GenomeNet

Database: RefSeq
Entry: NC_013080
LinkDB: NC_013080
Original site: NC_013080 
LOCUS       NC_013080            1513537 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome D complete sequence.
ACCESSION   NC_013080
VERSION     NC_013080.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 1513537)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1513537)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1513537)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928168.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1513537
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="D"
     gene            <796..>2658
                     /locus_tag="KLTH0D00110g"
                     /db_xref="GeneID:8294947"
     mRNA            <796..>2658
                     /locus_tag="KLTH0D00110g"
                     /product="KLTH0D00110p"
                     /transcript_id="XM_002552687.1"
                     /db_xref="GeneID:8294947"
     CDS             796..2658
                     /locus_tag="KLTH0D00110g"
                     /note="similar to uniprot|P38724 Saccharomyces cerevisiae
                     YHL047C ARN2 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to the
                     siderophore triacetylfusarinine C"
                     /codon_start=1
                     /product="KLTH0D00110p"
                     /protein_id="XP_002552733.1"
                     /db_xref="GeneID:8294947"
                     /db_xref="GOA:C5DDD7"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDD7"
                     /translation="MPEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELG
                     DKLQITKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMND
                     YQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDV
                     QRYAAGSIFYYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHV
                     ANPEKNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLV
                     QTLKQLFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFF
                     IYWESKLALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLS
                     ATRITSLYSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGK
                     GVIGAMVVWGITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAI
                     WTQSLYPRLLKALGDPTLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVG
                     LIFVAPMFLLTFFLRDPPLTEDYGQKLEDDEYVKHDDPITDWIAERFSSFKKHE"
     gene            complement(<2951..>6727)
                     /locus_tag="KLTH0D00132g"
                     /db_xref="GeneID:8294948"
     mRNA            complement(<2951..>6727)
                     /locus_tag="KLTH0D00132g"
                     /product="KLTH0D00132p"
                     /transcript_id="XM_002552688.1"
                     /db_xref="GeneID:8294948"
     CDS             complement(2951..6727)
                     /locus_tag="KLTH0D00132g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0D00132p"
                     /protein_id="XP_002552734.1"
                     /db_xref="GeneID:8294948"
                     /db_xref="GOA:C5DFV4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DFV4"
                     /translation="MEKISDRFAAIHGFLIKTNRDGTKRITCPNISSLKPTKKEVQRI
                     LELKLQNLAVYLGMKEDLIYVDCPLLFETVTSEQRYFYSTEDGMKAVRSGRTNSANTR
                     RSIEYRVLPITLPNKTRKYLCQTGKKLPEMPLEHEIATPRQESEAETATVPQASEDLD
                     VFHTLHCDKLVFTNRDRRLFRSFAMDRTLYEVESVAILKHCHREAISKTTKTNSFGEP
                     LVTKYKLETLEIHGKHAGVLLFLIANLHQLSLGQQVERPTVDSELLLDRIGELHNTEA
                     KAAHLQQLLYIVLKEERYMDLANLFTRLLLFRLSAHFDIRKDLEVEEMETVRERMSAT
                     GVWIKCVIISEKSEDQLNIFQEESHNIWSKFTTLYHKVAKESDQTMTMNINRVPPDCI
                     RVYGKTFGREYIKSFYSDMQYEFDQQWSKLDRVLTMTPVESTGKMLLENYRIPWAGHG
                     YRANFSLKDMFPQWIHDQVSPSMRQPLTQLDKREVLGAIDKMTVALMWMIWLAAGVPY
                     TFSELQVLACGGDQQNIYVDSERRCVQIITRSFKKGNLKEDFKWLDKRTSYYLVYYVT
                     VLRKTQISVLGENYEAFEPPKEGEVDLEGIWEHIEGKCNMSKKEASALIMDQYLFLDA
                     KLGQLMSRRRFLKPSEEHPNYVASPERLSFKQLKFGRMGLLRQYLASSLNDSKPVKTA
                     RIDLAMCRFAASSARDYMDELGDSEDVDDPDAMGDLEVLEESMWQCEQSERFMTRTWH
                     EEIAKQWIRWVGLDEEEEIHHPLTYSVGEIVLQKEALCPDDLVHAGRELYGKSFTFRN
                     SDQYLACVNAYLSNKKIIAVQAPPGLGKTLVFQLPLMCYTMRKLSLVSFVFVPFVGLL
                     AGTMCRLEASGNLRVGSVEKLLNETRCKENSLLDVYVGTFNDAAAEDFIKMINFWSLL
                     YPEKKLGLLAFDEFQNLYDEKSHSEVSFPSLKRVQFGRFRRIILTSATCEQGSAQGAL
                     QELGFRGREGTNFTWERSQAGRSVDVPIFLRNYVQEPAVMHVYKHALRMRGNGVGQVK
                     QFLRSLFAYDPDAKAALVVGENVATTELFTEVSQEFSAAYVHSDLTTEEKLKRVQSFI
                     KDKSLQLLIGTKQVVEGLDIEGLRMVILLDYYPRVAEYIQCVGRVRGSGTCIALWQDP
                     PPQVENDQPRVDYDKCFTSQICKYYELPQRVHAGCCGSFESVTEEAKSLFHRVVLEEE
                     VNDVCSQKTTRDEDSEQGRERKIARTDVIASADDSNEVSGVNKRPQDDTAITKA"
     repeat_region   complement(7718..8133)
                     /rpt_type=long_terminal_repeat
     gene            complement(<12199..>13608)
                     /locus_tag="KLTH0D00198g"
                     /db_xref="GeneID:8294951"
     mRNA            complement(<12199..>13608)
                     /locus_tag="KLTH0D00198g"
                     /product="KLTH0D00198p"
                     /transcript_id="XM_002552689.1"
                     /db_xref="GeneID:8294951"
     CDS             complement(12199..13608)
                     /locus_tag="KLTH0D00198g"
                     /note="similar to uniprot|P24031 Saccharomyces cerevisiae
                     YBR092C PHO3 Constitutively expressed acid phosphatase
                     similar to Pho5p; brought to the cell surface by transport
                     vesicles; hydrolyzes thiamin phosphates in the periplasmic
                     space, increasing cellular thiamin uptake; expression is
                     repressed by thiamin"
                     /codon_start=1
                     /product="KLTH0D00198p"
                     /protein_id="XP_002552735.1"
                     /db_xref="GeneID:8294951"
                     /db_xref="GOA:C5DFV5"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DFV5"
                     /translation="MWLENNMLMALAGLYTAHALSIPKKYKADVKNIGTQEHIFPYLA
                     GSGPYFSYPNDYGISADTPSGCEISQIQLLARHGERYPSKSKGKKLLKTWNTLQHFPY
                     QFNGSLSFIDDDYEFFIQDLDNLEMETTTENSVNAINPYTGEMDAKKHAQEFLAQYAD
                     FLEDNREFAVFAASSQRVHDTAQFFIDSLGDKFNISLQVVSEEPSAGANTLSPGYSCP
                     AWNPDEYEDIIGSYSTTYLKAIAERLNRENSGLNLTVTDAYNLFDWCAFELNARGYSE
                     ICDVFSPEELIHYSYYDDLTAYYEDGPGYPLIQAVGALYFNASIKLLQQSEQLDQKVW
                     LSFTHDTDILNYLTTVGLFDDEKKLDPSYIPFRNHVFHKSWFIPQGARVYTQKYRCSN
                     ESYIRYVVNDAVIPLENCSDGPGFSCEANKFYKYAENRTANQDFYQSCNVSSVSNITE
                     LTFFWDWNTTHYNATLLKE"
     gene            complement(<17298..>17885)
                     /locus_tag="KLTH0D00220g"
                     /db_xref="GeneID:8294952"
     mRNA            complement(<17298..>17885)
                     /locus_tag="KLTH0D00220g"
                     /product="KLTH0D00220p"
                     /transcript_id="XM_002552690.1"
                     /db_xref="GeneID:8294952"
     CDS             complement(17298..17885)
                     /locus_tag="KLTH0D00220g"
                     /note="highly similar to uniprot|P40893 Saccharomyces
                     cerevisiae YJL217W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D00220p"
                     /protein_id="XP_002552736.1"
                     /db_xref="GeneID:8294952"
                     /db_xref="InterPro:IPR009784"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR015987"
                     /db_xref="UniProtKB/TrEMBL:C5DFV6"
                     /translation="MTDSPWSKGSWLNAPSQVTIDNDRLKITTDEKTDFWRQTFYGFT
                     RDSGHFFGIKTGSSFTAELRVQGSYESLYDQAGIMVRIDSKNWIKAGIEVSDGQKMLS
                     SVLTTGVSDWTTAVYNGNAYDFWLRVTVENGVLRLQVSSDKKRWPLVRLAPFPSSEEY
                     FVGPMACTPKRGGLNVTFSDWKLTPPLKRELHDLS"
     gene            complement(<20418..>21098)
                     /locus_tag="KLTH0D00242g"
                     /db_xref="GeneID:8294953"
     mRNA            complement(<20418..>21098)
                     /locus_tag="KLTH0D00242g"
                     /product="KLTH0D00242p"
                     /transcript_id="XM_002552691.1"
                     /db_xref="GeneID:8294953"
     CDS             complement(20418..21098)
                     /locus_tag="KLTH0D00242g"
                     /note="some similarities with uniprot|P36034 Saccharomyces
