus_tag="KLTH0C07722g"
                     /product="KLTH0C07722p"
                     /transcript_id="XM_002552513.1"
                     /db_xref="GeneID:8291431"
     CDS             664219..665022
                     /locus_tag="KLTH0C07722g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C07722p"
                     /protein_id="XP_002552559.1"
                     /db_xref="GeneID:8291431"
                     /db_xref="InterPro:IPR015315"
                     /db_xref="UniProtKB/TrEMBL:C5DEB0"
                     /translation="MIATLGPNMKENFELPEYFEKHRAVLKDTIKECVDIHAEKASTG
                     TLDSKFGGCPYFPKGMAYPLNQEGNPLKLLAQINFEQVPRLNNYPEKGILQFFLDPCD
                     ELYGCSFDENTEQKNFRIIYHEEIETDESKLLSDFSFVKVEEEMFPIESEAKLIFTKG
                     TQIMPAGDFRFDSLIGADDKYEHYAELERYYELYGSLSHKIGGYPGFTQFDPREHYHK
                     DRTELLLQVDSDDAIDIIWGDCGVANFFISEEDLKNKDFSKVLYNWDCS"
     gene            <665986..>666552
                     /locus_tag="KLTH0C07744g"
                     /db_xref="GeneID:8291432"
     mRNA            <665986..>666552
                     /locus_tag="KLTH0C07744g"
                     /product="KLTH0C07744p"
                     /transcript_id="XM_002552514.1"
                     /db_xref="GeneID:8291432"
     CDS             665986..666552
                     /locus_tag="KLTH0C07744g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C07744p"
                     /protein_id="XP_002552560.1"
                     /db_xref="GeneID:8291432"
                     /db_xref="UniProtKB/TrEMBL:C5DEB1"
                     /translation="MPPGFARVPTRHERNPNEIADPDQFWPNARAAGPSKVRLAILPV
                     CRRRAAWSELQRANFTEKPPRILIRGPFGDESQLVTDFSFVPLNNSSFPLQVEAQLNF
                     PGGNEVVQSPASGQTDLRKARTSPLELPPARPLLCHKIGSSSSFAQYDLRPNGYAVFE
                     PEDESVKNYLNYTYLLLQVYSSDDIACC"
     gene            <667271..>667798
                     /locus_tag="KLTH0C07766g"
                     /db_xref="GeneID:8291433"
     mRNA            <667271..>667798
                     /locus_tag="KLTH0C07766g"
                     /product="KLTH0C07766p"
                     /transcript_id="XM_002552515.1"
                     /db_xref="GeneID:8291433"
     CDS             667271..667798
                     /locus_tag="KLTH0C07766g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C07766p"
                     /protein_id="XP_002552561.1"
                     /db_xref="GeneID:8291433"
                     /db_xref="UniProtKB/TrEMBL:C5DEB2"
                     /translation="MVIYVSVEDITQEDVYDFLETELEQLNEDTERFVTGGLVHEDSY
                     TTAYDAMLIARTRALGKISDEAADPECGADTPAQEITDVDQSSDPAVPSPSSMLAKAH
                     KRALKHTERDEMDRAIAAGALAYLHNLAKQGFLLREGGPASFLLGYVWVAPGLPGGPG
                     AAPEKSGPAESGGAE"
     gene            <668801..>670873
                     /locus_tag="KLTH0C07788g"
                     /db_xref="GeneID:8291434"
     mRNA            <668801..>670873
                     /locus_tag="KLTH0C07788g"
                     /product="KLTH0C07788p"
                     /transcript_id="XM_002552516.1"
                     /db_xref="GeneID:8291434"
     CDS             668801..670873
                     /locus_tag="KLTH0C07788g"
                     /note="some similarities with uniprot|Q12457 Saccharomyces
                     cerevisiae YDR026C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C07788p"
                     /protein_id="XP_002552562.1"
                     /db_xref="GeneID:8291434"
                     /db_xref="GOA:C5DEB3"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5DEB3"
                     /translation="MSDGRADQESVEEAVFKYVGVDLQGGKHDEGHPHELEAAENKRQ
                     AQARLAHVARDARARAQAQVQAQAQAQARAQAQTQSQVRAGAGSSTGGQDQHGQGQDH
                     DQDQHGQGQDANPVQDQDQDPDQDQDQAAGSADMEWFLRHELGASPSDLDMRGAREPQ
                     SVAAAAVAAAFAASQDNKRPRNEDDNGSGRNAASNVSGPRQHHGNKRFKVPDARLAGS
                     RVQSKMPHLGAVDPELASLDDPEDVTEHEQLVRKAILDADSIAHHPDFQHYLNTEDDS
                     DDKAQRMSLLSSKGSTVVLGGIHDHGRKIEVLPKVAGRNSVSGVDSHSGSSPGSGSGP
                     GAGLAARSMGRIPSGMTLGAGAGAGAHSEQDISNMIQDAATKASDFISAQNQSTGKSF
                     DAVEEQALEHFVGDYQAIKNLSRRQICERIWSNERRKDDFWTNICKVLPYRTRSSVYK
                     HVRRKYHIFEQRGKWTPEEDQELAQLCMEKEGQWSEIGKTLGRMPEDCRDRWRNYVKC
                     GNNRASNKWSPQEEEHLKQVISELLDSVEPQDDQSYDTDEVHMDGKAKAGKKKKQDSK
                     DTINWTVVSERMGGTRSRIQCRYKWNKLLKKQAMSKIKSISEDDKTWILEKLRDMGFT
                     EDSQVDWDELATLMPGRQWSGTELKLCYEKLRTGVKYYKDRTINQICKELIGARDEGL
                     PLESESKL"
     gene            complement(<671112..>671883)
                     /locus_tag="KLTH0C07810g"
                     /db_xref="GeneID:8291435"
     mRNA            complement(join(<671112..671537,671839..>671883))
                     /locus_tag="KLTH0C07810g"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_002552517.1"
                     /db_xref="GeneID:8291435"
     CDS             complement(join(671112..671537,671839..671883))
                     /locus_tag="KLTH0C07810g"
                     /note="highly similar to uniprot|P26781 Saccharomyces
                     cerevisiae YDR025w RPS18A or uniprot|P26781 Saccharomyces
                     cerevisiae YBR048w RPS18B ribosomal protein"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_002552563.1"
                     /db_xref="GeneID:8291435"
                     /db_xref="GOA:C5DEB4"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR028333"
                     /db_xref="UniProtKB/TrEMBL:C5DEB4"
                     /translation="MSTELTVQAERAFQKQPHIFTNPKTKANRRTKRWYKNVGLGFKT
                     PKTAIEGSYIDKKCPFTGNVSIRGKILSGVVVSAKMHRTIVIRRDYLHYVPKYNRYEK
                     RHKNVPAHVSPAFRVEVGDVVTVGQCRPISKTVRFNVLKVTSTAGQANKQFSKF"
     gene            complement(<672626..>673165)
                     /locus_tag="KLTH0C07832g"
                     /db_xref="GeneID:8291436"
     mRNA            complement(<672626..>673165)
                     /locus_tag="KLTH0C07832g"
                     /product="KLTH0C07832p"
                     /transcript_id="XM_002552518.1"
                     /db_xref="GeneID:8291436"
     CDS             complement(672626..673165)
                     /locus_tag="KLTH0C07832g"
                     /note="similar to uniprot|P38231 Saccharomyces cerevisiae
                     YBR047W FMP23"
                     /codon_start=1
                     /product="KLTH0C07832p"
                     /protein_id="XP_002552564.1"
                     /db_xref="GeneID:8291436"
                     /db_xref="UniProtKB/TrEMBL:C5DEB5"
                     /translation="MFSRRLSSRFLCTSARLGSQAVSNRVIVPPASHFQQRTAASAKL
                     AKKEYRQLPENCGYIENFYNELEQFSNDFLTSQLNKSYSDFDDCPEDLVFEIDKYIET
                     RIIPRHSVSSAAKQDARGARPPIVCETVSDKLVIERFLDFSNGVKLTLRMNGGYTFIF
                     DVMLQGKAAFDQFEAVRKC"
     gene            <673945..>675021
                     /locus_tag="KLTH0C07854g"
                     /db_xref="GeneID:8291437"
     mRNA            <673945..>675021
                     /locus_tag="KLTH0C07854g"
                     /product="KLTH0C07854p"
                     /transcript_id="XM_002552519.1"
                     /db_xref="GeneID:8291437"
     CDS             673945..675021
                     /locus_tag="KLTH0C07854g"
                     /note="similar to uniprot|P38230 Saccharomyces cerevisiae
                     YBR046C ZTA1 Zeta-crystallin homolog"
                     /codon_start=1
                     /product="KLTH0C07854p"
                     /protein_id="XP_002552565.1"
                     /db_xref="GeneID:8291437"
                     /db_xref="GOA:C5DEB6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DEB6"
                     /translation="MIARLTGSYLPTRSISRLVEKVKMTPIPAVQKAVLIRETGGLDV
                     LRYEQDFPVPKIGNNEILIKNKYAGINYIESYFRKGIYPSKKPYVLGREASGVVVAKG
                     DAVTKFDVNDKVAYLSSNTFAQYTKISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSL
                     AFVREAYPVKKGDYILLYAAAGGAGLAFNQFLKKAGAHTIAVASTDEKLQLAKEYGAE
                     FLINSSKDDVLARVLEITNGQGVEAAFDSVGKDTFETSLKALKRKGTLVSFGNASGPV
                     PPVAINILTPKNIKLLRPSLFGYIATHEEWESYSSELFDLLHSGALKILISKTYPLEE
                     YNQAAEQLESRKTVGKLMLEISQD"
     gene            <675193..>676974
                     /locus_tag="KLTH0C07876g"
                     /db_xref="GeneID:8291438"
     mRNA            <675193..>676974
                     /locus_tag="KLTH0C07876g"
                     /product="KLTH0C07876p"
                     /transcript_id="XM_002552520.1"
                     /db_xref="GeneID:8291438"
     CDS             675193..676974
                     /locus_tag="KLTH0C07876g"
                     /note="similar to uniprot|P32833 Saccharomyces cerevisiae
                     YBR060C ORC2 Subunit of the origin recognition complex"
                     /codon_start=1
                     /product="KLTH0C07876p"
                     /protein_id="XP_002552566.1"
                     /db_xref="GeneID:8291438"
                     /db_xref="UniProtKB/TrEMBL:C5DEB7"
                     /translation="MAVRTIGPHQPLSTNCSSDVKRQEEKQAGSKRKQFRKWLHSLKE
                     HAPSPDYRDEETVLIDIADSYLGFLDPLSYVPVLTTGEAAMLDCEKQSPSRTHSKRLR
                     EFLREHLKRRPSTHKDGRALQSRDQGPESSLNMSCSEANEAVVGDSPSQLDRPVCENE
                     FTILKSEAVEGLAPIKQEDDSQGSRSADGLKEPCFILQQDEDAGQNSLKRTSDSPLAD
                     NSTESKRTCFEREPERNDDGFIDESSSVYSDVPSPEASICKTPPAVLTKPCEGNVTPS
                     RGAGDDSNSAPLEDKLYVVIEKLKAAVHPRSSGSAKFEPADCSASSDKIASPVYEPTF
                     IRVPTFRQSLRRMHARGLLEDVRNGTIKEEDLLKLAKREPESFNFRDAKFFEKDSEAS
                     GSSESSKSLESSRFYSVKFDKFSHLLMYDATKRFHSDRWGTLRSANLSTGSKGKAKPC
                     PLLENAVYSKESIRSRKPILKCKSNTRAEVESLRAEDCDKVDVFAFLKFFEHHEAQRR
                     SEELSLSRIREQQLTNYYANDHVYNSARSGSLKFAAVDFNRSKKATEINIGRELRGPD
                     RRISSCPSMRDWDLGRKRRGDVSQHCY"
     gene            complement(<677089..>678474)
                     /locus_tag="KLTH0C07898g"
                     /db_xref="GeneID:8291439"
     mRNA            complement(<677089..>678474)
                     /locus_tag="KLTH0C07898g"
                     /product="KLTH0C07898p"
                     /transcript_id="XM_002552521.1"
                     /db_xref="GeneID:8291439"
     CDS             complement(677089..678474)
                     /locus_tag="KLTH0C07898g"
                     /note="highly similar to uniprot|P07284 Saccharomyces
                     cerevisiae YDR023W SES1 seryl-tRNA synthetase"
                     /codon_start=1
                     /product="KLTH0C07898p"
                     /protein_id="XP_002552567.1"
                     /db_xref="GeneID:8291439"
                     /db_xref="GOA:C5DEB8"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:C5DEB8"
                     /translation="MLDITQFIEEKGGNPELIRQSQKARHASVEIVDEIIADYKEWVK
                     TRFQLDELNKQQNKVQKEIGLKFKNKEDPKELLAEKDRIAAEKKKLSELEQKQDNDLK
                     QKVFQVGNIVHPSVVVSNDEENNELVRSWKPENLSEVGTNASCSGKPASLSHHEVLLR
                     LDGYDPERGVKISGHRGYFFRNYGVFLNQAMINYGLSFLASKGYIPLQAPVMMDKEAM
                     SKTAQLSEFDEELYKVMDGDDEKYLIATSEQPISAYHSGEWFEKPQEQLPVRYAGYSS
                     CFRREAGAHGKDAWGVFRVHAFEKIEQFVLTEPEKSWEEFDRMIATSEEFYQSLNLPY
                     RVVGIVSGELNNAAAKKYDLEAWFPYQQEYKELVSCSNCTDYQSRNLEIRCGIKKMGD
                     REKKYVHCLNSTLCATQRALCCVLENYQTEEGLVVPEVLRKYIPGEPEFIPFTKELPK
                     NSTSNKKKGNN"
     gene            679131..679204
                     /locus_tag="KLTH0C07920r"
                     /db_xref="GeneID:8291440"
     tRNA            679131..679204
                     /locus_tag="KLTH0C07920r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (TAC) cove score=73.15"
                     /db_xref="GeneID:8291440"
     gene            <679383..>679820
                     /locus_tag="KLTH0C07942g"
                     /db_xref="GeneID:8291441"
     mRNA            <679383..>679820
                     /locus_tag="KLTH0C07942g"
                     /product="KLTH0C07942p"
                     /transcript_id="XM_002552522.1"
                     /db_xref="GeneID:8291441"
     CDS             679383..679820
                     /locus_tag="KLTH0C07942g"
                     /note="weakly similar to uniprot|Q03939 Saccharomyces
                     cerevisiae YDR022C CIS1 Protein involved in microtubule
                     assembly"
                     /codon_start=1
                     /product="KLTH0C07942p"
                     /protein_id="XP_002552568.1"
                     /db_xref="GeneID:8291441"
                     /db_xref="GOA:C5DEB9"
                     /db_xref="InterPro:IPR018621"
                     /db_xref="PDB:4HPQ"
                     /db_xref="PDB:4P1W"
                     /db_xref="UniProtKB/TrEMBL:C5DEB9"
                     /translation="MSSEANPPVLEPFTVTVVDRNVKHQVEGEPEEEGHPDHEVQGVM
                     FATNVKYIFEDDQELLPEQEDPAIENVVIIEADESLRVTQVELISDQFKQVGYEVRDG
                     NEVCIDALSRFETPRQLGNLPLEKLVQLYKLQNDQLHSLFNTL"
     gene            complement(<679877..>681073)
                     /locus_tag="KLTH0C07964g"
                     /db_xref="GeneID:8291442"
     mRNA            complement(<679877..>681073)
                     /locus_tag="KLTH0C07964g"
                     /product="KLTH0C07964p"
                     /transcript_id="XM_002552523.1"
                     /db_xref="GeneID:8291442"
     CDS             complement(679877..681073)
                     /locus_tag="KLTH0C07964g"
                     /note="highly similar to uniprot|Q12099 Saccharomyces
                     cerevisiae YDR021W FAL1 Nucleolar protein required for
                     maturation of 18S rRNA member of the eIF4A subfamily of
                     DEAD-box ATP-dependent RNA helicases"
                     /codon_start=1
                     /product="KLTH0C07964p"
                     /protein_id="XP_002552569.1"
                     /db_xref="GeneID:8291442"
                     /db_xref="GOA:C5DEC0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEC0"
                     /translation="MSFSKDSDSKLKFKTSGKLKVSPTFESMHLKEDLLRGVYAYGFE
                     APSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGMLQVIDFKSRELQSLVLSPTRE
                     LAKQISQVVGNLGDYMNISAHACTGGKAMQTDTKKLTHGCHVVSGTPGRVLDMIKRRI
                     LNTRHLKMLILDEADELLSETLGFKQQIYDIFAKLPKSVQVVVVSATMSKDILEITKK
                     FMSDPVKILVKRDEISLEGIKQYHVNVDREEWKFDTLCDLYDSLTITQCVIFCNTKKV
                     VDWLSSKLLQANFAVASMHGDMKQEDRDRVMNDFRSGTSRVLISTDVWARGIDVQQVS
                     LVINYDLPDNLENYIHRIGRSGRFGRKGVAINFITRDDAQGLKAIEKHYSVKIRPMPA
                     NLAELS"
     gene            <681249..>681878
                     /locus_tag="KLTH0C07986g"
                     /db_xref="GeneID:8291443"
     mRNA            <681249..>681878
                     /locus_tag="KLTH0C07986g"
                     /product="KLTH0C07986p"
                     /transcript_id="XM_002552524.1"
                     /db_xref="GeneID:8291443"
     CDS             681249..681878
                     /locus_tag="KLTH0C07986g"
                     /note="similar to uniprot|Q12084 Saccharomyces cerevisiae
                     YDR020C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C07986p"
                     /protein_id="XP_002552570.1"
                     /db_xref="GeneID:8291443"
                     /db_xref="GOA:C5DEC1"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEC1"
                     /translation="MPRIIVSIGGGHLTDIHKAILQIKDALLEAFVNTEVVLVDLDKS
                     LKKGPLTHTDQDYDFKQVSARLCSAQDPNVWEAVLVCGAYALFDPTINELCHLKVFLD
                     SDGDRRLIDLINRRSAKTPELLAALIKDYMENLRPEMHKYIEPTKAHADLIIPNSSEN
                     VGPAIIVDSIVKIVEDSKGGIVRPRKLFPHLDFQAESLDIEKEKYYDLS"
     gene            <682247..>683920
                     /locus_tag="KLTH0C08008g"
                     /db_xref="GeneID:8291444"
     mRNA            <682247..>683920
                     /locus_tag="KLTH0C08008g"
                     /product="KLTH0C08008p"
                     /transcript_id="XM_002552525.1"
                     /db_xref="GeneID:8291444"
     CDS             682247..683920
                     /locus_tag="KLTH0C08008g"
                     /note="similar to uniprot|P38228 Saccharomyces cerevisiae
                     YBR044C TCM62 mitochondrial protein (putative) chaperone"
                     /codon_start=1
                     /product="KLTH0C08008p"
                     /protein_id="XP_002552571.1"
                     /db_xref="GeneID:8291444"
                     /db_xref="GOA:C5DEC2"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="UniProtKB/TrEMBL:C5DEC2"
                     /translation="MLKKAQWLCSRTVKTLHTPIYNASNLATRQSLLTYIAILEKVVH
                     SASYSRSVLYAGKYKKLPQAISGNDTVRMNYMLKELLTSLQLSEAENPEQQRDPSRKL
                     GKIGLQLFMACQQDNITALGTGLTKRLVECYNRYPSQDMAASIETSLSRVREFLKQNK
                     LIIKDRGDIDQLVSKLASSEEDASTIQKVLLELNYELVSDEVIRVVRGRRTEDEIEVS
                     KGWKFPSGLLDSNEPYKRSLQLSKNKLVAVNSESLVLVHDGTLREADKILPSLHYASK
                     QQKSLVIVVNGDCIGDALAAITIHNNKCRRQGVPSQAIVLRYIARDHQGVELQENIDF
                     LSFLKLPQGVGSVYSPEFSEHVPSTASAALFFGSLESLKATTGEAFLYNTQVGGQEIR
                     NDALRTTVTLHVGGHSELEIDHRRAQLDHIMNNILCHGLAHGWVPSQGVALAKSVAVL
                     QSGDSRSARSPGADVLTESLTLPLESAVTNLYAAHRFEASRLTAETIADPSFTTAYLP
                     EKCSTVERGVVEPWSNIDKILAGVASFVKLAASCDVLVTRFFDKPKKND"
     gene            <684324..>685493
                     /locus_tag="KLTH0C08030g"
                     /db_xref="GeneID:8291445"
     mRNA            <684324..>685493
                     /locus_tag="KLTH0C08030g"
                     /product="KLTH0C08030p"
                     /transcript_id="XM_002552526.1"
                     /db_xref="GeneID:8291445"
     CDS             684324..685493
                     /locus_tag="KLTH0C08030g"
                     /note="similar to uniprot|P48015 Saccharomyces cerevisiae
                     YDR019C (GCV1)"
                     /codon_start=1
                     /product="KLTH0C08030p"
                     /protein_id="XP_002552572.1"
                     /db_xref="GeneID:8291445"
                     /db_xref="GOA:C5DEC3"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:C5DEC3"
                     /translation="MIFKRLSSSAALKKTALYDLHVQLGGTMVPFAGYAMPVKYAGQT
                     HVESHIWTRTHAGLFDVSHMLQSRLEGPGATQFLHRVTPTDFQALPAGQGTLSVLLNA
                     RGGIVDDTLITKVADNKFSIVTNAGRAKEDIAFLNEQVQGFECRWEPVRDRALLALQG
                     PEAKHVLGSLVAGGLQSLQDLYFGQRRSFRAGTGVEIDVARSGYTGEDGFEVSVANSD
                     ATDLARMMLENSAVRAIGLAARDSLRLEAGMCLYGHELDEDTTPVEASLNWLISKSRR
                     DGSLGEFNGFSHIMGQIANKSATRARVGFKYLGKGPAARTDAPVFSDEGKTQVGHVTS
                     GSAAPSLAGINIGQAYVQKGLHKAGTQLFVGVRNKIFPIQIARMPLVPSHYYKSN"
     gene            <685805..>687604
                     /locus_tag="KLTH0C08052g"
                     /db_xref="GeneID:8291446"
     mRNA            <685805..>687604
                     /locus_tag="KLTH0C08052g"
                     /product="KLTH0C08052p"
                     /transcript_id="XM_002552527.1"
                     /db_xref="GeneID:8291446"
     CDS             685805..687604
                     /locus_tag="KLTH0C08052g"
                     /note="similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
                     YPL274W SAM3 High-affinity S-adenosylmethionine permease,
                     required for utilization of S-adenosylmethionine as a
                     sulfur source; has similarity to S-methylmethionine
                     permease Mmp1p"
                     /codon_start=1
                     /product="KLTH0C08052p"
                     /protein_id="XP_002552573.1"
                     /db_xref="GeneID:8291446"
                     /db_xref="GOA:C5DEC4"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DEC4"
                     /translation="MDKEAKQTISEHTLESVDTKAWHGESSKTLGSRLTRPFQRKQMS
                     SRMNRITQSFRRQDAVEYADVDLSMMDEQQRRNYVLANQPLQKTLSQRHLMMIAIGGT
                     LGTGLFIGIGYSLSSGPGSLLIGFLIVGLMMFCVVQSAAELACQYPVSGSYAVHVSRF
                     MEPSIGFTVATNYALAWLISFPSELIGCAMTLQYWNKSVNPAVWVAIFYVFIMSLNMF
                     GVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIGTKYWHDPGSFAKPVF
                     KGLCNTFVSAAFSFGGAELVVLTASESRKVESVSRAAKGTFWRIAIFYITTVIVIGCL
                     VPYTNEQLLGGDNDEDITASPFVIALSGQGSMGTKASHFMNTVILIAVLSVCNSAVYA
                     SSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVFGLLGFLVASDNEGDVFTWLFA
                     LCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSMLGIYGGFLGCLLNALLIAG
                     EIYVSIFPLGGDPSAKQFFQYCLSIPIMIAVYIGHKLFANKSKRVLIPAQEIDLETGR
                     KIKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC"
     gene            <688367..>690295
                     /locus_tag="KLTH0C08074g"
                     /db_xref="GeneID:8291447"
     mRNA            <688367..>690295
                     /locus_tag="KLTH0C08074g"
                     /product="KLTH0C08074p"
                     /transcript_id="XM_002552528.1"
                     /db_xref="GeneID:8291447"
     CDS             688367..690295
                     /locus_tag="KLTH0C08074g"
                     /note="similar to uniprot|P38227 Saccharomyces cerevisiae
                     YBR043C QDR3 Multidrug transporter required for resistance
                     to quinidine barban cisplatin and bleomycin member of the
                     major facilitator superfamily of transporters conferring
                     multiple drug resistance (MFS- MDR)"
                     /codon_start=1
                     /product="KLTH0C08074p"
                     /protein_id="XP_002552574.1"
                     /db_xref="GeneID:8291447"
                     /db_xref="GOA:C5DEC5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DEC5"
                     /translation="MMSGVQRAEQDADDLSLHTNSSLETSVGDEIGRPQTLHHNELST
                     SGTHLSKKSTLRDKSLMVPRKQRRGILANLSVVPEYKDARNYPGKLKAGIIFLIAYAA
                     MMGPMGTSIIYPSINPISEDYKTTTMMVNVSVGIYLLSLGVLPLWWSSLSELRGRRTV
                     YVLSFSLLCAFCVGSALAPNIQAFIVFRMLCGACSASVQSVGAGTVADLFKPEDRGKM
                     LGYYYLGALMAPLLAPIIGSLLVSRWSWRSTQWFMVILAGVNVLLLTLLLPETLRSQD
                     SKSAIAAILAERRNGAKAAAGATTDSASDASNAIKDKDEPEASNYDAEVQRVYSRASE
                     AAQYPRDEEEHFGDTMVAQITRVQTRDPKLEMRMREGELKRWKTNLENELDRMETEKT
                     SDKAEVLDLPKRSWSTTLYIYLIKPLKSLHFLRYPPVTLAITFSAISFAILYFVNMTL
                     EYSYSRSPYNFKPLYVGLLYIPNSVTYVIASIYGGKWVDNLLRQYKKKHGTLAPEARI
                     SWNVVTAVVTFPISLLIFGWCLDKKQHWVTPLVGTALFGYASMMTIGATVAYLVDSLP
                     GRGATGVALNNLIRQAFAATAVFVTEPMLEGMGPGWAFTMLAFIVIGASSVLVVLKMK
                     GDYWRENYDLQKLYDKLD"
     gene            <690559..>691761
                     /locus_tag="KLTH0C08096g"
                     /db_xref="GeneID:8291448"
     mRNA            <690559..>691761
                     /locus_tag="KLTH0C08096g"
                     /product="KLTH0C08096p"
                     /transcript_id="XM_002552529.1"
                     /db_xref="GeneID:8291448"
     CDS             690559..691761
                     /locus_tag="KLTH0C08096g"
                     /note="similar to uniprot|P38226 Saccharomyces cerevisiae
                     YBR042C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C08096p"
                     /protein_id="XP_002552575.1"
                     /db_xref="GeneID:8291448"
                     /db_xref="GOA:C5DEC6"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C5DEC6"
                     /translation="MSVSFLAQRAVKLLVTLASIVIFIQGAFVIVTHQVLTKTFLTHD
                     PIRMQKHLDRSKKSFIILLITILTIVAPSGVRITTDNRSIPKNTMVKDLRTGGIISSM
                     KQKSVLISNHQIYTDWVFLWWLAYTGDLAGNVYIMLKNSLAKIPIMGYGMRNYNFIFM
                     NRKWSKDRINLANHLGNLDHNARGVGRLAGKHPSLDIASGKEVWSDNGAATKDHRQIR
                     WPYTLIIFPEGTNLSANTREKSRVFSEKANLPIFNNLVLPRVTGLRFSLQELRNSCEV
                     VYDTTIGYSGVKQNEYGQDIYQLSNIFLRGHSPDLVDIYIRAFNLKDIPLDDEEEFTK
                     WLLDVWHEKDKLLDTFYAKGSFDLDPNTHQVTTGTCKIKSSEVAQFLILPLLSLAALV
                     AKILRSFC"
     gene            complement(<691865..>693877)
                     /locus_tag="KLTH0C08118g"
                     /db_xref="GeneID:8291449"
     mRNA            complement(<691865..>693877)
                     /locus_tag="KLTH0C08118g"
                     /product="KLTH0C08118p"
                     /transcript_id="XM_002552530.1"
                     /db_xref="GeneID:8291449"
     CDS             complement(691865..693877)
                     /locus_tag="KLTH0C08118g"
                     /note="similar to uniprot|P38225 Saccharomyces cerevisiae
                     YBR041W FAT1 Fatty acid transporter and very long-chain
                     fatty acyl-CoA synthetase may form a complex with Faa1p or
                     Faa4p that imports and activates exogenous fatty acids"
                     /codon_start=1
                     /product="KLTH0C08118p"
                     /protein_id="XP_002552576.1"
                     /db_xref="GeneID:8291449"
                     /db_xref="GOA:C5DEC7"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:C5DEC7"
                     /translation="MTGSTVEFVLVRTWKVILRVLSVPVVLIARLLTVCCGGWFEQLD
                     RKHRIKDDWYIIPFFFSAVFKYVWSVYRGKFQFWYMFERHVARNGNQPCISYPRPLAK
                     KGEFELETYSYRETYDIVLRLSHLLYNEYDVREGQTVALDYTNKPMFIFMWFALWNIG
                     AVPSFLNYNAIGAPLVHSIKIANVKSVFIDPQAAGPVKETEQAIRKELPDVKLHFLTE
                     EKVNNIIMNAESPQFLQDPKKRSPPYATDFQPACLIYTSGTTGLPKSAIMSWRKAVIG
                     CTLFGWVLRIKNDSTVFTAMPLYHSTAALLGVCAVFSQGGCVAISNKFSASSFWKQAC
                     MTRSTHIQYVGEICRYLLHTPVSKFESQHCVKVAYGNGLRADIWQEFRERFGIEVIGE
                     FYASTEAPFATTTFQRGDFGIGACRSYGTIINTVLSLQQTIIRVEPDDETTVYRNKKG
                     LCEVAPPGEPGEMLMKIFMPKKPEATFQGYLGNNKATKSKVLRDVFRKGDAWYRSGDL
                     LKSDEHGLWYFIDRMGDTFRWKSENVSAAEVEDQIMVFANYMMSAVAVVGIKVPNHEG
                     RAGLAVLELAPQFRNLRGDVKFLNDMLESLKKSLPKYALPTFVKFVDEIEHTDNHKIK
                     KKCYKDQVLPHGAGGDEILYWLKDSREYRPLTNSDWLEIMSGASKL"
     gene            complement(<694025..>694903)
                     /locus_tag="KLTH0C08140g"
                     /db_xref="GeneID:8291450"
     mRNA            complement(<694025..>694903)
                     /locus_tag="KLTH0C08140g"
                     /product="KLTH0C08140p"
                     /transcript_id="XM_002552531.1"
                     /db_xref="GeneID:8291450"
     CDS             complement(694025..694903)
                     /locus_tag="KLTH0C08140g"
                     /note="similar to uniprot|P38224 Saccharomyces cerevisiae
                     YBR040W FIG1 Integral membrane protein required for
                     efficient mating may participate in or regulate the low
                     affinity Ca2 influx system which affects intracellular
                     signaling and cell-cell fusion during mating"
                     /codon_start=1
                     /product="KLTH0C08140p"
                     /protein_id="XP_002552577.1"
                     /db_xref="GeneID:8291450"
                     /db_xref="InterPro:IPR016509"
                     /db_xref="UniProtKB/TrEMBL:C5DEC8"
                     /translation="MISISIIWFIVKRAPRFFALAVDIVAIFLLIFLLVGNNSTSQVS
                     TYLTSFEFDSSSPMYRIITSSFSSNNSTSDLQNVAVRAGYMGICVTGIPSTYSEKSTL
                     CYSRKNISNAPLYDDLDVKVFNIRSSNSSSTQATQLNILQLAEDSSVRLIHPYVLMAV
                     IVLTIVMFCCTLFATIPKLPGKTYLNRFLLALCPVLTLTWGIGAMWTHVAIHASSNYI
                     PHASMGILKVKMGYKASAMAWAAFAFLNVNCLILWALYFRDRRSLSNEIDRIRKPSAR
                     HAPNDQSDGSTLASKY"
     gene            complement(<695385..>696266)
                     /locus_tag="KLTH0C08162g"
                     /db_xref="GeneID:8291451"
     mRNA            complement(<695385..>696266)
                     /locus_tag="KLTH0C08162g"
                     /product="KLTH0C08162p"
                     /transcript_id="XM_002552532.1"
                     /db_xref="GeneID:8291451"
     CDS             complement(695385..696266)
                     /locus_tag="KLTH0C08162g"
                     /note="similar to uniprot|P38077 Saccharomyces cerevisiae
                     YBR039W ATP3 Gamma subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="KLTH0C08162p"
                     /protein_id="XP_002552578.1"
                     /db_xref="GeneID:8291451"
                     /db_xref="GOA:C5DEC9"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:C5DEC9"
                     /translation="MFVRSGANCARSVAGPARTFATLREIEMRLKSIKNIEKITKTMK
                     IVASTRLSKAERAKVTAREYSSAERQFYDSAETKPLEGEGEKKDLVIAVTSDKGLCGS
                     IHSQLSKAVRNYLAKTPGADVVAVGDKVKAQLLRTHSDRVKLAFNGIGKEAPTFEESS
                     LIANKILQLGGGNYSKISIFYNDPVSSLSFEPRVKPVFNETAIEQSPSFAKFEIDADS
                     KVSQDMFEFTLANQILAAMADGYAAEISARRNAMDNASKNAGDMINKYSILYNRTRQA
                     VITNELVDIITGASSLG"
     gene            <697163..>699823
                     /locus_tag="KLTH0C08184g"
                     /db_xref="GeneID:8291452"
     mRNA            <697163..>699823
                     /locus_tag="KLTH0C08184g"
                     /product="KLTH0C08184p"
                     /transcript_id="XM_002552533.1"
                     /db_xref="GeneID:8291452"
     CDS             697163..699823
                     /locus_tag="KLTH0C08184g"
                     /note="similar to uniprot|Q7LGR2 Saccharomyces cerevisiae
                     YDR017C KCS1 Inositol hexaphosphate kinase phosphorylates
                     inositol hexakisphosphate (InsP6) to diphosphoinositol
                     polyphosphates required for proper vacuole morphology and
                     involved in salt stress response contains two leucine
                     heptad repeats"
                     /codon_start=1
                     /product="KLTH0C08184p"
                     /protein_id="XP_002552579.1"
                     /db_xref="GeneID:8291452"
                     /db_xref="GOA:C5DED0"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:C5DED0"
                     /translation="MGSANEDNTRRGLSSLSTHLRDLNVFDKQKLPPVIHGRKASTYL
                     RIFQDDEHTHNREPQGAVTKPEDARAEPVSWKMPFHQTKTLLHGHVHEPRLSLGRRHS
                     FSSSDVHHKSRRGSLKERNTQPFHGYRPPRLPKKAQVGSGSQRYPLHSAEGLQLHHES
                     DTIPEGACPQLAQAQQRPHALAENSETGEVDSQGNKAKTLALKPISSATYYPHQTHNE
                     LADGTAPVTLAHSAPSVPQRTPLKTHQSQPGVPQTTRKIESRQQGSKSEDESEHDEEE
                     VYPLAVELQPFNNKVGGHTAIFRFSERAVCKALVSRENMWYENIEQQHKELLQFIPRY
                     IGVLNVRQHFNSKEEFLQEVEREKKAKIIKKQQKMDSLSVDGPSQKETRCATPPLAMK
                     NPEVVLDDNKHIIPDSLWYKYSHSPESAPSDSFLSSHSMEDRSSRGWDSGSTVVNTKL
                     QELVLKEVFAPTKRCAHARVSSLGERQLPQGSVSSNNLTSFNNDRRNSEELKQPDSTS
                     PSSPMLNKSAKVSIANAIDSHSSVLDLKQFNERKLAQIDAETKTLSQQKPDETLRSSS
                     PFHKFAEGQTDDEGVFTMEEDCPRTKEEPPNESVLFEENSHTIVSKFILLEDLTRKLD
                     KPCVLDLKMGTRQYGVSANKFKRLSQNKKCRQTTSRKLGVRICGLKIWSKDYYIKRDK
                     YFGRRVKIGWQFARVLARFLYNGEQISSIVSQIPRVISQLDKLYAEISKLKGYRLYGS
                     SLLLIYDGNGSSSKKCEVKVNLIDFAQCVTSDDVATSWDSFRIPPKSPETEDRGFLRG
                     VRSLKFYLQSLWNYLTGDSPLLFDDALNEYIQCNKESFEKPWDWLDNFDQESEFEFDD
                     AESELRKKWRKYELIFDVEPRYMDDAEISE"
     gene            <700272..>700565
                     /locus_tag="KLTH0C08206g"
                     /db_xref="GeneID:8291453"
     mRNA            <700272..>700565
                     /locus_tag="KLTH0C08206g"
                     /product="KLTH0C08206p"
                     /transcript_id="XM_002552534.1"
                     /db_xref="GeneID:8291453"
     CDS             700272..700565
                     /locus_tag="KLTH0C08206g"
                     /note="similar to uniprot|Q12248 Saccharomyces cerevisiae
                     YDR016C DAD1 Essential protein component of the DASH
                     complex involved in spindle integrity and kinetochore
                     function interacts with Duo1p and Dam1p localizes to
                     intranuclear spindles and kinetochore"
                     /codon_start=1
                     /product="KLTH0C08206p"
                     /protein_id="XP_002552580.1"
                     /db_xref="GeneID:8291453"
                     /db_xref="GOA:C5DED1"
                     /db_xref="InterPro:IPR013958"
                     /db_xref="UniProtKB/TrEMBL:C5DED1"
                     /translation="MSEKSRKGEDAAPVLSEGDKYFIEQREMILQDIGQTMDSILNNL
                     NGLNISLENFIAVGKEFENVSELWSTFYTGISGEAEAVDTVAVNEQENLAPEE"
     gene            701234..701307
                     /locus_tag="KLTH0C08228r"
                     /db_xref="GeneID:8291454"
     tRNA            701234..701307
                     /locus_tag="KLTH0C08228r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.40"
                     /db_xref="GeneID:8291454"
     gene            complement(<701335..>702309)
                     /locus_tag="KLTH0C08250g"
                     /db_xref="GeneID:8291455"
     mRNA            complement(<701335..>702309)
                     /locus_tag="KLTH0C08250g"
                     /product="KLTH0C08250p"
                     /transcript_id="XM_002552535.1"
                     /db_xref="GeneID:8291455"
     CDS             complement(701335..702309)
                     /locus_tag="KLTH0C08250g"
                     /note="some similarities with uniprot|Q03937 Saccharomyces
                     cerevisiae YDR014W-A HED1 Meiosis-specific protein that
                     down-regulates Rad51p-mediated mitotic recombination when
                     the meiotic recombination machinery is impaired"
                     /codon_start=1
                     /product="KLTH0C08250p"
                     /protein_id="XP_002552581.1"
                     /db_xref="GeneID:8291455"
                     /db_xref="UniProtKB/TrEMBL:C5DED2"
                     /translation="MSSRRSRTVGVVPHGISFAHYRPNTVHLDNLDAERSFEELQADV
                     SLEAEESSIVRVSQDSSFQQLRGGRSLTEAKVSSNNHPELKRSQTACIPLQNSEYDSG
                     YFGHDFERSLRAVDESRQTSAASISDLCEIETGLQCERSSSESDNRLSEGYVAICHVE
                     SAPCALGSAASGAHGCGIAGSPPCQQGTGVKPGSQPAPGSQQVTEPSSSDVLEPLGSP