                     cerevisiae YKL219W COS9 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="KLTH0D00242p"
                     /protein_id="XP_002552737.1"
                     /db_xref="GeneID:8294953"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DFV7"
                     /translation="MDERNIEEYLVGSHNESIGHSRLPRDVFHNWFQYEVVRHKFYFA
                     VAVIQVILFIISTHNFFQAQKNANKILTVTGAVYLSSVVIYFTGLIFFQVERGFVTTA
                     ANKVQFLKELITIRPGIDMIEWDILATKANTIFYNESVLTSPYYFYDGASCYSFFRFV
                     FLLPYLRRKEACFADENSPDEIRRFISQAIKVYQEKADRKWQLILNKILSGRTNTSRW
                     HSNFCFKN"
     gene            complement(<21321..>22868)
                     /locus_tag="KLTH0D00264g"
                     /db_xref="GeneID:8294954"
     mRNA            complement(<21321..>22868)
                     /locus_tag="KLTH0D00264g"
                     /product="KLTH0D00264p"
                     /transcript_id="XM_002552692.1"
                     /db_xref="GeneID:8294954"
     CDS             complement(21321..22868)
                     /locus_tag="KLTH0D00264g"
                     /note="similar to uniprot|P17064 Saccharomyces cerevisiae
                     YER056C FCY2 Purine-cytosine permease and similar to
                     uniprot|P40039 Saccharomyces cerevisiae YER060W FCY21
                     Putative purine-cytosine permease"
                     /codon_start=1
                     /product="KLTH0D00264p"
                     /protein_id="XP_002552738.1"
                     /db_xref="GeneID:8294954"
                     /db_xref="GOA:C5DFV8"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:C5DFV8"
                     /translation="MPLKSDVEVQTSDRLTETTSVLPQDDHVNKGAASCNRYFAFLDA
                     INAALGTETKGIEPTTEDERNDASLLNASTMWFSANMVIAAFSVGVLGPIVFELNFWG
                     CVVAVVVFAFLGVLPVAFYSVFGAELGLRQMVLSRYLLGNLTARIFAMINIIACIGWG
                     AVNTIASAQLLHMVNPHGARCPPWAGCLIIVLSTIIVSFFGYRVIHIYEKWAWVPNLA
                     VFLIVIARVRINGSFTIGHWEEGANTAAGILSLGGIVFGFATGWTTYASDYTVYMPST
                     INKYKVFFAVTAGLMLPLCFTILLGAAAGRAAMNNELYRYYYDKESTGGLLYAILVPK
                     SLGGFGQFCCVVLAMSTVANCIPNMYSIALGTQSLWQPLAKVPRVFWTVTGNFVTLAI
                     AIPAYYKFASFMTTFMDAIGYYLSIYIGISISEHFVYRRGRFQNYIVADWSSWDRLPV
                     GYAGCAALFVGGVGVALGMCQSYWSGEIGRLIGDYGGDIGFELGLGFSVITYNVLRPL
                     ELKFVGR"
     gene            complement(<28125..>28883)
                     /locus_tag="KLTH0D00308g"
                     /db_xref="GeneID:8294956"
     mRNA            complement(<28125..>28883)
                     /locus_tag="KLTH0D00308g"
                     /product="KLTH0D00308p"
                     /transcript_id="XM_002552693.1"
                     /db_xref="GeneID:8294956"
     CDS             complement(28125..28883)
                     /locus_tag="KLTH0D00308g"
                     /note="similar to uniprot|Q12512 Saccharomyces cerevisiae
                     YOL154W ZPS1 Putative GPI-anchored protein transcription
                     is induced under low-zinc conditions as mediated by the
                     Zap1p transcription factor and at alkaline pH"
                     /codon_start=1
                     /product="KLTH0D00308p"
                     /protein_id="XP_002552739.1"
                     /db_xref="GeneID:8294956"
                     /db_xref="GOA:C5DFV9"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR029482"
                     /db_xref="UniProtKB/TrEMBL:C5DFV9"
                     /translation="MFENFKVMKITNLLSCTSLLAAISLSAPVEYSSNATISSYVEYN
                     SDIPGWARPTFPELYQTCNSTKRRILQSFIEDSLEVSAYAKDRLLNYGAEDVFFQRWF
                     GNGSIITVLGTLDHLVEASKAGFVFRCDDIDGLCLKNPTTYPGYHRQTADKETVICDL
                     FFQSKKPLVNICYEGAIKDVGPKHYAGVDILHRYLHISSMNMNGFIGEFVEEFDDLAE
                     FASGNSTFAVRNVDSYLYYMADVYSSSVVPGGCL"
     repeat_region   31772..32188
                     /rpt_type=long_terminal_repeat
     gene            complement(<33818..>34939)
                     /locus_tag="KLTH0D00374g"
                     /db_xref="GeneID:8294959"
     mRNA            complement(<33818..>34939)
                     /locus_tag="KLTH0D00374g"
                     /product="KLTH0D00374p"
                     /transcript_id="XM_002552694.1"
                     /db_xref="GeneID:8294959"
     CDS             complement(33818..34939)
                     /locus_tag="KLTH0D00374g"
                     /note="weakly similar to uniprot|P53344 Saccharomyces
                     cerevisiae YGR295C COS6 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="KLTH0D00374p"
                     /protein_id="XP_002552740.1"
                     /db_xref="GeneID:8294959"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DFW0"
                     /translation="MNKACVPDKEAQNDFLPKFFYKSSLRWALDQLMRMPLFYLLLSS
                     IVIDIVWFSIGNKLHSFWIHVPVFSSLLLQIKVTKAISNSIQRLCEIVIEEGPGMQEE
                     QWDIAAARMNSHFYEQGLWPNSCCLYSGRQCHAAFRHLVMTPYNKKEEQIQASYSLDQ
                     QLPLEEQAAKVYIESVSRWWNTYTANLESSAQFHIENTLPQQEYRSKASWCFFKFIEV
                     VMGQSSFGGMCFYSILLSLFFTSFTSFKNYDSLLGVWIGNAAGFSICGPLLFFVLRGA
                     DLDAPHLMAFWASVVAIEPHGDINKWGLVASHTNHYWNALNEESPRNFFFDSMDCRKA
                     FKNRFSTSLLRNKGNSHIYSDLRKYIEEALEASKEINEK"
     gene            <35809..>37278
                     /locus_tag="KLTH0D00396g"
                     /db_xref="GeneID:8294960"
     mRNA            <35809..>37278
                     /locus_tag="KLTH0D00396g"
                     /product="KLTH0D00396p"
                     /transcript_id="XM_002552695.1"
                     /db_xref="GeneID:8294960"
     CDS             35809..37278
                     /locus_tag="KLTH0D00396g"
                     /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
                     YOL119C MCH4 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="KLTH0D00396p"
                     /protein_id="XP_002552741.1"
                     /db_xref="GeneID:8294960"
                     /db_xref="GOA:C5DFW1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DFW1"
                     /translation="MLMPSMLQKPTRAFLHGLKDLRKDHFEDSRFEAPTTSGYEGSAE
                     ERRLFGAELQAKRGNVQETPLSNELVEEIEIFEQEGGFQAWLVVFGSFMGLIPVFGTV
                     NSLGAIESYISKHQLASESSTVVSWIFSIYLSLTFSSCIIAGGYFDRNGGRDPLCVGT
                     ILFTGAIIATADCKTVWQFILAFSVLGGISSGILMTPLVSCVATWFLKKRGLATSIAT
                     IGGSVGGVIFPVMLRSLYSKVGFSWALRILALICFSCLACSIIFARERQKPESKPFHT
                     KTEAFKWYLNSSLNWRYFLDWKFLFASLGMGFAENSLTASSTYLASYSLARGNSEEVS
                     YALIATTNAVGIFGRYIPGYLADRWTGRFNMVIITVSLAAFFNLVMWLPFGGNVKVLW
                     AYSILYGFTTGTILSLPPVCIGQISRTTDFGKRYSSAYFLEALMTIPVIPVGGAIIGS
                     GKISNYNDFIVYSSMMMIAASICFIISRSICTGFRMCKF"
     gene            complement(<37778..>39463)
                     /locus_tag="KLTH0D00418g"
                     /db_xref="GeneID:8294961"
     mRNA            complement(<37778..>39463)
                     /locus_tag="KLTH0D00418g"
                     /product="KLTH0D00418p"
                     /transcript_id="XM_002552696.1"
                     /db_xref="GeneID:8294961"
     CDS             complement(37778..39463)
                     /locus_tag="KLTH0D00418g"
                     /note="similar to uniprot|P16467 Saccharomyces cerevisiae
                     YLR134W PDC5 Minor isoform of pyruvate decarboxylase"
                     /codon_start=1
                     /product="KLTH0D00418p"
                     /protein_id="XP_002552742.1"
                     /db_xref="GeneID:8294961"
                     /db_xref="GOA:C5DFW2"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DFW2"
                     /translation="MTTVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEV
                     NCCNELNCSFAAEGYARTKGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNT
                     NDSSDHRLLHHTIGTHNYDYQYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKP
                     CYIEVPTNMASAICAPPGPISSLVNSVPTPKDVLSQAVNASVDFINSHLKPTLLAGPK
                     LKCADAQKAFLRLAEALKCAVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWS
                     DLTICAGCIFTDYSTTGWTALQPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERV
                     SENDKSLIEYNRLRQSPPLIKAADPKAAITRKEMARQIQQLITPKTTLFAETGDSWFN
                     GVQMDLPKGALFEVEMQWGHIGWSVPASLGYAVGAPDRRIITMVGDGSFQMTAQEVSL
                     MVRLRKPIIIFLINNYGYTIEVEIHDGPYNNIKNWNYAALMEVFNANEGSGKGFKART
                     GGELADAIEKAQANVSGPTLIEIQINRDDCTNELITWGHFVALANARPPKKTT"
     gene            complement(<40316..>41296)
                     /locus_tag="KLTH0D00440g"
                     /db_xref="GeneID:8294962"
     mRNA            complement(<40316..>41296)
                     /locus_tag="KLTH0D00440g"
                     /product="KLTH0D00440p"
                     /transcript_id="XM_002552697.1"
                     /db_xref="GeneID:8294962"
     CDS             complement(40316..41296)
                     /locus_tag="KLTH0D00440g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D00440p"
                     /protein_id="XP_002552743.1"
                     /db_xref="GeneID:8294962"
                     /db_xref="GOA:C5DFW3"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR011304"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018177"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:C5DFW3"
                     /translation="MAQNKESSTMKAGLNPVKVVVVGTGSVGSTTAYTLLLSGMVAEI
                     VLIDINKDKADGEGMDLNHAAPMTTDCRVYVGDYPDCANAAIVIITGGANQKPGQTRM
                     DLAAKNAKIMQEIIPNIVKNAPDTILLLATNPVDVLTSISYKLSGFPASRVIGSGTLL
                     DSARLRYNLSKYYNISSESIGAFIIGEHGDSELPVWSLASIAGMRLRDYCEKSNQKFD
                     QDALEKIFEKTRSAAYDIIKRKGYTAYGIAAGLVRIVETILKNEGSLLTVSTVGDYFG
                     VKQVALSVPTKVDRTGAHHIVGLSLDDNEIEEVKKSGQNIKSVCSRLGFD"
     repeat_region   43700..44116
                     /rpt_type=long_terminal_repeat
     gene            complement(<44278..>45819)
                     /locus_tag="KLTH0D00484g"
                     /db_xref="GeneID:8294964"
     mRNA            complement(<44278..>45819)
                     /locus_tag="KLTH0D00484g"
                     /product="KLTH0D00484p"
                     /transcript_id="XM_002552698.1"
                     /db_xref="GeneID:8294964"
     CDS             complement(44278..45819)
                     /locus_tag="KLTH0D00484g"
                     /note="similar to uniprot|Q12300 Saccharomyces cerevisiae
                     YDL138W RGT2 Plasma membrane glucose receptor"
                     /codon_start=1
                     /product="KLTH0D00484p"
                     /protein_id="XP_002552744.1"
                     /db_xref="GeneID:8294964"
                     /db_xref="GOA:C5DFW4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DFW4"
                     /translation="MGILQTLFHAEEDIQGSKFRAIFIGLFVAFGGILFGYDTGTISG
                     VLAMDYVKEHFTSRGHFTANETSLITAILSAGTFCGAMLAPLASDTIGRRLGLIISTL
                     IFAVGVVLQIAATGQNLLIVGRVIAGAGVGVLSAIVPLYQSEASPKWIRGAVVSCYQW
                     AITIGLLLAACVNQGTHARNDSGSYRIPIALQLLWAIIMFIGMVILPESPRFYIMKEK
                     VPEARKALSKLRGLPEEHEVIQNELEEISANYNYERSFGSTSIWDCFKPANHQLKRIF
                     IGIAIQALQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVVNVVMTVPGIALVEIA
                     GRRNLLLWGAIGMCVSELIVAAVGTALPDSFSANKTLIAFSCTFIASFAATWGPLAWV
                     VVGEIFPLRVRAKSVAVCAASNWLFNFAIAYATPYLVDSEHANLQSKVFFIWGGCTFL
                     CFLFVYFFIYETKGLTLEQIDELFEVCPSARYSKNFVPSSGPAVDVSNISDSDKAVVE
                     VLEKV"
     gene            <47320..>49170
                     /locus_tag="KLTH0D00506g"
                     /db_xref="GeneID:8294965"
     mRNA            <47320..>49170
                     /locus_tag="KLTH0D00506g"
                     /product="KLTH0D00506p"
                     /transcript_id="XM_002552699.1"
                     /db_xref="GeneID:8294965"
     CDS             47320..49170
                     /locus_tag="KLTH0D00506g"
                     /note="similar to uniprot|P38731 Saccharomyces cerevisiae
                     YHL040C ARN1 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to
                     ferrirubin ferrirhodin and related siderophores"
                     /codon_start=1
                     /product="KLTH0D00506p"
                     /protein_id="XP_002552745.1"
                     /db_xref="GeneID:8294965"
                     /db_xref="GOA:C5DFW5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DFW5"
                     /translation="MSIEKETATGVQSSAYPIEADDKDSHRELNEYGLPDKLRVTRHI
                     VIKKTEILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLST
                     IGVVNNVIGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVF
                     YNIGYVGVILVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSW
                     DIGMWAFIFPLSCVPLIACMIHMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWK
                     LDVVGVLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWAR
                     DPLVPYGLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSS
                     FVSVVWSPIFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVW
                     GAGSTMWTYPVNISVQSATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQL
                     LKRLGDADLAAAAYASPYTFIVSYAWGTPQREAVVGAYRHVQRYETIVALVFCAPLVI
                     FAMCLRDPDLTDEVAHSGLEKGEYIVKDQTDPISDWFSSKWSRLRERKEN"
     gene            <50179..>50808
                     /locus_tag="KLTH0D00528g"
                     /db_xref="GeneID:8294966"
     mRNA            <50179..>50808
                     /locus_tag="KLTH0D00528g"
                     /product="KLTH0D00528p"
                     /transcript_id="XM_002552700.1"
                     /db_xref="GeneID:8294966"
     CDS             50179..50808
                     /locus_tag="KLTH0D00528g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D00528p"
                     /protein_id="XP_002552746.1"
                     /db_xref="GeneID:8294966"
                     /db_xref="UniProtKB/TrEMBL:C5DFW6"
                     /translation="MSLFDTQYKGIQSVTQRYTLASRARSKMMRCASQGKGQDLDLRV
                     LVGHANLLDRVMESLHTEEEEEVSTSDEEEPVELGITSEVGSGHVTFALPQPLETVYE
                     CDSDSDSDNDDEATSSDYDSDSDGEFSSDSDNESEDESDEEGFSNFGKSRNYTLTGSD
                     AATTPVLRKHGGGNLYLFSLTGDGADTAERGRDLAARNGEAAGPRVLCV"
     gene            <51882..>53270
                     /locus_tag="KLTH0D00550g"
                     /db_xref="GeneID:8294967"
     mRNA            <51882..>53270
                     /locus_tag="KLTH0D00550g"
                     /product="KLTH0D00550p"
                     /transcript_id="XM_002552701.1"
                     /db_xref="GeneID:8294967"
     CDS             51882..53270
                     /locus_tag="KLTH0D00550g"
                     /note="highly similar to uniprot|P07262 Saccharomyces
                     cerevisiae and to YAL062W uniprot|P39708 Saccharomyces
                     cerevisiae, GDH3 NADP(+)-dependent glutamate
                     dehydrogenase, synthesize glutamate from ammonia and
                     alpha- ketoglutarate; rate of alpha-ketoglutarate
                     utilization differs from Gdh1p; expression regulated by
                     nitrogen and carbon sources"
                     /codon_start=1
                     /product="KLTH0D00550p"
                     /protein_id="XP_002552747.1"
                     /db_xref="GeneID:8294967"
                     /db_xref="GOA:C5DFW7"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DFW7"
                     /translation="MSPIAHEPEFQQAYEEVVNSLKDSTLFDKQPKYQKVLPIVSVPE
                     RIIQFRVTWENDKGAQEVATGYRVQYNSAKGPYKGGLRFHPTVNLSILKFLGFEQIFK
                     NALTGQALGGGKGGLCVDLKGRSDNEIRRICYSFMRELSRHIGQDTDVPAGDIGVGGR
                     EVGFLFGAYKSYKNSWEGVLTGKGLNWGGSLIRPEATGYGLVYYTQAMIDFATKGKES
                     FAGKRVAISGSGNVAQYAALKVIELGGTVVSLSDSKGSIIAQNGITAEQVEAITEAKV
                     QFKTLEQIIGEYSAFSNNKIKYLAGARPWVHVGEVDVALPCATQNEVSGDEAKALVAA
                     GVKFVAEGSNMGCTAEAAHIFEGERLSAKSASEPAVWYAPGKASNMGGVAVSGLEMAQ
                     NSQRMSWSREQVDQELKKIMVNCFNDCLSTAREYTNEDNAEALPSLIKGANLVGFIRV
                     ADAMFDQGDVWA"
     gene            complement(<53475..>55136)
                     /locus_tag="KLTH0D00572g"
                     /db_xref="GeneID:8294968"
     mRNA            complement(<53475..>55136)
                     /locus_tag="KLTH0D00572g"
                     /product="KLTH0D00572p"
                     /transcript_id="XM_002552702.1"
                     /db_xref="GeneID:8294968"
     CDS             complement(53475..55136)
                     /locus_tag="KLTH0D00572g"
                     /note="weakly similar to uniprot|P54862 Saccharomyces
                     cerevisiae YOL156W HXT11 Putative hexose transporter that
                     is nearly identical to Hxt9p, has similarity to major
                     facilitator superfamily (MFS) transporters and is involved
                     in pleiotropic drug resistance"
                     /codon_start=1
                     /product="KLTH0D00572p"
                     /protein_id="XP_002552748.1"
                     /db_xref="GeneID:8294968"