                     GDEIVLCDSRLQQNEISAAKLHTVITPMLPLDGVPSPTQAEPNSVLSCQRSVLQSPDV
                     SVHKPLRDLINKTNHACYRTDSSKVRYKAGLSRKSSKLIPHLHDKFNK"
     gene            <704892..>705646
                     /locus_tag="KLTH0C08272g"
                     /db_xref="GeneID:8291456"
     mRNA            join(<704892..704925,705000..>705646)
                     /locus_tag="KLTH0C08272g"
                     /product="KLTH0C08272p"
                     /transcript_id="XM_002552536.1"
                     /db_xref="GeneID:8291456"
     CDS             join(704892..704925,705000..705646)
                     /locus_tag="KLTH0C08272g"
                     /note="highly similar to uniprot|P38075 Saccharomyces
                     cerevisiae YBR035C PDX3 Pyridoxine (pyridoxamine)
                     phosphate oxidase has homologs in E. coli and Myxococcus
                     xanthus transcription is under the general control of
                     nitrogen metabolism"
                     /codon_start=1
                     /product="KLTH0C08272p"
                     /protein_id="XP_002552582.1"
                     /db_xref="GeneID:8291456"
                     /db_xref="GOA:C5DED3"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:C5DED3"
                     /translation="MASDETKNPIIFAPETYQYNKDSLNESELAQDPIVEFTKWFADA
                     KNDPTEMIPEAVNFSSAELPSGRVSSRILLFKELDERGFTIYSNWETSRKAQDIRSNP
                     QAALTFFWRNLQRQVRVEGIVEKVSRETSERYFNTRPRGSKVGAWSSPQSAPLKDRAE
                     LQKLVDDNEARFEGVEEVPCPDFWGGVRIVPLMIEFWQGRPSRLHDRIVFKRESEKDP
                     WQMLRIAP"
     gene            complement(<705698..>707443)
                     /locus_tag="KLTH0C08294g"
                     /db_xref="GeneID:8291457"
     mRNA            complement(<705698..>707443)
                     /locus_tag="KLTH0C08294g"
                     /product="KLTH0C08294p"
                     /transcript_id="XM_002552537.1"
                     /db_xref="GeneID:8291457"
     CDS             complement(705698..707443)
                     /locus_tag="KLTH0C08294g"
                     /note="some similarities with uniprot|Q99359 Saccharomyces
                     cerevisiae YDR014W RAD61 Protein of unknown function
                     mutation confers radiation sensitivity"
                     /codon_start=1
                     /product="KLTH0C08294p"
                     /protein_id="XP_002552583.1"
                     /db_xref="GeneID:8291457"
                     /db_xref="UniProtKB/TrEMBL:C5DED4"
                     /translation="MRSYGKRGRFRSLVRPHQTQLQEFSDEEESFQENTSDKAMEAVT
                     PKSSFDADALNAGEKRNTTKEKTSGLDIFDFLDEPVRKKRKRAAQVKADSDACEEAEY
                     DAVDAFFSSQAEQSFQSTIDDANSMLSRICGESNAKSEWESSGTQDDIDARTPDDTDN
                     KVMYGKSRTMLHCEDEPEVTVEPPEESHDSAEPSTHHFNHLKTMGESLKYQDDLEFMM
                     QKEAQMTLAAKTSNLLIFVLNLINNAGFFEYVMKYSRKEIWQWCLHLGNCEDPVLRHL
                     CAFIYSKLPLDADDPMWGELNLYEFVLPLTSQKSGTLKIKGSKFTEMSYLEFLNATES
                     KPGLYYALLLWPPFLGHQKEIDQNVVDAFTALLQNSCEYVDTILPIVEKLVSKETVEG
                     HSTSYKNMMQALVPLFEPHARNDSLIKALVKMTNESTLVAELKDGQKTVLLTNSLEFL
                     LAYDRFLFDEQESELLDIFVLYLGLALNLVKALKQDDAVFEDKNPLMERLKRTFQDLQ
                     AASDESNQHNFNQNIFILIYCYIAMHYKVRLQEAERAFVIPRLEAFSQEIKRYNESIY
                     TAIAVILTPDILAPN"
     gene            <707550..>708173
                     /locus_tag="KLTH0C08316g"
                     /db_xref="GeneID:8291458"
     mRNA            <707550..>708173
                     /locus_tag="KLTH0C08316g"
                     /product="KLTH0C08316p"
                     /transcript_id="XM_002552538.1"
                     /db_xref="GeneID:8291458"
     CDS             707550..708173
                     /locus_tag="KLTH0C08316g"
                     /note="highly similar to uniprot|Q12488 Saccharomyces
                     cerevisiae YDR013W PSF1 Subunit of the GINS complex (Sld5p
                     Psf1p Psf2p Psf3p) which binds to DNA replication origins
                     and facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="KLTH0C08316p"
                     /protein_id="XP_002552584.1"
                     /db_xref="GeneID:8291458"
                     /db_xref="GOA:C5DED5"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:C5DED5"
                     /translation="MYGDLGSKLVLEAKRAQQLSQSSGSDQLPLYQDDLVRNILREIA
                     HLKKNAEILKSQQELENFDNKVAKCQYFVTLLCMERNKRCLLAYQKLRSDALDAAAWN
                     RNGLDAMSSLNTAKDGSTNLSHHEQEYLKDYVQLITDMKSGDYTDIDLSGSLTPPSDV
                     FIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRQADVERLIQQGYLQKL"
     gene            <708532..>709005
                     /locus_tag="KLTH0C08338g"
                     /db_xref="GeneID:8291459"
     mRNA            <708532..>709005
                     /locus_tag="KLTH0C08338g"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_002552539.1"
                     /db_xref="GeneID:8291459"
     CDS             708532..709005
                     /locus_tag="KLTH0C08338g"
                     /note="similar to uniprot|P23369 Saccharomyces cerevisiae
                     YGR076C MRPL25 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_002552585.1"
                     /db_xref="GeneID:8291459"
                     /db_xref="UniProtKB/TrEMBL:C5DED6"
                     /translation="MSSAPLKQYFQLLPDKLRTFFKKYPPNVKYSDKATSTGAIDANP
                     FLANKHPITGKYHNPKYSLRRMSDLYKLAHQYGLQELLPPSNKLFFDEKYEKKKLMKG
                     VLIPKGHKHELAQSEKMQKMREAIKNADQYILEVKGRKYMKKLEKRKEEKRPRWF"
     gene            <709211..>709978
                     /locus_tag="KLTH0C08360g"
                     /db_xref="GeneID:8291460"
     mRNA            <709211..>709978
                     /locus_tag="KLTH0C08360g"
                     /product="KLTH0C08360p"
                     /transcript_id="XM_002552540.1"
                     /db_xref="GeneID:8291460"
     CDS             709211..709978
                     /locus_tag="KLTH0C08360g"
                     /note="similar to uniprot|Q00723 Saccharomyces cerevisiae
                     YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
                     particle dispensable for spliceosome assembly but required
                     for conformational changes which lead to catalytic
                     activation of the spliceosome"
                     /codon_start=1
                     /product="KLTH0C08360p"
                     /protein_id="XP_002552586.1"
                     /db_xref="GeneID:8291460"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:C5DED7"
                     /translation="MSREFHVDENVSTKQLNHQSTSLVIPQLARTRIHNSMYYKINLD
                     PASLRGDTMVQLSKTMMRDFGTCRDNARRMALVCGGVEFKCLLMKLVHLRPQWGQIVT
                     ILQKGNERSSKFDNKYLVVLVLVYLRIQYYFLPDTSDEEKVTGVLNLNKRGSVSSGTL
                     RGLFRIYLSDYRKVKSINLETDYWYNSASKVPKTLHIDEVVDWLCTQDQIWGIPLGRC
                     QWCNIFKETSSEEESSDGSSDNSGDESAEEDSDNASS"
     gene            complement(<710145..>710564)
                     /locus_tag="KLTH0C08382g"
                     /db_xref="GeneID:8291461"
     mRNA            complement(<710145..>710564)
                     /locus_tag="KLTH0C08382g"
                     /product="KLTH0C08382p"
                     /transcript_id="XM_002552541.1"
                     /db_xref="GeneID:8291461"
     CDS             complement(710145..710564)
                     /locus_tag="KLTH0C08382g"
                     /note="highly similar to uniprot|Q02260 Saccharomyces
                     cerevisiae YGR074W SMD1 Homolog of human core snRNP
                     protein D1 involved in snRNA maturation U6 snRNP protein"
                     /codon_start=1
                     /product="KLTH0C08382p"
                     /protein_id="XP_002552587.1"
                     /db_xref="GeneID:8291461"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:C5DED8"
                     /translation="MKLVHFLMKLRNEQVTIELKNGTTVWGTLQTVSPQMNATLTDVK
                     LSLPNKSGNSAVASVFLSGGQRNSEQKTTSLQYINIRGNTIRQIILPDSLNLDTLLVD
                     ERHLNRLRRTGKVTNDHNKKRRMDSNGGPVKRPKRAL"
     gene            <711257..>712048
                     /locus_tag="KLTH0C08404g"
                     /db_xref="GeneID:8291462"
     mRNA            <711257..>712048
                     /locus_tag="KLTH0C08404g"
                     /product="KLTH0C08404p"
                     /transcript_id="XM_002552542.1"
                     /db_xref="GeneID:8291462"
     CDS             711257..712048
                     /locus_tag="KLTH0C08404g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C08404p"
                     /protein_id="XP_002552588.1"
                     /db_xref="GeneID:8291462"
                     /db_xref="GOA:C5DED9"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:C5DED9"
                     /translation="MLFFRDKFIVIAYVRYIKNRIYINALTKLKTTAHGLRNMSVASM
                     SVQTRQISIAARYNVLLTKYPLLTKMVTGAVLSALSELVSQFTTASKTQDKDEKQLSI
                     LQKLASALQKPRYRKLLSMFLYGGLVNAPINHFCYGWITRFTSRNVAPKWKRMAQLCG
                     SWFIVSPVQVFFLVIALTLVNLDQGASKLSQKLDAVKSSLRSKYGPMLSSSVISATAF
                     VSIAQQFIAPEKWSVFFSFAYAALNTGQNIYLKRGAKDSSKERAE"
     gene            complement(<712136..>713311)
                     /locus_tag="KLTH0C08426g"
                     /db_xref="GeneID:8291463"
     mRNA            complement(<712136..>713311)
                     /locus_tag="KLTH0C08426g"
                     /product="KLTH0C08426p"
                     /transcript_id="XM_002552543.1"
                     /db_xref="GeneID:8291463"
     CDS             complement(712136..713311)
                     /locus_tag="KLTH0C08426g"
                     /note="weakly similar to uniprot|P48412 Saccharomyces
                     cerevisiae YGR072W UPF3 Component of the nonsense-mediated
                     mRNA decay (NMD) pathway along with Nam7p and Nmd2p
                     involved in decay of mRNA containing nonsense codons"
                     /codon_start=1
                     /product="KLTH0C08426p"
                     /protein_id="XP_002552589.1"
                     /db_xref="GeneID:8291463"
                     /db_xref="GOA:C5DEE0"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DEE0"
                     /translation="MDERPQNGAEQNLKKHQGRKQAGKGHQTPKKPKPEAVGLNTSTN
                     SKSKKKYRKSKDAAVRSSAQYKLVLRQLPPNLMEEQFFDTVSAAVGSDFLQQHVEDRY
                     FFKGHFSRKPFKLPTYSRAYMTFNEAEKLQFFAKSVSAVTFVDDTNNSMVPTVTLSPY
                     LKKLRTEESKGLRKTKDLIEGTIEQDRTFQTFLKSLDLLENHKQEYQYADLSVIMPLE
                     KALRRKLEEEARVKAQGEKAMIALAGQVAKETTKAKKKKKKKKNKAATEGTEVKKKRP
                     QSTTASTSQEKQNMVIIEAAGRRELQRRERIKKKSEIKEKKAAAANSANPADANVSKA
                     ASVKAKGKAAKKNKNKRPNSKNKKKNEAKDKTADASSDKSVPKTKPKPKPQKKESNE"
     gene            <713441..>714823
                     /locus_tag="KLTH0C08448g"
                     /db_xref="GeneID:8291464"
     mRNA            <713441..>714823
                     /locus_tag="KLTH0C08448g"
                     /product="KLTH0C08448p"
                     /transcript_id="XM_002552544.1"
                     /db_xref="GeneID:8291464"
     CDS             713441..714823
                     /locus_tag="KLTH0C08448g"
                     /note="similar to uniprot|Q08231 Saccharomyces cerevisiae
                     YOL072W THP1 Nuclear pore-associated protein forms a
                     complex with Sac3p that is involved in transcription and
                     in mRNA export from the nucleus contains a PAM domain
                     implicated in protein-protein binding"
                     /codon_start=1
                     /product="KLTH0C08448p"
                     /protein_id="XP_002552590.1"
                     /db_xref="GeneID:8291464"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:C5DEE1"
                     /translation="MEGDSLKQFFVEVSKGDLSLLNVILEQNGTLIARLQLVLQKYDS
                     DEDIEALVEKQKLHGGSWTRFNILMTSFLKLCRDLNPWSLWESSDLIYTYYQDLTNCL
                     LNDSFPVDNLVTLFQTTTEYIVPLSRQLDANYLALGTRQHQFLAHVSSIITKLFNSIK
                     PRFEEPAVSFESLPRKQQILLYTANKLNNIYMRIDSSSSCANIFKNVKPKSAIQHFSQ
                     FPLREQVEYRYLLGRYYLLNHRVSNAFHQLNSAFGMLITTYRSKECPPAVQRNLQRIL
                     KYLLPAGILFGKMPSIQFCAQLSQNLASSYQQLATAVKTGNFASFHNWLNENEAVLRR
                     QNLLILLLEKVPLLIYRNLVRRVVIDFCFPQTLNKISYEILEHALAMSLGNPPLSKPI
                     YTAINVPEDIPNVLETLVNLTLLKANCFPLSKQCVFPKTQNINDIFPEVNRRLVALYP
                     LNAEDAWLDD"
     gene            <715134..>716063
                     /locus_tag="KLTH0C08470g"
                     /db_xref="GeneID:8291465"
     mRNA            <715134..>716063
                     /locus_tag="KLTH0C08470g"
                     /product="KLTH0C08470p"
                     /transcript_id="XM_002552545.1"
                     /db_xref="GeneID:8291465"
     CDS             715134..716063
                     /locus_tag="KLTH0C08470g"
                     /note="highly similar to uniprot|P20604 Saccharomyces
                     cerevisiae YDL047W SIT4 Type 2A-related serine-threonine
                     phosphatase that functions in the G1/S transition of the
                     mitotic cycle cytoplasmic and nuclear protein that
                     modulates functions mediated by Pkc1p including cell wall
                     and actin cytoskeleton organization"
                     /codon_start=1
                     /product="KLTH0C08470p"
                     /protein_id="XP_002552591.1"
                     /db_xref="GeneID:8291465"
                     /db_xref="GOA:C5DEE2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DEE2"
                     /translation="MVERGPDQWLEKIKKCQSLSENEMKQLCEMVKELLMEESNIQPV
                     QTPVTVCGDIHGQFHDLLELFRTAGGFPDQVNYIFLGDYVDRGYYSLETFTLLMCLKV
                     RYPSRLTLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKI
                     LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVDAWQVSPRGAGWLFG
                     SKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
                     DEDLEPTFKIFSAVPDDYIQETNHNNQRGGYFL"
     gene            <716689..>717213
                     /locus_tag="KLTH0C08492g"
                     /db_xref="GeneID:8291466"
     mRNA            <716689..>717213
                     /locus_tag="KLTH0C08492g"
                     /product="KLTH0C08492p"
                     /transcript_id="XM_002552546.1"
                     /db_xref="GeneID:8291466"
     CDS             716689..717213
                     /locus_tag="KLTH0C08492g"
                     /note="similar to uniprot|Q12408 Saccharomyces cerevisiae
                     YDL046W NPC2 Putative homolog of human NPC2/He1 which is a
                     cholesterol-binding protein whose deficiency causes
                     Niemann-Pick type C2 disease involving retention of
                     cholesterol in lysosomes"
                     /codon_start=1
                     /product="KLTH0C08492p"
                     /protein_id="XP_002552592.1"
                     /db_xref="GeneID:8291466"
                     /db_xref="InterPro:IPR003172"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DEE3"
                     /translation="MTRTLQLYLAALLLALAAASPVFPAFFGLPGTRSQNKPIPGDSP
                     LEQCDADDKQLLTIQLVNLLPNPPVRGENVTVSAAGHVKETIKEGAYVDVEVRLGYIK
                     LLTQTYDLCEELEKNDVGGLKCPIAPGDYKIDKTVEIPQEVPPGKYTVLARAYTEDDD
                     EITCLSGDIFFPSY"
     gene            <717495..>717974
                     /locus_tag="KLTH0C08514g"
                     /db_xref="GeneID:8291467"
     mRNA            <717495..>717974
                     /locus_tag="KLTH0C08514g"
                     /product="KLTH0C08514p"
                     /transcript_id="XM_002552547.1"
                     /db_xref="GeneID:8291467"
     CDS             717495..717974
                     /locus_tag="KLTH0C08514g"
                     /note="similar to uniprot|Q08230 Saccharomyces cerevisiae
                     YOL071W EMI5 Non-essential protein of unknown function
                     required for transcriptional induction of the early
                     meiotic-specific transcription factor IME1 also required
                     for sporulation"
                     /codon_start=1
                     /product="KLTH0C08514p"
                     /protein_id="XP_002552593.1"
                     /db_xref="GeneID:8291467"
                     /db_xref="GOA:C5DEE4"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:C5DEE4"
                     /translation="MTMLTRTLYQALRTPALYRKAALPRMAALYSSQGGEPVVISEKD
                     EVRVRLEPIKRAGETLENKRARLVYQSRKRGILETDLLLSRFAAKYLSSMTPEELEEY
                     DALLDELDWDIYYWATKNYAITPLPERFKDSKLLAKLQDFSENKNKEILRMPNLHSN"
     gene            <718329..>718616
                     /locus_tag="KLTH0C08536g"
                     /db_xref="GeneID:8291468"
     mRNA            <718329..>718616
                     /locus_tag="KLTH0C08536g"
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /transcript_id="XM_002552548.1"
                     /db_xref="GeneID:8291468"
     CDS             718329..718616
                     /locus_tag="KLTH0C08536g"
                     /note="similar to uniprot|O75012 Saccharomyces cerevisiae
                     YDL045W-A MRP10 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /protein_id="XP_002552594.1"
                     /db_xref="GeneID:8291468"
                     /db_xref="InterPro:IPR017264"
                     /db_xref="UniProtKB/TrEMBL:C5DEE5"
                     /translation="MSGKVPVYRLPPLPRLKVKKPIVQQEANKCLVLMSNLLQCWSSN
                     GHMNPVCENLVKDLKACSSESAMGKNSGVQKSNINYHAARLYDRVSGKPND"
     gene            complement(<718712..>719635)
                     /locus_tag="KLTH0C08558g"
                     /db_xref="GeneID:8291469"
     mRNA            complement(<718712..>719635)
                     /locus_tag="KLTH0C08558g"
                     /product="KLTH0C08558p"
                     /transcript_id="XM_002552549.1"
                     /db_xref="GeneID:8291469"
     CDS             complement(718712..719635)
                     /locus_tag="KLTH0C08558g"
                     /note="similar to uniprot|P38913 Saccharomyces cerevisiae
                     YDL045C FAD1 Flavin adenine dinucleotide (FAD) synthetase
                     performs the second step in synthesis of FAD from
                     riboflavin"
                     /codon_start=1
                     /product="KLTH0C08558p"
                     /protein_id="XP_002552595.1"
                     /db_xref="GeneID:8291469"
                     /db_xref="GOA:C5DEE6"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DEE6"
                     /translation="MNLGEVSAHCYNITTSYLSANNDSAIIESTKVAIRITRNHFLQE
                     IFPRWNPFSDQISFSYNGGKDCQALLILYLSCLWEFFLSSIQVSQYPPEYHLFPLKSL
                     PTVYINQAETFRTLEESIETTRSRYFLSVYESPRNQTSMPEAFKNYLEHNTHTQAIVI
                     GIRYTDPFGADLKCVQKTDSDWPEFMRIQPLLHWSLSNVWSLLLYSNEEICGLYEKGF
                     TSVGSVNSTIPNPYLKRSPGADRDNNGLKNHFEWEIRNAYGKEEPTDEVRVSAFSSSD
                     AKILQEAGTLNYYPGWFLIDDSLERAGRARR"
     gene            complement(<719781..>721031)
                     /locus_tag="KLTH0C08580g"
                     /db_xref="GeneID:8291470"
     mRNA            complement(<719781..>721031)
                     /locus_tag="KLTH0C08580g"
                     /product="KLTH0C08580p"
                     /transcript_id="XM_002552550.1"
                     /db_xref="GeneID:8291470"
     CDS             complement(719781..721031)
                     /locus_tag="KLTH0C08580g"
                     /note="similar to uniprot|P10849 Saccharomyces cerevisiae
                     YDL044C MTF2 Mitochondrial matrix protein that interacts
                     with an N-terminal region of mitochondrial RNA polymerase
                     (Rpo41p) and couples RNA processing and translation to
                     transcription"
                     /codon_start=1
                     /product="KLTH0C08580p"
                     /protein_id="XP_002552596.1"
                     /db_xref="GeneID:8291470"
                     /db_xref="UniProtKB/TrEMBL:C5DEE7"
                     /translation="MRLNFEPNPRLLGQLHRGIGARKQQFSHLRTLRERQTSDASGFK
                     DEQISTVQERTLFEQIFSQIMKKDEQKKKTKELLKPIISLTKDDQNQMHKGNDLQIVF
                     EKKKSDSQTLKLSRFLEDADTEGNVGSAGLARLTTDDIRKYPVSLTSTYFADSGDDSA
                     TRTTSEYLGKILSKGTLAKAKASGREISPETLNQIETKHKLNAKLEELLRPHMSYLFS
                     RIQTDSDCIEVLEGYLKQYRTRDTTLEKHTANTFADIEKSASSDPNQLPQPFDITMPF
                     VIRFILTSDSFSFPSNRKYTLISLVYNACKRASDMSLYLNICNVDFYNLLIEYSWENF
                     QEIHQLKDIVKEMSVNGIMGDLRTVDLLDYIAKSMQYMNDGILEETEGSENLQTVGLV
                     WCRENAQDLNYVEMYLKKLKESLM"
     gene            complement(<721228..>722883)
                     /locus_tag="KLTH0C08602g"
                     /db_xref="GeneID:8291471"
     mRNA            complement(<721228..>722883)
                     /locus_tag="KLTH0C08602g"
                     /product="KLTH0C08602p"
                     /transcript_id="XM_002552551.1"
                     /db_xref="GeneID:8291471"
     CDS             complement(721228..722883)
                     /locus_tag="KLTH0C08602g"
                     /note="similar to uniprot|Q08229 Saccharomyces cerevisiae
                     YOL070C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery cytoplasm and bud neck potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0C08602p"
                     /protein_id="XP_002552597.1"
                     /db_xref="GeneID:8291471"
                     /db_xref="UniProtKB/TrEMBL:C5DEE8"
                     /translation="MNTNTKRLSAMIDSFHDDGNDDALYVQRSTPSSPTKSQISKTDT
                     LSRPPALHPAFSSPMSYVNSSPGNRESLISDYSASIHEGVPVSYVVTKAGVPSGKDAS
                     VVYSAVNVPVSEETVVREEMLEQDGAESSPVGLALNLKHVSGVRSPLRLASNRSHSKN
                     HSSIGSGNLASESGHSHNFSTISASGSSSAPRFYAQNLESGEGHEENPIHIDQIEEES
                     DAENSKGTSPLEAFHSPVRSLTNRSAVGVAKDSGDVHSMTSSIVPSLHTKVLDSCAQN
                     KDPDRSSTTEYNPSIPPRSRNRPKSHMFIKDGLEDIQNQLQQQILQETENVSRASTNK
                     SSTYYSAADQDNQYNTEEDNFGKRDDDSYYHRPLPTVPVTEKIHRKQASIDREDTIVL
                     PSSERVDPEKPPRLPSLPASVMKASQTSNYDSDDDYEDIVDETFQKAKPNHDSKHVKN
                     TTSSASHQLRTAPHKNKQKAKRKREMRSFDIDTISQMLNVTKGTLIGSEFSNLGMKTE
                     EKRALERLVDSLSRLTADMVLDPERFQEGMRRLEKATRALEGF"
     gene            complement(<723206..>724921)
                     /locus_tag="KLTH0C08624g"
                     /db_xref="GeneID:8291472"
     mRNA            complement(<723206..>724921)
                     /locus_tag="KLTH0C08624g"
                     /product="KLTH0C08624p"
                     /transcript_id="XM_002552552.1"
                     /db_xref="GeneID:8291472"
     CDS             complement(723206..724921)
                     /locus_tag="KLTH0C08624g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C08624p"
                     /protein_id="XP_002552598.1"
                     /db_xref="GeneID:8291472"
                     /db_xref="GOA:C5DEE9"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C5DEE9"
                     /translation="MCPIKKIAVIGGGPAGLIAANDLFKESERQRWEVVGFETRNCLG
                     GVWSDKPGSGIDSPQVFEELRKLPHNLGTSYSPEDIFQYGSPLVSNGRIASLRPFNGT
                     SVTKPLRLVHKHLPRDGLINSSKTGVYDGLMTNVPGELMAFGPENLNTYASRNADISP
                     LVTLDQVQMNFEKFIEESEGSKTFRKNTCIEYLDKISPDKWVIVARRHPPGSEQDEWY
                     MELFDAVVIANGHFTCPYVPFYMSNLTGVESGIHEFNTQFPNVLSHVRDLDLWYNKRF
                     PQLKEEVLLDKRRVVIVGKSFSAMDVLKRLVPILDKAQGNLEIILSSNTPPMPENTAN
                     PFYWFDEWLSKTSKVEVKGPIAKFVSSHDMPALQFQDGSIFDNISDVIFATGYLYTFP
                     FISKRLLESYRVLITPDSRNFDAAPSNVSRVTGLYLHTFSIADPTMGFVGVSSNANFQ
                     SFNISSQALTGVWSRFNNLFNEEAPQDGPIFNSIWSKVLPSVQEQLKWSQNRLLKTGN
                     NGAFHFYYPLPALKEEWLDYCKPLFRENHRNTMLFPDNSADLSEKGIQTLKARFFDTM
                     GPEHL"
     gene            <725214..>726557
                     /locus_tag="KLTH0C08646g"
                     /db_xref="GeneID:8291473"
     mRNA            <725214..>726557
                     /locus_tag="KLTH0C08646g"
                     /product="KLTH0C08646p"
                     /transcript_id="XM_002552553.1"
                     /db_xref="GeneID:8291473"
     CDS             725214..726557
                     /locus_tag="KLTH0C08646g"
                     /note="similar to uniprot|P33895 Saccharomyces cerevisiae
                     YOL069W NUF2 Component of the evolutionarily conserved
                     kinetochore-associated Ndc80 complex (Ndc80p-
                     Nuf2p-Spc24p-Spc25p) involved in chromosome segregation
                     spindle checkpoint activity and kinetochore clustering"
                     /codon_start=1
                     /product="KLTH0C08646p"
                     /protein_id="XP_002552599.1"
                     /db_xref="GeneID:8291473"
                     /db_xref="GOA:C5DEF0"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="UniProtKB/TrEMBL:C5DEF0"
                     /translation="MNKDIFPLLDLQELVLCLQSCDFALASEENISRPTSQYVITLYK
                     QIIDSFTGVAPDTLISDGDAAVRPTSEVAGEDPVYKETLRMLTLNKICFKFFQDIGVS
                     DFNMMDLYKPDALRTQRFLSAVVNYARFREERMADCDQFMSQTESLLNQLREKFDDYN
                     FLQQQVAKHYELADLAEGESLAFLEANNRNLENQLKKLTQVQEAFTIDYNNYKSSKQK
                     LMSQLESLGFELIELESQRDKLHRYSETDISSLQESMNEFSQMLDEQQGNLAKMQSQY
                     KVLSKSTETFHAITLELYELLRIISTDLQESHLREIGLLEIKQQLAKSEAKMNNLLTS
                     GVMMKLSSLQSQLAMQKQRLRELEETTERKQNENTLALQNLQREFAEEVMPEVQKIDE
                     HVEKELFGKVIKSLEKDMQALRDDFKKDSVAIDLEYSLLASHIKNYVQQMLEKIS"
     gene            complement(<726594..>727352)
                     /locus_tag="KLTH0C08668g"
                     /db_xref="GeneID:8291474"
     mRNA            complement(<726594..>727352)
                     /locus_tag="KLTH0C08668g"
                     /product="KLTH0C08668p"
                     /transcript_id="XM_002552554.1"
                     /db_xref="GeneID:8291474"
     CDS             complement(726594..727352)
                     /locus_tag="KLTH0C08668g"
                     /note="similar to uniprot|Q07350 Saccharomyces cerevisiae
                     YDL043C PRP11 Subunit of the SF3a splicing factor complex
                     required for spliceosome assembly"
                     /codon_start=1
                     /product="KLTH0C08668p"
                     /protein_id="XP_002552600.1"
                     /db_xref="GeneID:8291474"
                     /db_xref="GOA:C5DEF1"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DEF1"
                     /translation="MDYQNRAGSKKGSGGIASSSQENLHRRKQVEDLLKDGEEVPYSF
                     QGISKEDEELSKKNPYIYKNHAGRLVCKLCNTIHMSWTSVERHLEGKKHGLNLIRRGG
                     TTSSQQQDAVSPEELKFKKTVEQLRSQIKDNGIVPNYQVAKVRDPTTNSRGIAMRVIY
                     TNPEPSEDGGDRPYVRIMSSLEFTREESDKKYLIIAFEPFKAIAIEIPNEEILTNSAA
                     FNTSGAKSVDDFNSKFTYWDEDNQTLYVQFFFKD"
     gene            complement(<727525..>729255)
                     /locus_tag="KLTH0C08690g"
                     /db_xref="GeneID:8291475"
     mRNA            complement(<727525..>729255)
                     /locus_tag="KLTH0C08690g"
                     /product="KLTH0C08690p"
                     /transcript_id="XM_002552555.1"
                     /db_xref="GeneID:8291475"
     CDS             complement(727525..729255)
                     /locus_tag="KLTH0C08690g"
                     /note="similar to uniprot|P06700 Saccharomyces cerevisiae
                     YDL042C SIR2 Conserved NAD dependent histone deacetylase
                     of the Sirtuin family involved in regulation of lifespan
                     plays roles in silencing at HML HMR telomeres and the rDNA
                     locus negatively regulates initiation of DNA replication"
                     /codon_start=1
                     /product="KLTH0C08690p"
                     /protein_id="XP_002552601.1"
                     /db_xref="GeneID:8291475"
                     /db_xref="GOA:C5DEF2"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DEF2"
                     /translation="MSLESPQYDAPNKRPLMDAGTNASEFLSTNEEGSKKPRPQDEEN
                     QIFEEAPPADELEDVVEDYVPSEPILNGKFSQDASPVGANDAKTPGADKQFVPKEPLP
                     PISITMSPETGKYRFPFISKEDSLTARSYLKYYGSGKFLDTYLPEELNSLYIYHLIKL
                     LGFQIKDKQLVEAVQDVVENDIFTQSPALATTQSGQSREKSPDSDDSDTFDDPLEKKH
                     AVRLIKDLQKAMNKVLSTRMRLANFHTLDDFCDKLKTAKKVLVLTGAGISTSLGIPDF
                     RSSEGFYSKIRHLGLDDPQDVFNYEIFMQDPSVFYNIAHMVLPPENLFSPLHSFIRMI
                     QDKGKLLRNYTQNIDNLESYAGIQAEKMVQCHGSFATASCVTCHWKLPGEKIFDNIRN
                     MELPLCPYCYHKRKEYFPTNSPDENDGQIESYHSSFNNVLKSYGVLKPDITFFGEALP
                     SKFHRFIRDDVMKCDLLICIGTSLKVAPVSEIVNMIPASVPQVLINKDPVRHAEFDLS
                     LLGFCDDVAALVTQKCGWSMPHSSWDDLKTTEYEYEETDRGVYHVKPKISEATSEADL
                     GNIGEPSEVK"
     gene            complement(<729680..>730231)
                     /locus_tag="KLTH0C08712g"
                     /db_xref="GeneID:8291476"
     mRNA            complement(<729680..>730231)
                     /locus_tag="KLTH0C08712g"
                     /product="KLTH0C08712p"
                     /transcript_id="XM_002552556.1"
                     /db_xref="GeneID:8291476"
     CDS             complement(729680..730231)
                     /locus_tag="KLTH0C08712g"
                     /note="similar to uniprot|P32607 Saccharomyces cerevisiae
                     YOL067C RTG1 Transcription factor (bHLH) involved in
                     interorganelle communication between mitochondria
                     peroxisomes and nucleus"
                     /codon_start=1
                     /product="KLTH0C08712p"
                     /protein_id="XP_002552602.1"
                     /db_xref="GeneID:8291476"
                     /db_xref="GOA:C5DEF3"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DEF3"
                     /translation="MSSIPRSNSVSSSVPSTAGTTMENDKKRRGNINDKIQQLLSMIP
                     PEYFQDYYRRSDSIDYENSQMTPGGSILSSAGMSSKNKGTGTKDGKPNKGQILTQAVE
                     YISKLQNQVDARNREEVELILRVKELSKKTGVAVDDINLENTSAEVALAKIGVGPLAG
                     VSEPYYGSGNQKNNPADYEGCEE"
     gene            complement(<730381..>732930)
                     /locus_tag="KLTH0C08734g"
                     /db_xref="GeneID:8291477"
     mRNA            complement(<730381..>732930)
                     /locus_tag="KLTH0C08734g"
                     /product="KLTH0C08734p"
                     /transcript_id="XM_002552557.1"
                     /db_xref="GeneID:8291477"
     CDS             complement(730381..732930)
                     /locus_tag="KLTH0C08734g"
                     /note="similar to uniprot|P12945 Saccharomyces cerevisiae
                     YDL040C NAT1 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat-shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="KLTH0C08734p"
                     /protein_id="XP_002552603.1"
                     /db_xref="GeneID:8291477"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:C5DEF4"
                     /translation="MSRRKGALPLKANGSAVGRSKEDNNLIEALKLYESKTYKKSLKL
                     VDAILKKNSQHIDSLALKGLNLYCTGQKEDAANYVQKAIARIESSGASPIGCHILGIY
                     MRNEKRYSEAAKWFQSSLDNGSTNKQIYRDLATLYSQEHDYKNLLKARKLYWEEFMGY
                     RANWTSLAIAHELNGQLDESANVLTKFEELAKGKLGESEAYEHNECLMYKNDVLYKAA
                     GADHEKLKGVLKHLDEIEPDVFDKYGWLERRAAIFMKLNQKGDASKIYRTLIKRNPDN
                     FKYYKLLEIALGIQRDAKLRLALYKKLESFYPRAEPPKFIPLTFIEDNSCFAESLSSY
                     ILPQLKRGVPATFNNIKTLYKKDVMRNSAIAEEIVLKYFDSINPKEAPIPYVWTCYFM
                     CQHYLYLKSFQKAREYIELALAHTPTLVELYILKARVLKHTGLLAEAAETINEGRKLD
                     LQDRFINTKTVKYYLRANMVEKAVEVVSIFTKNDGAANGVMDLHLMEASWFIAEQADA
                     YFRLYLEKKRLLHDEKSMEVPEDEESQESHARHIRDLTYETTKFGGLALKRWDAISKF
                     YKQFEDDQLDFHSYCMRKGVPRAYLEMFQWGKTVYTLPMFVRAMKGAARMYFILNDEM
                     KASSTTPEDDAIGELVGAKKGNKKTKKEAAAIKKRIEEDKKTVAAYEKDEDPLGEAYI
                     FTKAPMQDFYNKFYRRFSEEATESSKDYILDFEYHIRCGKLALCVGAISKYADMFGKK
                     DSIVGAMTLCLLDKIKFSNEIDEVTKKIAIKGLERLLSELPLKQLDEEAFDWLSFFQQ
                     EFEGPSLESLLLIHRSSVKIISAENIKQQVIEKLREEEPAVQSSVLNYQLN"
     gene            complement(<733074..>734906)
                     /locus_tag="KLTH0C08756g"
                     /db_xref="GeneID:8291478"
     mRNA            complement(<733074..>734906)
                     /locus_tag="KLTH0C08756g"
                     /product="KLTH0C08756p"
                     /transcript_id="XM_002552558.1"
                     /db_xref="GeneID:8291478"
     CDS             complement(733074..734906)
                     /locus_tag="KLTH0C08756g"
                     /note="similar to uniprot|Q12362 Saccharomyces cerevisiae
                     YOL066C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C08756p"
                     /protein_id="XP_002552604.1"
                     /db_xref="GeneID:8291478"
                     /db_xref="GOA:C5DEF5"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DEF5"
                     /translation="MRWIAQRNSALTKSTYRFMCELPKDSNLTESKKRPVTPPKTTGS
                     SDHSPSATEHLCVKKKKNGGPGELRDSKGFKLKIQESNHLRNKQVDPEYEVQVEGPLR
                     KIVPYDFTYKTFCKLRWRDRPLIDIFVNEFRDREESYYRKTIARGAVFLNENPANLES
                     IVRNGDLISHKIHRHEPPVTSRPIKIVFEDQDLFVIDKPSGIPVHPTGRYRFNTITKI
                     LQKQINGSVHPCNRLDRLTSGLMFLAKTPRGADHMANQLKAREVKKEYIARVVGEFPA
                     ERISVEKPLKCVEPRLALNGVCNSEEEGAKEAKTVFTRVSFDGETSLVKCQPHTGRTH
                     QIRVHLQYLGHPIANDPLYSNPQIWGPSLGKGQRTDFSEVIEKLSNVGKTVCAESWFF
                     PDSMGELLTGEKCPDCETDLYTDPGPNDLDLWLHAYCYESTEFNDNGTRKWSYKTEFP
                     EWALEPHRKYMEMAINEAKKCGPTTTAFSVGAVLTNSDKVLSTGFSRELPGNTHAEQC
                     ALEKYFEQSGNRSVPPGSVLYTTMEPCSFRLSGNKPCVDRIIDASKSIRTVFVGVMEP
                     DTFVKNNTSKTKLSQHEIDYVLIPGYEEDCTKAAKKGHKEDSGI"
     gene            complement(<734974..>736092)
                     /locus_tag="KLTH0C08778g"
                     /db_xref="GeneID:8291479"
     mRNA            complement(<734974..>736092)
                     /locus_tag="KLTH0C08778g"
                     /product="KLTH0C08778p"