                     /db_xref="GOA:C5DFW8"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DFW8"
                     /translation="MKAFKLKNIFAKAEDRPTPPQIYNWRIYGTALVASTASVLIGYD
                     TGFVGGCFANKYFLANFGLVEGEARTDDTISNLISCFHAAAFFGALFSYPLSHYWGRK
                     RALIIAAAVATVGAAVMLGSVTGHLAPMYIGRVFTGLTVGASTNLTVVYLSEVSPAPI
                     RGQIIAAFEIGWRVGDLVGFWINYGINQHIAPGNKQWIIPVGVQVIPAALFFIGSLIM
                     CESPRWLFQMHRDQEAIKNLCFLRNLPDDDGYMIWEINSIRESIATQNEEIGPGLLDP
                     AREVFIRNRKYAKRLVISSILLVIPNFMGIQSINYYSPKIFSSIGVKGTNATLFSSGM
                     FGVVKFICTFIYILFIVDNLGRRKAFLASASMCSLCFWYLGAYLKVNDPTKPGATPKP
                     GGKAAIGFMFIWTASFILAFSGGPFVWSSEVFEQNIRTFVQAINAAMSWVPIFIMTRL
                     TTTMIDHMKYGIFFFFAAIAALAIPFVFFFVPETKGIALEDMDQLFARGLPAYKAHKV
                     VTSKSEDTVLEIQNSASQFFSDQGSKKGTQKLVEDADVGESASKV"
     gene            <57414..>59309
                     /locus_tag="KLTH0D00594g"
                     /db_xref="GeneID:8294969"
     mRNA            <57414..>59309
                     /locus_tag="KLTH0D00594g"
                     /product="KLTH0D00594p"
                     /transcript_id="XM_002552703.1"
                     /db_xref="GeneID:8294969"
     CDS             57414..59309
                     /locus_tag="KLTH0D00594g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D00594p"
                     /protein_id="XP_002552749.1"
                     /db_xref="GeneID:8294969"
                     /db_xref="GOA:C5DFW9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DFW9"
                     /translation="MDFQPKRKRSVHGCLTCRTRRKKCDENKPVCGGCERNFVQCTWP
                     QHTGGRVRRKRGEAAELTSDRSSTSADPAAGQGFEFHIICGPRTPVFNRSGTLAFEAY
                     SKSSSNQLTKFDEDAGRFVATPQFAAETPEELTRWISCCGERQTTKQADAANNTQGTL
                     DDGSVETTLDMHMGGIAANVIGVPTGAIIVHASASADRLGWALQRDNWAYGQLLERYR
                     KAEEVTDEDLAGIDLREFLFYTCVKGFVPKLDTQYTHPSLTTGATFLPQADRNSIVRS
                     VFACCGATYLAWYDLERFQQLSDELYIDCKTQILEYVQSVDNYADEDWLFASLLLLCI
                     RDKNSFTGTVDGCVWHLANSFLIISEKYYHRAPAQSLDDPLSDNLLRESIVLQPQERM
                     FLESFIYHYSISLLFARDISALPNPCALFRSLSLVLKCPVYDIKGNNDWVSNPLLGLT
                     LDAFEILAKLSYIARMPMPLGPTWLGKVVHLKSLCTCYAPPAPTSPDMTEAEWLNYRV
                     TSATGVLVTKACDLLAKKIIDYDSFDIDSSDVQMRTREIIQLFKDLPSDHKIWGILPW
                     TLLITGAFCRRIEDQIFITRKIEIMAHRAHSYCGLKMSSFLHAIWNSEVGINYLFDRD
                     RLAQVDL"
     gene            <59883..>61031
                     /locus_tag="KLTH0D00616g"
                     /db_xref="GeneID:8294970"
     mRNA            <59883..>61031
                     /locus_tag="KLTH0D00616g"
                     /product="KLTH0D00616p"
                     /transcript_id="XM_002552704.1"
                     /db_xref="GeneID:8294970"
     CDS             59883..61031
                     /locus_tag="KLTH0D00616g"
                     /note="similar to uniprot|P39713 Saccharomyces cerevisiae
                     YAL061W putative polyol dehydrogenase"
                     /codon_start=1
                     /product="KLTH0D00616p"
                     /protein_id="XP_002552750.1"
                     /db_xref="GeneID:8294970"
                     /db_xref="GOA:C5DFX0"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DFX0"
                     /translation="MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLH
                     EYLDGPIFFPANGKTHAMSGQGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCT
                     CEDRARWPDVKHEREGLCIACKTGNPNCCTDLGFCGLGCQSGGFAEKIVLSERNVVKI
                     PNSLPLDVAALVEPISVSWHAVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTII
                     VSEPADTRRQKAEALGAQTFNPTEHGDNVIEALRKLAPGGEGFNFSYDCCGTSETFSA
                     GLHTLTPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQDFEEVVDAMDKGK
                     IDINKVKTMITGRERIENGFENGIMDLINNKEKNIKILLTPNNFKELA"
     gene            <61224..>61775
                     /locus_tag="KLTH0D00638g"
                     /db_xref="GeneID:8294971"
     mRNA            <61224..>61775
                     /locus_tag="KLTH0D00638g"
                     /product="KLTH0D00638p"
                     /transcript_id="XM_002552705.1"
                     /db_xref="GeneID:8294971"
     CDS             61224..61775
                     /locus_tag="KLTH0D00638g"
                     /note="similar to uniprot|P39715 Saccharomyces cerevisiae
                     YAL059W ECM1 Protein of unknown function localized in the
                     nucleoplasm and the nucleolus genetically interacts with
                     MTR2 in 60S ribosomal protein subunit export"
                     /codon_start=1
                     /product="KLTH0D00638p"
                     /protein_id="XP_002552751.1"
                     /db_xref="GeneID:8294971"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:C5DFX1"
                     /translation="MAKKISKHSRAARRLEVEDVEAQTLAKLPRAQNLDLTNKLIRTA
                     SKNEQLLEAKMRKKEGSGKRVGKKSIAKGLPENLDKERLEKALNVTSRLDGKVQKAKS
                     RAKYVQNARKAGWDRTNESIKRDLALLTASKSDISSKDDKTAEDSMEQDEAYIDEDEG
                     NSSTPPQAEATNAFDLLTDDVEA"
     gene            <62142..>62582
                     /locus_tag="KLTH0D00660g"
                     /db_xref="GeneID:8294972"
     mRNA            <62142..>62582
                     /locus_tag="KLTH0D00660g"
                     /product="KLTH0D00660p"
                     /transcript_id="XM_002552706.1"
                     /db_xref="GeneID:8294972"
     CDS             62142..62582
                     /locus_tag="KLTH0D00660g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D00660p"
                     /protein_id="XP_002552752.1"
                     /db_xref="GeneID:8294972"
                     /db_xref="UniProtKB/TrEMBL:C5DFX2"
                     /translation="MRTLEDITIGGSTYTMADKDALRLGETAQSIVNKIFSRFMLLDA
                     LFRGMVFGVGVLVVVFLTAVLLIKIMLASQENGKAKAKSGNRNTSPSSVDNAKSGDQK
                     SRNAKSSALNDEDHAHLLSRKVIPINSTDDFTEELEISVMEEDD"
     gene            complement(<63033..>64601)
                     /locus_tag="KLTH0D00682g"
                     /db_xref="GeneID:8294973"
     mRNA            complement(<63033..>64601)
                     /locus_tag="KLTH0D00682g"
                     /product="KLTH0D00682p"
                     /transcript_id="XM_002552707.1"
                     /db_xref="GeneID:8294973"
     CDS             complement(63033..64601)
                     /locus_tag="KLTH0D00682g"
                     /note="highly similar to uniprot|P46367 Saccharomyces
                     cerevisiae YOR374W ALD4 Mitochondrial aldehyde
                     dehydrogenase that utilizes NADP or NAD equally as
                     coenzymes expression is glucose repressed"
                     /codon_start=1
                     /product="KLTH0D00682p"
                     /protein_id="XP_002552753.1"
                     /db_xref="GeneID:8294973"
                     /db_xref="GOA:C5DFX3"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DFX3"
                     /translation="MLSRTGTALRGMPVAATRLGMRFYAQLPLRVPVKMPNGIEYEQP
                     TGLFINNKFVRAKQGKTFEVVSPATEEEITHVYEAREDDVEDAIAAADQAFKSGVWSD
                     ADPLVRAKALNKLAELIEEDLETIASIETLDNGKAISSARGDVQLVANYLRSCAGWCD
                     KIDGRLINTGSTHFSYTIRQPLGVCGQIIPWNFPLLMWAWKVGPALATGNTVVLKTAE
                     STPLSALYVSQFVPKAGIPAGVVNIISGFGKIIGEALTTHPKIKKIAFTGSTATGRHI
                     YQNAGANLKKVTLELGGKSPNIVFADADLKATVQNIILGIYYNSGEVCCAGSRVYVEE
                     SVYDQFLEELKAATENVKVGDPFDDATFQGAQTSQMQLSKILKYVEIGRDEGATLVTG
                     GERLGNKGFFVKPTIFGDVTEDMRIVKEEIFGPVVTITKFKTVEEVIEKANDSEYGLA
                     AGVHTKDINKAIEVSNRVNSGTVWINTFNDFHHAVPFGGFNASGIGREMGIEALENYT
                     QVKAVRAKLTLSGK"
     gene            complement(<65886..>68045)
                     /locus_tag="KLTH0D00704g"
                     /db_xref="GeneID:8294974"
     mRNA            complement(<65886..>68045)
                     /locus_tag="KLTH0D00704g"
                     /product="KLTH0D00704p"
                     /transcript_id="XM_002552708.1"
                     /db_xref="GeneID:8294974"
     CDS             complement(65886..68045)
                     /locus_tag="KLTH0D00704g"
                     /note="weakly similar to uniprot|P32336 Saccharomyces
                     cerevisiae YOR373W NUD1 Component of the spindle pole body
                     outer plaque required for exit from mitosis"
                     /codon_start=1
                     /product="KLTH0D00704p"
                     /protein_id="XP_002552754.1"
                     /db_xref="GeneID:8294974"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:C5DFX4"
                     /translation="MSSKSSPSKQLSESLGRFHISSPSKLKPYMENDKFQDKAFDSQG
                     RYPRNGRSYVDKLDSWSVNYGTVQQHGIDSENAELPQWKQYMQGQVVAEKGSQELHAP
                     ADLVVTSSLSDISLIPTNTFKKRGTRLPVDETHQLDPENNTTQEKDTELDIDPAREAL
                     GVFNNVLRHQRSNFFNDDEHKLNSPVRSVSDGYETGSNSSFDSFDPSLSPSIRQSNKK
                     QPHQPRNEARKESPRRPLKLITPEDAGMVFNYKEGVWDQPSATVDVSTSGAQDESSQS
                     KIVSFKLPRTRPETSMVDDTPLSTPKVDLKFLSRNRSGENTQVPAGVDKAVRRASRVT
                     SLPADTTHNLVDNVTSVSDLDTSFRISRGAVVSALVDAIPRKENWVKVRDLSLERRDL
                     ESLVGLDEMAPSVLELNVSHNKLNSLQGVPKHTISLCCSHNRIGTYCRLDALEHLEDV
                     DMSHNALSTNLSLFAACLHLRNINISQNGVTSLQGLSESRLRIDTLNIARNRLIGPLD
                     FADLLSSDQEPNFLTHLRELDLSGNKITTVKNLHLLTGLRVLKLDGNPLETLVGNTNK
                     SLRSLTALGCAALRELGDFPQLRILKLSGESLQIQRLPESLEHLELTGITGASSSVMV
                     PWNILPHMLRKLRLSRLGFEELPPEFATHCPALDALIITDNELQSAANLFERLPVNLR
                     TLDVRRNPLTQFKAESERKMLAEAAAMAAPNLKKIFL"
     gene            <68287..>69699
                     /locus_tag="KLTH0D00726g"
                     /db_xref="GeneID:8294975"
     mRNA            <68287..>69699
                     /locus_tag="KLTH0D00726g"
                     /product="KLTH0D00726p"
                     /transcript_id="XM_002552709.1"
                     /db_xref="GeneID:8294975"
     CDS             68287..69699
                     /locus_tag="KLTH0D00726g"
                     /note="weakly similar to uniprot|Q08887 Saccharomyces
                     cerevisiae YOR372C NDD1 Transcriptional activator
                     essential for nuclear division"
                     /codon_start=1
                     /product="KLTH0D00726p"
                     /protein_id="XP_002552755.1"
                     /db_xref="GeneID:8294975"
                     /db_xref="UniProtKB/TrEMBL:C5DFX5"
                     /translation="MEPSNDEEAFFRVISENMKYAFTSPIATTTQFPTPYSQAHNNTS
                     SHTQETERARTHSESQSIVENSMLAESNGASSLSDVNVQPSSVLQLGNEFMLTSPEQF
                     REFLFESPAGINLLHRTPAKTPLRFFNSSAIVSSAQSQSHQSQQNQGHLPQQATNGPL
                     QNQITPLRNIDVNLMFNSRNKQTNNTSSPSKRYLSLTPYGKRVLSDIGTPYAKLLASS
                     NSALVDFQRARKDVQKSVGPQGSDLRSRGNSNTNKGLSGDLDVGSGHHKASLVSGSDD
                     EIESGADDCGSSPTTIQLNSSVTKSTRDKLGSIGSIPENNITNSDLGPSSEDEHETNI
                     DERLFEMEKLPLSPTPKPSKRNDLDVTRIKIPELPKMGSFKSERSSSVPNTAKKTTRK
                     QPKFQIIVTDANSFNSTRGTVMGGDAVGKKRKPALKRSQSEIVSTTSASSSRGKTKRQ
                     KLSQVHNFSLDLNSRYPDSQ"
     gene            <70793..>73255
                     /locus_tag="KLTH0D00748g"
                     /db_xref="GeneID:8294976"
     mRNA            <70793..>73255
                     /locus_tag="KLTH0D00748g"
                     /product="KLTH0D00748p"
                     /transcript_id="XM_002552710.1"
                     /db_xref="GeneID:8294976"
     CDS             70793..73255
                     /locus_tag="KLTH0D00748g"
                     /note="weakly similar to uniprot|Q08886 Saccharomyces
                     cerevisiae YOR371C GPB1 Proposed beta subunit of the
                     heterotrimeric G protein that interacts with the receptor
                     Grp1p has signaling role in response to nutrients involved
                     in regulation of pseudohyphal growth through cAMP levels
                     homolog of Gpb2p"
                     /codon_start=1
                     /product="KLTH0D00748p"
                     /protein_id="XP_002552756.1"
                     /db_xref="GeneID:8294976"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:C5DFX6"
                     /translation="MQSGVSSFSGSSDNSQLSLNLQNNAPVAGNYGVPVWTKDHYKSQ
                     YKAPPYLSNYVPGLRDASAQVSAERRKLDNEKALIAYYSSKIHVSRHDSIISGCSNPS
                     VGSDNSRRSARMKHALKSTHKTFGDHGSPLRCAHDESKYSPEVFSKGYLNYCSKLPLP
                     VLESTKLLKRHNMWIPMTRWDIRDKNSESEGPSLSHHDGNKEEDSRLFTDVKIHPADY
                     PSNQNTFVGSMTIPPLFGEMKLPPFAYQCTVDLDDNIYTLGGLTSSYLYSDEAPDLSS
                     FHVDGVPNLPPPLLDNVVNNPCMVNNHDLYVISSSSSRVQKPTTTGQVPPPLLCMTGS
                     VLTKRHIFYYGGFEIKTETTVDEQTGKFFLKKRAYLHNTAYILDVVTFKFTKVELVAQ
                     PTKFNAYPATVPRFGHAQVSVQLSPTTTLKCAACSASSSSESKTDESKPENIGASSPI
                     SQPLDLRSQSETSLTAEKVINTKLSNSLNSGVFTVIVMGGYRQINEDEYETLNDLWKL
                     EVTVTARGKRNYFKFADTALATPFARVLNEHEGGTWPGARAFQACEVYDTELLKTYSS
                     KPKLLENLRANFCIEPETLSPGVMSPGEKAPSLTRRSELYENHHIHAYGDSTCSGAWN
                     HKSNANTQFTGKTLLVHGGSDKEHVYGDMWWFDLDNEEWTLVPTYVKRTDSKCHSNEV
                     QLPLVGHTLVRIASNAVLTGGLSQEDVDKLWSRNKTQSDPNPALPPSLTGALHLLDLS
                     SLVLKPFLLGTDPNEIQRARNIGWPEVLRFICAPGMHKNGFVYLVGGMMFNISKVEEL
                     YLRGTMTVFILPIITTPKVVTI"
     gene            <74519..>76360
                     /locus_tag="KLTH0D00770g"
                     /db_xref="GeneID:8294977"
     mRNA            <74519..>76360
                     /locus_tag="KLTH0D00770g"
                     /product="KLTH0D00770p"
                     /transcript_id="XM_002552711.1"
                     /db_xref="GeneID:8294977"
     CDS             74519..76360
                     /locus_tag="KLTH0D00770g"
                     /note="similar to uniprot|P32864 Saccharomyces cerevisiae
                     YOR370C MRS6 Rab escort protein forms a complex with the
                     Ras-like small GTPase Ypt1p that is required for the
                     prenylation of Ypt1p by protein geranylgeranyltransferase
                     type II (Bet2p-Bet4p)"
                     /codon_start=1
                     /product="KLTH0D00770p"
                     /protein_id="XP_002552757.1"
                     /db_xref="GeneID:8294977"
                     /db_xref="GOA:C5DFX7"
                     /db_xref="InterPro:IPR000632"
                     /db_xref="InterPro:IPR017230"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:C5DFX7"
                     /translation="MMGAERRTSMAERRPSTLNQSSFSMERRASSVVVPHLAGIEDPL
                     PDTTPDKVDVVVVGTGLVESILAAALAWQGSNVLHIDSNSYYGDTSATLTIDQLKQWV
                     QDVNQGSLKCYENAKLHISSVVGRGSYKSRDFGIDLSPKILFAKSDLLSILLKSRVHQ
                     YLEFQSLSSFHTYENDSFERLTNTKQEIFTNPSLPLMTKRSLMKFIKFVLDWENQQEV
                     WASYRDKPITSFLVNKFKLERAQVYELIFSIGLCYNIDVKTPEALQRIRRYLTSFDVY
                     GPFPVLYSKYGGPGELSQGFCRSAAVAGATYKLNETLVSYDPESKTAIFGDGSRVTVT
                     EKVVAAPTQCPKNSRNVPEQMFEVQRLTCVVDKPCLEWFGEGEYAAVVVFPPGSLKSG
                     NRQAVQALIMGAGSDVCPAGSSVWYLTSTESGPRGEMDLDAAFGALEESIIRESSADI
                     ENDSGILEVDTSGHFTLNSVKLGQSFKEHISGESIQVLVKLYYKQLTSTPPFEVVDPS
                     IFDVNDPADGVHKKLIPGASDNGVLYTALPSAEISYDEAVTAARVLFQRIVGSDDDFF
                     DLDFEDEDDTDQMNESAVVDDEDDRMDIGLNAEMSVEPVEFAGEMEI"
     gene            <76844..>77281
                     /locus_tag="KLTH0D00792g"
                     /db_xref="GeneID:8294978"
     mRNA            <76844..>77281
                     /locus_tag="KLTH0D00792g"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_002552712.1"
                     /db_xref="GeneID:8294978"
     CDS             76844..77281
                     /locus_tag="KLTH0D00792g"
                     /note="highly similar to uniprot|P48589 Saccharomyces
                     cerevisiae YOR369C"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_002552758.1"
                     /db_xref="GeneID:8294978"
                     /db_xref="GOA:C5DFX8"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5DFX8"
                     /translation="MSDVEEVQEVQEIQEVAVEQPTESITIEDALKVVLRTSLVHDGL
                     ARGLRESAKALTRGEAQLVVLVDSVTEDNIIKLVEGLANDPENKVPLIKVADAKQLGE
                     WAGLGKIDREGNARKVVGASVVVVKNWGADTEERQMILEHFSQ"
     gene            complement(<77439..>78620)
                     /locus_tag="KLTH0D00814g"
                     /db_xref="GeneID:8294979"
     mRNA            complement(<77439..>78620)
                     /locus_tag="KLTH0D00814g"
                     /product="KLTH0D00814p"
                     /transcript_id="XM_002552713.1"
                     /db_xref="GeneID:8294979"
     CDS             complement(77439..78620)
                     /locus_tag="KLTH0D00814g"
                     /note="similar to uniprot|P48581 Saccharomyces cerevisiae
                     YOR368W RAD17 Checkpoint protein involved in the
                     activation of the DNA damage and meiotic pachytene
                     checkpoints with Mec3p and Ddc1p forms a clamp that is
                     loaded onto partial duplex DNA homolog of human and S.