                     /transcript_id="XM_002552559.1"
                     /db_xref="GeneID:8291479"
     CDS             complement(734974..736092)
                     /locus_tag="KLTH0C08778g"
                     /note="similar to uniprot|Q08227 Saccharomyces cerevisiae
                     YOL065C INP54 Phosphatidylinositol 4 5- bisphosphate
                     5-phosphatase with a role in secretion localizes to the
                     endoplasmic reticulum via the C-terminal tail lacks the
                     Sac1 domain and proline-rich region found in the other 3
                     INP proteins"
                     /codon_start=1
                     /product="KLTH0C08778p"
                     /protein_id="XP_002552605.1"
                     /db_xref="GeneID:8291479"
                     /db_xref="GOA:C5DEF6"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DEF6"
                     /translation="METKYKLFVSTFNCGKCLHFEQTSEIDSILSHIIPKDHVHDIYA
                     LGFQELVPLWQGSFPDEVHAQLQSLSSRVLNLINSLNPRRSFRLVGLNSVGAIGLLLF
                     ADTTYEVTSILKASARCGALCSSLKGATAIKFNLSRPSSSATDSFIFIAAHFAANEGE
                     LQRQRREGDYNNIVGTLQQELGCFEGNHVLFCGDFNFRSRKWASTPADFNNLELLQAA
                     VGVHDELSLSRKAERVFQNFEEAPITFAPTYKFKLSVPDPEYNLRRIPSWCDRILFQN
                     YGSPVKILSYAACKREAVLQFTDHLPVVLQLEVPHLSPRSPTRSKALSSQSRSYKLMG
                     DVADFLIGYGGWAYVFHGHWLLAVSLVLGLLVMFHLFT"
     gene            complement(<736187..>739039)
                     /locus_tag="KLTH0C08800g"
                     /db_xref="GeneID:8291480"
     mRNA            complement(<736187..>739039)
                     /locus_tag="KLTH0C08800g"
                     /product="KLTH0C08800p"
                     /transcript_id="XM_002552560.1"
                     /db_xref="GeneID:8291480"
     CDS             complement(736187..739039)
                     /locus_tag="KLTH0C08800g"
                     /note="weakly similar to uniprot|Q12361 Saccharomyces
                     cerevisiae YDL035C GPR1 Plasma membrane G-protein coupled
                     receptor that interacts with the heterotrimeric G protein
                     alpha subunit Gpa2p and with Plc1p sensor that integrates
                     nutritional signals with the modulation of cell fate via
                     PKA and cAMP synthesis"
                     /codon_start=1
                     /product="KLTH0C08800p"
                     /protein_id="XP_002552606.1"
                     /db_xref="GeneID:8291480"
                     /db_xref="GOA:C5DEF7"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:C5DEF7"
                     /translation="MPQPQNSTFLVNGEVVPPVYLNRTWNTTTVNQLLGLPGMFSTFT
                     APELLRLRGIAITSSSISILAAAVGFLYITGIDQRRRVFRHNLVFFLIVCDFLKALVL
                     LIYPVVILARNDVYGMPAFYNTLGWLSAFAIEGADFAIAIFAIHFALLIFVPSWKWQN
                     RSTGNMEGGLYRMRHSLYPVTFLVPMILASLAFVGFNTFIPVNLNDRVVLDNDSFDFS
                     YQARKGGYKALSAWCYLPPHPVWYRICLSWGPRYFILVLIMFIYVSIYIFVSKENRKI
                     KNQIGSFKSKDSLDIHRARDSMGKILTLQQRLLIYLKFFYRKSRIPKIMSALGNFFFL
                     SLEDYRHEDLTERESSDQALASLRRANGDDVTARAASDLNSNYIPLSLARRNVLSSLK
                     ASNKRFSCSCPTLPRYRLQRRGGSVGNLRTACSSAGSTRRHSVNVSAFGDSVSTTNVF
                     EPPHQLSNEEPNWNKALGVPSRVGSKNSQSGLTAYPKTNMTSSSLQATNSFERSFNFE
                     RQQNSTNLSPVRSVASNRDSSFRTAPVHLKNTTSRTLTRLNADPDDPDVIALDTNHLN
                     GVKQNFQSETYQEFKKRRAQIQKQMRAIFIYPFSYILIWTFPLAVDVIQYRYEIVHGP
                     VVWLEYIATFMQPLSCFVDVMVFIYRERPSRHSWASITKNELLNTYSLKGELGEQKIR
                     ELCNSELGKKGWYYRGRWTKLGCWRYKPQRWKRVAWFIYRFVKGFVKNNYDFSDNCYD
                     ATYWEAHYTGKSPSENMGSSNMRCSEALKEILDVNNTRKDSYFSGSTSEYLYENSGFV
                     KVPLKWRILHCLPMLEGVDLDELEYQLRTSNNSGNFEIPGLNLAVNNFGKNKNEDNSN
                     SFFKPDYNMTNTSAGGPKSPSARPQPVTAKHSSSSSSSPLHSLIYEGSGGRRRFSSAI
                     FGDDSRNNFTNSSQDQDINEEDSSGKQLGLMDFLKG"
     gene            complement(<739352..>740434)
                     /locus_tag="KLTH0C08822g"
                     /db_xref="GeneID:8291481"
     mRNA            complement(<739352..>740434)
                     /locus_tag="KLTH0C08822g"
                     /product="KLTH0C08822p"
                     /transcript_id="XM_002552561.1"
                     /db_xref="GeneID:8291481"
     CDS             complement(739352..740434)
                     /locus_tag="KLTH0C08822g"
                     /note="similar to uniprot|P32179 Saccharomyces cerevisiae
                     YOL064C MET22 Bisphosphate-3'-nucleotidase involved in
                     salt tolerance and methionine biogenesis dephosphorylates
                     3'-phosphoadenosine-5'-phosphate and 3'-
                     phosphoadenosine-5'-phosphosulfate intermediates of the
                     sulfate assimilation pathway"
                     /codon_start=1
                     /product="KLTH0C08822p"
                     /protein_id="XP_002552607.1"
                     /db_xref="GeneID:8291481"
                     /db_xref="GOA:C5DEF8"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:C5DEF8"
                     /translation="MPFEKELFVATQAVRKAALLTKRIQAQVIADRKSTITKTDSSPV
                     TVGDYSAQAIIINAIKANFPEDEIVGEEESKGLNDEFVGQILREIEATEAPFKELFGE
                     YDSVRAGMQFRSREYPLTSLADVRRVIDLGSSEGGRKTRFWCLDPIDGTKGFLRGEQY
                     AVCLALVVGGVVQLGCIACPNLELANYGGKDSDPEAAHRLGYVFRAVRGHGAFFAPTA
                     VDFSWHPLPVRSLSSTRDMVSLEGVEKGHSAHSAQDAVKEELGISRALHLDSQVKYCL
                     LALGLGDVYLRLPISLSYREKIWDHAAGNALVAETGGQHTDSIEGVPLDFGNGRTLAT
                     KGVIASSGTKLVHQMIVDSSSKAINK"
     gene            complement(<741049..>742329)
                     /locus_tag="KLTH0C08844g"
                     /db_xref="GeneID:8291482"
     mRNA            complement(<741049..>742329)
                     /locus_tag="KLTH0C08844g"
                     /product="KLTH0C08844p"
                     /transcript_id="XM_002552562.1"
                     /db_xref="GeneID:8291482"
     CDS             complement(741049..742329)
                     /locus_tag="KLTH0C08844g"
                     /note="similar to uniprot|Q12093 Saccharomyces cerevisiae
                     YDL033C SLM3 Mitochondrial protein with a potential role
                     in protein synthesis the bacterial homolog is responsible
                     for the 2-thiolation of mnm5s2U34 in tRNALys tRNAGlu and
                     tRNAGln"
                     /codon_start=1
                     /product="KLTH0C08844p"
                     /protein_id="XP_002552608.1"
                     /db_xref="GeneID:8291482"
                     /db_xref="GOA:C5DEF9"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023382"
                     /db_xref="UniProtKB/TrEMBL:C5DEF9"
                     /translation="MACLKPFEQLAKFAASQCRQVPGYQPMKLPSKFDNIVIAMSSGV
                     DSSVAAAMFSGFPNACGIYMQNWTETRSEREPCHERDWKDVQKVGAHLNLPVEKVNFE
                     QDYWLDVFEPMLRDYEQGVTPNPDIGCNRFIKFGKLRAHLDASLGTGNYWLVTGHYSR
                     VLQTESKALGLNSWHLLRAFYAPKDQSYYLSQVPSAALPALCLPMGVLTKPEVREMAH
                     DLRLPTAHKPDSQGICFVANSQHGKISRFLEQYIPSHAGEIITLDPITGERTEWGRHT
                     GLWNYTIGQKVGISMPQGDPRYQGAWFVADKRVDTNEIVICKGRDNPSLYKNRVVLKD
                     FSPLGNLNDVQEAVKNNLAGGAIHIQYRSLQEPAKVSRCCWETTEAGESRLVMTLEQK
                     QRAMAPGQYCTIYHKERILGSGTILASDAVEANK"
     gene            <742559..>745477
                     /locus_tag="KLTH0C08866g"
                     /db_xref="GeneID:8291483"
     mRNA            <742559..>745477
                     /locus_tag="KLTH0C08866g"
                     /product="KLTH0C08866p"
                     /transcript_id="XM_002552563.1"
                     /db_xref="GeneID:8291483"
     CDS             742559..745477
                     /locus_tag="KLTH0C08866g"
                     /note="highly similar to uniprot|Q12389 Saccharomyces
                     cerevisiae YDL031W DBP10 Essential protein involved in
                     ribosome biogenesis putative ATP-dependent RNA helicase of
                     the DEAD-box protein family"
                     /codon_start=1
                     /product="KLTH0C08866p"
                     /protein_id="XP_002552609.1"
                     /db_xref="GeneID:8291483"
                     /db_xref="GOA:C5DEG0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEG0"
                     /translation="MVKAVAKRSRQQSALSDDEDVDIAGNIALDSSDSSSSSDNDDDG
                     SEDEAGDVQDIIEFSDEDEEEARAKAAPQKKKKNAHEGGFPALELSDNEDHDDGKDGA
                     DDVTEYFSTNNPEAAKHKKGSFASFGLSKFIVSNIAKKGFRQPTPIQRKTIPLILQKR
                     DIVGMARTGSGKTAAFVLPMIEKLKGHSAKIGARAVILSPSRELAMQTHKVFREFSRG
                     SDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLHLKVEMNLDLKSVEYLVFDEAD
                     RLFEMGFEEQLSELLAALPVARQTLLFSATLPSSLVNFAKAGLTNPVLVRLDAETKVS
                     ENLEMLFLSSKNEEREANLLYLLQEAMKIPVATEEQLLEYKAKVKNSYDSDDSDEDAK
                     AKAKKQRKSAIRKKLPSANELPSEHATIVFVPTRHHVEYISQLLKDCGYLVSYLYGTL
                     DQHARRQQLFNFRAGLTTILVVTDVAARGVDIPLLANVVNYSLPASSKIFVHRVGRTA
                     RAGNKGFAYSIVSENELPYLLDLELFLGKKILLTPMFEATTELLKSKWIAEGNSELTF
                     NPPKVSYTNRMVLGACPRLDLETCGDLFKNLTQSSFDLQQLKGVAAKAEKLYFRTRPP
                     ASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKLDFLAKLQNRNNKETVFEFARNQDDE
                     MSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLRHTVEDEILKGDENEVGYSVPEEV
                     LHREFQDADELLGAQSKSKRPKSFRDPAFFLSHYAPASEIQDKQLEVTNGFTNEAANA
                     TFDLHNDDKVQNHKQVATTKWDKKRQKYVNTQGLDNKKYIMGESGHKIPASFRSGKFD
                     EWSKARKLGPLKVGAKESSTTAKMLSNPTAEGQRSIGGRFKHNKVRAPKLPDKHRDDY
                     HVQKKKVEKAVSSGIPVKGYNAPGMKSEMRSTQQIYKERVAKEKKRAKNARPAKKRKF
                     "
     gene            <745663..>747183
                     /locus_tag="KLTH0C08888g"
                     /db_xref="GeneID:8291484"
     mRNA            <745663..>747183
                     /locus_tag="KLTH0C08888g"
                     /product="KLTH0C08888p"
                     /transcript_id="XM_002552564.1"
                     /db_xref="GeneID:8291484"
     CDS             745663..747183
                     /locus_tag="KLTH0C08888g"
                     /note="similar to uniprot|P19736 Saccharomyces cerevisiae
                     YDL030W PRP9 Subunit of the SF3a splicing factor complex
                     required for spliceosome assembly"
                     /codon_start=1
                     /product="KLTH0C08888p"
                     /protein_id="XP_002552610.1"
                     /db_xref="GeneID:8291484"
                     /db_xref="GOA:C5DEG1"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:C5DEG1"
                     /translation="MKTYEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEH
                     SGRFDHIPSSQKSANKVYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEFDM
                     SEYRVDNGSVNKLLEHIERIKEIHPKDDEFGDQYAMFSSSTPSNKNIISRKAQNLDIN
                     SYFTRDEQYGEYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFTDQRYLLQPAVNRNS
                     SRYREFVASLHHYLSDYAARAYPLLSWDLIHAKAQELYHTNVAKPIPSGESGVFCIPC
                     DKRFKTDTVYNAHLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKL
                     AFTTEERTQELERLTDIYDSPVYGRQEQEDAQEDENKETEDKEDSVLDSSMNLPLGPD
                     GFPIPYWLYKLQGLDIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASF
                     KGVTKIDDAKQLWSHLRSTSSGRVSSEGKLEVEVEDEDGNVMSKKVYDELKKQGLL"
     gene            <747343..>748662
                     /locus_tag="KLTH0C08910g"
                     /db_xref="GeneID:8291485"
     mRNA            <747343..>748662
                     /locus_tag="KLTH0C08910g"
                     /product="KLTH0C08910p"
                     /transcript_id="XM_002552565.1"
                     /db_xref="GeneID:8291485"
     CDS             747343..748662
                     /locus_tag="KLTH0C08910g"
                     /note="similar to uniprot|P38221 Saccharomyces cerevisiae
                     YBR029C CDS1 Phosphatidate cytidylyltransferase
                     (CDP-diglyceride synthetase) an enzyme that catalyzes that
                     conversion of CTP phosphate into diphosphate
                     CDP-diaclglyerol a critical step in the synthesis of all
                     major yeast phospholipids"
                     /codon_start=1
                     /product="KLTH0C08910p"
                     /protein_id="XP_002552611.1"
                     /db_xref="GeneID:8291485"
                     /db_xref="GOA:C5DEG2"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR016720"
                     /db_xref="UniProtKB/TrEMBL:C5DEG2"
                     /translation="MATKKSKKGAGGSKKPQASFNHGEVSKVKSHGNQKRKNEKDTKD
                     TKDTKKYNFFVRTVWTFIMISGFFITLASGHFWCVMLILACQIAAFKECIRVTAMSGR
                     QKNLPLSKTLNWYFLFTTIYYLDGKSLFQFFQYYVVNYRFLSMIASNHFFICYCLYVL
                     GFVIFVCSLRKGYLKFQFASLCVTHMVLLLVVFQAHLVINNVLNGLIWFLLPCGLVIV
                     NDIFAYLCGITFGRTKLIEISPKKTLEGFLGAWFFTAIASIILTRLLTPFSYMTCPVN
                     DIQTNLFTSLQCDPNPVFVPQEYRLPPIIFEKLNISSITIKPIYLHALNLATFASLFA
                     PFGGFFASGLKRTFQVKDFGQSIPGHGGITDRIDCQFLMGSFMNLYYETFISEKRVTV
                     ETVISTILMNFNEKQMVELIKILNEVLYSNGYLSDKAYKQLKTLYNI"
     gene            <749308..>750867
                     /locus_tag="KLTH0C08932g"
                     /db_xref="GeneID:8291486"
     mRNA            <749308..>750867
                     /locus_tag="KLTH0C08932g"
                     /product="KLTH0C08932p"
                     /transcript_id="XM_002552566.1"
                     /db_xref="GeneID:8291486"
     CDS             749308..750867
                     /locus_tag="KLTH0C08932g"
                     /note="similar to uniprot|P38070 Saccharomyces cerevisiae
                     YBR028C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C08932p"
                     /protein_id="XP_002552612.1"
                     /db_xref="GeneID:8291486"
                     /db_xref="GOA:C5DEG3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C5DEG3"
                     /translation="MSIFSLDEEICKLTVNGSCAVLDDEDDFEHDFSSDLWHKNLLSV
                     EPKAEAPKQFLKASPASISSNMTRRRRSSLYDKMSVNTPPNTRRFALSTQEQKDGNDS
                     NNSSYCSPSVLQKHGMRSLEDFKPIRVLGRGAYGKVLLVRDSHTHRLYAMKQLKKAEI
                     LIHEDKSSDTEETKDDALEKRLERTFAERIILSQLEHPNIVKLFYSFHDHHKLYLVLQ
                     FIPGGELFYHLKEQGTLDENTVTFYAAEISCALKFLHERGIVYRDLKPENCLLDERGH
                     LVLTDFGLSKKSAADSDTPERSDIDGDALNSHSGEPVNKLYSIIGTPEYCAPEILEGK
                     PYTQNCDWYSLGCLVFDMLIGKPPYTGVNHKVILGKILKDKTPKIPSYLSEGMKDYLG
                     ALLKKDVTKRWDVDKFWDSDGPKQKKKKAGQAKTTSYRAHFVFRKINWDKLETGELQK
                     SSVGPILPIITNWELAENFDAEFTEMRLDSQADDGRIDILPVNTKFEHKDVFKGFSYV
                     ASSSYLDRHFL"
     gene            complement(<750972..>751334)
                     /locus_tag="KLTH0C08954g"
                     /db_xref="GeneID:8291487"
     mRNA            complement(<750972..>751334)
                     /locus_tag="KLTH0C08954g"
                     /product="KLTH0C08954p"
                     /transcript_id="XM_002552567.1"
                     /db_xref="GeneID:8291487"
     CDS             complement(750972..751334)
                     /locus_tag="KLTH0C08954g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C08954p"
                     /protein_id="XP_002552613.1"
                     /db_xref="GeneID:8291487"
                     /db_xref="UniProtKB/TrEMBL:C5DEG4"
                     /translation="MSSVSFTKKELLTCIKASSTWAQWDNPNEGLVDLIQPFVDGPYE
                     VKDFSAANSEAAQEARDRVNHLIGKHILKTKLSSGSWYAYTKGKKQYRFALRYCSEPT
                     TLYFKRITRSLSREKQLS"
     gene            <751731..>753839
                     /locus_tag="KLTH0C08976g"
                     /db_xref="GeneID:8291488"
     mRNA            <751731..>753839
                     /locus_tag="KLTH0C08976g"
                     /product="KLTH0C08976p"
                     /transcript_id="XM_002552568.1"
                     /db_xref="GeneID:8291488"
     CDS             751731..753839
                     /locus_tag="KLTH0C08976g"
                     /note="weakly similar to uniprot|P38069 Saccharomyces
                     cerevisiae YBR015C MNN2 Alpha-1 2-mannosyltransferase
                     responsible for addition of the first alpha-1 2-linked
                     mannose to form the branches on the mannan backbone of
                     oligosaccharides localizes to an early Golgi compartment"
                     /codon_start=1
                     /product="KLTH0C08976p"
                     /protein_id="XP_002552614.1"
                     /db_xref="GeneID:8291488"
                     /db_xref="GOA:C5DEG5"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DEG5"
                     /translation="MSFTRIIRDLSVRALAVLDLVGTRFRQSNHVWRRGKGKGISTIV
                     LGVFGLIVLGLIIGVAHKSNEDLDFLDYDGGAPGVDYAYEDLGGDASYEPPADEEVGR
                     KPDDPQVSEATKKAFKEVLDAIQANSPEGQLQVSKGSECNLMDIGVTDTSKFDRLTKE
                     SLEKCLQIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSGDGILIVGGGKYSV
                     FALPAIKAIRENSGFKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDPLGLTKCVFLDE
                     MFDADTLSHIEGYQIKALALLVSRFERVLMLDADNYVVNSINDYFTSSALNDKGLILW
                     PDYWRRLHHPKLYGIVDLGVSPDHISRYSVDDVSPDYMYKKSVTDTPFHDFRDALPDG
                     GTESGQLLVDKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDTFALASRVMHG
                     PGSFYQVKTPVDTLGHWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYIEDSKFSSLA
                     REVLGNTIRNNEEKFCDEWAAKNKGKFSAEEKARREECKKSKEVQDALHEKMRASYKL
                     DDYLAFFSFTGVSFVHSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYVPAHSGNY
                     RMYDSKFNQISSYDLELANWSAFKSYLCDLEGGYKNFGYLSNKIDSTKSPKQSNKDMC
                     KYIEERVEYLKSTSWNDYDV"
     gene            complement(<754506..>755567)
                     /locus_tag="KLTH0C08998g"
                     /db_xref="GeneID:8291489"
     mRNA            complement(<754506..>755567)
                     /locus_tag="KLTH0C08998g"
                     /product="KLTH0C08998p"
                     /transcript_id="XM_002552569.1"
                     /db_xref="GeneID:8291489"
     CDS             complement(754506..755567)
                     /locus_tag="KLTH0C08998g"
                     /note="similar to uniprot|Q4WG56 Aspergillus fumigatus
                     Afu7g03850 Oxidoreductase 2-nitropropane dioxygenase
                     family putative"
                     /codon_start=1
                     /product="KLTH0C08998p"
                     /protein_id="XP_002552615.1"
                     /db_xref="GeneID:8291489"
                     /db_xref="GOA:C5DEG6"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DEG6"
                     /translation="MSSSLRSIYPWIRSPLVACSPMLRISQPALAVAVSHAGGLGFVA
                     GGYDTDELALNMKNAVGLLRGLDPPVPTQTGVLPIGIGFVLWGCDLERSVQVIQQFVP
                     AAVWLFAAPSNEQYALWASRIRDATQSRTQIWIQVAGVKEGLDVVRAAQPDVLVAQGN
                     DAGGHGMKRSASVISLVPELRDSLDAHGFGRTTVLAAGGIVDGRGAAAALVLGADGVV
                     MGTRFLASHEAVVAKGYQQELLRAEDGGVSTVRSRLFDRVKETNGWPDDYDGRAFVNR
                     TFLDAQNGMPVEQNISLHKQEVAHGDTDGGVKARTIRYAGTGVGLIHDVVPAAEIVNT
                     VAAEVEMSLAKAIKKLNAA"
     gene            <756619..>757752
                     /locus_tag="KLTH0C09020g"
                     /db_xref="GeneID:8291490"
     mRNA            <756619..>757752
                     /locus_tag="KLTH0C09020g"
                     /product="KLTH0C09020p"
                     /transcript_id="XM_002552570.1"
                     /db_xref="GeneID:8291490"
     CDS             756619..757752
                     /locus_tag="KLTH0C09020g"
                     /note="similar to uniprot|P38071 Saccharomyces cerevisiae
                     YBR026C ETR1 2-enoyl thioester reductase member of the
                     medium chain dehydrogenase/reductase family localized to
                     in mitochondria where it has a probable role in fatty acid
                     synthesis"
                     /codon_start=1
                     /product="KLTH0C09020p"
                     /protein_id="XP_002552616.1"
                     /db_xref="GeneID:8291490"
                     /db_xref="GOA:C5DEG7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DEG7"
                     /translation="MKPFISGKRFLSGKVPASFKSLVYSSHDAEDCTKVLSLHQYAAK
                     APSESSIVLRTLAFPINPSDINQLEGVYPSKPKKTLELGTKEPSAIAGNEGVFEVVHL
                     PQGVRGLSVGDMVIPLQANFGTWSTFRTCQDASQLVKIEACDKLAAATIAVNGCTAYQ
                     LLNNYVKWDKNGNEWLVQNAGTSSVSKIVTQLARLQNIKTLSVIRDRDNFEEVARDLE
                     TKFGATKVISESQNNDKVFGKETLPSILGPEARVKLALNSVGGKSSSSIARKLETDAT
                     MLTYGGMSKMPVVLPTSLHIFKGLKSLGFWVTRNSLLDPENKRQTVECVAKLYADGKL
                     LSPKEEARVLEWDVHNMSDQEVLELIKKGIKEKGKKNIVCLKW"
     gene            complement(<758149..>759279)
                     /locus_tag="KLTH0C09042g"
                     /db_xref="GeneID:8291491"
     mRNA            complement(<758149..>759279)
                     /locus_tag="KLTH0C09042g"
                     /product="KLTH0C09042p"
                     /transcript_id="XM_002552571.1"
                     /db_xref="GeneID:8291491"
     CDS             complement(758149..759279)
                     /locus_tag="KLTH0C09042g"
                     /note="similar to uniprot|P35206 Saccharomyces cerevisiae
                     YBR036C CSG2 Endoplasmic reticulum membrane protein
                     required for mannosylation of inositolphosphorylceramide
                     and for growth at high calcium concentrations"
                     /codon_start=1
                     /product="KLTH0C09042p"
                     /protein_id="XP_002552617.1"
                     /db_xref="GeneID:8291491"
                     /db_xref="UniProtKB/TrEMBL:C5DEG8"
                     /translation="MRIALWLTAVLGYVVQIKCISHIYSTSVQGTLDVLYFLFAHCSS
                     WILVAPLTQVYYYVRYGKTNRREIWNMGFWVAIQDYNIGSDAEAQMQGASKVGRQVKR
                     ALQFAILAGLISIAGYTFLMSLNLSPALDIAIIHNTSMFEIVSLLLVVTGLASRRHLL
                     QNFLMMVVILIGILIVSYTKATCDVLSGKLSINQDTGELNDPFLFDRLKGALICGLGA
                     LTIGPVFVLWSKWTANAKNTKEGAIRPFTASRDRNFVSNCEISLVGVFNLMILGTALL
                     VCGKGGSGSQTVMYKSEWILVSIFAGHLPMVVATVHLSRRVSPIFTSTCFIGCIVFTA
                     LADWIAESAQSIITRWEVIGYLMVSITGIFLGRRYLATARFK"
     gene            759509..759582
                     /locus_tag="KLTH0C09064r"
                     /db_xref="GeneID:8291492"
     tRNA            759509..759582
                     /locus_tag="KLTH0C09064r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:8291492"
     gene            complement(<759755..>760166)
                     /locus_tag="KLTH0C09086g"
                     /db_xref="GeneID:8291493"
     mRNA            complement(join(<759755..759867,759935..>760166))
                     /locus_tag="KLTH0C09086g"
                     /product="KLTH0C09086p"
                     /transcript_id="XM_002552572.1"
                     /db_xref="GeneID:8291493"
     CDS             complement(join(759755..759867,759935..760166))
                     /locus_tag="KLTH0C09086g"
                     /note="similar to uniprot|P13902 Saccharomyces cerevisiae
                     YOL108C INO4 Transcription factor required for
                     derepression of inositol-choline-regulated genes involved
                     in phospholipid synthesis forms a complex with Ino2p that
                     binds the inositol-choline-responsive element through a
                     basic helix-loop-helix domain"
                     /codon_start=1
                     /product="KLTH0C09086p"
                     /protein_id="XP_002552618.1"
                     /db_xref="GeneID:8291493"
                     /db_xref="GOA:C5DEG9"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DEG9"
                     /translation="MTNSTAPSDTGADPADQRKRKRASRESSLSEDQKRQNHVSSEQR
                     RRQAMRQTYDTLVDIVPDLTSAQSRSELQIYAKSYNYLVWLYERNRALREQLERKTGS
                     SAPQHLAWEMPQ"
     gene            760796..760867
                     /locus_tag="KLTH0C09108r"
                     /db_xref="GeneID:8291494"
     tRNA            760796..760867
                     /locus_tag="KLTH0C09108r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=66.41"
                     /db_xref="GeneID:8291494"
     gene            <761006..>762004
                     /locus_tag="KLTH0C09130g"
                     /db_xref="GeneID:8291495"
     mRNA            <761006..>762004
                     /locus_tag="KLTH0C09130g"
                     /product="KLTH0C09130p"
                     /transcript_id="XM_002552573.1"
                     /db_xref="GeneID:8291495"
     CDS             761006..762004
                     /locus_tag="KLTH0C09130g"
                     /note="similar to uniprot|Q12239 Saccharomyces cerevisiae
                     YOL107W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C09130p"
                     /protein_id="XP_002552619.1"
                     /db_xref="GeneID:8291495"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="UniProtKB/TrEMBL:C5DEH0"
                     /translation="MHYRSKIFEINVPPSVLNARDLPNATALLTAAYIVFTLSLWWVK
                     WSYPSLEANADATRAPVFSPILQLVPAQTLYDPWSLVLSNLVDVKWWKIGVDLLNLVV
                     GGSFIERNWNSSWELVRFLLVIGSVSNLVVVLVTILSSAVFPKVRLDTPLDGNYTMLV
                     GFCIVYKQLIPETTIFHIRNLPLVSKNFRFKLLPIFVLVVSTVTQLMFLRHFSELLSI
                     WVTFLCSWVYLRFFQVLPPAITGAASRSLVGDASDTFQLIYFFPDIIKPFLSPIFNMC
                     YWVFCVKLRIREPFNEDDVDTGNSLAEQRGAKVITSQVEERRRKLALQVLQERGTV"
     gene            complement(<762101..>762973)
                     /locus_tag="KLTH0C09152g"
                     /db_xref="GeneID:8291496"
     mRNA            complement(<762101..>762973)
                     /locus_tag="KLTH0C09152g"
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /transcript_id="XM_002552574.1"
                     /db_xref="GeneID:8291496"
     CDS             complement(762101..762973)
                     /locus_tag="KLTH0C09152g"
                     /note="similar to uniprot|P36520 Saccharomyces cerevisiae
                     YNL284C MRPL10 Mitochondrial ribosomal protein of the
                     large subunit appears as two protein spots (YmL10 and
                     YmL18) on two-dimensional SDS gels"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /protein_id="XP_002552620.1"
                     /db_xref="GeneID:8291496"
                     /db_xref="GOA:C5DEH1"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:C5DEH1"
                     /translation="MLLTRSTGVFQGIQTGLRQLAVSQCRQVSILSQLRPSEGSIKAY
                     KRVGRGPSSGRGKTSTRGQKGQKARGKVKSWFEGGQTPIYKLFPKIGFTNVTSLTLNE
                     LNLERIMWFHRKGRLNLAPGETLDMKKMKDIGLVTGSIKHGIKVLGEGKQFYNLPIKI
                     EATRASKDAIQAIEKAGGEFTARYFNQLGLKAHLSPQWFLQKRGRIPLQARPVKRKDI
                     DYYSNEKKRGYLVKENDPLLQQIQQAQAGGHDHLVKKGGKKSALELQLESVQDMHASK
                     SAPSRIITLEELTK"
     gene            763130..763202
                     /locus_tag="KLTH0C09174r"
                     /db_xref="GeneID:8291497"
     tRNA            763130..763202
                     /locus_tag="KLTH0C09174r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:8291497"
     gene            complement(<763731..>765050)
                     /locus_tag="KLTH0C09196g"
                     /db_xref="GeneID:8291498"
     mRNA            complement(<763731..>765050)
                     /locus_tag="KLTH0C09196g"
                     /product="KLTH0C09196p"
                     /transcript_id="XM_002552575.1"
                     /db_xref="GeneID:8291498"
     CDS             complement(763731..765050)
                     /locus_tag="KLTH0C09196g"
                     /note="some similarities with uniprot|Q12215 Saccharomyces
                     cerevisiae YOL105C WSC3 cell wall integrity and stress
                     response component 3 Putative integral membrane protein
                     containing novel cysteine motif. Similarity to SLG1 (WSC1)
                     WSC2 and WSC4"
                     /codon_start=1
                     /product="KLTH0C09196p"
                     /protein_id="XP_002552621.1"
                     /db_xref="GeneID:8291498"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:C5DEH2"
                     /translation="MKTLLKVPWAVLALTSMARVSQAATASYSQVGCYKEADLESALS
                     SKGSYIYQSVSYCEEQCDGSEVAALLGGNTCYCGDASALGGASSGDSSNCNTKCAGWP
                     YDTCGGSGYMQVYVREGVSVPSASASSSASSSSASSTSSSTSTSTSSSSSSSTKSSTS
                     SSSQSSTTSSSTTRSSSTSASSSSSSSSTSSSASSTSSSDTSSSTSAATSSASSSSSP
                     SSSSQPSSSSPASSSTSSSATPSSTSSTVSATNSPSVSATSVTLSRTTMVTASVSVVT
                     LSNNNRSTMYVTATTIVEAPSSSAQANASTKNNSNGKSKKSLSGGAIAGVVIGAIVGS
                     FLIAATVFFLFWRRRNRREADLEETKQHQPYSFGGTGAVPLAGATRRNTSLNASSSSN
                     DAQFTDEYLQASPTFEDSFGRIRLSNGSLPDVTQEHGPLRIVNPDSD"
     gene            complement(766122..766194)
                     /locus_tag="KLTH0C09218r"
                     /db_xref="GeneID:8291499"
     tRNA            complement(766122..766194)
                     /locus_tag="KLTH0C09218r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8291499"
     gene            complement(<766620..>771260)
                     /locus_tag="KLTH0C09240g"
                     /db_xref="GeneID:8291500"
     mRNA            complement(<766620..>771260)
                     /locus_tag="KLTH0C09240g"
                     /product="KLTH0C09240p"
                     /transcript_id="XM_002552576.1"
                     /db_xref="GeneID:8291500"
     CDS             complement(766620..771260)
                     /locus_tag="KLTH0C09240g"
                     /note="similar to uniprot|P14772 Saccharomyces cerevisiae
                     YLL015W BPT1 ABC type transmembrane transporter of
                     MRP/CFTR family found in vacuolar membrane involved in the
                     transport of unconjugated bilirubin and in heavy metal
                     detoxification via glutathione conjugates along with
                     Ycf1p"
                     /codon_start=1
                     /product="KLTH0C09240p"
                     /protein_id="XP_002552622.1"
                     /db_xref="GeneID:8291500"
                     /db_xref="GOA:C5DEH3"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEH3"
                     /translation="MATYQQTHTIKRQFMGQKDCAYGLRPYPDHKTNALNPCFLSAVS
                     VGHASFFAIIGVFQLARLARERRVPPNFRYVSSWKSISTRHLLHLSNIGLQSVLFICA
                     LSVCGPDTSQITKWGLVSQLLYVALISLPSQVIEFYKSTASLAGQLFYYLTQIFLLGY
                     QLGQRISHYPDERFVIVTGSYGAFLEVALLVNAISIFLYDLLSYKPSQELLNYYEEHK
                     MYQECNLLQNLTFTWMNKLIGQVYRDGEIKDPHNMPLPPINLSIKEKAGALGASWAKE
                     NWTGRNSLLWAIMNTFGKTIIIAISIEVVKDFMTILQPQLLRLFIEEFNQDRERTHPL
                     INAVFIAFALFLMKLVSTCLSNQFFIMIFEAGMGIRGALMTMLYQKSLKLSSEAREGK
                     TAGDIMNMMAVDVLRIQRFFETSQELVGSPIALLTTLVSLYTFLGYSTAGGVVIMAVM
                     FPINSYLSRKIKVLIKKQMEYKDARIKTVTEILNSVKTVKLYAWEEPMLKRLDHVRNE
                     LELESFKKIAVMNNLTLFAWNCVPILVASSTFLIYALVMDVPLTPQIVFPSLSLFDIL
                     NDCIYTIPRTIINFIETGVSMGRLKDFLLAKELDKSFIEFESLPDDPNVPVIEVHNAT
                     FLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRVGAGKSTFLHA
                     LLGQLPCISSSHDQATPKMHFRCDSVALCSQQAWILNASVKYNVLFGHKYDEASYKAT
                     IEACQLLPDLGILADGDETLVGEKGISLSGGQKARISLARAVYSRSDVYLLDDILSAV
                     DAEVCKRIIDHVLSRKTGLLKNKTVILTTNSISVLKHSQSIYALENGEIVERGSFDEI
                     MSKDAESKLKTLIAEFGSDSSAVKDDEPIPEQKPPVDLQEVEDDALEEEINPEVPFEL
                     DNAFSSDFRSRKASMATLRARKIIDLNADTRKTAQKAEKKEKGRVKTKVYVAYLKACG
                     ILGAVLFLVFIGFSRVLLVGENFWLKHWSEKNEKNGENRNAVFFVGIYVLISLGAAFF
                     NSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRIINRFSSDMNSVDDN
                     VQYVISFFLISILDYVVVVVIIGYQVPLFLLVNAALLGIYLYYQVFYVTLSRELKRLM
                     STSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNIEAVQFNINCVFNFRSTNRWLSIR
                     LESIGALMILTTALLSLATTTGDKALSTGMVGLLMSYALQVTNKLMWIVRMSVQLETN
                     VVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSARYRENLDPVLKKLNV
                     EINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDITKIGLADLRSHLSII
                     PQDAQAFEGSVRSNLDPFEQYSDDEIWRALELSHLKPHILKMANEEGPEKTKNLLETK
                     ISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEFKDRT
                     ILTIAHRIDTVMDSDKIMVLDQGEVKEFDSPSNLLADKNTIFYNLCSQGGYL"
     gene            <772193..>772783
                     /locus_tag="KLTH0C09262g"
                     /db_xref="GeneID:8291501"
     mRNA            <772193..>772783
                     /locus_tag="KLTH0C09262g"
                     /product="KLTH0C09262p"
                     /transcript_id="XM_002552577.1"
                     /db_xref="GeneID:8291501"
     CDS             772193..772783
                     /locus_tag="KLTH0C09262g"
                     /note="similar to uniprot|P53833 Saccharomyces cerevisiae
                     YNL282W POP3 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="KLTH0C09262p"
                     /protein_id="XP_002552623.1"
                     /db_xref="GeneID:8291501"
                     /db_xref="InterPro:IPR013241"
                     /db_xref="UniProtKB/TrEMBL:C5DEH4"
                     /translation="MSSLKEIQQNTARRKQVYKPILDNPFTDEAHMWPYVRDQPLVAE
                     LVRSHVIEPLAHAHAMKLQGTLNAHFGFNSVVQYLEAPPTSDSVFLFVCNRDSVPSVL
                     LSQIPILAQVSSCDITLVPLPRGTSDSLGACTSTDHDGLLLVVQDGKFDPHIATQLSA
                     HVDHVKEKPWLLFSKSRIAALSSTAAISSKSKSKSK"
     gene            <773048..>773485
                     /locus_tag="KLTH0C09284g"
                     /db_xref="GeneID:8291502"
     mRNA            <773048..>773485
                     /locus_tag="KLTH0C09284g"
                     /product="KLTH0C09284p"
                     /transcript_id="XM_002552578.1"
                     /db_xref="GeneID:8291502"
     CDS             773048..773485
                     /locus_tag="KLTH0C09284g"