                     pombe Rad1 and U. maydis Rec1 proteins"
                     /codon_start=1
                     /product="KLTH0D00814p"
                     /protein_id="XP_002552759.1"
                     /db_xref="GeneID:8294979"
                     /db_xref="GOA:C5DFX9"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="UniProtKB/TrEMBL:C5DFX9"
                     /translation="MLDQNVLFSASTVHLEHITTALNCLTPFGLRDDVLIIIDSDGLS
                     FARENNRVISIQLFLSKELFISYQYNAPESDSDAHTKISVKINHILDSISVASRDKDD
                     VVECTLSYVGEGSPFVLIFEDSAITEKVEYSTYLTKEWDMTGLELDRSLVDLECMMKG
                     DIFYSALQDLKEIGCKECYIYARAGSSGKNIFAIISKSHLGFSKILLPSERSILEKLE
                     TFDSDTHEKVHEKPVIGFFDFGSFDKMRASAKIASKVLIRKDAHGLMSVNILSETDDI
                     LRGDSKTKSSASPANPHSSAYLSREYPGIVIDISILEKARVDYDDMEEVKLLMQNNDE
                     LKAPPAYQPVSTGASRDPNPAAQESTSLLFNERKRHAEELDNGEDGEFIPATNDIPLF
                     F"
     gene            complement(<79191..>79817)
                     /locus_tag="KLTH0D00836g"
                     /db_xref="GeneID:8294980"
     mRNA            complement(<79191..>79817)
                     /locus_tag="KLTH0D00836g"
                     /product="KLTH0D00836p"
                     /transcript_id="XM_002552714.1"
                     /db_xref="GeneID:8294980"
     CDS             complement(79191..79817)
                     /locus_tag="KLTH0D00836g"
                     /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
                     YOR367W"
                     /codon_start=1
                     /product="KLTH0D00836p"
                     /protein_id="XP_002552760.1"
                     /db_xref="GeneID:8294980"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR003096"
                     /db_xref="UniProtKB/TrEMBL:C5DFY0"
                     /translation="MNSKHTGPSSYTAKADVTSLDQDLQELRRSKFSRESIDEISQWI
                     FGAVLKEPIPSDLLPALKDSTALCRLANALHEADAPNSGPLIKFKESRMPFVQMEQIS
                     QFLSFARQYGVPEDELFQTVDLYEEKDPATVYQALKSLSRYANKKHPHQFPVIGPQIA
                     TKRPRPPKAAKPKHLQSSGWSTLEYGYIKGANQSSEGVVFGQKRDITH"
     gene            <80807..>83134
                     /locus_tag="KLTH0D00858g"
                     /db_xref="GeneID:8294981"
     mRNA            <80807..>83134
                     /locus_tag="KLTH0D00858g"
                     /product="KLTH0D00858p"
                     /transcript_id="XM_002552715.1"
                     /db_xref="GeneID:8294981"
     CDS             80807..83134
                     /locus_tag="KLTH0D00858g"
                     /note="similar to uniprot|P39719 Saccharomyces cerevisiae
                     YAL053W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="KLTH0D00858p"
                     /protein_id="XP_002552761.1"
                     /db_xref="GeneID:8294981"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:C5DFY1"
                     /translation="MRPALTGPMRVLFLVFVFLQFWVSPASASNTSRHLETTSLLTCM
                     QNSQLTASFFEVKFYPSLNKVYFNIDATTTISTNITAEVQVIVYGLNLMERSINFCNL
                     DQPALCPLQAGRIDVNSSFTVDSDITSNIPNVAYTVPDLDAQVRVVVYSTSDTDHGTP
                     LACVVAPLGNGKTVQTKYAAWPIAAISGLGVLTSGFVSVIGHSTTAAHIASNSISLFI
                     YFQNLAITSMMGVSRVPPIAAAWSQNFQWSMGIINVKFMQDIFNWYIKATGGEPTVVV
                     ANKDVLSIAVQKKRVKRALVEGAKHLYKRLTISTTDSMDLDSFLSEQGLYTGNERNST
                     NYASKTLVLHGIQRVAYKAGIELSNLFLTGVVFTFFFVFIVVIALMFFKALVELLTRT
                     RVMAESSKFFEYRKSWGNIIKGTLFRLSIIAFPQLSILCIWEFTQRDSAATMVDAIVI
                     LITIGAVLLYGVIKVVLRGRESARLYKTPAYMLYGDSNFLNRYGFLYVQFKADLYWWL
                     MPLLGYSFLRSLFVAVLQNNGKAQAMVTFIIEMVYFVAICWKRPYLDKRTNAFNIVIH
                     LVNFFNALFFLFFSGLFRQPQIVSSVMAVVLFVMNAVFALFLLIFTIVTCSLALIYRN
                     PDARYQPMKDDRVSFIPKIQTNGNASKSETELFELGKAVMTTNEASNISSDKSYRNQS
                     SKKLLFDDEVDDSSIFDDHSGAREKRANSGEAVQPSSAVLGPSTFGTYQKIPTAPSSR
                     GAQNLRAPENTFGNTSYQGYTGASSNPYSKNNPYL"
     gene            complement(<84021..>86015)
                     /locus_tag="KLTH0D00880g"
                     /db_xref="GeneID:8294982"
     mRNA            complement(<84021..>86015)
                     /locus_tag="KLTH0D00880g"
                     /product="KLTH0D00880p"
                     /transcript_id="XM_002552716.1"
                     /db_xref="GeneID:8294982"
     CDS             complement(84021..86015)
                     /locus_tag="KLTH0D00880g"
                     /note="highly similar to uniprot|P39722 Saccharomyces
                     cerevisiae YAL048C GEM1 Evolutionarily-conserved
                     tail-anchored outer mitochondrial membrane GTPase which
                     regulates mitochondrial morphology cells lacking Gem1p
                     contain collapsed globular or grape-like mitochondria not
                     required for pheromone-induced cell death"
                     /codon_start=1
                     /product="KLTH0D00880p"
                     /protein_id="XP_002552762.1"
                     /db_xref="GeneID:8294982"
                     /db_xref="GOA:C5DFY2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR020860"
                     /db_xref="InterPro:IPR021181"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DFY2"
                     /translation="MGKEQIKIVVCGDDGVGKTSLVACLVKDQFIQNLQNCLPPVTIP
                     RDFSSSPFCPKSSILVDTTSYDLPALHRELKSADVIWLVYSDHETYDRVALYWMMMFR
                     SLGVNLPVVLCKNKCDDFSVESEPKSSVLSPSDDSLSDSTKVEDEEFIPILREFKEIE
                     TCIKTSAKDKFNVNQAFYLCQRAITHPIAPLFDSRVGELKPLTVLALKRIFLLSDKDQ
                     DGFLNDHELIVLQKRAFGKAIDKSELEFIKETLLNLSMPPQEYGSYTLYIPDKGITKD
                     GFLVLNKLYSEKGRHETTWGILRAFHYTDSLSISDKVLYPKMDITDTASVELSPLGYR
                     FLVELFLTFDKDNDGGLNEQEIDFLFKTTPGIPRLWAETNFPFSTVVNSQGFVTLQGW
                     LAQWSMTTFLDHKTTTEYLVYLGIEKDARLALQITKSRKKRRRNGKFYRALVTDRKVF
                     NCFVIGKPFSGKSSLLESFVGRSFLESYSPTIRPRIAVNSLELKGSKQYYLILQEFGE
                     QEPAILENVEKMKECDVLCLTYDSSDPESFSFLFELINQHKHLQELPMVFVALKADLD
                     KQQQRCYIQPDDFTDQLYIDHPLHVSSVWSSSLNELFIKLTEASLEPSINTPGIAPDI
                     VKEDINYWRYALVATSAVGFTSLFTFTFFKLFRSLRNEHS"
     gene            <86268..>87172
                     /locus_tag="KLTH0D00902g"
                     /db_xref="GeneID:8294983"
     mRNA            join(<86268..86270,86342..>87172)
                     /locus_tag="KLTH0D00902g"
                     /product="KLTH0D00902p"
                     /transcript_id="XM_002552717.1"
                     /db_xref="GeneID:8294983"
     CDS             join(86268..86270,86342..87172)
                     /locus_tag="KLTH0D00902g"
                     /note="highly similar to uniprot|P21242 Saccharomyces
                     cerevisiae YOR362C PRE10 20S proteasome alpha-type
                     subunit"
                     /codon_start=1
                     /product="KLTH0D00902p"
                     /protein_id="XP_002552763.1"
                     /db_xref="GeneID:8294983"
                     /db_xref="GOA:C5DFY3"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DFY3"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKD
                     GIVLAVEKLVTSKLLVPGKNKKIQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKT
                     YATPIPLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDDDGAHLYMLEPSGTYWGY
                     KGAATGKGRQSAKAELEKVISNKPELDAREAVKEAARIIYLAHEDNKEKDFELEMSWC
                     SISETNGLHKAVPKDLLDEAIAFAKAENGDDSDSDDSSDESENEKDNEKKDAEGDVQL
                     E"
     gene            complement(<87310..>89439)
                     /locus_tag="KLTH0D00924g"
                     /db_xref="GeneID:8294984"
     mRNA            complement(<87310..>89439)
                     /locus_tag="KLTH0D00924g"
                     /product="KLTH0D00924p"
                     /transcript_id="XM_002552718.1"
                     /db_xref="GeneID:8294984"
     CDS             complement(87310..89439)
                     /locus_tag="KLTH0D00924g"
                     /note="weakly similar to uniprot|P39723 Saccharomyces
                     cerevisiae YAL047C SPC72 Component of the cytoplasmic
                     Tub4p (gamma-tubulin) complex binds spindle pole bodies
                     and links them to microtubules has roles in astral
                     microtubule formation and stabilization"
                     /codon_start=1
                     /product="KLTH0D00924p"
                     /protein_id="XP_002552764.1"
                     /db_xref="GeneID:8294984"
                     /db_xref="InterPro:IPR024545"
                     /db_xref="UniProtKB/TrEMBL:C5DFY4"