                     /note="similar to uniprot|P53834 Saccharomyces cerevisiae
                     YNL281W HCH1 Heat shock protein regulator that binds to
                     Hsp90p and may stimulate ATPase activity originally
                     identified as a high-copy number suppressor of a HSP90
                     loss-of-function mutation GFP-fusion protein localizes to
                     the cytoplasm and nucleus"
                     /codon_start=1
                     /product="KLTH0C09284p"
                     /protein_id="XP_002552624.1"
                     /db_xref="GeneID:8291502"
                     /db_xref="GOA:C5DEH5"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="UniProtKB/TrEMBL:C5DEH5"
                     /translation="MVVLNPNNWHWVDKNTLPWTQTYMQELKISCDAKDGATTVRVTR
                     VNSVSGDSHVSQRKGKVICYFDLDLSFATEVVEAESGNSVCEGKIVVPELVHDETDFE
                     IRPEGFGDHHALVRDEFVPLLREALCKYQQDLIDHHSRDVQQS"
     gene            complement(<773612..>774934)
                     /locus_tag="KLTH0C09306g"
                     /db_xref="GeneID:8291503"
     mRNA            complement(<773612..>774934)
                     /locus_tag="KLTH0C09306g"
                     /product="KLTH0C09306p"
                     /transcript_id="XM_002552579.1"
                     /db_xref="GeneID:8291503"
     CDS             complement(773612..774934)
                     /locus_tag="KLTH0C09306g"
                     /note="similar to uniprot|P32462 Saccharomyces cerevisiae
                     YNL280C ERG24 C-14 sterol reductase acts in ergosterol
                     biosynthesis mutants accumulate the abnormal sterol
                     ignosterol (ergosta-8 14 dienol) and are viable under
                     anaerobic growth conditions but inviable on rich medium
                     under aerobic conditions"
                     /codon_start=1
                     /product="KLTH0C09306p"
                     /protein_id="XP_002552625.1"
                     /db_xref="GeneID:8291503"
                     /db_xref="GOA:C5DEH6"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:C5DEH6"
                     /translation="MAKSNAPLNPRTTSFEFSGIPGALGITFGLPLVCVVLNQMIRPD
                     YHITGFFSNFDVAELWNHIKPLKWYMTNRELWTYYLCWFGSLAILDVVLPGPVMEGVE
                     LRDGTKLRYKINGIALCSLLSSVLAVRWKLTGGQLPELQYLYEHQTDFCIIVVIFSFI
                     MSVFLYMASFFPLTGENGTGTKERILSVSGNTGNVIYDWFIGRELNPRVGPLDLKMFC
                     ELRPGLLLWCLINISCLHHYYLETGKINNAILFVTLAQGFYVFDGVLNEEGVLTMMDI
                     TTDGFGYMLTFGDLALVPFTYTLQARYLTVSPITLTKGYLAFLTGIMALGYYIFHSAN
                     KQKSDFRHGKLPHLESMDTKRGTKLLCDGWWGMSQHMNYFGDWLISLSWCLATGFQTP
                     LTYYYSLYFATLLFHRQQRDEHLCKIKYGDDWKRYEEKVPYKIIPYVY"
     gene            complement(<775129..>776121)
                     /locus_tag="KLTH0C09328g"
                     /db_xref="GeneID:8291504"
     mRNA            complement(<775129..>776121)
                     /locus_tag="KLTH0C09328g"
                     /product="KLTH0C09328p"
                     /transcript_id="XM_002552580.1"
                     /db_xref="GeneID:8291504"
     CDS             complement(775129..776121)
                     /locus_tag="KLTH0C09328g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C09328p"
                     /protein_id="XP_002552626.1"
                     /db_xref="GeneID:8291504"
                     /db_xref="UniProtKB/TrEMBL:C5DEH7"
                     /translation="MNDSTYRVSFSEDSDDSQDDTVVPFITLVRNRNVLPPSEFVDSI
                     ANDNLKNCHNLVFLLWLLNSPVHLNHEFLRSDRPFLLFSNCYSASGSHNYEEYLQIWP
                     RFAKTGGDSADSFEVSVFPQALQFTKLDQFRMDKLTHQYTQQFGRILNSYSLQSSQQS
                     SHYLRANLHALLQSYVYDTLFDLFFKWKSWSQITGRGFGLVSFSSLVGKFWDSYMCLQ
                     FDDSLQSLASTLNSKSDCKNFTQQPETDFTGCKSWRIRYAVWVDTANGIMLLINGVNG
                     GNIGVVPAQGLDLTPRNVEQNISKLLLFVNMCLIECLSWELNGKTETGLYIKGG"
     gene            <776304..>777332
                     /locus_tag="KLTH0C09350g"
                     /db_xref="GeneID:8291505"
     mRNA            <776304..>777332
                     /locus_tag="KLTH0C09350g"
                     /product="KLTH0C09350p"
                     /transcript_id="XM_002552581.1"
                     /db_xref="GeneID:8291505"
     CDS             776304..777332
                     /locus_tag="KLTH0C09350g"
                     /note="some similarities with uniprot|P28791 Saccharomyces
                     cerevisiae YDR498C SEC20 Membrane glycoprotein v-SNARE
                     involved in retrograde transport from the Golgi to the ER
                     required for N- and O-glycosylation in the Golgi but not
                     in the ER forms a complex with the cytosolic Tip20p"
                     /codon_start=1
                     /product="KLTH0C09350p"
                     /protein_id="XP_002552627.1"
                     /db_xref="GeneID:8291505"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="UniProtKB/TrEMBL:C5DEH8"
                     /translation="MIQDSEFDGYVSKLQQLEAQLLSDPYSAAAVEVLSQYAEMVRVL
                     IVCATQRHRGLRISWKRFNDLKIEGGAGKDDEEAAEHVAQIVQAVDFVVALEKRYKAA
                     QVEANDEFGARLKELRAERYAKYREQVAEQQGRAEQQSQEEGAGQPVSKKQQLLTTNK
                     KITSTLMRTSHLLQSSVMQSELNLGELQEQTRSMHKLNDRFDSLSGVLHTSSKIVKII
                     NDSSGRERRQIYTGLSFLGLCIAWVLWRRIFKLPVKLALWMWFRFSRALLASLGALPK
                     TKVPAPMVLNTVAPAIASTATNALSAVSAVSAESAQTAATEQATASMESLVQDAVDGA
                     FARIRDEL"
     gene            <778251..>780077
                     /locus_tag="KLTH0C09372g"
                     /db_xref="GeneID:8291506"
     mRNA            <778251..>780077
                     /locus_tag="KLTH0C09372g"
                     /product="KLTH0C09372p"
                     /transcript_id="XM_002552582.1"
                     /db_xref="GeneID:8291506"
     CDS             778251..780077
                     /locus_tag="KLTH0C09372g"
                     /note="highly similar to uniprot|P30605 Saccharomyces
                     cerevisiae YDR497C ITR1 Myo-inositol transporter with
                     strong similarity to the minor myo-inositol transporter
                     Itr2p, member of the sugar transporter superfamily;
                     expression is repressed by inositol and choline via Opi1p
                     and derepressed via Ino2p and Ino4p"
                     /codon_start=1
                     /product="KLTH0C09372p"
                     /protein_id="XP_002552628.1"
                     /db_xref="GeneID:8291506"
                     /db_xref="GOA:C5DEH9"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DEH9"
                     /translation="MTLRKPESGVGSASGAESALAGRAQDRAQGHGHGFHEIDASKDS
                     NDDSAQSITVIEPDVTNGKLDADGALLDDRIQIRPVNDEDDTSVMITFNQKVSPFIIV
                     LTFVASISGFMFGYDTGYISSALVSIGTDLDHRALTYGDKEIITAATSLGALISSIFA
                     GTSADIWGRKPCLMFSNLLFTVGAVLQISARSFWQMAVGRLIMGFGVGIGSLISPLFI
                     GEIAPKNIRGRLVVINSLCLTGGQLVAYGCGAGLDKVHNGWRILVGLSLIPTCIQFVC
                     FWFLPDTPRYYVMKGRLDKAAEVLGKSYVDAPSELIHQKIQELNALNRTIPGDTIPKK
                     VWNTIKEIHTVPSNFRALILGCALQGIQQFCGWNSLMYFSGTIFETVGFSDSAAVSIV
                     VAGTNFVFTLVAFFAIDRIGRRCILLIGLPGMCGSLIVCAVAFHFLGVHFEGGGQATI
                     EHQGFSAWGIIVILSIIFYAAFYALGIGTVPWQQSELFPQAVRGIGTSYSTATNWGGS
                     LVIASTFLTMLQNITPTGTFALFAGLSLVSFFFCYFCYPELSGLELEEVQMILKDGFN
                     IKASKTLAKKRKQQLAAQKNSSGNGDLHDYHKSKPSDELMEC"
     gene            <780557..>782530
                     /locus_tag="KLTH0C09394g"
                     /db_xref="GeneID:8291507"
     mRNA            <780557..>782530
                     /locus_tag="KLTH0C09394g"
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /transcript_id="XM_002552583.1"
                     /db_xref="GeneID:8291507"
     CDS             780557..782530
                     /locus_tag="KLTH0C09394g"
                     /note="similar to uniprot|Q04373 YDR496C Saccharomyces
                     cerevisiae PUF6 Pumilio-homology domain protein that binds
                     ASH1 mRNA at PUF consensus sequences"
                     /codon_start=1
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /protein_id="XP_002552629.1"
                     /db_xref="GeneID:8291507"
                     /db_xref="GOA:C5DEI0"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012959"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DEI0"
                     /translation="MAPVISKKSGKKHSLNAKDQKTAKKAKLSSKVPEDEGVSGSSSE
                     EEDDLDEVLSSGESDKDELDESSSEGEQEDGSEGSEDESEGSSEAKGEDDSKGGVSQH
                     AEQRKLLKERKLQRKSGTQVQQIKSLWERLRVKNPPMPKEVREKLSNEIWELSKDCIS
                     DLVMKHDASRVVQTLVKYSSKARRDQIVAALKGQYYVLATSSYGKYLLVKLLHYGSKQ
                     SRQLIIDELHGSLRKLMRHREGAYVVEDLYVLYASHEQKQQMLREFWGSEYAVFRDAH
                     KNQTLEQVCESSAEKKTIIARNLIGTISASVEKGSTGFQILHAAMRDYVKIAGEKETS
                     EFIELLDEKYAELVHTPEGADVACTLLAKATAKERKMIIKNLKDHADKLIRNEHGNLV
                     FITALMCVDDTVLMFKSFGPSVKEMLQSFVVDKYGRRPFLYILLGLDGKYFSPIVKKD
                     LNRYIEYSKATSKKPFEQRRKELLNKFAPMYLSTISKYYDMILSDNLGSQFVSEVLVN
                     DEFYDQLSDKEKEKHREIVNTVSTYFKGDVSEESHPIHKPFSVRLLKSLIQGGKWNAK
                     EKKVEPLHSVLGLGTEFAQQFYEDIIDETNLLDWINNADSSFTIVAIYESLSKTENKK
                     FFKDLKKVSKKINKDDESNKGARLLLKLMNNKA"
     gene            <782703..>785471
                     /locus_tag="KLTH0C09416g"
                     /db_xref="GeneID:8291508"
     mRNA            <782703..>785471
                     /locus_tag="KLTH0C09416g"
                     /product="KLTH0C09416p"
                     /transcript_id="XM_002552584.1"
                     /db_xref="GeneID:8291508"
     CDS             782703..785471
                     /locus_tag="KLTH0C09416g"
                     /note="similar to uniprot|P23643 Saccharomyces cerevisiae
                     YDR495C VPS3 Vacuolar sorting protein"
                     /codon_start=1
                     /product="KLTH0C09416p"
                     /protein_id="XP_002552630.1"
                     /db_xref="GeneID:8291508"
                     /db_xref="GOA:C5DEI1"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="UniProtKB/TrEMBL:C5DEI1"
                     /translation="MSDGGNNSSDTTKESQDDVIENQENAPELDSPSEASGDEAEDLQ
                     ISEGPIKLQPLIQWLPKELNFTAFDAYDNNLYLGTDVGDLLHYFEMEPGNYMLVSQTK
                     FDDDRDLPIERIRILPLIELALVHCDGSLHFFLLPEFAPVPNMSNISEVNDFIVLKYS
                     ANSSSYKIQIFGESGARALRISNRKVTTSRTVYNKPITKARVHGKSLLAARGPNYELI
                     DLKDGSETPLFHVSETSTNLNPLIAPYSSNEFLLACGSSEGESAMGLVVNTQGDITQG
                     TIVFERFPLDLMIDLPFVIVDYGVTGVYVYQVEVNKEPTLVQTITSNRQKRIRFVRSS
                     HIFSVTNSENKSLVVDRLRLVPLKSGNHEFRINQEKEYVQSIFEESTPLVLYCSAGIY
                     LFCKKPVILEVTDYSESAIDHVTRILGDIESSPVLSVFAKVERNFFRTLYLLLETLHC
                     SSIDMDVAKKWCSFSQVIDIRIFLHLCGIEIYGDLWAPHGLQKFIAETRSLKLENKIE
                     NSLGVLSFMRETLKRSRLDELKDSENVLRSFDLAIVRICIEKDFDIEIDQCEPASFPD
                     IIKKVEKKQLRYAPVLLELCSRCGDYSRCLELLRDLDRPLDFSNFLLINYGHLQQQNS
                     YTGQDFLRDVIYLIKRCKTTKEREPVIGNIRKILECGELKTKNLISMADKSSTKILLL
                     ENLGAGDLNDKRYMIDYYVADLQELMETENLWDFFAELSATYSKELDYLKPAFGSFIN
                     LSLRQNPRCSRVLEICDKLRGLMYESENSFLNIVCDEVKKFDIANILTLYLVKDEDKE
                     AVFGENLLDELMTFNDYETIDRIVKEENVVKILKYYLQLNSQRDSIALVQKHIQKHLR
                     HLKHRDQIIAVLESVPLDYSLASIVDAITPIIIKLESTLGQQNVHKSLLKERIQSKQK
                     LLRRLGAE"
     gene            complement(<785549..>786610)
                     /locus_tag="KLTH0C09438g"
                     /db_xref="GeneID:8291509"
     mRNA            complement(<785549..>786610)
                     /locus_tag="KLTH0C09438g"
                     /product="KLTH0C09438p"
                     /transcript_id="XM_002552585.1"
                     /db_xref="GeneID:8291509"
     CDS             complement(785549..786610)
                     /locus_tag="KLTH0C09438g"
                     /note="weakly similar to uniprot|Q8X185 Saccharomyces
                     cerevisiae YDR494W RSM28 Mitochondrial ribosomal protein
                     of the small subunit genetic interactions suggest a
                     possible role in promoting translation initiation"
                     /codon_start=1
                     /product="KLTH0C09438p"
                     /protein_id="XP_002552631.1"
                     /db_xref="GeneID:8291509"
                     /db_xref="UniProtKB/TrEMBL:C5DEI2"
                     /translation="MIGFQGLRTPKRLYSSTISQDFLRNVLERVKETASKKPLSNNGG
                     TRNRNPRGPRGNKEGRSTRGASSESRDNFRRVGNKTVPGNDSEAAPRPKKPWINANVV
                     NRQPQFQRKTGAAGLSSKQKVDESLMDALDAVQQGNVKGKPQTTRGRRAPKTAQKSVP
                     GMSQSPGSVEGIVAQAKKSTVSRQYVPDEPTPLSLLKYAPKLAYSSSSKMSSFGVSTL
                     DQSDFPLTRRVNLGVATSPSQKPLNVSLSPRTAAFGQYAPASSLVWCKEKLLKNVSIR
                     ADFDQFESSVNGKYEKLVPATERDFQAVSKNNQKRAELVNNSDVVRLSLQKSNMDFAS
                     KSLVYQVCSGLEPISSLKA"
     gene            complement(<786979..>787656)
                     /locus_tag="KLTH0C09460g"
                     /db_xref="GeneID:8291510"
     mRNA            complement(<786979..>787656)
                     /locus_tag="KLTH0C09460g"
                     /product="KLTH0C09460p"
                     /transcript_id="XM_002552586.1"
                     /db_xref="GeneID:8291510"
     CDS             complement(786979..787656)
                     /locus_tag="KLTH0C09460g"
                     /note="similar to uniprot|Q12272 YOL102C Saccharomyces
                     cerevisiae TPT1 tRNA 2'-phosphotransferase"
                     /codon_start=1
                     /product="KLTH0C09460p"
                     /protein_id="XP_002552632.1"
                     /db_xref="GeneID:8291510"
                     /db_xref="GOA:C5DEI3"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="UniProtKB/TrEMBL:C5DEI3"
                     /translation="MSEGKRDVQISKSLAYLLRHGALKEKLPIDPNGYIPISVLLQHN
                     RLKSLHCTQQDVDRVVANNAKKRFHIKTEDNNVLICATQGHSIAAVAPAGDVLQPITA
                     DDKLPEKLVHGTNLKNCKLIIESGGIRKMRRNHVHLAAGITGLDGEVVSGTRTSSNVF
                     IFLKRELAFQQLRLFKSLNDVYLTADDVPTELFEKVLLRTRSANKKGISELVLLLESK
                     GIPVELQ"
     gene            complement(<787911..>788267)
                     /locus_tag="KLTH0C09482g"
                     /db_xref="GeneID:8291511"
     mRNA            complement(<787911..>788267)
                     /locus_tag="KLTH0C09482g"
                     /product="KLTH0C09482p"
                     /transcript_id="XM_002552587.1"
                     /db_xref="GeneID:8291511"
     CDS             complement(787911..788267)
                     /locus_tag="KLTH0C09482g"
                     /note="similar to uniprot|Q03429 YDR493W Saccharomyces
                     cerevisiae FMP36"
                     /codon_start=1
                     /product="KLTH0C09482p"
                     /protein_id="XP_002552633.1"
                     /db_xref="GeneID:8291511"
                     /db_xref="GOA:C5DEI4"
                     /translation="MSTSSMALAAYRNGLRATKVAFGQDLRMLQAARSKMREGMANPP
                     NPELAPEQQIQHLNEVSQFLRRNIVQGKRGEGDKYTLNIHKETELGDNETIKTTKKTL
                     VSRGGGCCGGGQGLYK"
     gene            complement(<788442..>789401)
                     /locus_tag="KLTH0C09504g"
                     /db_xref="GeneID:8291512"
     mRNA            complement(<788442..>789401)
                     /locus_tag="KLTH0C09504g"
                     /product="KLTH0C09504p"
                     /transcript_id="XM_002552588.1"
                     /db_xref="GeneID:8291512"
     CDS             complement(788442..789401)
                     /locus_tag="KLTH0C09504g"
                     /note="similar to uniprot|Q6Q557 Saccharomyces cerevisiae
                     YDR492W IZH1 Membrane protein involved in zinc metabolism
                     member of the four-protein IZH family transcription is
                     regulated directly by Zap1p expression induced by zinc
                     deficiency and fatty acids deletion increases sensitivity
                     to elevated zinc"
                     /codon_start=1
                     /product="KLTH0C09504p"
                     /protein_id="XP_002552634.1"
                     /db_xref="GeneID:8291512"
                     /db_xref="GOA:C5DEI5"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:C5DEI5"
                     /translation="MSSTYTLRQRRQQCAPNKGKAGTSGATAPGKNGLCCFEELPDWQ
                     RDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVMLMFFTDLFLIP
                     QFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDYMGIIVLISC
                     STVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAGFFVTFGF
                     SGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGKFDFVG
                     HSHQIFHILVVLGSLCHFRALLGSYFFMHTGISSPGLLNLKAL"
     gene            complement(<791169..>791753)
                     /locus_tag="KLTH0C09526g"
                     /db_xref="GeneID:8291513"
     mRNA            complement(<791169..>791753)
                     /locus_tag="KLTH0C09526g"
                     /product="KLTH0C09526p"
                     /transcript_id="XM_002552589.1"
                     /db_xref="GeneID:8291513"
     CDS             complement(791169..791753)
                     /locus_tag="KLTH0C09526g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C09526p"
                     /protein_id="XP_002552635.1"
                     /db_xref="GeneID:8291513"
                     /db_xref="UniProtKB/TrEMBL:C5DEI6"
                     /translation="MSALVNSNFEEEVGEYVSRAKFRKRIRSWLSTSKEDWAGASGCE
                     KHTAKEVSYDTEQLDFLLRLSGLQETQEDPRRDSLSLTSAEKLCSSVLSSGDEAEPTT
                     RRGRILQFYRKLKSSFHRPSAGSLPGLREKHASKPWINLQEGEANFPELPQSKTDGAG
                     LSDFVSPPCLSHDQMCTDVAVTRLSLEQWSLRDS"
     gene            <792218..>795199
                     /locus_tag="KLTH0C09548g"
                     /db_xref="GeneID:8291514"
     mRNA            <792218..>795199
                     /locus_tag="KLTH0C09548g"
                     /product="KLTH0C09548p"
                     /transcript_id="XM_002552590.1"
                     /db_xref="GeneID:8291514"
     CDS             792218..795199
                     /locus_tag="KLTH0C09548g"
                     /note="similar to uniprot|Q12236 YOL100W Saccharomyces
                     cerevisiae YOL100W PKH2 Serine/threonine protein kinase
                     involved in sphingolipid-mediated signaling pathway that
                     controls endocytosis"
                     /codon_start=1
                     /product="KLTH0C09548p"
                     /protein_id="XP_002552636.1"
                     /db_xref="GeneID:8291514"
                     /db_xref="GOA:C5DEI7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DEI7"
                     /translation="MSFRFERPLIPENETDGHHDRTTPGFTLLPPEKDMSTQSVPDSL
                     QASRGYNSSRHIYGQNVPRPPLMEKALTNTDKFIQIHNGDSGQLRSDQNDEAISLSSD
                     DNSADTSGSNMSIKEMTMNEAMRRRQEEWAERGAAKIVKEVVNPETGVTARHVIKKGI
                     KDFKFGEVLGDGSYSTVMLARSIDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRL
                     NDGRGIIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYGSLNQDCSVYYSAQILDAID
                     YLHQKGVIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSFVGTA
                     EYVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAG
                     FPLIIRDLIKQILVKNPEQRLDTLQVKKHHFFKDTNFHDGSVWDTDPPEIAPYKITAK
                     AMQPVPALKEAKPHLIINMPKKTPRSSSSSLPTTPEPTPDNKKPVASKPASDARTAQI
                     LENAKREINNRRQNNRRTTSAASAAAQALMKKAPKSSPATSLSKRTDASQDGAPGKTA
                     SPRPPHTAPAARSSDRALPSAAISTAMNLAPAVPPMSKTDILWSFYLKSLDERVLKMG
                     ELEMTTSKTSFLEKRISKSGASLVDPEKSSQRTTLLSQVARSGGGVTGFRNESANSVL
                     SEKGYYLEWDIPEDVVADLFKKPTTEDTETHAVSNKFKKLFQVKAEDTEKPELLPGSE
                     FLRKVAVITTFGRCLIFVKRNKLQPETNLFFDLEYDINLSQKGTKIKEIVGGRPQDTK
                     EMNFVIETPFKSFIFKCDTSDTTWLPSLTKSVKLNHDRLLLKNKAEDPSGIASRAAQL
                     ASPGLASTASFGSEASSTFVRASPKSPSVPKSSSLTKSPSKSSFALSASLNSAGGKQE
                     RLFDTFVSSKGKQGKKLAKPVPLSGKLVNGLPTESLLNDNHSMQPDFSAKNGHSIGGN
                     SRVISGKSSRMLARSDRPLRR"
     gene            complement(<795587..>798715)
                     /locus_tag="KLTH0C09570g"
                     /db_xref="GeneID:8291515"
     mRNA            complement(<795587..>798715)
                     /locus_tag="KLTH0C09570g"
                     /product="KLTH0C09570p"
                     /transcript_id="XM_002552591.1"
                     /db_xref="GeneID:8291515"
     CDS             complement(795587..798715)
                     /locus_tag="KLTH0C09570g"
                     /note="similar to uniprot|Q12496 Saccharomyces cerevisiae
                     YOL098C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C09570p"
                     /protein_id="XP_002552637.1"
                     /db_xref="GeneID:8291515"
                     /db_xref="GOA:C5DEI8"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C5DEI8"
                     /translation="MAFNKLVSFQVEYAPQYHLAKYVSPRTRLQLVHINNKASPLVQG
                     YFAVATECPTDSGVPHTLEHLIFMGSKKFPYKGLLDTAGNLCMSSTNAWTATDQTVYT
                     LTSAGWQGFKKLLPVYLDHVLHPTITDDACTTEVYHVDPEDLQEKGVVFSEMEGIESQ
                     SWFITMLEKQRQMFPEGSGYRSETGGLTSQLRHLTNEEIRQFHKDMYSPENLCLIICG
                     NVPEDELLSILTQFDETLPEFKGDRRRPFLDSKESQIPVKRTQTIETEIEFPETDESQ
                     GEILMSWIAEPYSSHLEDLAVSILMDYFTKTALAPFNSQLVEIDDPYANFADYWTDDF
                     MRTIMNLNFHGVPVKRLGEAKEKVLDILKSHKIDISRIRQVLENGKWDYVMDCEKNGC
                     TLLSQTCITDFLYGDESGEILEQSIKDLKDFDVLSSWTVDEWQNLLKKVFIKNHPVIV
                     LGKPSMELYKRLQDEKEERTKQAEQKLGKKGKEMLKERLEEAIRHNSVEVPSDLLREF
                     VIEEPEKSVDFISTEGVSTVSSTKEVTESPLAQRILKSKPENFPFFLRLEQFPSQFIE
                     LRVLLNSAKVKDVTLLPLYHVICELFSMPMKAEDGSIISFESVVSALKSETVDSQISL
                     GPSRSFPDLLEIQISCKNADYENAVKWIKHCLFDMVFDEKRVRVLLEKYLSSIVEIKR
                     EGESMVRSLFDRHFYTARTMKKSTDALFVEEIIEDILDDIDDGKFKKEVLPQLNAMRD
                     QMVADLHSYHILIFGDIEKLNNVYEPWLPVAARASKGKSAITDVPPVPRLIDCLSPLG
                     NHPKGVAHIITTPASESSYMTTATKLDLGNDYSHPDYATLCLAAEYLECVEGPFWKGI
                     RGSGLAYGANIVKMSESDAIGFSVYRGADVIECYKTARNIVNDYASGKCDIEPQLLQG
                     AMSSIINGIATAESDYFSAALMKYIDDYCRKRGPDFNQAFLQRLGMVTVSDIQAALAK
                     YFTSIFDANTSSVFISCHPGKLETIQAFLEKEGYKVIVEELEDESDEDSEAESDEDSE
                     AESDEVSTNESE"
     gene            complement(799014..799104)
                     /gene="SNR58"
                     /locus_tag="KLTH0C09592r"
                     /db_xref="GeneID:8291516"
     ncRNA           complement(799014..799104)
                     /ncRNA_class="snoRNA"
                     /gene="SNR58"
                     /locus_tag="KLTH0C09592r"
                     /product="snR58"
                     /note="C/D snoRNA monocistronic SNR58"
                     /transcript_id="XR_002432182.1"
                     /db_xref="GeneID:8291516"
     gene            complement(<799426..>800310)
                     /locus_tag="KLTH0C09614g"
                     /db_xref="GeneID:8291627"
     mRNA            complement(<799426..>800310)
                     /locus_tag="KLTH0C09614g"
                     /product="KLTH0C09614p"
                     /transcript_id="XM_002552592.1"
                     /db_xref="GeneID:8291627"
     CDS             complement(799426..800310)
                     /locus_tag="KLTH0C09614g"
                     /note="similar to uniprot|Q6Q558 Saccharomyces cerevisiae
                     YDR489W SLD5 Subunit of the GINS complex (Sld5p Psf1p
                     Psf2p Psf3p) which binds to DNA replication origins and
                     facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="KLTH0C09614p"
                     /protein_id="XP_002552638.1"
                     /db_xref="GeneID:8291627"
                     /db_xref="GOA:C5DEI9"
                     /db_xref="InterPro:IPR008591"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:C5DEI9"
                     /translation="MNIDIDDILADLDRDTTAVDQTLTSQGQNDTTVFGSDVPGSDKA
                     GGAAVSPVRDFEALMTHWRNERLSPELLPYPHALMARMLRRVQEQLEHIECISMGYLE
                     TLGEEDNDAAGDSGSNSNVLNKLPLLCMEADLERLKFVLRSYVRCRLAKVDKYSLYLR
                     QLAQDNERMVPLSGLLSRQELEYHERHSAILLKLLNNTILRHMPPELQAVDDNEGSVK
                     MVEEPEWDRFVFVYVRGPSSPRDPDPALEVGPDGQCFYNVMIQGLREEVELTVGGIYV
                     MRYNVVRELIMEGKVELI"
     gene            <800421..>802229
                     /locus_tag="KLTH0C09636g"
                     /db_xref="GeneID:8291517"
     mRNA            <800421..>802229
                     /locus_tag="KLTH0C09636g"
                     /product="KLTH0C09636p"
                     /transcript_id="XM_002552593.1"
                     /db_xref="GeneID:8291517"
     CDS             800421..802229
                     /locus_tag="KLTH0C09636g"
                     /note="weakly similar to uniprot|P40960 Saccharomyces
                     cerevisiae YDR488C PAC11 Dynein intermediate chain acts in
                     the cytoplasmic dynein pathway forms cortical cytoplasmic
                     microtubule capture site with Num1p null mutant is
                     defective in nuclear migration essential in the absence of
                     CIN8"
                     /codon_start=1
                     /product="KLTH0C09636p"
                     /protein_id="XP_002552639.1"
                     /db_xref="GeneID:8291517"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ0"
                     /translation="MDRLQQLEEKKRKLQELRERRRHVQVSNTACSSDDLVKHLLRTT
                     TNAPQVNTETVSVGTQTEDAEGAEAPERAPDAFPGLITYEKGIQTEPVEFKEEENPKE
                     SQDVSVADVQAEEASRSPHSPGSPDARLGEHAEAAAKPRVVTPYVVENQALTIGTRSF
                     SLLEALDQDRLSLTQKELDNMQQFHVTHSLGPALSLAGGAKCVWIDYHAELTLAVLQH
                     ADENAPQCTSSVAAVYRLSTAELVDAVEFRGQALLRGEFLRRKGSKIVSVLLTSYNGK
                     TILYEMRAAASADGSLAVERNIIARNFHHYPAFALWQYHTTEPRVLVGSTDGTVSELD
                     VLTMEPYQNPVSSGFSSHFKVLPLPPSALIGGGNAPEETKLQASFKPQLELLSRYDEV
                     AVTSIVTMPQDPSMLYLGCEDGGIYKVNTHDLETRSVSVDAQNNGFVPDAQAPAPTVA
                     EGLQETTLFHSLPVTGLYTCRSAPNLLLSSSMDWECAVWDVINCKKVTQIELDHPVVS
                     CEWVSHEERHYVFVLTPAALQVYDLRLLPEFSPTGAVAWSAPKRPAELFSISVEHCEG
                     FSFFASFKTLQERNRFFVVLGGDSAVQRCVEVLLRD"
     gene            complement(802388..802477)
                     /locus_tag="KLTH0C09658r"
                     /db_xref="GeneID:8291518"
     tRNA            complement(join(802388..802423,802441..802477))
                     /locus_tag="KLTH0C09658r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove"
                     /db_xref="GeneID:8291518"
     repeat_region   complement(802545..802806)
                     /rpt_type=long_terminal_repeat
     gene            complement(<802885..>803391)
                     /locus_tag="KLTH0C09702g"
                     /db_xref="GeneID:8291520"
     mRNA            complement(<802885..>803391)
                     /locus_tag="KLTH0C09702g"
                     /product="KLTH0C09702p"
                     /transcript_id="XM_002552594.1"
                     /db_xref="GeneID:8291520"
     CDS             complement(802885..803391)
                     /locus_tag="KLTH0C09702g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0C09702p"
                     /protein_id="XP_002552640.1"
                     /db_xref="GeneID:8291520"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ1"
                     /translation="MSNEEKPERKSGLLRSSAANVLATLAAVAACLFCSMRLGSILKP
                     IRKAMEENSGATRDLIFKVGQVVSLSALASLPVFVIWTTYRSFKFTRELSAPSEQRPS
                     CAIAGSPTGICIPLKCSRKRYTNSSDLVHCNSLRTFNINSSISEETSILRAPARIKHN
                     GLISYEAT"
     gene            complement(<806399..>806596)
                     /locus_tag="KLTH0C09724g"
                     /db_xref="GeneID:8291521"
     mRNA            complement(<806399..>806596)
                     /locus_tag="KLTH0C09724g"
                     /product="KLTH0C09724p"
                     /transcript_id="XM_002552595.1"
                     /db_xref="GeneID:8291521"
     CDS             complement(806399..806596)
                     /locus_tag="KLTH0C09724g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C09724p"
                     /protein_id="XP_002552641.1"
                     /db_xref="GeneID:8291521"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ2"
                     /translation="MVDEKKPSTIRRLVAVVVSIGVINILIDGCKFILKRALSPVTNA
                     VYGNPDPYSALFKSNNSLFLL"
     gene            <807458..>808096
                     /locus_tag="KLTH0C09746g"
                     /db_xref="GeneID:8291522"
     mRNA            <807458..>808096
                     /locus_tag="KLTH0C09746g"
                     /product="KLTH0C09746p"
                     /transcript_id="XM_002552596.1"
                     /db_xref="GeneID:8291522"
     CDS             807458..808096
                     /locus_tag="KLTH0C09746g"
                     /note="highly similar to uniprot|Q99258 Saccharomyces
                     cerevisiae YDR487C RIB3 3
                     4-dihydroxy-2-butanone-4-phosphate synthase (DHBP
                     synthase) required for riboflavin biosynthesis from
                     ribulose-5-phosphate also has an unrelated function in
                     mitochondrial respiration"
                     /codon_start=1
                     /product="KLTH0C09746p"
                     /protein_id="XP_002552642.1"
                     /db_xref="GeneID:8291522"
                     /db_xref="GOA:C5DEJ3"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ3"
                     /translation="MSNNFTPFEEALELFKQNKFVMVMDDEGRENEADLICAAEGVTQ
                     EQMAFLVRYSSGYVCAPLTNEIADRIDLPLMRSMDVKSSQDDRHGTAYTITCDFADGT
                     TTGISAHDRALTCRKLADASTKPADFLKPGHIVPLRAVDGGVLQRGGHTEAAVDLCKL
                     AGKAPVGVICELVRDEDGLMMRRDDCFKMKQKFDIPLITIEQLKEYISKHNS"
     gene            complement(<808196..>809476)
                     /locus_tag="KLTH0C09768g"
                     /db_xref="GeneID:8291523"
     mRNA            complement(<808196..>809476)
                     /locus_tag="KLTH0C09768g"
                     /product="KLTH0C09768p"
                     /transcript_id="XM_002552597.1"
                     /db_xref="GeneID:8291523"
     CDS             complement(808196..809476)
                     /locus_tag="KLTH0C09768g"
                     /note="highly similar to uniprot|Q12109 Saccharomyces
                     cerevisiae YOL097C WRS1 Cytoplasmic tryptophanyl-tRNA
                     synthetase aminoacylates tryptophanyl-tRNA"
                     /codon_start=1
                     /product="KLTH0C09768p"
                     /protein_id="XP_002552643.1"
                     /db_xref="GeneID:8291523"
                     /db_xref="GOA:C5DEJ4"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ4"
                     /translation="MTEQISPAAASEKLADLSVKEQNITPWDVEGAVDENGQSQDIDY
                     DKLIKQFGTKAVGEETLQRFEQVTGHKPHHFLRKGLFFSERDFNKILDLYEQGKPFFL
                     YTGRGPSSDSMHLGHMVPFVFTKWLQDVFDAPLVIELTDDEKFLFKQKLTIEDVKRFA
                     RQNASDIISVGFNPQKTFIFSDLAYMGGGFYETVVRVSRQITGSTAKAVFGFNDSDCI
                     GKFHFASIQIASAFPSSYPDVLGIPNKTPCLIPCAIDQDPYFRVCRDVAEKLKFSKPA
                     LIHSKFFPALQGSTTKMSASDDTTAIFMTDTPKQIQKKINKYAFSGGQVSIEDHRKLG
                     GNPDVDVAFQYLSFFKDDDEFLEDVYNKYKSGELLSGEMKKLCIDVLQEFVKEFQERK
                     ARVTDEVIDQFMQPHKLVWGQQERLVPVKPKEKK"
     gene            <810128..>810811
                     /locus_tag="KLTH0C09790g"
                     /db_xref="GeneID:8291524"
     mRNA            <810128..>810811
                     /locus_tag="KLTH0C09790g"
                     /product="KLTH0C09790p"
                     /transcript_id="XM_002552598.1"
                     /db_xref="GeneID:8291524"
     CDS             810128..810811
                     /locus_tag="KLTH0C09790g"
                     /note="similar to uniprot|Q03390 Saccharomyces cerevisiae
                     YDR486C VPS60 vacuolar protein sorting (putative)"
                     /codon_start=1
                     /product="KLTH0C09790p"
                     /protein_id="XP_002552644.1"
                     /db_xref="GeneID:8291524"
                     /db_xref="GOA:C5DEJ5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ5"
                     /translation="MNRIFGYGGRKNHEQLLQDSNKAMNEAQQSMQQRISGIDTQISQ
                     LNVQLQAIQRKISSTKSAAGQKPLRQRALKLLNKRKQLEGMRDSLDSQSWSMNQAQMT
                     SDNLRNTMVTVNALKQTNKALKAQYGKINVDKLQDMQDEMLDLVEQGEELQQVLAMGS
                     GAQDFDDISETELDAELEALGDDQLYGEMNLEGDTAGEIPSYLSGTVPQFVDEEPLSE
                     AEGKLETAT"
     gene            complement(<810850..>811770)
                     /locus_tag="KLTH0C09812g"
                     /db_xref="GeneID:8291525"
     mRNA            complement(<810850..>811770)
                     /locus_tag="KLTH0C09812g"
                     /product="KLTH0C09812p"
                     /transcript_id="XM_002552599.1"
                     /db_xref="GeneID:8291525"
     CDS             complement(810850..811770)
                     /locus_tag="KLTH0C09812g"
                     /note="similar to uniprot|P27680 Saccharomyces cerevisiae
                     YOL096C"
                     /codon_start=1
                     /product="KLTH0C09812p"
                     /protein_id="XP_002552645.1"
                     /db_xref="GeneID:8291525"
                     /db_xref="GOA:C5DEJ6"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ6"
                     /translation="MIRVLKRAYTKFNPEFLKPVSSGATTSQGGSTAASQDEVLHFTE
                     LAPSWWDVSGPQRILHKMNLARMDFIQKTLREQFKAGPDTYVPGFNYKEHLPARVSTA
                     IEQELDQDVRSQLQKHKYRVLDIGCGGGILTESLARMPFVSKVDGVDLTPECIEVARG
                     HAEKDPLVKNKLNYQLVPLEDVTENYDLVTCMEMLEHVDQPSEILRHAWNRLNRGGVL
                     FLSTINRDPISWFTTIFVAERVIKVVPSGTHHLSKYINSEEIEQWFKDECAGQYQVLD
                     CKGTMYVPLKGWAIHECSGIGNYIMAVKKL"
     gene            <812005..>814098