                     /translation="MVPLRGNSVQDSSGCLSANNTRSSDEGSTGTMSEADELDIPQFN
                     NSMTPWRKRDVAKESIYHQGSSSVSPTVGASAENGDGFSEGPLNLASPVNSRPHTRSS
                     LFSDGYTSSVPTMSASSSNEVEQLQRQLTACKLRLRALAEVIKELNYDRESHHFDEFP
                     NLPCSAKLVDTLPSCDKCAKLSKDLAELRQNLEAKDKELLSAKNDYSTVLDDVNSYLE
                     HSDVIASNIDDILQVLSEKLDISDEEKEVLCKARGISNNFIDVKINALGSTVRKFLDT
                     LSTAQIPEQFDKSLITVADNSQGNISQMDTRLESAIESMHEEYHNFLRSLQDRMDQSG
                     ETEKLLGDKLMKQQLLLEKLTELFHGRSISGVTAGVLSMDIHASDRAKSPDTQGSSSQ
                     TFPAPNVEIEEYKNRLEIQKNRVKELEEEIVAIEQRREKLDRGSAETGGVTEVEGRYK
                     EKELEWMNKIEDLMSQVSKSRTESQRLENVIAELQNELSAAQEESEKTIMDLEKTLKR
                     AVRNSGLYMGENREMQQHIKEIESELNSTIRHNSQLEESINEVTKDRSELENELLKLR
                     SHLILHLNKIFDVFDKILQRHSIDQAKKKLKNLDVLSSKNHHKAVHAKLESLYVFIES
                     AINSIVEEHAKLLLKEKKRSSHINVKDTEEGYGSQLHIELLERRWVAERERRKLDADA
                     AEYRISQLEDENRALRLKIRERFGHSQ"
     gene            <89863..>92082
                     /locus_tag="KLTH0D00946g"
                     /db_xref="GeneID:8294985"
     mRNA            <89863..>92082
                     /locus_tag="KLTH0D00946g"
                     /product="KLTH0D00946p"
                     /transcript_id="XM_002552719.1"
                     /db_xref="GeneID:8294985"
     CDS             89863..92082
                     /locus_tag="KLTH0D00946g"
                     /note="similar to uniprot|P06103 Saccharomyces cerevisiae
                     YOR361C PRT1 Subunit of the core complex of translation
                     initiation factor 3(eIF3) essential for translation part
                     of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates
                     binding of mRNA and tRNA(i)Met to ribosomes"
                     /codon_start=1
                     /product="KLTH0D00946p"
                     /protein_id="XP_002552765.1"
                     /db_xref="GeneID:8294985"
                     /db_xref="GOA:C5DFY5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DFY5"
                     /translation="MATSALEDIRIEDIPVDDVDFSDLEKKYEVESPVNFDNFVVVDG
                     APVAPESKVPVLTKVLTKLFSQAGSVVDINLPLDEEKKTTKGYLFVEFDSPASARKAI
                     KLLNGKKLDVKHRLFVNSLTDVEKFGTEDFDTEFHEPKLPEFQKTDYLQSWLQDEQGR
                     DQFVLQKGELTGVFWNRNTQQPENAVEPRTNWSNTTVKFSPKGTYLFSFHNQGVASWG
                     GRNFERLRRFFHPQAKALAISPTEKYLVTLSPEPIVVPEDAPEDFPFGPESNGHQLCV
                     WDIATGLSVKTFALPPNQRLHWPMIKWSFDDKYCARLGPNALAVYDAENNFELLGGRI
                     MKIEGIQDFSFAPAGAKLAVNRNGELSSVLAFWTPESNNQSCKATVMEIPTRRVLRTV
                     NLVQVSDVTLHWQNQAEYLCVKVDRHTKSKKTFFSNLEICKLTEKDVPVEKVEMKDLA
                     VRFAWEPKGHRFVTISTTETADDNPSIPKNVVTFFAPEQKEKTNVAVKAEPKKWKAFA
                     SVPGKFSNTISWSPAGRFVVVATLVTPDTRKADFDFYDFDFTGDKNDNDSDDVAANLK
                     AVAHPEFYSATDMQWDPSGRFVAVWSSAVKHKLENGYKVFNVAGECVREEMIEAFKNF
                     VWRPRPESLLTNGEKKKVRKNLREWSAQFEELDAMQADSAMRELILSRRSMLEGWTQY
                     RQDRAALMEEEYNYKVFDQVEHSTADEDYEVVEEIKEEILEEKEEEVTSFEEPTSSE"
     gene            complement(<92187..>92450)
                     /locus_tag="KLTH0D00968g"
                     /db_xref="GeneID:8294986"
     mRNA            complement(<92187..>92450)
                     /locus_tag="KLTH0D00968g"
                     /product="KLTH0D00968p"
                     /transcript_id="XM_002552720.1"
                     /db_xref="GeneID:8294986"
     CDS             complement(92187..92450)
                     /locus_tag="KLTH0D00968g"
                     /note="highly similar to uniprot|P39724 Saccharomyces
                     cerevisiae YAL046C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D00968p"
                     /protein_id="XP_002552766.1"
                     /db_xref="GeneID:8294986"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:C5DFY6"
                     /translation="MLARVARRLLSFTPEEKLVYEKLTKQLKPQQIEVRDISGGCGSM
                     FAIDITSEKFKGLSMVKQHKLVNKVLQDDIKRWHGLQLRTRSE"
     gene            <92563..>92928
                     /locus_tag="KLTH0D00990g"
                     /db_xref="GeneID:8294987"
     mRNA            <92563..>92928
                     /locus_tag="KLTH0D00990g"
                     /product="KLTH0D00990p"
                     /transcript_id="XM_002552721.1"
                     /db_xref="GeneID:8294987"
     CDS             92563..92928
                     /locus_tag="KLTH0D00990g"
                     /note="similar to uniprot|Q3E793 Saccharomyces cerevisiae
                     YAL044W-A Similar to pombe uvi31 putative DNA repair
                     protein"
                     /codon_start=1
                     /product="KLTH0D00990p"
                     /protein_id="XP_002552767.1"
                     /db_xref="GeneID:8294987"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:C5DFY7"
                     /translation="MLLLKTLARSMSTAANRSTSGPIAQSITNKVRQQFPDLQHFALF
                     NDSYKHAGHHGMAEAENRIESHFRIEVVSGAFEGLTLPKRHRLMYTLLDEELQKGVHA
                     LQLQTRTPAEQERKNQRAE"
     gene            complement(<93016..>93540)
                     /locus_tag="KLTH0D01012g"
                     /db_xref="GeneID:8294988"
     mRNA            complement(<93016..>93540)
                     /locus_tag="KLTH0D01012g"
                     /product="KLTH0D01012p"
                     /transcript_id="XM_002552722.1"
                     /db_xref="GeneID:8294988"
     CDS             complement(93016..93540)
                     /locus_tag="KLTH0D01012g"
                     /note="similar to uniprot|P39726 Saccharomyces cerevisiae
                     YAL044C GCV3 H subunit of the mitochondrial glycine
                     decarboxylase complex required for the catabolism of
                     glycine to 5 10-methylene-THF expression is regulated by
                     levels of levels of 5 10-methylene-THF in the cytoplasm"
                     /codon_start=1
                     /product="KLTH0D01012p"
                     /protein_id="XP_002552768.1"
                     /db_xref="GeneID:8294988"
                     /db_xref="GOA:C5DFY8"
                     /db_xref="InterPro:IPR002930"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR017453"
                     /db_xref="UniProtKB/TrEMBL:C5DFY8"
                     /translation="MIRTCAQSTLRASSRLSAISPRLFLRAQSSNALTKTQPPFTFSK
                     SGPSSVKYTSQHEWIAAHQDGTAFVGITKYAADALGDATYIELPEADSELEAGDSLGS
                     VESVKSASEVYQPLAGTVLEGNESLNDTPQLINEDPMGEGWIAKVRLNDLADMNGEEL
                     MSLEQYEESLKEDH"
     gene            <94778..>96259
                     /locus_tag="KLTH0D01034g"
                     /db_xref="GeneID:8294989"
     mRNA            <94778..>96259
                     /locus_tag="KLTH0D01034g"
                     /product="KLTH0D01034p"
                     /transcript_id="XM_002552723.1"
                     /db_xref="GeneID:8294989"
     CDS             94778..96259
                     /locus_tag="KLTH0D01034g"
                     /note="similar to uniprot|P06776 Saccharomyces cerevisiae
                     YOR360C PDE2 High-affinity cyclic AMP phosphodiesterase
                     component of the cAMP-dependent protein kinase signaling
                     system protects the cell from extracellular cAMP contains
                     readthrough motif surrounding termination codon"
                     /codon_start=1
                     /product="KLTH0D01034p"
                     /protein_id="XP_002552769.1"
                     /db_xref="GeneID:8294989"
                     /db_xref="GOA:C5DFY9"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:C5DFY9"
                     /translation="MSSMATLFTVNSPELAPQLASRFKGHVVALTAVADLLARLYSDR
                     LSGADNYERDLYLVVYCEPKRSAQDASPPASSTLDTLSAAELAHLLEKQFPCFNLSVV
                     TPERAVPAIAELDNYRAKYTQRLTRVTTWMYAKRHDPCSVNMYSMISHLTQVRHSNTE
                     KPRRSYARLISSSLDLRKLIQLPQGKSDDHYWKLLTTWDFCALSLSTCELIWCSYLIL
                     KKLAIDADYVISDNDLFLLLLTLETSYHQGNKFHNFRHAVDVMQATWQLCCKLQLHFP
                     KDASVLLVCVAAIGHDLGHPGTNNALMCEENSPVAQLYQKASVLENFHTELFLDLLQD
                     HWPQLLEDRRNVISDTILATDMALHSQYIDQMDEAPSQQPTFLSLIIKAADISNVTRP
                     LEISAKWAVLITCEFNECAALVRELKEGSAEYDAYNTEYDQPLPESVDSILEKFPSIP
                     KGQLIFINAFAEGLFAGLGDYFEELKFLHHNVQANKKFWEGKL"
     gene            complement(<97316..>98434)
                     /locus_tag="KLTH0D01056g"
                     /db_xref="GeneID:8294990"
     mRNA            complement(<97316..>98434)
                     /locus_tag="KLTH0D01056g"