                     /locus_tag="KLTH0C09834g"
                     /db_xref="GeneID:8291526"
     mRNA            <812005..>814098
                     /locus_tag="KLTH0C09834g"
                     /product="KLTH0C09834p"
                     /transcript_id="XM_002552600.1"
                     /db_xref="GeneID:8291526"
     CDS             812005..814098
                     /locus_tag="KLTH0C09834g"
                     /note="weakly similar to uniprot|Q03388 Saccharomyces
                     cerevisiae YDR485C VPS72 Protein of unknown function
                     component of the Swr1p complex that incorporates Htz1p
                     into chromatin required for vacuolar protein sorting"
                     /codon_start=1
                     /product="KLTH0C09834p"
                     /protein_id="XP_002552646.1"
                     /db_xref="GeneID:8291526"
                     /db_xref="GOA:C5DEJ7"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ7"
                     /translation="MTDSGEMLMASRSRRSNAGNKMQKLIDQERQELQERTAALDEDE
                     INLLFQEEEGDEEFTADDKRRKDDDEVFSNSEDESDAEDDEEEGERELQQQERKKRKL
                     SQKKKIPVVKKRPNIETAAKPQYEQPKAESLLLGSRRTSKRSSVVANKLQVYEKLAKA
                     EKKRVQIQDRLRKSKANLAYVELTQEDRLRQAEETEKINLQSLNKFKEEEIYKKETRI
                     ALQLRKKAKFAMGEIMIRINTLGWRLTPLMEVEDRQFWEQQLSKRHKKKKKYTRRKKD
                     KSTEAVSEGSKTVPDGTKETNQSPENEGKRETEHSKQPLPADSDSSDKLIAPKLEDSK
                     LEETETMSAAEESPEPAEMKINEKGSHEDKTINEESDAVHEQTGSDHKDHDQSTNSES
                     KFEIPNKTEFAAENGEHTDVASRAGTPNALPIEELQSSPVLSTEENENKSLPKQVSFA
                     AENEVTKFDSSEPANTVPSREQSVESELSRQTSKEPTEQDEKDETDASEIYEGPEQLV
                     GRNFITLYAYPEENPKVHDVRPYIFGPQWMQPLNSRSEDVETIAKIYNNQDESNWSDV
                     GSSLIPDLSALEKFPAFGEYDKKLSTEVAEETDTRLQLEIKTPAPAGVFLPNGIRKKC
                     LITNRDCQYFDPKNGVPYADVEAYKTVQELQDPIGDGGSEEEPRPQYKWFGFARGGIF
                     LDVRQKPAKGVPEGF"
     gene            complement(<814145..>816286)
                     /locus_tag="KLTH0C09856g"
                     /db_xref="GeneID:8291527"
     mRNA            complement(<814145..>816286)
                     /locus_tag="KLTH0C09856g"
                     /product="KLTH0C09856p"
                     /transcript_id="XM_002552601.1"
                     /db_xref="GeneID:8291527"
     CDS             complement(814145..816286)
                     /locus_tag="KLTH0C09856g"
                     /note="similar to uniprot|Q05379 Saccharomyces cerevisiae
                     YOL095C HMI1 Mitochondrial inner membrane localized
                     ATP-dependent DNA helicase required for the maintenance of
                     the mitochondrial genome not required for mitochondrial
                     transcription"
                     /codon_start=1
                     /product="KLTH0C09856p"
                     /protein_id="XP_002552647.1"
                     /db_xref="GeneID:8291527"
                     /db_xref="GOA:C5DEJ8"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ8"
                     /translation="MPTPTPSQNEVIQCAYEPATTVKVIAGPGSGKTLTLMLKVRELI
                     SKGIVGADEVLVLSLTNKAVDNVINQLNSIFSELETTTDGIQGDVLTDLVAQIGVYTI
                     HGLANRVVVENEGLVNIIEENGWRGLSKLIPANLLKKYVSGRRGTTLTPKMFERLFRE
                     YQAKGTVNEKDAAMEQIVTIMKASKVFTNEELISLATKYLRSGAANQASELPSMTNGL
                     LHKYKVVIVDEYQDLFPSLGPFLSAISQNKQLFLFGDPHQSIYGFLGDNRSVIRFLES
                     MRPPENLKVFHLYDNFRSTPEITRWANAVAGDVSRAVTNNNAFFSKEPMGIEPSLVDI
                     ADPLEELEIITDKICQLVSNSVKLSDIAVLTRTNAQLKAVGDHFSSYGIPTEKLTAQP
                     DWISDKNIKFLVDLLKTCMLVSREKRFVEGAGQHQSDFSVIVTLSSLKGVSNQSIQTL
                     FGEAQKANISLWNFISQSRQWPTGVSNRTRIESFVRHLEPLLEYLESSQPLTAISIIS
                     RLVTVSHQIGFKPDEIKNENDLEIFREHLIEMLGVLKLCSSTRPQNVSLTEWFLETWM
                     DQHSSFIQHAANERSNIHDLGAVKISTIHSSKGLEFPVVFLSGSSNSNFPIEKNALYV
                     GMTRARNLLYMMNVKNKFLPPPNPESGTGIFDNQKIWNYYNKDLNRPIGRQLESSLQK
                     YRAVNQKFSLNPSVRAYSTMVRMVCNSLKHI"
     gene            complement(<816450..>818222)
                     /locus_tag="KLTH0C09878g"
                     /db_xref="GeneID:8291528"
     mRNA            complement(<816450..>818222)
                     /locus_tag="KLTH0C09878g"
                     /product="KLTH0C09878p"
                     /transcript_id="XM_002552602.1"
                     /db_xref="GeneID:8291528"
     CDS             complement(816450..818222)
                     /locus_tag="KLTH0C09878g"
                     /note="similar to uniprot|P39904 Saccharomyces cerevisiae
                     YDR484W"
                     /codon_start=1
                     /product="KLTH0C09878p"
                     /protein_id="XP_002552648.1"
                     /db_xref="GeneID:8291528"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:C5DEJ9"
                     /translation="MDALQTILGTQVQAIPPSDGTDLYEGFLEHAKEHRFQVDNSSLT
                     ELHNLEERSKAIEQAIEEKIPPLQSYFSGLNDKFKSLTRDLSLIRGKSLELNKLSQEN
                     SKDLAGISPLVNDLIISPEVVSQITRGKINASWVENAAYIKDKQEIYAKYKEENWEVP
                     SDFAKLSELLDVLQSLVLERSKKFIVSRIKILRDHRTVPSQRIQSQLLEVKEIFQYLV
                     KHNYSLALELRQAYAYTMRWYYKQYFSRYMRSLTILQYVSIDSNYALGRGLSNSATAS
                     GRFASYFSGGYKSSMIGSSNPSDAAINDYFQIEKRLSVLTQEDNTVMVSQIAENNNAP
                     NFLEVGFKNLNLAILDNCSVEFTFLNDFFQVSNNVEDLRGILEQIFQPTFEDAMAYTK
                     RLVTPTFDMFGVLISIWISHHLQFESQRRKVPVVDEYLDGQLILLWPKFQQLVDFQCE
                     SLRNFPISVHAKTHSARKEEPDPSTTIQDLTVQFANFLNSILMLSMTQKEHIDERSEP
                     LYNSVIRIRNDFETVMTKCSKKTNHPERFLATNYTYLLNALQQNYVSRERQQHDDTAF
                     KPSLIFQETKTHLEALVEAFSSIT"
     gene            complement(<818369..>819337)
                     /locus_tag="KLTH0C09900g"
                     /db_xref="GeneID:8291529"
     mRNA            complement(<818369..>819337)
                     /locus_tag="KLTH0C09900g"
                     /product="KLTH0C09900p"
                     /transcript_id="XM_002552603.1"
                     /db_xref="GeneID:8291529"
     CDS             complement(818369..819337)
                     /locus_tag="KLTH0C09900g"
                     /note="highly similar to uniprot|P40339 Saccharomyces
                     cerevisiae YOL094C RFC4 Subunit of heteropentameric
                     Replication factor C (RF-C) which is a DNA binding protein
                     and ATPase that acts as a clamp loader of the
                     proliferating cell nuclear antigen (PCNA) processivity
                     factor for DNA polymerases delta and epsilon"
                     /codon_start=1
                     /product="KLTH0C09900p"
                     /protein_id="XP_002552649.1"
                     /db_xref="GeneID:8291529"
                     /db_xref="GOA:C5DEK0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEK0"
                     /translation="MSANALKLELPWVEKYRPHLLKDIVGNEETITRLQQIAQDGNMP
                     HLIISGLPGIGKTTSVSCLAHELLGNAYSQAVLELNASDDRGIDVVRNQIKQFAQKKC
                     SLPPGRHKIVILDEADSMTAGAQQALRRTMEIYSNTTRFAFACNQSNKIIEPLQSRCA
                     ILRYSKLQDDQVLRRLLEVIQAENVQYTNDGLEAIIFTAEGDMRQALNNLQSTVAGYG
                     LVNGENVFKIVDSPHPLIVKRMLLAPSLDESLALFKELWNKGYSAVDIVTTCFRVTKN
                     LDEIKEAVRLEMIREIGFAHMRILEGVGTYLQLAGMLAKISKVRGL"
     gene            <819571..>820479
                     /locus_tag="KLTH0C09922g"
                     /db_xref="GeneID:8291530"
     mRNA            <819571..>820479
                     /locus_tag="KLTH0C09922g"
                     /product="KLTH0C09922p"
                     /transcript_id="XM_002552604.1"
                     /db_xref="GeneID:8291530"
     CDS             819571..820479
                     /locus_tag="KLTH0C09922g"
                     /note="similar to uniprot|Q12400 Saccharomyces cerevisiae
                     YOL093W"
                     /codon_start=1
                     /product="KLTH0C09922p"
                     /protein_id="XP_002552650.1"
                     /db_xref="GeneID:8291530"
                     /db_xref="GOA:C5DEK1"
                     /db_xref="InterPro:IPR007356"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="InterPro:IPR016653"
                     /db_xref="InterPro:IPR028564"
                     /db_xref="UniProtKB/TrEMBL:C5DEK1"
                     /translation="MSDSKPEKPITMHPHPLPPVPEGMSKSQWKKVWKKKRFEETKDE
                     FAKIRREKRQKAKETRRAKIQEYLDRGEEVPEDLRRKPRKNQDQKDSGINIILDCAFD
                     DLMNDKEVVSLSTQITRAYSHNKRENHFAKVKVTSFNKRLRTRFEEGLKDAHHDEWKN
                     FEFTEDPTLPTENSVYLTADTDETLEKLEPGTNYIVGGIVDKNRHKLLCYNKARELGI
                     PTKKLPLAEFIKLTGREVLTCTHVIHLMLRYFDNLDWKEAFETVLPQRKLEEAEAAAE
                     AAAKAQSPQAESSEPSSATSEEEPQD"
     gene            <822021..>822947
                     /locus_tag="KLTH0C09944g"
                     /db_xref="GeneID:8291531"
     mRNA            <822021..>822947
                     /locus_tag="KLTH0C09944g"
                     /product="KLTH0C09944p"
                     /transcript_id="XM_002552605.1"
                     /db_xref="GeneID:8291531"
     CDS             822021..822947
                     /locus_tag="KLTH0C09944g"
                     /note="similar to uniprot|Q12010 YOL092W Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C09944p"
                     /protein_id="XP_002552651.1"
                     /db_xref="GeneID:8291531"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5DEK2"
                     /translation="MVPIVLNSQTVSGITGSISIACWIIVFVPQIYENFYRNSAEGLS
                     LLFVVLWLLGDIFNLLGAVLQGLLPTMIILAAYYTLADIVLLGQCLFYGNEEKVDPVH
                     LSPANPINERVLEDVFNEHQPLLHDHKQKQQRAEVAVGSSSVSAQTTQEVGPRAENDE
                     TPSTKNYIANAVLVTSVFLGGFLSWYLSYIRDPNPIGAEPDLHMNWMAQFFGYLSAVL
                     YLGSRVPQILLNFQRKSCEGISFLFFLFACLGNTTFIISVLSISMEPRYLLVNASWLI
                     GSIGTLFMDFVIFMQFFIYENPSDTRETGVAV"
     gene            <823260..>825542
                     /locus_tag="KLTH0C09966g"
                     /db_xref="GeneID:8291532"
     mRNA            <823260..>825542
                     /locus_tag="KLTH0C09966g"
                     /product="KLTH0C09966p"
                     /transcript_id="XM_002552606.1"
                     /db_xref="GeneID:8291532"
     CDS             823260..825542
                     /locus_tag="KLTH0C09966g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C09966p"
                     /protein_id="XP_002552652.1"
                     /db_xref="GeneID:8291532"
                     /db_xref="UniProtKB/TrEMBL:C5DEK3"
                     /translation="MPLLSNRTYHKDTKKCSFVDRTNPYDLQNYDIREDDEITSSDDA
                     GLESSDAGYEDEYEEGSYNVSSGPNTADEGSASASQGEKGKRPRSASPFKRSISSLFK
                     RRGSRDSCVEEKELDIADEDGSCAAIPGIDQVQSDAASSSKFWRSWRLKHERHGSEHV
                     DENNDVESDAFASDKQAICTDATVPLRHGSNIEKLSELQIENTSLEIFETDREGNPDG
                     AFDARKLDESPTSIARGLQLKTRLGIDSAGSQQPEKDSNHGTLGYAEGGDIMSAKVPL
                     LPSPSTPVEEQIFWKKNVPKSEFQHYESIYLTPKDYVALEDQFDRVQVNKNSRTYRNF
                     VNIIELLDGTSENTFQMFSLEEFTTAVLGLVKGEPKEHKGVRPEHHAKLDRTSSCDDH
                     SSLELKKQDRSSSRIRDLEEELSSLRERYDCSVEDAYNCRNELKIVKSELEETRHEVD
                     NTINRMDKIKSDLKEEINRRISTEETLRGELDIAAESAKKELSKSEELRDSLIKSKNE
                     QEALQAETLVLKEQNETSRSRINELVQLVSQLEAEARKAREENSQLQQSFQEKDVLAT
                     HAKMANVKLQKDCQRERCKLLDGRRELDLLRRQMELAACHKAEALQFMAQMMMSFRDV
                     LSKDTLQECDSYLGAINSNQLFNRALFNTDGEMTERQLSDQFGQELQRVTEFYRDFAK
                     KRLLDQIFAKHISYMRSNLFLSQQLKGLRQQGQDHEEYISRLLKDCKAQRVLIAKQDN
                     RIETMKKVKQSDFKTGSIQT"
     gene            <825726..>828593
                     /locus_tag="KLTH0C09988g"
                     /db_xref="GeneID:8291533"
     mRNA            <825726..>828593
                     /locus_tag="KLTH0C09988g"
                     /product="KLTH0C09988p"
                     /transcript_id="XM_002552607.1"
                     /db_xref="GeneID:8291533"
     CDS             825726..828593
                     /locus_tag="KLTH0C09988g"
                     /note="highly similar to uniprot|P25847 Saccharomyces
                     cerevisiae YOL090W MSH2 Protein that forms heterodimers
                     with Msh3p and Msh6p that bind to DNA mismatches to
                     initiate the mismatch repair process contains a Walker
                     ATP-binding motif required for repair activity Msh2p-Msh6p
                     binds to and hydrolyzes ATP"
                     /codon_start=1
                     /product="KLTH0C09988p"
                     /protein_id="XP_002552653.1"
                     /db_xref="GeneID:8291533"
                     /db_xref="GOA:C5DEK4"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR011184"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEK4"
                     /translation="MSSSRPELKFFDISEERGFYKRFSTLPEKPPKTIRIVDKGEYYT
                     VVGNDALFVADNVYHTNSVLKDCRIDPSTAKSIQEPLKYVTISSQVLSGLLKLCLLEQ
                     GMKVEIYDKSWKLLRNGSPGNIEQVDDLMNISLDSSIVLTSIKIQPNAQEGNCVLGVS
                     FIDSSSYKIGMLDIVDNEVYSNLESFLIQMGVKECLLPDLRSNETVANELKKMVGVLD
                     RCGCVSTFVKNSDFSHRDVDQDLVKLVGDELSMSLMKFSNLALGSCNALLSYLQLLND
                     ESQLGRYELVQHSLTEFMKLDASALKALNIFPTGPSGASGVSVSHGGGSGGKVSSIFQ
                     LLNKCKTNAGVRLLNQWLKQPLTDLQAIQNRHDLVEFLIDQLELRQVLQSDYLPLVPD
                     VRRLTKKLNKNGGLEDVLKIYQFARKIPEVSQVLEDYLGNMDGGDSIKPLVTETWLQP
                     LNAHITPLDKFQEMVETTVDLEAYEDTNEFMIKVDFNEDLAKIRGELDALKDNIKSIH
                     LDAAEDLGFDPEKKLKLENHHMHGWCMRLTRNDGKALRQHRKYLELTTVKAGIYFSTR
                     ELKQIAEQTAILQKEYDRLQYDLVKEIVQITLTYTPVLEKLSIVLANLDVLSAFAHVS
                     SYAPIPYVRPQMHGLGTQRKTELIGSRHPVLETLDDVTFISNDVRLESGKSEFLIITG
                     PNMGGKSTYIRQVGVISLMAQIGCFVPCDTAEIAVVDAVLCRVGAGDSQLKGVSTFMV
                     EMLETASILKNATENSLIIVDELGRGTSTYDGFGLAWSISEHIARNVRCFALFATHFH
                     ELTSLADQVPTVQNMHVIAHIEDARASTHSADDITLLYKVEPGISDQSFGIHVAEVVQ
                     FPAKLVSMAKRKAAELEDLKHDSQALKRQKCSAGEIAEGTRVLKDVLKAWAAAVRAEG
                     LHEKLSDDESQARVLELLNQVSAASAQTDNKFMKEIAELLM"
     gene            <829145..>830110
                     /locus_tag="KLTH0C10010g"
                     /db_xref="GeneID:8291534"
     mRNA            <829145..>830110
                     /locus_tag="KLTH0C10010g"
                     /product="KLTH0C10010p"
                     /transcript_id="XM_002552608.1"
                     /db_xref="GeneID:8291534"
     CDS             829145..830110
                     /locus_tag="KLTH0C10010g"
                     /note="similar to uniprot|P38115 Saccharomyces cerevisiae
                     YBR149W ARA1 Large subunit of NADP dependent arabinose
                     dehydrogenase involved in carbohydrate metabolism small
                     subunit is unidentified"
                     /codon_start=1
                     /product="KLTH0C10010p"
                     /protein_id="XP_002552654.1"
                     /db_xref="GeneID:8291534"
                     /db_xref="GOA:C5DEK5"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DEK5"
                     /translation="MLHPKNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAI
                     KSGYRHIDTAWAYQCEDRVGEALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRS
                     LENLGLDHVDLVLQHWPLCFNRLEDPDGIDGVRRNPYHEDGSPHYNEKGDYLETFKTL
                     EKLYLAKDPRFRAIGVSNYPVEYLERLLKECQVVPAINQVECHPHLPQMELRDFCTKH
                     NIRLEAYSPLGATNAPLIDNELVKKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKH
                     IASNVQFVALSKEDIDTLNKFGVENTKRIVDEPFAAAIPGFRENK"
     gene            complement(<830334..>832934)
                     /locus_tag="KLTH0C10032g"
                     /db_xref="GeneID:8291535"
     mRNA            complement(<830334..>832934)
                     /locus_tag="KLTH0C10032g"
                     /product="KLTH0C10032p"
                     /transcript_id="XM_002552609.1"
                     /db_xref="GeneID:8291535"
     CDS             complement(830334..832934)
                     /locus_tag="KLTH0C10032g"
                     /note="weakly similar to uniprot|Q12180 Saccharomyces
                     cerevisiae YOL089C HAL9 Putative transcription factor
                     containing a zinc finger overexpression increases salt
                     tolerance through increased expression of the ENA1 (Na /Li
                     extrusion pump) gene while gene disruption decreases both
                     salt tolerance and ENA1 expression"
                     /codon_start=1
                     /product="KLTH0C10032p"
                     /protein_id="XP_002552655.1"
                     /db_xref="GeneID:8291535"
                     /db_xref="GOA:C5DEK6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DEK6"
                     /translation="MAPESPSELSAFKFRKRVPKACDHCRKRKIKCGAVNPITGTCDN
                     CTKFNTVCTFKHHDEIGRHRKYAELKKLQSHEPKVRKVSESSSPGASATDRKLEQLEY
                     QIARLHELTARQQYQAGVCSRHSPSLGVDTIPDMSPAPKQKRYFTSLLTKRRIAWLRN
                     QAKAFSANQETPGDAGSPMLSFYPLTDAFMVASKWYVAQVKKIIDFSNPFVPFNSSQL
                     YPLPPQEHANIAVKAIQENLSPGSFNVVRGPELQALFDKHYANQKLTYSEILLLDIIL
                     TVSNSYPLTDDPRRLKEGESEHSTVESHMLLNAINQYHKVALLSEGVRSVQALLILYQ
                     YVSCHISGEAAYNIFNTTQRFAQDIGLNRKESYKNLSLEEASLRLKMWYCCVLADSQL
                     SLAFCRAPLIDLEDTSVLTEEFYMELVKERHLGNSDRTSIQTLDEAIQSLLGSSDTFQ
                     LGTAYYGMTLTRTFHKAYRRLLAANSMTNVTFDQVIEGVLDIKSDLIRWEKSLPPILA
                     LGEYEENLTRLRNASGDPLSAKHFEILSTTILQLHYEHLYLNLIVSQIACSFVFDNED
                     ILPKSRYNVAALRRTFVNDACDSAVQMMKLWPSIKVVPHMVHRLFYTFSTGAFVLLLT
                     VIAFPNEDRVLEYISTMCTTVEYLLEMGEYRVFKDNIKWNVTMFVFCFLLTLSINYFN
                     ACNPQAKDANFSSAPFRNSLEALMNRCKMNKDVAVNQLREHLNIFAPGFDENSEMHEN
                     PDISSGTCDASKGLPRTLYLFSEVDEEDLRCLMSSLPVQIPCSNRFGPETEAKGSAMQ
                     ASPSKGSQHGFRSGPSADNDFAAAFSLGLPSSDEPQTLAGGPPSDQVDFENMLDDMLF
                     DRDFTFPTLM"
     gene            <834498..>835406
                     /locus_tag="KLTH0C10054g"
                     /db_xref="GeneID:8291536"
     mRNA            <834498..>835406
                     /locus_tag="KLTH0C10054g"
                     /product="KLTH0C10054p"
                     /transcript_id="XM_002552610.1"
                     /db_xref="GeneID:8291536"
     CDS             834498..835406
                     /locus_tag="KLTH0C10054g"
                     /note="similar to uniprot|P38281 Saccharomyces cerevisiae
                     YBR151W APD1 Protein of unknown function required for
                     normal localization of actin patches and for normal
                     tolerance of sodium ions and hydrogen peroxide localizes
                     to both cytoplasm and nucleus"
                     /codon_start=1
                     /product="KLTH0C10054p"
                     /protein_id="XP_002552656.1"
                     /db_xref="GeneID:8291536"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DEK7"
                     /translation="MGLLKLFKSADSVSKKDIAKIEQVAEVCSSECNDCKSSSAEIER
                     DEARVSSLKIDHETPLFGSSKSSKVHFVVPTSQTDWAHDACLETKGTVQWELAQWIDA
                     NSSKLKGGEGDTVRCSVSSLPKDIMDIDVMRGRKNDVLVLPHFLLIKHLRAEDVAKTA
                     EVVMPLLLENKRDELLAMENIEEAREQAFVFLCSHKTRDKRCGITAPILQKGFFRELQ
                     EHDLYRDPSDFRPGGCNVAFVNHVGGHKFAANVLIYLRRSHSLIWLGRVTPKHIPVIV
                     NTMIVPEKPRIPWPEKVRCVEKYSGW"
     gene            complement(<835443..>836180)
                     /locus_tag="KLTH0C10076g"
                     /db_xref="GeneID:8291537"
     mRNA            complement(<835443..>836180)
                     /locus_tag="KLTH0C10076g"
                     /product="KLTH0C10076p"
                     /transcript_id="XM_002552611.1"
                     /db_xref="GeneID:8291537"
     CDS             complement(835443..836180)
                     /locus_tag="KLTH0C10076g"
                     /note="weakly similar to uniprot|Q99316 Saccharomyces
                     cerevisiae YOL088C MPD2 Member of the protein disulfide
                     isomerase (PDI) family exhibits chaperone activity
                     overexpression suppresses the lethality of a pdi1 deletion
                     but does not complement all Pdi1p functions undergoes
                     oxidation by Ero1p"
                     /codon_start=1
                     /product="KLTH0C10076p"
                     /protein_id="XP_002552657.1"
                     /db_xref="GeneID:8291537"
                     /db_xref="GOA:C5DEK8"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:C5DEK8"
                     /translation="MKVSLFLPAFFLPLLALCRVHSVASLDFFYDTINTDSYTVVKYF
                     TTWCSHCKRLGPVFSQLSEAFEDRKDINATFLEVDCDLFGSTLCDHLPGYPAVEVIKP
                     ITEQERLDSNSAQKNTEKLSWWSKLIKTIKQGGYNPAWHMDKSRAVEFNGSRDLPRLK
                     NFVDMVVESTEQDKVLEAVLSEATCEDDRCESLRKYLSKVHSTDREAQKLESILRNNP
                     DEELAEIKLKLKLLHKLQEKNSEHDEL"
     gene            complement(<836528..>838843)
                     /locus_tag="KLTH0C10098g"
                     /db_xref="GeneID:8291538"
     mRNA            complement(<836528..>838843)
                     /locus_tag="KLTH0C10098g"
                     /product="KLTH0C10098p"
                     /transcript_id="XM_002552612.1"
                     /db_xref="GeneID:8291538"
     CDS             complement(836528..838843)
                     /locus_tag="KLTH0C10098g"
                     /note="weakly similar to uniprot|Q6B2M3 Saccharomyces
                     cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger transcription
                     factor that activates genes involved in multidrug
                     resistance paralog of Yrr1p acting on an overlapping set
                     of target genes"
                     /codon_start=1
                     /product="KLTH0C10098p"
                     /protein_id="XP_002552658.1"
                     /db_xref="GeneID:8291538"
                     /db_xref="GOA:C5DEK9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DEK9"
                     /translation="MMESQPNIPGLSLIRLSFLPAEPDRPVFHAPLNTEFPAREMPLN
                     TPPDSGASSKPSTRRRRRKVIKSCTFCRQRKMKCDQQKPMCGSCVERKLSECIYTDGF
                     NFQLTSDELFSRQPNVTLLRRIQELEEQLSRVSFDDLQKTGESYVVADSAGYAATSQT
                     CVPCGPPNKNDILDLKVLRVKDGRYNYYGPTSIRVIITASGERFVAEYSKVWRKVEAE
                     VNAWKNVHGRLLTMEHNSLESPNNAPLLESIIQDLPSYEAIQEKLREFFDSPLHDYFQ
                     FLDKDKVFSDFARCFIPNYVAAMQDTNFTTRSVIMLLAPENNNVFTIAVVIMILCLNH
                     YKTTLPVSIERLIVSLVGFTTSKSVSVERTQFLLLLYLFRAYNGLSGSGSSHVMSLVS
                     LLCSTAFNLGLHQDIRLLYAGQEHAVGSIESLENLWYWTLFVDLYTAFDKGLPMNITP
                     GHYDDTKLPTNEKGRISILRNFLHVGRKCMHVLFDREQSPDLLKLNSLLLEFVEQNFR
                     PICYYTDSSLISQVDLFDLMILSPTFSMLANFYDLTRVIYSQVTIQIKNGFVKCILIA
                     ISILVNTILRCYELDRDLLSEDDFARAKTLSPSLNLCVLILNSLPIRALNEIYGLMFY
                     KITLFEKGLIVSVHDSQGAPPPNLDDLKIPNESFITFNGIFDTLCYAFDKLWKPENTG
                     LTHMLSNSHYYVIMMALERVNRTIFQVGLDSRAQVEVNHKWPELNQDEVPEVMVKMLA
                     DEVWNNYSTGFTDLINMDAEDFLVDFDMDQN"
     gene            <839780..>841735
                     /locus_tag="KLTH0C10120g"
                     /db_xref="GeneID:8291539"
     mRNA            <839780..>841735
                     /locus_tag="KLTH0C10120g"
                     /product="KLTH0C10120p"
                     /transcript_id="XM_002552613.1"
                     /db_xref="GeneID:8291539"
     CDS             839780..841735
                     /locus_tag="KLTH0C10120g"
                     /note="similar to uniprot|P33335 Saccharomyces cerevisiae
                     YPR198W SGE1 Member of drug-resistance protein family
                     multicopy suppressor of gal11 null mutation"
                     /codon_start=1
                     /product="KLTH0C10120p"
                     /protein_id="XP_002552659.1"
                     /db_xref="GeneID:8291539"
                     /db_xref="GOA:C5DEL0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DEL0"
                     /translation="MLIYLFRRLRSAAAKTRTDTQAQTAPSHSFSLQDFSAKHALLAL
                     CLLSLVLTLFLAALDIVIVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMA
                     SLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLV
                     SERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASWRWCFFINLPIGGAAAFMLFLCY
                     NPSGKPLLSTLTSKLEAARDYRYSNVCTRKFWAHALDLGVFRFDIIGFALSSAGFVLL
                     LLGLTFGGRKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPVLARSLAYSSEVTPLVP
                     WPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHMWALSIPALV
                     VIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSIGYCILAGAGFSA
                     VMQSTLLSAQIQVDKTDPKFNQKFIEITTLNNFFRVLGISFGGIMGTLIYSTSLKNEL
                     ATAGPNIPSFASTDELIAYRSKNFDGASSPLENIMSKSIQRVFYGSLGCQALAFLFTI
                     CMSNKRLDLEPNPPAVATFEPALNAAVSDQEKGFGITQGPTSSETQNLRVSDSSLAYN
                     ITGEKADENEEHYDSMTSRDSPVSAKN"
     gene            <842371..>844092
                     /locus_tag="KLTH0C10142g"
                     /db_xref="GeneID:8291540"
     mRNA            <842371..>844092
                     /locus_tag="KLTH0C10142g"
                     /product="KLTH0C10142p"
                     /transcript_id="XM_002552614.1"
                     /db_xref="GeneID:8291540"
     CDS             842371..844092
                     /locus_tag="KLTH0C10142g"
                     /note="similar to uniprot|P33335 Saccharomyces cerevisiae
                     YPR198W SGE1 Member of drug-resistance protein family
                     multicopy suppressor of gal11 null mutation"
                     /codon_start=1
                     /product="KLTH0C10142p"
                     /protein_id="XP_002552660.1"
                     /db_xref="GeneID:8291540"
                     /db_xref="GOA:C5DEL1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DEL1"
                     /translation="MRKLSLVLCLTSLALTLFLAALDIVIVITLYETIGEKFKDYARI
                     GWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGR
                     VVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW
                     RWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAY
                     NFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLTVGAILVLFWLVFD
                     FVLLYKWAAWCRKREATPLLRRSLCFRPGIFTSSIANLFTCFGFNMQTVYIVQLYQLV
                     FNSGPTAASMHLWAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVR
                     NTSTTGNVIGYCILPGAAFGSIMQGTLLSAQVQVDHDDENFQTMFIEATALNTFVKSL
                     GFSFGGVVATMIFTNSVKNQLRSTSAGVAAFSSVEALIAYRGQNYDGPGSTLSLMFVK
                     AIKDVMYAALGCYGIVFIASLFTSNRRLRLPSKNDGVEATAQEKSISGGDKSQLAPQS
                     TSENDEN"
     gene            <844475..>845380
                     /locus_tag="KLTH0C10164g"
                     /db_xref="GeneID:8291541"
     mRNA            <844475..>845380
                     /locus_tag="KLTH0C10164g"
                     /product="KLTH0C10164p"
                     /transcript_id="XM_002552615.1"
                     /db_xref="GeneID:8291541"
     CDS             844475..845380
                     /locus_tag="KLTH0C10164g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C10164p"
                     /protein_id="XP_002552661.1"
                     /db_xref="GeneID:8291541"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="UniProtKB/TrEMBL:C5DEL2"
                     /translation="MSTTTTATTEESAGTQFRETLKASAAPPSVEATQGVHNLSMGGL
                     EYKNKRPTFSSKLEERQHVLKHMACAFRVFGRKGYNEGTAGHMSVRDPVDPSTFWINP
                     LGQHFSLMRVSDLVHVDSNGNVLPDGNQAVINKAGFKIHSHLHKARPNVNAACHTHSE
                     YGRAWSAFGREIEMLNQDSCMFYKKHTVYRNFGGVVLEDEEGERLAQALGDNKAIILQ
                     NHGLLTVGETVDEAAYLFTLLERTCKVQLQVEMASRGGLERNIIGDEEAYYTYFNTSD
                     PETLYTEFQPEYDLERELTNAAFEK"
     gene            <846014..>846550
                     /locus_tag="KLTH0C10186g"
                     /db_xref="GeneID:8291542"
     mRNA            <846014..>846550
                     /locus_tag="KLTH0C10186g"
                     /product="KLTH0C10186p"
                     /transcript_id="XM_002552616.1"
                     /db_xref="GeneID:8291542"
     CDS             846014..846550
                     /locus_tag="KLTH0C10186g"
                     /note="similar to uniprot|Q99321 Saccharomyces cerevisiae
                     YOR163W DDP1 Diadenosine polyphosphate hydrolase member of
                     the MutT family of nucleotide hydrolases with high
                     specificity for diadenosine hexa- and pentaphosphates
                     required for efficient hydrolysis of diphosphorylated
                     inositol polyphosphates"
                     /codon_start=1
                     /product="KLTH0C10186p"
                     /protein_id="XP_002552662.1"
                     /db_xref="GeneID:8291542"
                     /db_xref="GOA:C5DEL3"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:C5DEL3"
                     /translation="MAEFQRSNTARVGRQNQVYSATTGARLVAGCVCLDSSKERVLMI
                     QSSAHKKKWVLPKGGVEKDESDFKMTAVRETWEEAGAIGDIVRNLGVIEDMRPPKEFN
                     TDIRAFEEATDPEVNKRPPRSEFHFFEMSVRSLEEEYPERCKRTRKWFSFKEAKEQLI
                     IAKRPELLEALTRSSICQ"
     gene            complement(<846933..>847844)
                     /locus_tag="KLTH0C10208g"
                     /db_xref="GeneID:8291543"
     mRNA            complement(<846933..>847844)
                     /locus_tag="KLTH0C10208g"
                     /product="KLTH0C10208p"
                     /transcript_id="XM_002552617.1"
                     /db_xref="GeneID:8291543"
     CDS             complement(846933..847844)
                     /locus_tag="KLTH0C10208g"
                     /note="similar to uniprot|Q12125 Saccharomyces cerevisiae
                     YOR164C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C10208p"
                     /protein_id="XP_002552663.1"
                     /db_xref="GeneID:8291543"
                     /db_xref="InterPro:IPR007317"
                     /db_xref="UniProtKB/TrEMBL:C5DEL4"
                     /translation="MSANVKLGRTLARFHARIEAGDYYEAHQTLRTIANRYVRSKNYR
                     EAIDLITEGAQALLGAKQGGSATDLIFYLLEVYNVAEVKVEDVSVSRLVRLLALLDAE
                     EPNMKDVITGMNNWSVKFGNCKFGDPYLHSVIGSKLVEGGHVYEAERYLTLGTHDSLD
                     KYLDLIWEWYLQSGDREAVGDFFSRLIFNYLFIGNVQNAEQAKQKFLAKFIENFNPKY
                     ELIDRGEFKTYCFEDYPELNFLQLLPYSCQTKNADLFDFLKKHYAGSSERYGSELDYL
                     GQEYFGIVVQKPMNFMQDILAGILGGK"
     gene            <847951..>850302
                     /locus_tag="KLTH0C10230g"
                     /db_xref="GeneID:8291544"
     mRNA            <847951..>850302
                     /locus_tag="KLTH0C10230g"
                     /product="KLTH0C10230p"
                     /transcript_id="XM_002552618.1"
                     /db_xref="GeneID:8291544"
     CDS             847951..850302
                     /locus_tag="KLTH0C10230g"
                     /note="similar to uniprot|Q99287 Saccharomyces cerevisiae
                     YOR165W SEY1 Synthetic Enhancement with YOP1"
                     /codon_start=1
                     /product="KLTH0C10230p"
                     /protein_id="XP_002552664.1"
                     /db_xref="GeneID:8291544"
                     /db_xref="GOA:C5DEL5"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGETEEAIQLINEEKEFNSSTLQYFQKCVKERDVGVDYHVISVF
                     GSQSSGKSTLLNALFHTQFDTMNAKVKRQQTTKGIWLGHTTRIATLENSLTPVKDLFV
                     LDVEGSDGAERGEDQDFERKAALFAIAISEVLIVNMWEQQVGLYQGNNMALLKTVFEV
                     NLSLFGHQNDHKVLLLFVIRDHVGVTPLSSLQETLEAELNAIWSDLAKPEGCENSSLY
                     DFFDLKFTALAHKVLQPDLFMENVKELGNKFSSETPGKSFFKPEYHHNLPLDGWTMYA
                     GNCWNQIETNKDLDLPTQQILVAKFKTEEISNQALALLLENYPVDLHCRELSDLAGKL
                     QELKSLCLQEYDTYASRYAKPVYMDNRRDLSHKIENKFKETISKFLDVQKEDLLSQVE
                     KDLTERSRSTPFVTKMKEARKKAFDAFEELLLQFTKLELVASLSDENEAFSIALDEAC
                     SNQSRKQLKQSVNRISKSVSSGIKEDIFFLLAHPELDLWDKVMEKFNEIVSDSTERYA
                     VDDEKFDFQVGLSEEENQKVYKKVRSNAWTNLYEFVHGYLNEDNVVSILRDRFENKFR
                     YDEHDSPRLWRNEEEIDNAFRVAKEHALEVLNVLSLASNSDHVEIVPDVPLSSGLDDE
                     ELEGEYEDEEGIYHEKGFAHILTASQRERAVQKFKRQANTTVIEAKRSIIRTTTHIPL
                     YVYALLVVLGWNEFMIVIRNPLFVTLLVILSVTAYFVHKLNLWAPILALVNSAVSETK
                     ALARNKLKVILDDDSSSSSKASKEPTEEYEMQDLAKSSTTGTG"
     gene            <850445..>851542
                     /locus_tag="KLTH0C10252g"
                     /db_xref="GeneID:8291545"
     mRNA            <850445..>851542
                     /locus_tag="KLTH0C10252g"
                     /product="KLTH0C10252p"
                     /transcript_id="XM_002552619.1"
                     /db_xref="GeneID:8291545"
     CDS             850445..851542
                     /locus_tag="KLTH0C10252g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C10252p"
                     /protein_id="XP_002552665.1"
                     /db_xref="GeneID:8291545"
                     /db_xref="UniProtKB/TrEMBL:C5DEL6"
                     /translation="MQRRNTDSTRRTHVTNTLKWLPYKVNQSPYFGSFVDTLDKNKLH
                     LCLTSLKTCPFLVEFEAFEIKEQASRQGFVFKTLEDVIDQVFAYLKKPSEELQFSYSG
                     KQITFKIVVSRELCLTLDSPTRQIEEPQRSSIFQSLSSSFFDNQVLLREIVDDLHNII
                     TCKDQGLAFLMDSLRDVGFESLIKKWAPRGSFNHDLLQPFDFDEWLNKWPSPAKTLHQ
                     GTGYSPKVCKFLRLLSTKPNFVSQQNTSVSPKAQTKVLSSGDEFASLSFAEDEQNETH
                     FSHESESDDTKHLCGRLQRASTPIETESLGKQIRLADVPILSPQKTERLSRSPKQPSP
                     TPEGQIEDMQEQSEDRSPSRKRRKFGKLRIE"
     gene            complement(<851565..>852866)
                     /locus_tag="KLTH0C10274g"
                     /db_xref="GeneID:8291546"
     mRNA            complement(<851565..>852866)
                     /locus_tag="KLTH0C10274g"
                     /product="KLTH0C10274p"
                     /transcript_id="XM_002552620.1"
                     /db_xref="GeneID:8291546"
     CDS             complement(851565..852866)
                     /locus_tag="KLTH0C10274g"
                     /note="similar to uniprot|Q12104 Saccharomyces cerevisiae
                     YOR166C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C10274p"
                     /protein_id="XP_002552666.1"
                     /db_xref="GeneID:8291546"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DEL7"
                     /translation="MPKFPDQKYTIEDIERVLIGHPSRAEKPIALQAAHGRRAARQNA
                     KDQEIGSLSPLETDEDAVMIDMSGESGVQMVSEAVAHQREHEPHQATQEEDLMELDSI
                     PPAVEVSSSTTAFVVDTNFIISHLDILESLRSSSFQFNHQIIIPRTVIHELDGLKNPN
                     HSSVQGTSKEAISVLARKANNWIYSNLANVAHGVVGQRLNQRLDYESRKDDSILDCCL
                     FFKERLRRFVILLSNDKNLCLKALTEGILTVSFRKGMSADSIAQKAYAERGVPLNSGE
                     HAVYHDRAASTSSSHASTEIQPSSFEKVALTIKNEIESLVLSAVDFVMRAEYGDDLYL
                     TDYNDKKLTDLKSCSHYIFKFWLSVFAEYFSTGDIRRQDWKSVPSYLISTPSTASELE
                     KFVQYWIFALCCLYKKRDDQQKNALKILSRRWSKGVSSGVL"
     gene            complement(<854674..>854877)
                     /locus_tag="KLTH0C10296g"
                     /db_xref="GeneID:8291547"
     mRNA            complement(<854674..>854877)
                     /locus_tag="KLTH0C10296g"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_002552621.1"
                     /db_xref="GeneID:8291547"
     CDS             complement(854674..854877)
                     /locus_tag="KLTH0C10296g"
                     /note="highly similar to uniprot|P0C0X0 Saccharomyces
                     cerevisiae YLR264W RPS28B or highly similar to
                     uniprot|Q3E7X9 Saccharomyces cerevisiae YOR167C RPS28A"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_002552667.1"
                     /db_xref="GeneID:8291547"
                     /db_xref="GOA:C5DEL8"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /db_xref="UniProtKB/TrEMBL:C5DEL8"
                     /translation="MDSKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLDDTSRTIVRNV
                     KGPVRENDILVLMESEREARRLR"
     gene            complement(<855121..>857520)
                     /locus_tag="KLTH0C10318g"
                     /db_xref="GeneID:8291548"
     mRNA            complement(join(<855121..857157,857236..>857520))
                     /locus_tag="KLTH0C10318g"
                     /product="KLTH0C10318p"
                     /transcript_id="XM_002552622.1"
                     /db_xref="GeneID:8291548"
     CDS             complement(join(855121..857157,857236..857520))
                     /locus_tag="KLTH0C10318g"
                     /note="weakly similar to uniprot|P14291 Saccharomyces
                     cerevisiae YLR263W RED1 Protein involved in chromosome
                     segregation during the first meiotic division"
                     /codon_start=1
                     /product="KLTH0C10318p"
                     /protein_id="XP_002552668.1"
                     /db_xref="GeneID:8291548"
                     /db_xref="GOA:C5DEL9"
                     /db_xref="InterPro:IPR012491"
                     /db_xref="UniProtKB/TrEMBL:C5DEL9"
                     /translation="MSQLNGEVQKLIKLAETGYLGRELNFLKSLQSRKEKGASVGAKT
                     KRSLCDLLKKDSKSLEPFRWQLADITVQVVLASNAEGIDSDNSGYMWSVLMRPQSWST
                     SDYDSHFLKTLINFGLDFDEPHSWKCIALLLEIAVDEPKRCKPVLASMLQVKYRKALR
                     DALENTRDFQLANVLVRLLGFLFPRKAVSGAAQLQCSLQIWDEPYKNESFFNDSCYPS
                     KKSSSLEFALKRMGPFPCFGHLKSFSFVTGSSSEETETIKNANFVQCTDSMLYVWTAS
                     SHFAEFQLKHLEATKCTVEGGLRLKLLNPRNTIYFPVQSVFSAMPSKACYLLIVFEDA
                     LLAETCLKSTRRHKISEVESFITLPLNSSITENSDNASPKKSENLAYNKSSSGSGNSP
                     SWQPLSKNIQDAPNSNGLVLKLKSDEWDFDSPMDTDKSVSSPPTGEEADSISRSGEEH
                     NHDEHSPLVMMQKRKQARAERRLTGIVPPKLANITSSECKATNGALFNHVKEKGESAA
                     ASVSVGSSRTQKPRLPKSKFAGSIKQQDLLRLESIFNSTEQKANPRKPKDLHSAPRNK
                     GHAKTSHKSHKPPTDPLKMYKRSAEEAEVGLLNAKRVAYAAEEEAAKVITTQAKAAVV
                     KITTEPKPLFNPSAIETTSLSPGALVKAPPSPEITNFESTTIATPSGILQGKGPDHTD
                     NSFTNKLQEQIFKSVTCFSEELVRRIEIVNEELNNKVFLELSEKYQRMFDQLQASFQS
                     DVSNMSQFVGEIKDLLHLPEDQLVKAIRQKKFN"
     gene            <857898..>860300
                     /locus_tag="KLTH0C10340g"
                     /db_xref="GeneID:8291549"
     mRNA            <857898..>860300
                     /locus_tag="KLTH0C10340g"
                     /product="KLTH0C10340p"
                     /transcript_id="XM_002552623.1"
                     /db_xref="GeneID:8291549"
     CDS             857898..860300
                     /locus_tag="KLTH0C10340g"
                     /note="highly similar to uniprot|P13188 Saccharomyces
                     cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
                     monomeric class I tRNA synthetase that catalyzes the
                     specific glutaminylation of tRNA(Glu) N-terminal domain
                     proposed to be involved in enzyme-tRNA interactions"
                     /codon_start=1
                     /product="KLTH0C10340p"
                     /protein_id="XP_002552669.1"
                     /db_xref="GeneID:8291549"
                     /db_xref="GOA:C5DEM0"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004514"
                     /db_xref="InterPro:IPR007638"
                     /db_xref="InterPro:IPR007639"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:C5DEM0"
                     /translation="MSSVEELSKLFSEIGFEEPKVKEIVKNKKVSGSLESLINECPNN
                     YEWDKSSRTLMHQLASLIKGTELPNQKLIVNGILSGDLKTPLQVDAAFKYIKDAKEDA
                     TEENLKKEAGVGIVVTESQVREGVQKYISDHRDDIVTQRYKLVPGILANVKGLPELKW
                     AEPRLFKPIIDEEVLKLLGPKDERDVVKKEKKKKGKEAKGGAPAETAGPKRTMFTEGF
                     LGDLHKVGENPQAYPELMADHLKVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKH
                     NDGVCYLRFDDTNPEAEAPEYFESIKSMVSWLGFKPWKITYSSDYFDKLYELAEKLIT
                     NGKAYVCHCTAEEIKRGRGIKEDGTPGGERHACVHRGRSVEENLAEFRKMRDGAYKPG
                     EATLRMKQDLESPSPQMWDLIAYRVLNASHPRTGDKWKIYPTYDFTHCLVDSFENITH
                     SLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTILSKRKIAKLVNEHYVRGW
                     NDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLEDNTPRLM
                     MVLDPVEVVVDNLPEDYEELVTVPYRPGTPEFGERQVPFTGKFYIERSDFSEATDDKE
                     FFRLTPNQPVGLIKVPYTVSYQSVDKDSNGKVIRIHVKYDNEDAKPKKPKTYIQWVPV
                     SSKYNSPVRIAETRVYNQLFKSENPSAHPEGFLNDINPESELVHGNSVVEHNFNHVIE
                     KSPWVVDSAKESEFYVEEQHGRKEVCRFQAMRVGYFTLDLESESDKIILNRIVSLKDS
                     TK"
     gene            <860484..>860678
                     /locus_tag="KLTH0C10362g"
                     /db_xref="GeneID:8291550"
     mRNA            <860484..>860678
                     /locus_tag="KLTH0C10362g"
                     /product="KLTH0C10362p"
                     /transcript_id="XM_002552624.1"
                     /db_xref="GeneID:8291550"
     CDS             860484..860678
                     /locus_tag="KLTH0C10362g"
                     /note="highly similar to uniprot|Q3E764 Saccharomyces
                     cerevisiae YLR262C-A TMA7"
                     /codon_start=1
                     /product="KLTH0C10362p"
                     /protein_id="XP_002552670.1"
                     /db_xref="GeneID:8291550"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="UniProtKB/TrEMBL:C5DEM1"
                     /translation="MSGRQGGKLKPLKSKKKGPQELDPEEAAFKEKQKADAAAKKALM
                     NNLKGGKNLVSGGIKKSGKK"
     gene            <861122..>861826
                     /locus_tag="KLTH0C10384g"
                     /db_xref="GeneID:8291551"
     mRNA            <861122..>861826
                     /locus_tag="KLTH0C10384g"
                     /product="KLTH0C10384p"
                     /transcript_id="XM_002552625.1"
                     /db_xref="GeneID:8291551"
     CDS             861122..861826
                     /locus_tag="KLTH0C10384g"
                     /note="highly similar to uniprot|Q99260 Saccharomyces
                     cerevisiae YLR262C YPT6 Ras-like GTP binding protein
                     involved in the secretory pathway, required for fusion of
                     endosome-derived vesicles with the late Golgi; has
                     similarity to the human GTPase, Rab6"
                     /codon_start=1
                     /product="KLTH0C10384p"
                     /protein_id="XP_002552671.1"
                     /db_xref="GeneID:8291551"
                     /db_xref="GOA:C5DEM2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEM2"
                     /translation="MVQHLIKSKFKVQSQLTKKLPMSANRAGKSLTKYKIVFLGEQGV
                     GKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSY
                     IRDSHVAIVVYDVTNKKSFEYIDKWVEDVKSERGEENVVLCIVGNKNDLSDERQVSTE
                     EGERKAQVLNAKIFIETSTKVGFNVKNLFRKIAKTLPEFQKSDSVPLDDNATKNKPDV
                     IDITTNEEQEQSSCQC"
     gene            complement(<862020..>863681)
                     /locus_tag="KLTH0C10406g"
                     /db_xref="GeneID:8291552"
     mRNA            complement(<862020..>863681)
                     /locus_tag="KLTH0C10406g"
                     /product="KLTH0C10406p"
                     /transcript_id="XM_002552626.1"
                     /db_xref="GeneID:8291552"
     CDS             complement(862020..863681)
                     /locus_tag="KLTH0C10406g"
                     /note="similar to uniprot|Q12246 Saccharomyces cerevisiae
                     YLR260W LCB5 Minor sphingoid long-chain base kinase
                     paralog of Lcb4p responsible for few percent of the total
                     activity possibly involved in synthesis of long- chain
                     base phosphates which function as signaling molecules and
                     similar to YOR171c"
                     /codon_start=1
                     /product="KLTH0C10406p"
                     /protein_id="XP_002552672.1"
                     /db_xref="GeneID:8291552"
                     /db_xref="GOA:C5DEM3"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:C5DEM3"
                     /translation="MKKLKSYMNNYGRAVLTDTGIMIKGQQSLPADAMEASDSSNANP
                     FADNEDRETRNSFDTSSLISCVTCLSESDSRADESSSGPLPTNTLIPYAKVLHAKEIC
                     AVSTELTPYRDEVGEQESSNAGETILSTLVEVTYARPRRHDLVPKKQLLCVGALPSGG
                     SIVEEIMSRSYKGTKRNKTILVIMNPHGGKGHAKKLYLSKVKPILAASNCTVETVETT
                     YHGHATDLAKTVDADKFDIIACASGDGIPHEVLNGLFQRPDRADAFNKLIITQLPCGS
                     GNAMSVSCHGTTNPSHAALNILKAPEIRIDLMCCSQPSYKDQPRLSFLSQTYGIIAES
                     DVNTEFIRWMGPARFDLGVLLNILQRKKYPCEVHVKYAAKTKNELREHYTYHKSKIGR
                     GESQETLDASKQDISESAFELKYPLSDEIPEGWETVDPTITNNLGIFYTGKMPYVAPD
                     AKFFPAALPSDGTFDLIITDSRTSLSRMVPILLSSDKGHHVLQPEVIHSKITAFRLIP
                     KLKHSVISVDGEKFPFEPLQVEILPGVCRTLSYDGSYVETDFDSM"
     gene            <865513..>867219
                     /locus_tag="KLTH0C10428g"
                     /db_xref="GeneID:8291553"
     mRNA            <865513..>867219
                     /locus_tag="KLTH0C10428g"
                     /product="KLTH0C10428p"
                     /transcript_id="XM_002552627.1"
                     /db_xref="GeneID:8291553"
     CDS             865513..867219
                     /locus_tag="KLTH0C10428g"
                     /note="highly similar to uniprot|P19882 Saccharomyces
                     cerevisiae YLR259C HSP60 Tetradecameric mitochondrial
                     chaperonin required for ATP-dependent folding of precursor
                     polypeptides and complex assembly; prevents aggregation
                     and mediates protein refolding after heat shock; role in
                     mtDNA transmission; similarity to groEL"
                     /codon_start=1
                     /product="KLTH0C10428p"
                     /protein_id="XP_002552673.1"
                     /db_xref="GeneID:8291553"
                     /db_xref="GOA:C5DEM4"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DEM4"
                     /translation="MLRATRGALNKRIGSVLRRNYSMHKELKFGVEGRAALLKGVETL
                     AEAVSATLGPKGRNVLIEQPFGAPKITKDGVTVAKAITLEDKFENMGAKLLQEVASKT
                     NEAAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGTQAAVEKVIEFLSANKKEIT
                     TSAEIAQVATISANGDAHVGKLLASAMEKVGKEGVITIKEGRTLEDELEVTEGMRFDR
                     GFISPYFITDAKSNKVEFEKPLLLLSEKKISSIQDILPALEISNQTRRPLLIIAEDID
                     GEALAACILNKLRGQVKVCAVKAPGFGDNRKNTLGDIAILSGGTVFTEELDLKPENCT
                     IEQLGSCGSITITKEDTVMLNGDGAKENISARIEQIKNSIDLTTTNSYEKEKLQERLA
                     KLSGGVAVVRVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALLKAARVLDE
                     VQTENFDQKLGVDIIRKAITRPARKIIENAGEEGSVIVGKIIDEYGSDFTKGYNAAKS
                     EYTDMLAAGIIDPFKVVRSGLVDASGVASLLATTEVAIVDAPQPPSAAPPAGMPGMPG
                     MM"
     gene            complement(<867872..>869572)
                     /locus_tag="KLTH0C10450g"
                     /db_xref="GeneID:8291554"
     mRNA            complement(<867872..>869572)
                     /locus_tag="KLTH0C10450g"
                     /product="KLTH0C10450p"
                     /transcript_id="XM_002552628.1"
                     /db_xref="GeneID:8291554"
     CDS             complement(867872..869572)
                     /locus_tag="KLTH0C10450g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C10450p"
                     /protein_id="XP_002552674.1"
                     /db_xref="GeneID:8291554"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEM5"
                     /translation="MTSDKKVSKAIPITLLSGFLGSGKTTLLEKILTTNHGFKIAVII
                     NDMSELNIDSSLVQAHNVCQKEEKLIELQNGCICCTLRGDLLEELVGIGERGEFDYIV
                     IESTGIAEPMQVAETFSVEFSDILLETPGGIPENEEKLLRKVSDMGGLQAIAKLDTCV
                     TVIDALNFLSNIQTTEFLADRWGENGQGEAERTITDLMVDQIEFSDVIIVNKKSMVSK
                     KKLKEIKKMVKILNPVAKVIATDYCNVPLSSILDTKLHDFEKASLSAGWLQSINEMTV
                     RDGFGNKGSSVLTPKPETEEYGVNNFVYRRRRPFHPERLYDLIRDKFFVIEQAGAAGM
                     DEEEEDDEEESEEQSSESEADSEMEAEVDEGARDGEEKEEEEGEEYTEEEINKNRANS
                     PFGKLLRSKGFFWLATRFVVRGEWSSAGPMLTLNGGLPWFAVSGLEDVPEEALELVKK
                     DYEGEFGDRRNELVFIGLDINEKLLSEALDSCLLTDKEYKRFKNITSKHNALVADEKL
                     SKVWDDGFEDWIIMGAGDEEEEDREQEEEQEEEEEEEGKERSQKSVPMEISTSKGISV
                     "
     gene            complement(870024..870133)
                     /locus_tag="KLTH0C10472r"
                     /db_xref="GeneID:8291555"
     tRNA            complement(join(870024..870059,870098..870133))
                     /locus_tag="KLTH0C10472r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove"
                     /db_xref="GeneID:8291555"
     gene            <870639..>870896
                     /locus_tag="KLTH0C10494g"
                     /db_xref="GeneID:8291556"
     mRNA            <870639..>870896
                     /locus_tag="KLTH0C10494g"
                     /product="KLTH0C10494p"
                     /transcript_id="XM_002552629.1"
                     /db_xref="GeneID:8291556"
     CDS             870639..870896
                     /locus_tag="KLTH0C10494g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C10494p"
                     /protein_id="XP_002552675.1"
                     /db_xref="GeneID:8291556"
                     /db_xref="UniProtKB/TrEMBL:C5DEM6"
                     /translation="MVEGTVYFLLAQPLNSEKVLTTAMIELVYTRVSTLSGAYEVPQV
                     VLADWEQSMRAILRSIDELHLNRVYRTRYAFVQIFKNSTVA"
     gene            <871091..>872776
                     /locus_tag="KLTH0C10516g"
                     /db_xref="GeneID:8291557"
     mRNA            <871091..>872776
                     /locus_tag="KLTH0C10516g"
                     /product="KLTH0C10516p"
                     /transcript_id="XM_002552630.1"
                     /db_xref="GeneID:8291557"
     CDS             871091..872776
                     /locus_tag="KLTH0C10516g"
                     /note="similar to uniprot|P23172 Saccharomyces cerevisiae
                     YOR380W RDR1 Transcriptional repressor involved in the
                     control of multidrug resistance negatively regulates
                     expression of the PDR5 gene member of the Gal4p family of
                     zinc cluster proteins"
                     /codon_start=1
                     /product="KLTH0C10516p"
                     /protein_id="XP_002552676.1"
                     /db_xref="GeneID:8291557"
                     /db_xref="GOA:C5DEM7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DEM7"
                     /translation="MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAY
                     KCHYDEQGDPATLPAPLIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQG
                     VFDAAKSRYMGLSSAVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDL
                     ITKEETFHFTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGS
                     LFSGRPGHPRELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLA
                     SCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDY
                     GRSSASLGGISCKLPTKSDGNYTAQLVDLALIIPPANTEASKETRVADLLQALTLVYE
                     TPDEHNFLSLVKADLCNSFYRRLRLFNYTLDSEVVFQLTTVCNHALSAAYDLVERKLP
                     WWNVLSAPFQYICVLLAINTSESLANVAKAKNIFDRIVSNLNTHMAIEAQNTIKLLLQ
                     DSIKKKRQELTDLEAADQAGTASEAPFTAEIDWDVLLDPSHALHLMQQDFSSF"
     gene            complement(<873623..>874444)
                     /locus_tag="KLTH0C10538g"
                     /db_xref="GeneID:8291558"
     mRNA            complement(<873623..>874444)
                     /locus_tag="KLTH0C10538g"
                     /product="KLTH0C10538p"
                     /transcript_id="XM_002552631.1"
                     /db_xref="GeneID:8291558"
     CDS             complement(873623..874444)
                     /locus_tag="KLTH0C10538g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C10538p"
                     /protein_id="XP_002552677.1"
                     /db_xref="GeneID:8291558"
                     /db_xref="GOA:C5DEM8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DEM8"
                     /translation="MNARGGFPYTVFPRIPGRDFAGTVVAGPRSGEEVFGTSGYTHAF
                     TTNGFHAEYCVVSEDAVALKPKNVTFAQAACLGVPLTTASLALQRAAVEPSDCVSVIG
                     ASGSVGSYVVQLAQSMGCRVLRAARQSPTDVCIAEDEEFSALTSLTQGRGVDVVIDTV
                     GMPALMKAAAEKLAHGGRMAVISARYGAELAIHLKDFYRNEKSLVGCNTLSHSAPKLA
                     KELAAMSQALEKGDITPEDEKVWTKFSLGQAAEAYRKSEEGSGKYVLVMEEHCKV"
     gene            <875216..>876763
                     /locus_tag="KLTH0C10560g"
                     /db_xref="GeneID:8291559"
     mRNA            <875216..>876763
                     /locus_tag="KLTH0C10560g"
                     /product="KLTH0C10560p"
                     /transcript_id="XM_002552632.1"
                     /db_xref="GeneID:8291559"
     CDS             875216..876763
                     /locus_tag="KLTH0C10560g"
                     /note="similar to uniprot|Q08902 Saccharomyces cerevisiae
                     YOR378W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C10560p"
                     /protein_id="XP_002552678.1"
                     /db_xref="GeneID:8291559"
                     /db_xref="GOA:C5DEM9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DEM9"
                     /translation="MSFTDKEENQKKDDGLTRESTHDQGQELSQPHHNGIQKPESLLG
                     EAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILI
                     AGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQIFFDCCRAFQGIGPALLLPNAI
                     AILGRTYVPGRRKAMILSLFGATAPAGFVLGAVFSSIFGQLTWWPWAYWAMGIVCFFL
                     AVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYT
                     YSLLIVSAVFLCVFAFIESRAPHPLLPLSALSSDAAFVLGCVGAGWSSFGIWIYYFWL
                     FLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILI
                     ATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYS
                     ISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKKM
                     PSEKPFA"
     gene            <877398..>878843
                     /locus_tag="KLTH0C10582g"
                     /db_xref="GeneID:8291560"
     mRNA            <877398..>878843
                     /locus_tag="KLTH0C10582g"
                     /product="KLTH0C10582p"
                     /transcript_id="XM_002552633.1"
                     /db_xref="GeneID:8291560"
     CDS             877398..878843
                     /locus_tag="KLTH0C10582g"
                     /note="similar to uniprot|Q04712 Saccharomyces cerevisiae
                     YML043C RRN11 rDNA transcription factor CF component which
                     also contains Rrn6p and Rrn7p which is required for rDNA
                     transcription by RNA polymerase I component of rDNA
                     transcription factor"
                     /codon_start=1
                     /product="KLTH0C10582p"
                     /protein_id="XP_002552679.1"
                     /db_xref="GeneID:8291560"
                     /db_xref="InterPro:IPR007224"
                     /db_xref="UniProtKB/TrEMBL:C5DEN0"
                     /translation="MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQSFANANSTL
                     PTPENSAAEEASDGDHNSADATSRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEAD
                     QADSEKEFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMA
                     HISKNANFHFQAMKDGYETVAETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLL
                     IRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMD
                     PVFRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIP
                     PYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIR
                     TCEAKKEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFELDNSPENLDTQNVL
                     GPGMSPMIDEEENFFGSAEQVHFGFDSDSST"
     gene            complement(<878953..>880500)
                     /locus_tag="KLTH0C10604g"
                     /db_xref="GeneID:8291561"
     mRNA            complement(<878953..>880500)
                     /locus_tag="KLTH0C10604g"
                     /product="KLTH0C10604p"
                     /transcript_id="XM_002552634.1"
                     /db_xref="GeneID:8291561"
     CDS             complement(878953..880500)
                     /locus_tag="KLTH0C10604g"
                     /note="similar to uniprot|Q08109 Saccharomyces cerevisiae
                     YOL013C HRD1 Ubiquitin-protein ligase required for
                     endoplasmic reticulum-associated degradation (ERAD) of
                     misfolded proteins genetically linked to the unfolded
                     protein response (UPR) regulated through association with
                     Hrd3p contains an H2 ring finger"
                     /codon_start=1
                     /product="KLTH0C10604p"
                     /protein_id="XP_002552680.1"
                     /db_xref="GeneID:8291561"
                     /db_xref="GOA:C5DEN1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DEN1"
                     /translation="MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCE
                     GLNLVVLCNFAIVNSILLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPE
                     YQFLTVMILFALLTFIRVFHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVV
                     DYQMVRFCLRNSLTNKHDPSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCK
                     RAFERDGDDFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIA
                     LFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKP
                     KKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISEDASVAQ
                     QPLSAANESNSTSLASTHTGSLGAVSSSNPNFPTWYTFPVTLSDNDGAVDFKVRDING
                     VEINAKLIIKKRPGFDVPKEQDQESQRVVINDPPATQYQDIERLKRRISELENKVDEL
                     TKKARTE"
     gene            <880732..>881151
                     /locus_tag="KLTH0C10626g"
                     /db_xref="GeneID:8291562"
     mRNA            <880732..>881151
                     /locus_tag="KLTH0C10626g"
                     /product="KLTH0C10626p"
                     /transcript_id="XM_002552635.1"
                     /db_xref="GeneID:8291562"
     CDS             880732..881151
                     /locus_tag="KLTH0C10626g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C10626p"
                     /protein_id="XP_002552681.1"
                     /db_xref="GeneID:8291562"
                     /db_xref="InterPro:IPR010754"
                     /db_xref="UniProtKB/TrEMBL:C5DEN2"
                     /translation="MSGLALKLGTLLIRQVTRPVANVLKAQAKQHDTFKKVCVGLAQK
                     MHRVDARLRTRMTPGNREIKIRPLNDARAVENGATWLSEAFVFGVTGSVVVWETLRQR
                     TKELNRREQVANDISFLQSEIESLREKLDAKERAAGK"
     gene            complement(<881350..>881754)
                     /locus_tag="KLTH0C10648g"
                     /db_xref="GeneID:8291563"
     mRNA            complement(<881350..>881754)
                     /locus_tag="KLTH0C10648g"
                     /product="KLTH0C10648p"
                     /transcript_id="XM_002552636.1"
                     /db_xref="GeneID:8291563"
     CDS             complement(881350..881754)
                     /locus_tag="KLTH0C10648g"
                     /note="highly similar to uniprot|Q12692 Saccharomyces
                     cerevisiae YOL012C HTZ1 Histone variant H2AZ exchanged for
                     histone H2A in nucleosomes by the SWR1 complex involved in
                     transcriptional regulation through prevention of the
                     spread of silent heterochromatin"
                     /codon_start=1
                     /product="KLTH0C10648p"
                     /protein_id="XP_002552682.1"
                     /db_xref="GeneID:8291563"
                     /db_xref="GOA:C5DEN3"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DEN3"
                     /translation="MSGKVHGGKGKSGAKTGSNMRATTHSARAGLQFPVGRIKRYLKR
                     NAAGRTRVGSKSAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDEL
                     DTLVRATIASGGVLPHINKALLLKVERKGTKN"
     gene            <882520..>884478
                     /locus_tag="KLTH0C10670g"
                     /db_xref="GeneID:8291564"
     mRNA            <882520..>884478
                     /locus_tag="KLTH0C10670g"
                     /product="KLTH0C10670p"
                     /transcript_id="XM_002552637.1"
                     /db_xref="GeneID:8291564"
     CDS             882520..884478
                     /locus_tag="KLTH0C10670g"
                     /note="similar to uniprot|P39105 Saccharomyces cerevisiae
                     YMR008C PLB1 Phospholipase B (lysophospholipase) involved
                     in lipid metabolism required for deacylation of
                     phosphatidylcholine and phosphatidylethanolamine but not
                     phosphatidylinositol"
                     /codon_start=1
                     /product="KLTH0C10670p"
                     /protein_id="XP_002552683.1"
                     /db_xref="GeneID:8291564"
                     /db_xref="GOA:C5DEN4"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C5DEN4"
                     /translation="MLWLVPLFLLALRAVQAWSPTDSYAPGNVSCADDISLVREASGL
                     SPNETAWLEKRDAYTKQALREFLDGATANFSNSSLVDSLWSADKIPRVAMAFSGGGYR
                     AMLSGAGMISAFDNRTNGSTEHGLGGLLQGATYLAGLSGGNWLVGSLAWNNWTSVQHV
                     IDTRGKDDELWDISNSIVNPGGINILSSASRWDQISDAVEAKQDAGFNTSLADVWGRA
                     LAYNFFPTLSKGGDGYTWSTLRDADVFKNGEMPFPISVADGRYPGTQIVDLNSTLFEF
                     NPFEMGSWDPSLNAFTDVKYLGTNARNGTPVTKGQCVAGFDNTGFVIGTSSTLFNQFL
                     LQLNTTSVSSFLKGIIGDFLKDLSEDYDDIAIYNPNPFRETEFVESNYTKGIVNSENL
                     FLVDGGEDGENIPFVPLIQKERDVDVIFALDNSADTDEYWPAGLSLISTYERQFGAQG
                     KDIAFPYVPDFDTFINEGLNQKPVFFGCDASNTTGLSYTPPLIVYMPNNRQSYNSNTS
                     TFKMSYSSSQRMKMFQNGFEAVTRNNLTDDSSFRGCVACAVLRRKQESQNMTLPQECA
                     KCFQDYCWNGKISNKTAKVSTIENYSGSISFITDSASADAASSTAAASSSGTSTSKKN
                     AAASLPSSNSLKWYVAFASLLGMAIGLM"
     gene            884867..884940
                     /locus_tag="KLTH0C10692r"
                     /db_xref="GeneID:8291565"
     tRNA            884867..884940
                     /locus_tag="KLTH0C10692r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8291565"
     gene            complement(<885055..>886287)
                     /locus_tag="KLTH0C10714g"
                     /db_xref="GeneID:8291566"
     mRNA            complement(<885055..>886287)
                     /locus_tag="KLTH0C10714g"
                     /product="KLTH0C10714p"
                     /transcript_id="XM_002552638.1"
                     /db_xref="GeneID:8291566"
     CDS             complement(885055..886287)
                     /locus_tag="KLTH0C10714g"
                     /note="similar to uniprot|P50105 Saccharomyces cerevisiae
                     YMR005W TAF4 TFIID subunit (48 kDa) involved in RNA
                     polymerase II transcription initiation potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0C10714p"
                     /protein_id="XP_002552684.1"
                     /db_xref="GeneID:8291566"
                     /db_xref="GOA:C5DEN5"
                     /db_xref="InterPro:IPR007900"
                     /db_xref="UniProtKB/TrEMBL:C5DEN5"
                     /translation="MARSPKRQDPNAQENLRAKRPKKEEQEQIFDEEEPAFEIGGGNT
                     NESASPENTDFSTNMPTPFDNIVEDPVGGASLPESASPTTNLAQTTNSNSQSVKDVDD
                     KKRGRPSGSQTQNTKVNSTGPKKSVMTQSSASAHHPNTQQAQSQNQQAASSKMQTDPD
                     KLSDALFSAGVDIREEEALLNSSMNITKSSAQAGSQAVNNQIPPQPPLLHPTHVASFM
                     KKVGSEQNFNQDFSKAHDVLSLMSTACEVFMTDIITNSLVISRHRRRSIKLNSGRRSE
                     VSRALRDLAIHQKEQEERRVKRRIAMGLEKETAEAKMETEETLHRASNATANMMIAGG
                     KKKYSWLNAGAKANNNSVKVLGKVSSDVAARGEMGIRYREAREEPGIVMRDLLNALEN
                     RRVGVNTVVAKGYARIRD"
     gene            <886518..>887612
                     /locus_tag="KLTH0C10736g"
                     /db_xref="GeneID:8291567"
     mRNA            <886518..>887612
                     /locus_tag="KLTH0C10736g"
                     /product="KLTH0C10736p"
                     /transcript_id="XM_002552639.1"
                     /db_xref="GeneID:8291567"
     CDS             886518..887612
                     /locus_tag="KLTH0C10736g"
                     /note="highly similar to uniprot|Q08096 Saccharomyces
                     cerevisiae YOL010W RCL1 RNA terminal phosphate
                     cyclase-like protein involved in rRNA processing at sites
                     A0 A1 and A2 does not possess detectable RNA cyclase
                     activity"
                     /codon_start=1
                     /product="KLTH0C10736p"
                     /protein_id="XP_002552685.1"
                     /db_xref="GeneID:8291567"
                     /db_xref="GOA:C5DEN6"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="UniProtKB/TrEMBL:C5DEN6"
                     /translation="MSSSRITSFQGSRNFRLLIVLATLSGKPIKIEKIRSDDLNPGLR
                     DHEVSFLRLMEAVTNGSSIEISYTGTTIIYKPGIITGGSYTHNCPPSKPVGYYVEPML
                     YLAPFSKNKFSIIFRGVTASHNDAGVEAIKWGLLPVMEKFGVRECALHTLKRGSPPLG
                     GGEVHLVVDSLIAQPVTMHALDTPQIASIRGVAYSTRVSPSMVNRMIEGARNVLRGLS
                     CEVDITADVWRGENSGKSPGWGITLVAESKKGWRYFAENIGGAGDVPEDIGTQVAYEL
                     LEEISESAVVGRTQLPLAIVYMVIGKEDIGRLRITKSQVDERFIWLLRHIKKMFGTEV
                     FLKPVDEPESDDIIVTIKGIGFTNTNKKTA"
     gene            complement(<887737..>889305)
                     /locus_tag="KLTH0C10758g"
                     /db_xref="GeneID:8291568"
     mRNA            complement(<887737..>889305)
                     /locus_tag="KLTH0C10758g"
                     /product="KLTH0C10758p"
                     /transcript_id="XM_002552640.1"
                     /db_xref="GeneID:8291568"
     CDS             complement(887737..889305)
                     /locus_tag="KLTH0C10758g"
                     /note="similar to uniprot|P40959 Saccharomyces cerevisiae
                     YMR004W MVP1 Protein required for sorting proteins to the
                     vacuole overproduction of Mvp1p suppresses several
                     dominant VPS1 mutations Mvp1p and Vps1p act in concert to
                     promote membrane traffic to the vacuole"
                     /codon_start=1
                     /product="KLTH0C10758p"
                     /protein_id="XP_002552686.1"
                     /db_xref="GeneID:8291568"
                     /db_xref="GOA:C5DEN7"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DEN7"
                     /translation="MSLYDDLEDPWRSEQPTSTSHSANEWTGLNVDPLAGSDVLPSGS
                     LISGINTMTLDSGLGNSGSLPVGSSTLLSAHPENSMEGAWSDSLDEANHRVSNDLNRG
                     EMVAGVPFQSENPHSTEESGKEDYEVWSDGIRKAYNPLAPDIITVEEIPEREGLLFKH
                     TNYLVKHLVELPDTEPSSDRSVIRRYSDFVWLQEVLLKKYPFRMIPDLPPKRIGSHSS
                     DPIFLIKRRNGLSRFINIVVKHPVFKKDDLVLTFLTVPTDLLGWRKQASYDTSDEFTD
                     RKIEASFIKMWRKDMAERWNQADASIDGALELWAKITVLVDRCEKRLRFIAQDRSMLA
                     SMLDSFSDSAPQIFASDDGTLLDIKNHLGIVSKHLTTCNNLVKEENMQASSELSPRFR
                     TFTDVLLSLKGLFERYKIMAGNNVPQLQRRIEVNTDRLEQMKDKPDLKGAEYDRVKQS
                     IQRDRKSIAEQMNRSWLVRKCILEEYVYFQETQFLVSDVFQRWVKLNMTFNELNTNEW
                     EKLLDHVQAMPSTR"
     gene            complement(<889534..>890340)
                     /locus_tag="KLTH0C10780g"
                     /db_xref="GeneID:8291569"
     mRNA            complement(<889534..>890340)
                     /locus_tag="KLTH0C10780g"
                     /product="KLTH0C10780p"
                     /transcript_id="XM_002552641.1"
                     /db_xref="GeneID:8291569"
     CDS             complement(889534..890340)
                     /locus_tag="KLTH0C10780g"
                     /note="similar to uniprot|Q92328 Saccharomyces cerevisiae
                     YOL009C MDM12 Required for normal mitochondrial morphology
                     and distribution Mdm12p is a mitochondrial outer membrane
                     protein. An Mdm12p homolog exists in S. Pombe which
                     confers a dominant negative phenotype when expressed in S.
                     cerevisiae"
                     /codon_start=1
                     /product="KLTH0C10780p"
                     /protein_id="XP_002552687.1"
                     /db_xref="GeneID:8291569"
                     /db_xref="GOA:C5DEN8"
                     /db_xref="InterPro:IPR027532"
                     /translation="MSFEINWQDLGEDEAVNDSIKSFLNSHLQSISLPSYVSSLQVTD
                     FCLGGIPPNITLREISDPLDEFYNHIEKEELPKDKIPEESDSGCQSADGENGDLLPEV
                     QAESDLQFLVEVDYKGDMRIGVSAELALNYPSPSFMTLPVKLSITDLGIHALCLVAYI
                     SKQLFVSFLCDVADPILDARESLIDLGSSAILGKKSLERISLIRSIKIDSEIGEQNNV
                     EGSVLRSVGKLEQFLLEVFRTILKKEAAWPSWINLDFNEDPSGNESSDED"
     gene            <890455..>891060
                     /locus_tag="KLTH0C10802g"
                     /db_xref="GeneID:8291570"
     mRNA            <890455..>891060
                     /locus_tag="KLTH0C10802g"
                     /product="KLTH0C10802p"
                     /transcript_id="XM_002552642.1"
                     /db_xref="GeneID:8291570"
     CDS             890455..891060
                     /locus_tag="KLTH0C10802g"
                     /note="similar to uniprot|Q08058 Saccharomyces cerevisiae
                     YOL008W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C10802p"
                     /protein_id="XP_002552688.1"
                     /db_xref="GeneID:8291570"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:C5DEN9"
                     /translation="MIKTCLKGPSATALRQCTIYQKRSFLKSSKGPKEQTFLLTKTIN
                     APVTNVYSVICDISEYHRFIPYCNESFVNKRNPVTGLPTEAGLRVGFQHYDEKYVCQI
                     HCQRDPSDHCIVQADSLTHSLFDVLLTKWTICPHPSKDGVTTAELLLKFKFKFSLYNN
                     VASIFGKSVTQHVMKSFERRIFMLMKQEAKARSSKKSQRTT"
     gene            complement(<891260..>892060)
                     /locus_tag="KLTH0C10824g"
                     /db_xref="GeneID:8291571"
     mRNA            complement(<891260..>892060)
                     /locus_tag="KLTH0C10824g"
                     /product="KLTH0C10824p"
                     /transcript_id="XM_002552643.1"
                     /db_xref="GeneID:8291571"
     CDS             complement(891260..892060)
                     /locus_tag="KLTH0C10824g"
                     /note="weakly similar to uniprot|Q03673 Saccharomyces
                     cerevisiae YMR003W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C10824p"
                     /protein_id="XP_002552689.1"
                     /db_xref="GeneID:8291571"
                     /db_xref="GOA:C5DEP0"
                     /db_xref="InterPro:IPR003034"
                     /translation="MNKQFYSQQWKGVLTGFRPLTMVSPRFSMFLVPRRISCRFVHST
                     PKKDHTTLLSNDKLATFNVMSLKALKNECRTRGLKISGRKGELVDRILAFETSGSLSG
                     GAAKQAARQLHISKSIRARNDIKPVDDVRMPDIAATEKSLETPEQEYIVHITPLSSSA
                     DKKPVTRLEKELSVEEVSANVPPAVSTTDHDKVIFQVDAPTDNIEVVDEEAELDADKR
                     ASENFGLHATKEELNSRDKTFLFGFAAALVGWWSLKFWDNKGKKRSLT"
     gene            complement(<892459..>892920)
                     /locus_tag="KLTH0C10846g"
                     /db_xref="GeneID:8291572"
     mRNA            complement(<892459..>892920)
                     /locus_tag="KLTH0C10846g"
                     /product="KLTH0C10846p"
                     /transcript_id="XM_002552644.1"
                     /db_xref="GeneID:8291572"
     CDS             complement(892459..892920)
                     /locus_tag="KLTH0C10846g"
                     /note="similar to uniprot|Q03667 Saccharomyces cerevisiae
                     YMR002W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C10846p"
                     /protein_id="XP_002552690.1"
                     /db_xref="GeneID:8291572"
                     /db_xref="UniProtKB/TrEMBL:C5DEP1"
                     /translation="MARSRGGVRSRPAPAQTRSASSMAAYPPAQQHAPQTSAYSHPQS
                     ATQPRQPGLFAQMASTAAGVAVGSAVGHTVGAGITGMFSGSSSAPAEQQQQQLAAAAP
                     AQQGFAQEQARSCDLDARNLTRCLEENSGNMQICEFYLQQLKACQEAARPY"
     gene            complement(<893158..>894057)
                     /locus_tag="KLTH0C10868g"
                     /db_xref="GeneID:8291573"
     mRNA            complement(<893158..>894057)
                     /locus_tag="KLTH0C10868g"
                     /product="KLTH0C10868p"
                     /transcript_id="XM_002552645.1"
                     /db_xref="GeneID:8291573"
     CDS             complement(893158..894057)
                     /locus_tag="KLTH0C10868g"
                     /note="some similarities with uniprot|Q08054 Saccharomyces
                     cerevisiae YOL007C Appears to be a structural component of
                     the chitin synthase 3 complex"
                     /codon_start=1
                     /product="KLTH0C10868p"
                     /protein_id="XP_002552691.1"
                     /db_xref="GeneID:8291573"
                     /db_xref="UniProtKB/TrEMBL:C5DEP2"
                     /translation="MKVHQVFVTLCAIISLASATAEFNRAFSSLRKRALPSLTASTTA
                     SSTRNSSLPAITSSAAADSASLSSSNSTTSASNTTSSYIPTFTPQVPDSTGNHYIFRT
                     KYHNGTVFVAVGATMGAIVSAFGLAWLILAAKAWSSARREHRIHSLRSRYQSDPFLFH
                     SGDADSNYSNGSDSSDISEQVLKTRATTRPSIYSLGSHSTIDLLQRCAQDGPLISEAN
                     KESMFISPTAVIKNTANNKSALSQGTPTSDTFNTTPVQGADVVNFYGSYYHPSHAAEA
                     QAHETGRTRPPSVHLEKMFDENR"
     gene            complement(<894335..>896605)
                     /locus_tag="KLTH0C10890g"
                     /db_xref="GeneID:8291574"
     mRNA            complement(<894335..>896605)
                     /locus_tag="KLTH0C10890g"
                     /product="KLTH0C10890p"
                     /transcript_id="XM_002552646.1"
                     /db_xref="GeneID:8291574"
     CDS             complement(894335..896605)
                     /locus_tag="KLTH0C10890g"
                     /note="similar to uniprot|P04786 Saccharomyces cerevisiae
                     YOL006C TOP1 topoisomerase I"
                     /codon_start=1
                     /product="KLTH0C10890p"
                     /protein_id="XP_002552692.1"
                     /db_xref="GeneID:8291574"
                     /db_xref="GOA:C5DEP3"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:C5DEP3"
                     /translation="MTVKLKDETSDEDDIPLASATNGRRKRKIDYSEQGEDSNNEVKE
                     EEGDSYDSDEKLSEVSKSGPKTKRARKTTPTKKSATKRVAKKAKKAVKREPSVEQQNA
                     EPEEDSKELTEDADSFKWWEKENEDDSIKWTTLKHNGVIFPPPYEPLPSHIKLYYDGK
                     PVDLPPQAEEVAGFFAALLESDHAQNPVFQKNFFNDFLDVLRENGGPKNGAEIEKFEL
                     CDFSKMFDYFQLQKEQKKQLSSQEKKKLKIEKEQFEEPFKFCFLDGRKEQVGNFRIEP
                     PGLFRGRGAHPKTGKLKRRVYPEDVVLNLDKEAEIPKAPEGHKWGEIRHDSTVQWLAM
                     WRENISNSFKYVRFAANSSLKGMSDFKKFEKARQLRGFIDAIRADYTKNLKSKVMLER
                     QIAVACYFIDVFALRAGGEKADDEADTVGCCSLRYEHVTLKPPNTVIFDFLGKDSIRF
                     YQEVEVTKQVFKNLTIFKKPPKKPGHQLFDRLDPSILNKHLQNYMPGLTAKVFRTYNA
                     SKTMQDQLDLIPNEGTVAEKMLKYNAANRTVAILCNHQRTVTKGHAASVQKATERIEE
                     LEWQKIRLKRAILQLDEKQAKKDPKFFAEVTDLVKEQEAAIHKRLIEKEREKYVKKFS
                     RENEKRKFEKQEELPESQLKEWMARVDELEKQYNEELESGKVQLKTNSESAEKLKMQI
                     EKLDQRIETATIQLKDKEDNSQVALGTSKINYIDPRLSVVFCKKYGVPIEKVFTKSLR
                     DKFKWAIESADENWRF"
     gene            <898372..>900465
                     /locus_tag="KLTH0C10912g"
                     /db_xref="GeneID:8291575"
     mRNA            <898372..>900465
                     /locus_tag="KLTH0C10912g"
                     /product="KLTH0C10912p"
                     /transcript_id="XM_002552647.1"
                     /db_xref="GeneID:8291575"
     CDS             898372..900465
                     /locus_tag="KLTH0C10912g"
                     /note="highly similar to uniprot|P32562 Saccharomyces
                     cerevisiae YMR001C"
                     /codon_start=1
                     /product="KLTH0C10912p"
                     /protein_id="XP_002552693.1"
                     /db_xref="GeneID:8291575"
                     /db_xref="GOA:C5DEP4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DEP4"
                     /translation="MSAAPLQIVNERHLNTRTNAVFTPTKHTAGKENQHLSSNKRLDH
                     NNDQHRQPAQKKKKEKLSALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGK
                     IFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPN
                     GSLMDLLKRRKVLTEPEVRFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIG
                     DFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHSYEVDIWSCGVMIYALLIGKP
                     PFQAKEVNIIYERIKCGDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWF
                     RGIFPPRIDASVLSSAPSYENLDAAQSLANFKNCMAHSGLLSGSSSSTKDPIRMVKTD
                     LEQEKSRTILPQSLSPGGTKNKYQEVVDLDAQRKLNDLAREARVRRAQQATIKKDLVA
                     TSTNAIKSEISLRILASECHLTLNGILEAEAQKRMGGLPKSRLPKLKNPIVVTKWVDY
                     SNKHGFSYQLSTDDIGVLFNNGTTVLRLADAEEFWYISYDDREGWVASHYNLAERPHE
                     LARHLEVVDFFSKYMKANLSRISTFVREEYHKDDVFLRRYTRYKQYVMFELSDGTFQF
                     NFKDHHKFAVSEGGSLITYISPDRESCTFPTVELLKTGEIPNHPEINFTDKLFMIKEG
                     LKQKASIVSITQSQL"
     gene            complement(<900683..>901051)
                     /locus_tag="KLTH0C10934g"
                     /db_xref="GeneID:8291576"
     mRNA            complement(<900683..>901051)
                     /locus_tag="KLTH0C10934g"
                     /product="KLTH0C10934p"
                     /transcript_id="XM_002552648.1"
                     /db_xref="GeneID:8291576"
     CDS             complement(900683..901051)
                     /locus_tag="KLTH0C10934g"
                     /note="highly similar to uniprot|P38902 Saccharomyces
                     cerevisiae YOL005C"
                     /codon_start=1
                     /product="KLTH0C10934p"
                     /protein_id="XP_002552694.1"
                     /db_xref="GeneID:8291576"
                     /db_xref="GOA:C5DEP5"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:C5DEP5"
                     /translation="MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLAN
                     LIRGELLEDKGVLFAAYKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQ
                     SNFETEWNLQTLASEDNYAM"
     gene            <901384..>905685
                     /locus_tag="KLTH0C10956g"
                     /db_xref="GeneID:8291577"
     mRNA            <901384..>905685
                     /locus_tag="KLTH0C10956g"
                     /product="KLTH0C10956p"
                     /transcript_id="XM_002552649.1"
                     /db_xref="GeneID:8291577"
     CDS             901384..905685
                     /locus_tag="KLTH0C10956g"
                     /note="similar to uniprot|P22579 Saccharomyces cerevisiae
                     YOL004W SIN3 DNA binding protein involved in
                     transcriptional regulation"
                     /codon_start=1
                     /product="KLTH0C10956p"
                     /protein_id="XP_002552695.1"
                     /db_xref="GeneID:8291577"
                     /db_xref="GOA:C5DEP6"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:C5DEP6"
                     /translation="MPPSWTNQPASQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGE
                     SKANAPVDASQQPHQFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGF
                     SVASLNNPLPAQQQMLHSQQQQQLLQQGVLPLEHVQDPSYRPLNFKDALSYLEQVKFQ
                     FNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIEC
                     TLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAA
                     VQPKLENAPTNLPVPTTFNQNLPQHEQQNQQHGSQSPAMPQQQRQDQQFMGNRPSGDV
                     EFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLL
                     DDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQQIQQHQSHYQNASQDLDQRQQHTH
                     QPFGNTVPFYQTQQGRPQNLPPLGSFSPPINGRENDPQLNLPAVQPPAMEFASQQVPH
                     HPSHVVPQVIPGGTLPLSDLRGAMDGNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPV
                     IPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKV
                     EHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTF
                     MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE
                     ANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEII
                     DALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQA
                     DKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFI
                     DHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSDAVSNSNPRKRLWESEQ
                     PLKELLRSKHKHHKKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNI
                     LDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVV
                     QFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKA
                     FKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYM
                     GLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPH
                     EEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTR
                     FAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLH
                     GKHESLNKNPALVQGTRDPRHESSVAKEASSLESHADDTELKAGETTAEDIQGNE"
     gene            complement(<905760..>906893)
                     /locus_tag="KLTH0C10978g"
                     /db_xref="GeneID:8291578"
     mRNA            complement(<905760..>906893)
                     /locus_tag="KLTH0C10978g"
                     /product="KLTH0C10978p"
                     /transcript_id="XM_002552650.1"
                     /db_xref="GeneID:8291578"
     CDS             complement(905760..906893)
                     /locus_tag="KLTH0C10978g"
                     /note="similar to uniprot|Q12006 Saccharomyces cerevisiae
                     YOL003C DHHC-CRD protein"
                     /codon_start=1
                     /product="KLTH0C10978p"
                     /protein_id="XP_002552696.1"
                     /db_xref="GeneID:8291578"
                     /db_xref="GOA:C5DEP7"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:C5DEP7"
                     /translation="MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFE
                     FSLTLIWVSYAFAIFKNPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVL
                     SMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHT
                     SELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVP
                     QLIDNLKELFPEDTFDEGAAQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWC
                     LPCGRPRDEGTRFVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETF
                     SSGGEATLRNRSFDSRISVPRTEWHNDWGENLSDFGVDVDAET"
     repeat_region   908123..908365
                     /rpt_type=long_terminal_repeat
     gene            908424..908496
                     /locus_tag="KLTH0C11022r"
                     /db_xref="GeneID:8291580"
     tRNA            908424..908496
                     /locus_tag="KLTH0C11022r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:8291580"
     gene            complement(<908604..>909551)
                     /locus_tag="KLTH0C11044g"
                     /db_xref="GeneID:8291581"
     mRNA            complement(<908604..>909551)
                     /locus_tag="KLTH0C11044g"
                     /product="KLTH0C11044p"
                     /transcript_id="XM_002552651.1"
                     /db_xref="GeneID:8291581"
     CDS             complement(908604..909551)
                     /locus_tag="KLTH0C11044g"
                     /note="similar to uniprot|Q12442 Saccharomyces cerevisiae
                     YOL002C IZH2 Membrane protein involved in zinc metabolism
                     member of the four-protein IZH family direct target of the
                     Zap1p transcription factor expression induced by zinc
                     deficiency and fatty acids deletion increases sensitivity
                     to elevated zinc"
                     /codon_start=1
                     /product="KLTH0C11044p"
                     /protein_id="XP_002552697.1"
                     /db_xref="GeneID:8291581"
                     /db_xref="GOA:C5DEP8"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:C5DEP8"
                     /translation="MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTW
                     DEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFN
                     QVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIV
                     ALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLF
                     VAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGC
                     FDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHHVKVV"
     gene            complement(<910359..>912566)
                     /locus_tag="KLTH0C11066g"
                     /db_xref="GeneID:8291582"
     mRNA            complement(<910359..>912566)
                     /locus_tag="KLTH0C11066g"
                     /product="KLTH0C11066p"
                     /transcript_id="XM_002552652.1"
                     /db_xref="GeneID:8291582"
     CDS             complement(910359..912566)
                     /locus_tag="KLTH0C11066g"
                     /note="similar to uniprot|Q12149 Saccharomyces cerevisiae
                     YOR001W RRP6 Exonuclease component of the nuclear exosome
                     contributes to the quality-control system that retains and
                     degrades aberrant mRNAs in the nucleus"
                     /codon_start=1
                     /product="KLTH0C11066p"
                     /protein_id="XP_002552698.1"
                     /db_xref="GeneID:8291582"
                     /db_xref="GOA:C5DEP9"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002562"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012588"
                     /db_xref="UniProtKB/TrEMBL:C5DEP9"
                     /translation="MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATS
                     VNNISARLLGLINDILLSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAG
                     EKRDNGELSKTVQYLDDSPSLHDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHA
                     LRSLDESLRLTAEQEDVPAHYPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWV
                     DNTDALKLMLNELLLANEIAIDLEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDL
                     WILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLL
                     ERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFLLNIYDNMRNSLIEQNKLSQVL
                     HDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLMFQYNIPQSKSLLVRRLYEW
                     RDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTFVTEHIRQNAKSLALLIK
                     KSLESSSNEFGQLLNSANTVQNSSPTKMSSEDIEKNSRMFEKFLEDFSYEKAADCGIS
                     LGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQVSKKYEAERDIARPQVHIRA
                     ASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVLKQRKTLADKEQRAVDKATPSIE
                     PLDLQSARKILEAPSNNVRRPKKRFDPYATLAAGPPSVKKRKKTKGLQKSFRG"
     misc_feature    912837..912964
                     /note="Centromere Klth0C"
     gene            complement(<914257..>915099)
                     /locus_tag="KLTH0C11110g"
                     /db_xref="GeneID:8291584"
     mRNA            complement(<914257..>915099)
                     /locus_tag="KLTH0C11110g"
                     /product="KLTH0C11110p"
                     /transcript_id="XM_002552653.1"
                     /db_xref="GeneID:8291584"
     CDS             complement(914257..915099)
                     /locus_tag="KLTH0C11110g"
                     /note="similar to uniprot|P20052 Saccharomyces cerevisiae
                     YOL001W PHO80 Cyclin negatively regulates phosphate
                     metabolism Pho80p-Pho85p (cyclin-CDK complex)
                     phosphorylates Pho4p and Swi5p deletion of PHO80 leads to
                     aminoglycoside supersensitivity truncated form of PHO80
                     affects vacuole inheritance"
                     /codon_start=1
                     /product="KLTH0C11110p"
                     /protein_id="XP_002552699.1"
                     /db_xref="GeneID:8291584"
                     /db_xref="GOA:C5DEQ0"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ0"
                     /translation="MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRT
                     DLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAV
                     LIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQC
                     SELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVTATYAKENRGPNNGFNVLDT
                     YYQKIIEIVGSYDSSPDKTKRAHYVMKTPPAPREAEAPKKKRAHEESESAGSQASSSC
                     KKPA"
     gene            complement(<915337..>915963)
                     /locus_tag="KLTH0C11132g"
                     /db_xref="GeneID:8291585"
     mRNA            complement(<915337..>915963)
                     /locus_tag="KLTH0C11132g"
                     /product="KLTH0C11132p"
                     /transcript_id="XM_002552654.1"
                     /db_xref="GeneID:8291585"
     CDS             complement(915337..915963)
                     /locus_tag="KLTH0C11132g"
                     /note="highly similar to uniprot|P32939 Saccharomyces
                     cerevisiae YML001W YPT7 Gtp-binding protein of the rab
                     family required for homotypic fusion event in vacuole
                     inheritance for endosome-endosome fusion and for fusion of
                     endosomes to vacuoles when expressed from high copy
                     plasmid GTP-binding protein rab family"
                     /codon_start=1
                     /product="KLTH0C11132p"
                     /protein_id="XP_002552700.1"
                     /db_xref="GeneID:8291585"
                     /db_xref="GOA:C5DEQ1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ1"
                     /translation="MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKFSQQYKATIGAD
                     FLTKEVTMDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNAKSFENIKS
                     WRDEFLVHANVSSPETFPFVILGNKLDVEESKKVVSNRSAQDMAKSLGNIPLFLTSAK
                     GSINVDTAFEEIARNALQQSQADADAFEDDFNDAINIQLDGEPSSCSC"
     gene            <916374..>917291
                     /locus_tag="KLTH0C11154g"
                     /db_xref="GeneID:8291586"
     mRNA            <916374..>917291
                     /locus_tag="KLTH0C11154g"
                     /product="KLTH0C11154p"
                     /transcript_id="XM_002552655.1"
                     /db_xref="GeneID:8291586"
     CDS             916374..917291
                     /locus_tag="KLTH0C11154g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C11154p"
                     /protein_id="XP_002552701.1"
                     /db_xref="GeneID:8291586"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ2"
                     /translation="MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDH
                     FNVSPPAGFPDHPHHGQETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSE
                     IPVELESGAPSVGLQLWVDLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESY
                     GVGSMSELAYTPVHFYHYITRKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSS
                     VFFNTDGSRVEGSGSSEESEFILIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGT
                     NGFERAQGWSSSIARGVVFSDVAKIESCE"
     gene            <917419..>919029
                     /locus_tag="KLTH0C11176g"
                     /db_xref="GeneID:8291587"
     mRNA            <917419..>919029
                     /locus_tag="KLTH0C11176g"
                     /product="KLTH0C11176p"
                     /transcript_id="XM_002552656.1"
                     /db_xref="GeneID:8291587"
     CDS             917419..919029
                     /locus_tag="KLTH0C11176g"
                     /note="similar to uniprot|Q12001 Saccharomyces cerevisiae
                     YOR002W ALG6 Glucosyltransferase involved in transfer of
                     oligosaccharides from dolichyl pyrophosphate to asparagine
                     residues of proteins during N-linked protein glycosylation
                     mutations in human ortholog are associated with disease"
                     /codon_start=1
                     /product="KLTH0C11176p"
                     /protein_id="XP_002552702.1"
                     /db_xref="GeneID:8291587"
                     /db_xref="GOA:C5DEQ3"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ3"
                     /translation="MDARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVI
                     RCAVGLGSFSGEATVPMHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYH
                     SYALGKLGSVLNPEWFALGSSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGI
                     KRRQSPIGQYIAAAAILFQPSLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAIC
                     FMLSLCFKQMALFYSPIFFAYLLSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVF
                     GGMKNVLQSIHRIFPFSRGIFEDKVANFWCVSNVIVKYADNFTQDQLQKLSTFATAAG
                     FLPSFALVVLYPKKHMIPYGLAACSMAFFLFGFQVHEKSILVPLLPISLLFCSTDWNV
                     LAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLSNWLIGNFSFVTPRFLPGFITPGP
                     SMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHILDLFVQPPAKLPDLWVLMNCA
                     LGFTCFSVFWLWNNYKLFTMRNKSILDL"
     gene            920586..920675
                     /locus_tag="KLTH0C11198r"
                     /db_xref="GeneID:8291588"
     tRNA            join(920586..920622,920640..920675)
                     /locus_tag="KLTH0C11198r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove"
                     /db_xref="GeneID:8291588"
     gene            <920972..>921955
                     /locus_tag="KLTH0C11220g"
                     /db_xref="GeneID:8291589"
     mRNA            <920972..>921955
                     /locus_tag="KLTH0C11220g"
                     /product="KLTH0C11220p"
                     /transcript_id="XM_002552657.1"
                     /db_xref="GeneID:8291589"
     CDS             920972..921955
                     /locus_tag="KLTH0C11220g"
                     /note="similar to uniprot|Q12118 Saccharomyces cerevisiae
                     YOR007C SGT2 Glutamine-rich cytoplasmic protein of unknown
                     function contains tetratricopeptide (TPR) repeats which
                     often mediate protein-protein interactions conserved in
                     human and C. elegans"
                     /codon_start=1
                     /product="KLTH0C11220p"
                     /protein_id="XP_002552703.1"
                     /db_xref="GeneID:8291589"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ4"
                     /translation="MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAF
                     EVEKESASSVIEKSFGGQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALK
                     LEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK
                     VNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQS
                     LNVERSAPAASNAESPDAAGGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQN
                     PNAMQEMMSNPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGGPKQ"
     gene            complement(<921970..>925263)
                     /locus_tag="KLTH0C11242g"
                     /db_xref="GeneID:8291590"
     mRNA            complement(<921970..>925263)
                     /locus_tag="KLTH0C11242g"
                     /product="KLTH0C11242p"
                     /transcript_id="XM_002552658.1"
                     /db_xref="GeneID:8291590"
     CDS             complement(921970..925263)
                     /locus_tag="KLTH0C11242g"
                     /note="similar to uniprot|Q04263 Saccharomyces cerevisiae
                     YML002W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C11242p"
                     /protein_id="XP_002552704.1"
                     /db_xref="GeneID:8291590"
                     /db_xref="GOA:C5DEQ5"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ5"
                     /translation="MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTP
                     TPEILLEYEDLESGSSLQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQ
                     QKALFTGEGFDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPG
                     FKAYRFASTDTTSANSSLAASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTY
                     NADNLAAHFMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKD
                     SEIENQSDFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTN
                     SHSSKAKVIVETLQTVSRSLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQ
                     EFAKDSNSITFGILAYGMSTLEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPL
                     GSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVE
                     GSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLI
                     VKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSK
                     HQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDK
                     RLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMT
                     LVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINR
                     LETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAEHVQEQEANSTYGMIEPEEV
                     ASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGR
                     STNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVS
                     LRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLR
                     RSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALYDYKDKFASK
                     PVNTLHIIP"
     gene            <925534..>926574
                     /locus_tag="KLTH0C11264g"
                     /db_xref="GeneID:8291591"
     mRNA            <925534..>926574
                     /locus_tag="KLTH0C11264g"
                     /product="KLTH0C11264p"
                     /transcript_id="XM_002552659.1"
                     /db_xref="GeneID:8291591"
     CDS             925534..926574
                     /locus_tag="KLTH0C11264g"
                     /note="similar to uniprot|Q12094 Saccharomyces cerevisiae
                     YOR006C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C11264p"
                     /protein_id="XP_002552705.1"
                     /db_xref="GeneID:8291591"
                     /db_xref="GOA:C5DEQ6"
                     /db_xref="InterPro:IPR007177"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR022968"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ6"
                     /translation="MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKN
                     FPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNI
                     VEENGAAVVECSWARLDEVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAAC
                     FAIVGRLDLATELLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEA
                     QERKARNPGDDLWLTGNVNHKKGHGVTQNENKDEAEVGSTWEQGENSEYESDESAADG
                     EEAYHGPVKYDSLGNEITLSESSDPEYSDSEELLEEPDFLGDNSFSNDSDIRDVTVGL
                     SKVAIKGDVTEQ"
     gene            <926742..>929597
                     /locus_tag="KLTH0C11286g"
                     /db_xref="GeneID:8291592"
     mRNA            <926742..>929597
                     /locus_tag="KLTH0C11286g"
                     /product="KLTH0C11286p"
                     /transcript_id="XM_002552660.1"
                     /db_xref="GeneID:8291592"
     CDS             926742..929597
                     /locus_tag="KLTH0C11286g"
                     /note="similar to uniprot|Q08387 Saccharomyces cerevisiae
                     YOR005C DNL4 DNA ligase required for nonhomologous
                     end-joining (NHEJ) forms stable heterodimer with required
                     cofactor Lif1p catalyzes DNA ligation as part of a complex
                     with Lif1p and Nej1p involved in meiosis not essential for
                     vegetative growth"
                     /codon_start=1
                     /product="KLTH0C11286p"
                     /protein_id="XP_002552706.1"
                     /db_xref="GeneID:8291592"
                     /db_xref="GOA:C5DEQ7"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="InterPro:IPR029710"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ7"
                     /translation="MDGNGKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAI
                     NEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLI
                     KAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGL
                     NEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEH
                     KFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVS
                     YERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVIS
                     QYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLY
                     MVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAI
                     EMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRDPGKKDSLMCG
                     LLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYK
                     EKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRR
                     IRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKRNVHEIFEYCAGEAKSEL
                     DTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLR
                     IVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRV
                     DQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDEAPLFLLQRFKIYVL
                     AADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAYYVQELRQKIAGN
                     AFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI"
     gene            <929710..>931782
                     /locus_tag="KLTH0C11308g"
                     /db_xref="GeneID:8291593"
     mRNA            <929710..>931782
                     /locus_tag="KLTH0C11308g"
                     /product="KLTH0C11308p"
                     /transcript_id="XM_002552661.1"
                     /db_xref="GeneID:8291593"
     CDS             929710..931782
                     /locus_tag="KLTH0C11308g"
                     /note="similar to uniprot|P39923 Saccharomyces cerevisiae
                     YEL062W NPR2 Regulator of nitrogen permeases transcription
                     is induced in response to proline and urea contains two
                     PEST sequences"
                     /codon_start=1
                     /product="KLTH0C11308p"
                     /protein_id="XP_002552707.1"
                     /db_xref="GeneID:8291593"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ8"
                     /translation="MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFD
                     TIKNYVIPKPQLCNKLLTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATS
                     PYEPAIERLGKMFTVLEEQSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSL
                     DIGEIAQPENQGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSG
                     NAVDIKLFPLLSPPSSCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKV
                     AKFSDSDVNLVVECIKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIY
                     VAYNESAHLPNLPFERGPSRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFL
                     SNKHQHTPQSRSSSIPYHNTSDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTI
                     REWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHS
                     RYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYR
                     KLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRESANSMGSDIKNKVAFDVRKTL
                     ATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDKICTLLGKDRERVESMLSEL
                     GPYNVLHS"
     gene            complement(<931865..>934690)
                     /locus_tag="KLTH0C11330g"
                     /db_xref="GeneID:8291594"
     mRNA            complement(<931865..>934690)
                     /locus_tag="KLTH0C11330g"
                     /product="KLTH0C11330p"
                     /transcript_id="XM_002552662.1"
                     /db_xref="GeneID:8291594"
     CDS             complement(931865..934690)
                     /locus_tag="KLTH0C11330g"
                     /note="similar to uniprot|P27895 Saccharomyces cerevisiae
                     YEL061C CIN8 Kinesin motor protein involved in mitotic
                     spindle assembly and chromosome segregation"
                     /codon_start=1
                     /product="KLTH0C11330p"
                     /protein_id="XP_002552708.1"
                     /db_xref="GeneID:8291594"
                     /db_xref="GOA:C5DEQ9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DEQ9"
                     /translation="MSEEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSI
                     NTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMT
                     STGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEEL
                     KDLLDETPDSSMPRKLRIFDSVTNPNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTMYK
                     PSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSS
                     RSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL
                     GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYA
                     TKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE
                     LENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKID
                     RQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLN
                     EIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQD
                     IRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTY
                     HQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESS
                     LENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALR
                     TDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHS
                     ENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRSYSISPIREIDG
                     NRKASSPFKRKITIDHENVPFSSQKIE"
     gene            complement(<934886..>935692)
                     /locus_tag="KLTH0C11352g"
                     /db_xref="GeneID:8291595"
     mRNA            complement(<934886..>935692)
                     /locus_tag="KLTH0C11352g"
                     /product="KLTH0C11352p"
                     /transcript_id="XM_002552663.1"
                     /db_xref="GeneID:8291595"
     CDS             complement(934886..935692)
                     /locus_tag="KLTH0C11352g"
                     /note="similar to uniprot|Q12339 Saccharomyces cerevisiae
                     YOR004W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0C11352p"
                     /protein_id="XP_002552709.1"
                     /db_xref="GeneID:8291595"
                     /db_xref="GOA:C5DER0"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DER0"
                     /translation="MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFD
                     LVKGLQRTLQAEVKPMITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIEC
                     LQSVVSVNGNNKHRYVVASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSR
                     AQEKEKLFKGLNDPKYAGLPAEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPD
                     SKDESPPSDKISVTDAEPVDRSSSGRRRRRHHKRSSTEAGEEGESGNISS"
     gene            complement(<935901..>936518)
                     /locus_tag="KLTH0C11374g"
                     /db_xref="GeneID:8291596"
     mRNA            complement(<935901..>936518)
                     /locus_tag="KLTH0C11374g"
                     /product="KLTH0C11374p"
                     /transcript_id="XM_002552664.1"
                     /db_xref="GeneID:8291596"
     CDS             complement(935901..936518)
                     /locus_tag="KLTH0C11374g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C11374p"
                     /protein_id="XP_002552710.1"
                     /db_xref="GeneID:8291596"
                     /db_xref="UniProtKB/TrEMBL:C5DER1"
                     /translation="MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRE
                     LKPKAIAHARREPSWGTLEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAIN
                     DDSTLLDTGDKIVARQKADVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPLTL
                     KAPMIHQGDTLKKILLTFALLITVLTFESMSSKLINIIKASTGLS"
     gene            complement(<936878..>938530)
                     /locus_tag="KLTH0C11396g"
                     /db_xref="GeneID:8291597"
     mRNA            complement(<936878..>938530)
                     /locus_tag="KLTH0C11396g"
                     /product="KLTH0C11396p"
                     /transcript_id="XM_002552665.1"
                     /db_xref="GeneID:8291597"
     CDS             complement(936878..938530)
                     /locus_tag="KLTH0C11396g"
                     /note="similar to uniprot|P09232 Saccharomyces cerevisiae
                     YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
                     protease of the subtilisin family involved in protein
                     degradation in the vacuole and required for full protein
                     degradation during sporulation"
                     /codon_start=1
                     /product="KLTH0C11396p"
                     /protein_id="XP_002552711.1"
                     /db_xref="GeneID:8291597"
                     /db_xref="GOA:C5DER2"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:C5DER2"
                     /translation="MKLQTALPVAVVASVGAALVLPDLEEASNTVALKVKDVITAGES
                     IVSSFSKQMTKDAASKGESVELSPLVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQI
                     VSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLL
                     TGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGS
                     FNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAG
                     TIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGST
                     ANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLA
                     DDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQP
                     DSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGKE
                     SVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII"
     gene            940021..940135
                     /locus_tag="KLTH0C11418r"
                     /db_xref="GeneID:8291598"
     tRNA            join(940021..940058,940092..940135)
                     /locus_tag="KLTH0C11418r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8291598"
     gene            complement(<940466..>941992)
                     /locus_tag="KLTH0C11440g"
                     /db_xref="GeneID:8291599"
     mRNA            complement(<940466..>941992)
                     /locus_tag="KLTH0C11440g"
                     /product="KLTH0C11440p"
                     /transcript_id="XM_002552666.1"
                     /db_xref="GeneID:8291599"
     CDS             complement(940466..941992)
                     /locus_tag="KLTH0C11440g"
                     /note="similar to uniprot|P53296 Saccharomyces cerevisiae
                     YGR177C ATF2 Alcohol acetyltransferase may play a role in
                     steroid detoxification forms volatile esters during
                     fermentation which is important in brewing"
                     /codon_start=1
                     /product="KLTH0C11440p"
                     /protein_id="XP_002552712.1"
                     /db_xref="GeneID:8291599"
                     /db_xref="GOA:C5DER3"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:C5DER3"
                     /translation="MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSP
                     KQLAYALRSICLQNPILVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLS
                     DIVMNEQEEYGTVVSEAIEEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPE
                     GESNLWRKFIYITNHCSSDGRSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLR
                     KLPDPIENRIDYKPPISYLLQLLSSSYVRDYLGYYSKGPLVTRIDEVGENKTYYSYFL
                     NFSAEQMKTIKQKLKSRLPGCTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMN
                     TAQMLPDDPELRSMYKYGSNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAME
                     KKHYLFPLGALMLDSLREKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVR
                     DLVFAQSLGSLRHTFVCNSCTTDVGGMNIVACAAQGSVASEHDWADVCELFKEQTLAL
                     "
     gene            complement(<942263..>943741)
                     /locus_tag="KLTH0C11462g"
                     /db_xref="GeneID:8291600"
     mRNA            complement(<942263..>943741)
                     /locus_tag="KLTH0C11462g"
                     /product="KLTH0C11462p"
                     /transcript_id="XM_002552667.1"
                     /db_xref="GeneID:8291600"
     CDS             complement(942263..943741)
                     /locus_tag="KLTH0C11462g"
                     /note="highly similar to uniprot|P08417 Saccharomyces
                     cerevisiae YPL262W FUM1 Fumarase converts fumaric acid to
                     L-malic acid in the TCA cycle cytosolic and mitochondrial
                     localization determined by the N-terminal mitochondrial
                     targeting sequence and protein conformation"
                     /codon_start=1
                     /product="KLTH0C11462p"
                     /protein_id="XP_002552713.1"
                     /db_xref="GeneID:8291600"
                     /db_xref="GOA:C5DER4"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:C5DER4"
                     /translation="MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINV
                     PADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKP
                     IQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPN
                     NHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHL
                     QDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIA
                     EQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCG
                     YGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP
                     VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAA
                     SKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK"
     gene            complement(<944502..>944771)
                     /locus_tag="KLTH0C11484g"
                     /db_xref="GeneID:8291601"
     mRNA            complement(<944502..>944771)
                     /locus_tag="KLTH0C11484g"
                     /product="KLTH0C11484p"
                     /transcript_id="XM_002552668.1"
                     /db_xref="GeneID:8291601"
     CDS             complement(944502..944771)
                     /locus_tag="KLTH0C11484g"
                     /note="similar to uniprot|Q05676 Saccharomyces cerevisiae
                     YEL059C-A SOM1 Protein whose overexpression suppresses the
                     imp1 mutation may be required for the function of the
                     Imp1p mitochondrial inner membrane peptidase and/or the
                     protein sorting machinery"
                     /codon_start=1
                     /product="KLTH0C11484p"
                     /protein_id="XP_002552714.1"
                     /db_xref="GeneID:8291601"
                     /db_xref="GOA:C5DER5"
                     /db_xref="InterPro:IPR024645"
                     /db_xref="UniProtKB/TrEMBL:C5DER5"
                     /translation="MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCT
                     PFKRLFKECGAGKRIVRIEVTDQDTNHLAFDATVTRFWESSRRCT"
     gene            <944869..>946503
                     /locus_tag="KLTH0C11506g"
                     /db_xref="GeneID:8291602"
     mRNA            <944869..>946503
                     /locus_tag="KLTH0C11506g"
                     /product="KLTH0C11506p"
                     /transcript_id="XM_002552669.1"
                     /db_xref="GeneID:8291602"
     CDS             944869..946503
                     /locus_tag="KLTH0C11506g"
                     /note="similar to uniprot|P38628 Saccharomyces cerevisiae
                     YEL058W PCM1 Essential N-acetylglucosamine- phosphate
                     mutase a hexosephosphate mutase involved in the
                     biosynthesis of chitin"
                     /codon_start=1
                     /product="KLTH0C11506p"
                     /protein_id="XP_002552715.1"
                     /db_xref="GeneID:8291602"
                     /db_xref="GOA:C5DER6"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:C5DER6"
                     /translation="MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGV
                     LAGLRSIYLEGRTVGVMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQS
                     FTAFLAYLQNLVSELGLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYG
                     LLTTPQLHFLTSKRNELPNDTAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAAN
                     GIGAPRVKEMLSTHKFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANND
                     CQRICCSFDGDADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLG
                     VVQTAYANGSSTHYIERVLGIPVTCTPTGVKHLHHEAINYDIGVYFEANGHGTVVFSK
                     KFDEVVNSGLSNKHQSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTP
                     QKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFV
                     RASGTEDAVRVYAEASTREEADSLASRVSQVVEHNG"
     gene            <946632..>948560
                     /locus_tag="KLTH0C11528g"
                     /db_xref="GeneID:8291603"
     mRNA            <946632..>948560
                     /locus_tag="KLTH0C11528g"
                     /product="KLTH0C11528p"
                     /transcript_id="XM_002552670.1"
                     /db_xref="GeneID:8291603"
     CDS             946632..948560
                     /locus_tag="KLTH0C11528g"
                     /note="similar to uniprot|Q08979 Saccharomyces cerevisiae
                     YPL263C KEL3 Cytoplasmic protein of unknown function"
                     /codon_start=1
                     /product="KLTH0C11528p"
                     /protein_id="XP_002552716.1"
                     /db_xref="GeneID:8291603"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:C5DER7"
                     /translation="MAKKNKKDKEAKKARAELKNKKNLEKAEVKDKKRSKKLNSEDDD
                     DLDIDEILENFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQ
                     TSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQ
                     NTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTY
                     LNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQK
                     GKILTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEET
                     EEGLSSEFFNDLLSYQVEANRWYSIKMRPQKKKIVAASKSAKSKDDELVGILNDILQK
                     ANLADEENEENESDSEIEKELHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDT
                     LFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEE
                     EDDDDEDDEEETLDEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFE
                     TLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEM
                     GGVENIIERDSSHSTKRR"
     gene            <949063..>950259
                     /locus_tag="KLTH0C11550g"
                     /db_xref="GeneID:8291604"
     mRNA            <949063..>950259
                     /locus_tag="KLTH0C11550g"
                     /product="KLTH0C11550p"
                     /transcript_id="XM_002552671.1"
                     /db_xref="GeneID:8291604"
     CDS             949063..950259
                     /locus_tag="KLTH0C11550g"
                     /note="similar to uniprot|P39984 Saccharomyces cerevisiae
                     YEL056W"
                     /codon_start=1
                     /product="KLTH0C11550p"
                     /protein_id="XP_002552717.1"
                     /db_xref="GeneID:8291604"
                     /db_xref="GOA:C5DER8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:C5DER8"
                     /translation="MQATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQW
                     LPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQP
                     QSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFH
                     KENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKS
                     PFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLY
                     DLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDA
                     DDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDY
                     NIRSLE"
     gene            complement(<950297..>951853)
                     /locus_tag="KLTH0C11572g"
                     /db_xref="GeneID:8291605"
     mRNA            complement(<950297..>951853)
                     /locus_tag="KLTH0C11572g"
                     /product="KLTH0C11572p"
                     /transcript_id="XM_002552672.1"
                     /db_xref="GeneID:8291605"
     CDS             complement(950297..951853)
                     /locus_tag="KLTH0C11572g"
                     /note="similar to uniprot|Q08984 Saccharomyces cerevisiae
                     YPL272C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C11572p"
                     /protein_id="XP_002552718.1"
                     /db_xref="GeneID:8291605"
                     /db_xref="GOA:C5DER9"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:C5DER9"
                     /translation="MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD
                     LSDNETLRSDMNQRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRK
                     IEFDCYADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVL
                     FDTFAAANFHKLFLQALNSLSESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITD
                     AFYSQSQAILRSLYNLAIKKPLRFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGT
                     ISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWS
                     SPLGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESL
                     FERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDL
                     SNVNPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEA
                     FLENYPKFVC"
     gene            complement(<952163..>955183)
                     /locus_tag="KLTH0C11594g"
                     /db_xref="GeneID:8291606"
     mRNA            complement(<952163..>955183)
                     /locus_tag="KLTH0C11594g"
                     /product="KLTH0C11594p"
                     /transcript_id="XM_002552673.1"
                     /db_xref="GeneID:8291606"
     CDS             complement(952163..955183)
                     /locus_tag="KLTH0C11594g"
                     /note="similar to uniprot|P39985 Saccharomyces cerevisiae
                     YEL055C"
                     /codon_start=1
                     /product="KLTH0C11594p"
                     /protein_id="XP_002552719.1"
                     /db_xref="GeneID:8291606"
                     /db_xref="GOA:C5DES0"
                     /db_xref="InterPro:IPR007015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DES0"
                     /translation="MVAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWE
                     YVLNRLIKGLSSSRNGARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIK
                     NGKEERGILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIR
                     ESSMFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTG
                     ALRKKGLLEDLKLNSPWKNNDPLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHF
                     VWDIILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSS
                     SERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIV
                     DVCKNQPEKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLT
                     NHLFTSLRDHSRVRFLLDAMLHLVRAHKSAADKVWLAPLLDSLVQQGFFELDENDRQP
                     EVGDETFTVSKLAVERLYSILADLISADYKSEKVCWPRFTVEILMSKLKKNKLLNPMD
                     EELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDL
                     NSFHQTLEENKSGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLE
                     ILPARENKEGFSKLFEGDDEGGSDEEEISDELFAEEGASGDNTEEEESGPDSDDQDGE
                     DTEQIDKEATSALVKALNLPESIVNDNGEVHFEDLEDTEDEEISDEDLDDEKMMELDG
                     QLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQG
                     GRPEKSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTSLDGLEE
                     NLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVY
                     HKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNSD"
     gene            <956011..>958233
                     /locus_tag="KLTH0C11616g"
                     /db_xref="GeneID:8291607"
     mRNA            <956011..>958233
                     /locus_tag="KLTH0C11616g"
                     /product="KLTH0C11616p"
                     /transcript_id="XM_002552674.1"
                     /db_xref="GeneID:8291607"
     CDS             956011..958233
                     /locus_tag="KLTH0C11616g"
                     /note="similar to uniprot|P33311 Saccharomyces cerevisiae
                     YPL270W MDL2 Half-type ATP-binding cassette (ABC)
                     transporter of the inner mitochondrial membrane"
                     /codon_start=1
                     /product="KLTH0C11616p"
                     /protein_id="XP_002552720.1"
                     /db_xref="GeneID:8291607"
                     /db_xref="GOA:C5DES1"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DES1"
                     /translation="MLLARFSRQQGGARLPLGVQLLSWRRGLSGVQAFIHLSPARYHG
                     ATHRPLGLLQRPTQLDLRNPVSSSFIRYHSQNSPNSSTPSSSNDSGGKANNESTEEKS
                     KTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSG
                     PMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK
                     KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINIS
                     ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVA
                     EGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLS
                     VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP
                     SWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYD
                     PNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS
                     VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSA
                     LDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL
                     YANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQKSSKLTP
                     "
     gene            <958488..>960137
                     /locus_tag="KLTH0C11638g"
                     /db_xref="GeneID:8291608"
     mRNA            <958488..>960137
                     /locus_tag="KLTH0C11638g"
                     /product="KLTH0C11638p"
                     /transcript_id="XM_002552675.1"
                     /db_xref="GeneID:8291608"
     CDS             958488..960137
                     /locus_tag="KLTH0C11638g"
                     /note="weakly similar to uniprot|P32526 Saccharomyces
                     cerevisiae YPL269W KAR9 Karyogamy protein required for
                     correct positioning of the mitotic spindle and for
                     orienting cytoplasmic microtubules localizes at the shmoo
                     tip in mating cells and at the tip of the growing bud in
                     small-budded cells through anaphase"
                     /codon_start=1
                     /product="KLTH0C11638p"
                     /protein_id="XP_002552721.1"
                     /db_xref="GeneID:8291608"
                     /db_xref="InterPro:IPR013889"
                     /db_xref="UniProtKB/TrEMBL:C5DES2"
                     /translation="MELASPSKKLSELLSESVDVLSSTARSLDNPKLDGDVEKNLAKL
                     QALWQFLKDVLSSNFDDKCSPAELLDRFEWMQKSKKQFYMLCQEVADFDSKLEELLKI
                     IEHNLAKGSVGENPELLFESFEGCWSSLESFKPVLISSKAIFEAGLEFNEILNDHLGS
                     LDMLVDENIEKCSEIRRHTPSTEFNSGEFDKPKRVSTILLASADTGFSTLPRFPNDNE
                     AIDSFIAVGESMNLLEGNLRLVPSTKIETFTGRKIHNKEFLSKILHQKHHTISLKYET
                     LVAAYVSLKSDLVDTRWQFMFQVLNDSIAGDIDQVRDILLDSSRTATHIHNANRLLAL
                     SSTIEKNFNIIYQALSYSVLTIEVTEKANELASQWLALQSEIDLLDLKENYDQDIAVG
                     LRRLSLKSTGSEDSRRSEPQSKGVGALLLQRMNIKPVIIQNTPTSVEKRNTNYANKMA
                     PQSAAINLYEVPVLKLPEASTGSGEENKEISAELSFRKLLSKICVFSGRRSGLPIYLD
                     RNSGYMSSLRTKLSSPMRIRLKASSQPSIRRGRIAHCVKVT"
     gene            <960335..>962890
                     /locus_tag="KLTH0C11660g"
                     /db_xref="GeneID:8291609"
     mRNA            <960335..>962890
                     /locus_tag="KLTH0C11660g"
                     /product="KLTH0C11660p"
                     /transcript_id="XM_002552676.1"
                     /db_xref="GeneID:8291609"
     CDS             960335..962890
                     /locus_tag="KLTH0C11660g"
                     /note="some similarities with uniprot|P32383 Saccharomyces
                     cerevisiae YPL268W PLC1 Phosphoinositide- specific
                     phospholipase C hydrolyzes phosphatidylinositol 4
                     5-biphosphate (PIP2) to generate inositol 1 4 5-
                     triphosphate (IP3) and 1 2-diacylglycerol (DAG) involved
                     in kinetochore function and pseudohyphal differentiation"
                     /codon_start=1
                     /product="KLTH0C11660p"
                     /protein_id="XP_002552722.1"
                     /db_xref="GeneID:8291609"
                     /db_xref="GOA:C5DES3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015359"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:C5DES3"
                     /translation="MSNDAFATSLHGDEIITGQHVRQQPWIKSTDESKLVLLNENCAR
                     YTSNSVKGSPPQRSVKSSFRRILRRTTNYIPRSKAQKNPAFLGPMTYNQAYLSRNVEK
                     ANQFARDEGLLRDMYHRLQVGIYMTKITRKKQVDHVFTINDGMLSWRESKSIDLDTIK
                     DVRCGEMAKNYIEDYKASPSTARLWITIIYQVSSKFRALHVVARNLDDLECFYLGIVN
                     LVDSRRNLMKSIKNPEDDMFANIHWHASVSSEKCAESVEVLSFNDVKTLCSKFSIFCS
                     DVYLREVFNTADANSNGLLNFTEFQKFVKLLKERKELSRIWLNITNGEAMLTLEGFGR
                     FVRQAQHEEINSETVFKEFNKFKQDNCLMSLDGFQKYLSSQPYLRDVDMDYSMPINKY
                     FISSSHNTYLQGKQLGESPTVETYIHALQQGCRCIEIDIWDGEDGPVVCHGKLTGSLP
                     LQNVIRVVRKYAFMTSPYPLILSLEIHCKPVNQLVTERILRDLLGDQIYHGSENGRLV
                     SPSKLKHKFLIKVKKSSTVRATPDDEPTSSTSASSSYDSEIDSQKTTGRRLSISKKIH
                     VIESLVAASAIHGVKFRNFSLPESKVPNHCFSLSEKKLDNLGKDEAQRLAIDKHNRRF
                     LMRVYPHALRYRSSNFNPIRFWEAGVQMVATNWQTYDLGQQLNKAMFQLPLEESSLWH
                     SGYVLKPSYLARDVNKTNEIEDLYASLKSKTMILSIEVLSAQLLPKPKTLKQKQSSYN
                     FSVKLEVHSNMPVETFEVFNGVTTSESSGSTQCCKENGFTPTWEALFKVTLADTFFNF
                     LLFTVKAGDTDLASCCLKVDYLRKGYRHVPLYSGSGERFIFSTLFLGVNYYYV"
     gene            <965848..>966465
                     /locus_tag="KLTH0C11682g"
                     /db_xref="GeneID:8291610"
     mRNA            <965848..>966465
                     /locus_tag="KLTH0C11682g"
                     /product="KLTH0C11682p"
                     /transcript_id="XM_002552677.1"
                     /db_xref="GeneID:8291610"
     CDS             965848..966465
                     /locus_tag="KLTH0C11682g"
                     /note="weakly similar to uniprot|Q08981 Saccharomyces
                     cerevisiae YPL267W ACM1"
                     /codon_start=1
                     /product="KLTH0C11682p"
                     /protein_id="XP_002552723.1"
                     /db_xref="GeneID:8291610"
                     /db_xref="UniProtKB/TrEMBL:C5DES4"
                     /translation="MNVRSPGKLRRALSGKNINSKSGLRKRSASLSPKKLGTARRSAE
                     HSVLQVKSIEKVQPFQFFEQSVEDQQAVSSAQNKLCHAGDDKVCTTKEKENIPLDNPN
                     CRFGSKPTQVSNERAPLSRLNADDYGGVLQIHDLPTYADSEHQSENLIEVSGFTTPPR
                     GGKTGTDTAFHSFNTSPRKIETQQGREERTSFSALKVARKLKFED"
     gene            <966706..>967674
                     /locus_tag="KLTH0C11704g"
                     /db_xref="GeneID:8291611"
     mRNA            <966706..>967674
                     /locus_tag="KLTH0C11704g"
                     /product="KLTH0C11704p"
                     /transcript_id="XM_002552678.1"
                     /db_xref="GeneID:8291611"
     CDS             966706..967674
                     /locus_tag="KLTH0C11704g"
                     /note="highly similar to uniprot|P41819 Saccharomyces
                     cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
                     responsible for conserved m6(2)Am6(2)A dimethylation in
                     3'-terminal loop of 18 S rRNA part of 90S and 40S
                     pre-particles in nucleolus involved in pre-ribosomal RNA
                     processing"
                     /codon_start=1
                     /product="KLTH0C11704p"
                     /protein_id="XP_002552724.1"
                     /db_xref="GeneID:8291611"
                     /db_xref="GOA:C5DES5"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DES5"
                     /translation="MGKAPKKSFSGSGSKGNQVSAEKHLNSVFKFNTDLGQHILKNPL
                     VAQGIVDKAQIKPSDVVLEVGPGTGNLTVRILEQARKVIAVEMDPRMGAELTKRVHGT
                     AGEKKLDILLGDFMKTDLPYFDICISNTPYQISSPLVFKLINQPKPPRVSILMFQREF
                     AMRLLARPGDSLYCRLSANVQMWANVTHIMKVGKNNFRPPPQVESSVVRLEIKNPRPK
                     VEFNEWDGLLRIVFVRKNRTIAAGFKSTTVLEILEKNYKAFLATTGNGSDMVDDTEKS
                     MIDVVKAKIETVLKETGLSDKRAGKCDQTDFLKLLYAFHQVGIHFA"
     repeat_region   969403..969665
                     /rpt_type=long_terminal_repeat
     gene            969738..969809
                     /locus_tag="KLTH0C11748r"
                     /db_xref="GeneID:8291613"
     tRNA            969738..969809
                     /locus_tag="KLTH0C11748r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=66.72"
                     /db_xref="GeneID:8291613"
     gene            <970979..>972835
                     /locus_tag="KLTH0C11770g"
                     /db_xref="GeneID:8291614"
     mRNA            <970979..>972835
                     /locus_tag="KLTH0C11770g"
                     /product="KLTH0C11770p"
                     /transcript_id="XM_002552679.1"
                     /db_xref="GeneID:8291614"
     CDS             970979..972835
                     /locus_tag="KLTH0C11770g"
                     /note="similar to uniprot|P00175 Saccharomyces cerevisiae
                     YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
                     oxidoreductase) component of the mitochondrial
                     intermembrane space required for lactate utilization
                     expression is repressed by glucose and anaerobic
                     conditions"
                     /codon_start=1
                     /product="KLTH0C11770p"
                     /protein_id="XP_002552725.1"
                     /db_xref="GeneID:8291614"
                     /db_xref="GOA:C5DES6"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DES6"
                     /translation="MMRLQELRNQRYRDLNLRIRITQSEISTSRTVVTTALPVLMFRL
                     ISQKTHVSLSRLFLRGQWRAFSKGAGFRGTQRVKRLSSHVALFTALAGLTYILGPGRE
                     ISLIKNDAAKHSKRRHVSATEVIRHNKEDDCWVVIDGYVYDVTAFIDQHPGGSAVIRG
                     NAGKDVSALFSALHPPDVIQKYIPETQRLGPLEDQMPSDRICSPPAIGETVEDIQRKE
                     ELRQKLLDLNSLLNLYDFEYLASQILANQAWAYYSSASDDEFTYRENHAAYHRIFFKP
                     RVLVNVKNVDISTEMLGFKVSVPFYVSATALVKLGNPEEGEKDIARGCGQGEHKCPQM
                     ISTFASCSLQEIVEAAPSKEQIQWLQLYVNTNRSATESLLREAETLGLRAIFLTVDTP
                     ASGRREKDMKLKFISSNAPQNARAAKNKSSRGASQALASFIDPTLTWEDVAELKTKTN
                     LPVVIKGVQCVEDVLKAAEIGVDGVVISNHGGRQLDFSRAPLEVLADTMPILKEKHLD
                     DKLEVFIDGGVRRGTDILKALCLGAKGVGLGRPFLYANSCYGKDGVEKAISMLAEELQ
                     CSMRLLGAKSIKELGPELLDVTGLKNRSIEIPGDSLCNTVYQKPDFARFVEK"
     repeat_region   973295..973556
                     /rpt_type=long_terminal_repeat
     gene            973616..973687
                     /locus_tag="KLTH0C11814r"
                     /db_xref="GeneID:8291616"
     tRNA            973616..973687
                     /locus_tag="KLTH0C11814r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=64.56"
                     /db_xref="GeneID:8291616"
     gene            <976791..>978212
                     /locus_tag="KLTH0C11836g"
                     /db_xref="GeneID:8291617"
     mRNA            <976791..>978212
                     /locus_tag="KLTH0C11836g"
                     /product="KLTH0C11836p"
                     /transcript_id="XM_002552680.1"
                     /db_xref="GeneID:8291617"
     CDS             976791..978212
                     /locus_tag="KLTH0C11836g"
                     /note="weakly similar to uniprot|P18544 Saccharomyces
                     cerevisiae YOL140W ARG8 Acetylornithine aminotransferase
                     catalyzes the fourth step in the biosynthesis of the
                     arginine precursor ornithine"
                     /codon_start=1
                     /product="KLTH0C11836p"
                     /protein_id="XP_002552726.1"
                     /db_xref="GeneID:8291617"
                     /db_xref="GOA:C5DES7"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DES7"
                     /translation="MTIANDIQTEQSYVFQASVDKLGPQVTEGKGIYITIEKDGKIHK
                     NVLDAITGAAVGALGWGDEEALEIMDKSARASTYSYPCLISNKSSEALAKFYIENSPE
                     GAFSAALWCSSGSESNENALRIMRQYYLERGLPNKVKLMSRESSYHGFTLGAQSMSWN
                     PRVEPFEPYLMDRKKINIKIPCAYTYRYKKEEETEEDYARRLIDDLENKIVSNDPDTI
                     AAVVVETLPGSSLGTTPPPKGYLKGIRELCNKYDIIFYLDEVMCGTGRCNPNGRLNCW
                     ENYLDPCDAPDIQTVGKTLGSGYVPIAGVLIGPKIKNAFLNGSKAVVGGHTYSCHAFC
                     CGVALGVQQKIKRENLTSNVFKMGNLMGEKLKNTLLAKSNIVGDVRGVGGFWSVEFVK
                     NRETKEPFDISLGVGPRFKAVCFDNGLSVMGMPGNPDGSCGDRALLAPSFIITEEVVD
                     DIVGKMVKSVAELTDELKSEGIF"
     gene            <979073..>980740
                     /locus_tag="KLTH0C11858g"
                     /db_xref="GeneID:8291618"
     mRNA            <979073..>980740
                     /locus_tag="KLTH0C11858g"
                     /product="KLTH0C11858p"
                     /transcript_id="XM_002552681.1"
                     /db_xref="GeneID:8291618"
     CDS             979073..980740
                     /locus_tag="KLTH0C11858g"
                     /note="similar to uniprot|P00175 Saccharomyces cerevisiae
                     YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
                     oxidoreductase) component of the mitochondrial
                     intermembrane space required for lactate utilization
                     expression is repressed by glucose and anaerobic
                     conditions"
                     /codon_start=1
                     /product="KLTH0C11858p"
                     /protein_id="XP_002552727.1"
                     /db_xref="GeneID:8291618"
                     /db_xref="GOA:C5DES8"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5DES8"
                     /translation="MLITKLARCKSLKQLRLCSFKDAKWPSTRKMSNLNPPIKATHPR
                     RKEFRKASVLTGASASAALLAYSLLDFSSDGIEVSEVMQHNKPDDCWIVLNGEVYDVT
                     SFLQMHPGGAARIMEVAGNDATRKFYSIHSDSTLEKMKEQLVYIGKLKGKFAETISEE
                     DLRIRESRKNIPSLGLIFNLSDFEAVAKEVLPKSTYAYFATGSSDEFSIRENHYAYSR
                     VFFKPMILQENEYDVDTSTEFLGSKVSLPVYISAFAGSKWAHPLAELNLQSAAYEADI
                     MQMVPKQNSYSIEEFYENVPEDQKHWSQYHFDSREEFNEAGTLIKKLEAQPSVKALFL
                     NVDLRDIGNREKDSRQRALDVESSKSLSAIVTSDKSYAKFTWKDIDQIMSSTKLPIGL
                     KGVQRGEDVVLAAEKGVKAVVLSNHGGRQLDFSRPPLEVLAEAKQMLKERGLEDKIEI
                     YLDGGIRRGSDVIKALCLGAKGVGLGRPFLYAMAGYGEEGVSHLLDILRNEMKNNMRL
                     LGVDKVEDLNENLVDIGSLKFRNPRANDVLYDEAYQPLRFPPVRSAI"
     gene            complement(<982966..>983361)
                     /locus_tag="KLTH0C11880g"
                     /db_xref="GeneID:8291619"
     mRNA            complement(<982966..>983361)
                     /locus_tag="KLTH0C11880g"
                     /product="KLTH0C11880p"
                     /transcript_id="XM_002552682.1"
                     /db_xref="GeneID:8291619"
     CDS             complement(982966..983361)
                     /locus_tag="KLTH0C11880g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C11880p"
                     /protein_id="XP_002552728.1"
                     /db_xref="GeneID:8291619"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="UniProtKB/TrEMBL:C5DES9"
                     /translation="MVRKLKWEEVGVSNGPSFLSPGCVSSKNCDLLFTSGCVGNDPIT
                     GEYPEDVESQARNAMENMKRVLESASSNFDYVLKALLFISDPSYASAVNKVYQEFFPG
                     RPSRSCIVVSFPDPKLKFEMECVAEVPAN"
     gene            <983840..>984871
                     /locus_tag="KLTH0C11902g"
                     /db_xref="GeneID:8291620"
     mRNA            <983840..>984871
                     /locus_tag="KLTH0C11902g"
                     /product="KLTH0C11902p"
                     /transcript_id="XM_002552683.1"
                     /db_xref="GeneID:8291620"
     CDS             983840..984871
                     /locus_tag="KLTH0C11902g"
                     /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
                     YDL144C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C11902p"
                     /protein_id="XP_002552729.1"
                     /db_xref="GeneID:8291620"
                     /db_xref="GOA:C5DET0"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DET0"
                     /translation="MNNCLCDNDMDSKCKVLLVGSGGVGTIASYALEYAGKTKVTSVL
                     RSDYDRVLEKGFSINSCDYGNGLIFKPSNIVNSVEASKKHGPFEYVVIATKCLPEVTS
                     MIDVIAPAITKDTAIVLVQNGIGIEMEALTKFPENVVLSGVSMIGSANMGGHIEHESP
                     DMLRIGYFENNNISQSHQEAVCKRFVDLYQNDKNQCVYDEDVKFSRWRKLVYNACLNP
                     VCALTGVDIGRLEIWGGVDSIIRKAMREVLAIAKSDGVVLPEDVIEFMIRSDDPVYYR
                     PSMLVDADKRNLLEIEVILGNPVRIARKNKVDVPFLTIIYELLKIVQSRTMEEKGMIT
                     IPKERPVPK"
     gene            <987757..>989166
                     /locus_tag="KLTH0C11924g"
                     /db_xref="GeneID:8291621"
     mRNA            <987757..>989166
                     /locus_tag="KLTH0C11924g"
                     /product="KLTH0C11924p"
                     /transcript_id="XM_002552684.1"
                     /db_xref="GeneID:8291621"
     CDS             987757..989166
                     /locus_tag="KLTH0C11924g"
                     /note="some similarities with uniprot|P38894 Saccharomyces
                     cerevisiae YHR211W"
                     /codon_start=1
                     /product="KLTH0C11924p"
                     /protein_id="XP_002552730.1"
                     /db_xref="GeneID:8291621"
                     /db_xref="GOA:C5DET1"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="UniProtKB/TrEMBL:C5DET1"
                     /translation="MASEPQVLCITMHTPTSTYSTASTAFSIWTGSETSTYSTAVSTF
                     TGSDGSTTTETVYYVEAPTVATTVFTPGTCSETSTYSVGRTAVTGSDGQPTTETMHYI
                     ETPAAVTTAYTAGYVTAATMYSTGATTFPGSDVKPTIQTAYYVETPSSGSQVYTQWTS
                     SFASTYSTEFAAVVVDSVATTKTICHVETPSSGSDVYTPWTGSFSSTYSTDLSTFTGS
                     GGQPTTNTIYYVEAPSSGSDVYTPWSGSFTSTFSTEFSTHTSSDGRPIIDTIYRVETL
                     ILASSVLARWTDKFTSSYSTKYATFTGSDGLASTQTAYYIETPVSAYNGNSTSYTNSP
                     ESTSTSMTSSGPPATTTSNAATTHDLPTSSQLSPGSISISSTATGAGFGSSSVSNAGF
                     GSSCNSGSGSNSGSGSGSSSRLSQTTTITPKTQSSSSVYSTSSSETGSTASPYVSTYE
                     GAASRIGFSLLFVLPLAFV"
     gene            <991279..>992616
                     /locus_tag="KLTH0C11946g"
                     /db_xref="GeneID:8291622"
     mRNA            <991279..>992616
                     /locus_tag="KLTH0C11946g"
                     /product="KLTH0C11946p"
                     /transcript_id="XM_002552685.1"
                     /db_xref="GeneID:8291622"
     CDS             991279..992616
                     /locus_tag="KLTH0C11946g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0C11946p"
                     /protein_id="XP_002552731.1"
                     /db_xref="GeneID:8291622"
                     /db_xref="UniProtKB/TrEMBL:C5DET2"
                     /translation="MVRKAHLPLLASIASACATCPSISDVNVLSADDGSSSFWGTGLG
                     AYIELTLSATEKGECWFSAPSNVFGNFPACPFSWDYGTVNSAGGNNYSIQFNQIPHGG
                     VAKLGFLTSLAEGYKSSITSGKTDTYSFVTSSGEHKSSVSFNDFPSDQVYCGSCGTQQ
                     EGNSLSFDVSVPAAIIESAFTINIEKQQGYKFQTGGIKLYYTQSSNSFDEASNEQLVP
                     SSSITDSSTEDKISIAFNGNLPSGCSGLRLSYDVAVLEEMTYYSSVCNVEFSSFSQQL
                     TAYVYTKNHMGSIETPAVSKGPGCGSQTSSSSGYSSSTVTTLSPSTGFTSSSTSAAVT
                     SATSSSGCDDGCDDGSGSSSSSSSPAAPTSSSGCDSGCDDNTATSSATPSTSTSSSSS
                     SGTSCDSGCDENSGSGSGSGSGHGSGHYAGHVGRHNWGHNSGHKGGQGSGCKS"
     gene            <993683..>995005
                     /locus_tag="KLTH0C11968g"
                     /db_xref="GeneID:8291623"
     mRNA            <993683..>995005
                     /locus_tag="KLTH0C11968g"
                     /product="KLTH0C11968p"
                     /transcript_id="XM_002552686.1"
                     /db_xref="GeneID:8291623"
     CDS             993683..995005
                     /locus_tag="KLTH0C11968g"
                     /note="highly similar to uniprot|P40896 Saccharomyces
                     cerevisiae YJL213W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0C11968p"
                     /protein_id="XP_002552732.1"
                     /db_xref="GeneID:8291623"
                     /db_xref="GOA:C5DET3"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:C5DET3"
                     /translation="MKTCTIDVNERNNKKLEDLVAPWRLKPPQNYCITNTNLIDVVEG
                     KTHPEAYIFINEGRISKVNFGREPKSEISKYYEIIDGTGKYVMPGLFDNHVHMGAVPG
                     EMGLAQLAMMPESVAVLRLRFTMEASLARGFTTVRDCGGIEGFVKAAVANGSLIGPRL
                     ITCGHAISQTGGHGDLRPGSLPASAFDSCSCHTGTVGVVADGVDGCYTAAREEFRRGA
                     DFIKMMGSGGVASPTDKITNLQFCHDEIKALVDVAKTYHTYVTAHVYTPETIQNCIKL
                     GVKGVEHGNLLDEETAELMAELGCCLTPTLVTCKIMASDQFGTFLGPVNRKKNAEVLG
                     QGIDAIKIAQEKGVKICFGSDLLGPLGGYQTQEFFIRGKVQSARDVLLSATVTPAEMN
                     GLGNKLGQVKPGFIANLLMMKSNPLEDVSIMDEPETNLVFVMKEGRIY"
CONTIG      join(CU928167.1:1..999246)
//
DBGET integrated database retrieval system