                     /product="KLTH0D01056p"
                     /transcript_id="XM_002552724.1"
                     /db_xref="GeneID:8294990"
     CDS             complement(97316..98434)
                     /locus_tag="KLTH0D01056g"
                     /note="some similarities with uniprot|Q08831 Saccharomyces
                     cerevisiae YOR359W VTS1"
                     /codon_start=1
                     /product="KLTH0D01056p"
                     /protein_id="XP_002552770.1"
                     /db_xref="GeneID:8294990"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ0"
                     /translation="MFKEESMSFPPRVHSPVGMPRRAHPGAVLLSPQASAMNNSHSTG
                     PGNSGVSQLPLSPQLSSQHLSLNDLLDQQQNMLVDSQRAAAGPAVVSPMLQPSSSMFL
                     DTFTRPASSGAQVPAPQHNSMVNFAHDLNQLCSWMAMLSTSQQNSVMDNLLSSLNEEV
                     LQHTKLKLDSLISSGYISPSVRSPQVIAPMPDRGPTPQPLTLDSLLNNNMDHHMSRQW
                     SPIPQNPSNSQPIYDYINDLTHRPRSADPQLRRKMGSSGKPVQKKSPTQPKPNPHNGL
                     SSPTGSNGSSASSSMNPKTLTDPKLLNNIPAWLKSLRLHKYSDALSGKPWAELVYLED
                     DALESMGVSALGARRKLLKAFAVVRDYKERGLIDANAY"
     gene            complement(<99148..>101307)
                     /locus_tag="KLTH0D01078g"
                     /db_xref="GeneID:8294991"
     mRNA            complement(<99148..>101307)
                     /locus_tag="KLTH0D01078g"
                     /product="KLTH0D01078p"
                     /transcript_id="XM_002552725.1"
                     /db_xref="GeneID:8294991"
     CDS             complement(99148..101307)
                     /locus_tag="KLTH0D01078g"
                     /note="similar to uniprot|Q01329 Saccharomyces cerevisiae
                     YAL043C PTA1 Subunit of holo-CPF a multiprotein complex
                     and functional homolog of mammalian CPSF required for the
                     cleavage and polyadenylation of mRNA and snoRNA 3' ends
                     involved in pre-tRNA processing binds to the
                     phosphorylated CTD of RNAPII"
                     /codon_start=1
                     /product="KLTH0D01078p"
                     /protein_id="XP_002552771.1"
                     /db_xref="GeneID:8294991"
                     /db_xref="InterPro:IPR021850"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ1"
                     /translation="MSSEVLQLAQARELAMDNKPGEMLPKVLDTAMALHRSSRSPSVE
                     LGRLCAKLFLDVASHEAVVSSEKPFLASQHLGELWKLCSSSTDHSTLRDGILGLSRCY
                     DWLFDLVAKTSNKELWETLCQFRSFVLSKWKTVYPLTPSEDSLQDHSRSLGVKLATVK
                     FISTLVIVHTPGNSGISIASVPENHPVITGKSQLESGAKKLLGFLLSYLSEEPMMVAS
                     LFIGVLNCLAFVMKRRPQATYHILGGLLRFNVDMKYQQNAESVLQYRLAKRFVERCYK
                     VFVQFGLKSQLIKNSGNMAQYHAKLSKISQTLHIIGEETKAKGIMNFDPKQVERKMPS
                     RERAKYVTALKASNQNSSSRNNSTQPRMSPDMQLLTELQKYTMSKNSSAGFFNTSPIA
                     FDSTYASVYSLMNSKHSEIDVSKLSPAVMAKLCTECLYQTDTNKMISGLSIVASRYTD
                     LMNKASQATDNKKRPLEADTVQQPSKKREVVKQPEDEELSEDEDKQEFTLGAPAPMSE
                     EEKKQHFIRIVGHIMAVKDSEEEPGASNEVPVNMLHKVRLLDWNNKTSWLTLLTRLAS
                     RGVSHNEEMSNTARQAIYDYFIEDFGNRVAVVIEWLSEEWYYESLNNEKGETPVYDQW
                     SLKILDALIPFLEVSHRRLFIRLVSELPRLSQEHVDKIRSLCLDPLRGSLGFQSLKFM
                     VMFRPPVKPHIAKLLTSMKEQDESVREQCEAVLAKFY"
     gene            complement(<102765..>103181)
                     /locus_tag="KLTH0D01100g"
                     /db_xref="GeneID:8294992"
     mRNA            complement(<102765..>103181)
                     /locus_tag="KLTH0D01100g"
                     /product="KLTH0D01100p"
                     /transcript_id="XM_002552726.1"
                     /db_xref="GeneID:8294992"
     CDS             complement(102765..103181)
                     /locus_tag="KLTH0D01100g"
                     /note="similar to uniprot|Q02516 Saccharomyces cerevisiae
                     YOR358W HAP5 Subunit of the heme-activated
                     glucose-repressed Hap2/3/4/5 CCAAT-binding complex a
                     transcriptional activator and global regulator of
                     respiratory gene expression required for assembly and DNA
                     binding activity of the complex"
                     /codon_start=1
                     /product="KLTH0D01100p"
                     /protein_id="XP_002552772.1"
                     /db_xref="GeneID:8294992"
                     /db_xref="GOA:C5DFZ2"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR027170"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ2"
                     /translation="MDPHPEEEEIDVFRNVGQGLVGPYREITIQYWQELINEIEMTNE
                     PGSPHQDDFKSHSLPLARIKKVMKTDEDVRMISAEAPILFAKACEIFITELTMRAWCI
                     AEEHKRRTLQKSDIAQALLKSDMFDFLIDIVPRNIE"
     gene            <103352..>103834
                     /locus_tag="KLTH0D01122g"
                     /db_xref="GeneID:8294993"
     mRNA            <103352..>103834
                     /locus_tag="KLTH0D01122g"
                     /product="KLTH0D01122p"
                     /transcript_id="XM_002552727.1"
                     /db_xref="GeneID:8294993"
     CDS             103352..103834
                     /locus_tag="KLTH0D01122g"
                     /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
                     YOR357C"
                     /codon_start=1
                     /product="KLTH0D01122p"
                     /protein_id="XP_002552773.1"
                     /db_xref="GeneID:8294993"
                     /db_xref="GOA:C5DFZ3"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ3"
                     /translation="MRQFQSFSSSIESSLPQPHKQQSSSEIYAEPENFLEIEVTNPKT
                     HFPHPDHRGMFTDYELICRTNVPAFTKRMSRVRRRYSDFELFRKCLLKELSLSSHPKI
                     AVPHLPGKILLGNRFNDEVIQERMQSLNKWMIAVAGHPLLQSGSKVLVRFVEDEKFTG
                     "
     gene            <104099..>105307
                     /locus_tag="KLTH0D01144g"
                     /db_xref="GeneID:8294994"
     mRNA            <104099..>105307
                     /locus_tag="KLTH0D01144g"
                     /product="KLTH0D01144p"
                     /transcript_id="XM_002552728.1"
                     /db_xref="GeneID:8294994"
     CDS             104099..105307
                     /locus_tag="KLTH0D01144g"
                     /note="similar to uniprot|P39727 Saccharomyces cerevisiae
                     YAL042W ERV46 Protein localized to COPII-coated vesicles
                     forms a complex with Erv41p involved in the membrane
                     fusion stage of transport"
                     /codon_start=1
                     /product="KLTH0D01144p"
                     /protein_id="XP_002552774.1"
                     /db_xref="GeneID:8294994"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ4"
                     /translation="MKKSKLLSIDAFAKTEEDVRIRTRTGGLITLSCVVVTFLLLLSE
                     WFHLKEVVTRPQLVVDRDRHLKLDLNMDITFPHIPCYLLNMDIMDSAGEMQLEVLNKG
                     WSKTRLDPSGQVLDTKQFKPGKDVVDYAPEDENYCGPCYGARDQSKNDEVNVDERVCC
                     QTCDDVREAYAEKQWAFFDGKNIEQCEREGYVEQVNEHIEEGCRIKGMAKLNRIGGNL
                     HFAPGKGFHNIRGHFHDASLYQNSPSLNFNHIIHHLSFGKEVEDITGQGASTAPLDGT
                     NVSPEFDTHKHQFSYFAKIVPTRYEYLSGETVETTQFTTTYHSRPLKGGRDSDHPTTL
                     HSQGGFPSVYFYFEMSPLKVINKQQYAQSWSGFWLNCITSIGGVLAVGTVLDKITYKA
                     QRSMWGKKST"
     gene            <105674..>107905
                     /locus_tag="KLTH0D01166g"
                     /db_xref="GeneID:8294995"
     mRNA            <105674..>107905
                     /locus_tag="KLTH0D01166g"
                     /product="KLTH0D01166p"
                     /transcript_id="XM_002552729.1"
                     /db_xref="GeneID:8294995"
     CDS             105674..107905
                     /locus_tag="KLTH0D01166g"
                     /note="some similarities with uniprot|P11433 Saccharomyces
                     cerevisiae YAL041W CDC24 Guanine nucleotide exchange
                     factor (GEF or GDP-release factor) for Cdc42p required for
                     polarity establishment and maintenance and mutants have
                     morphological defects in bud formation and shmooing"
                     /codon_start=1
                     /product="KLTH0D01166p"
                     /protein_id="XP_002552775.1"
                     /db_xref="GeneID:8294995"
                     /db_xref="GOA:C5DFZ5"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010481"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ5"
                     /translation="MAIQSQSTVSLPTSVTQSTQSLLNRKVSTEDSLYHICLTIQKRL
                     ELLPQIRPYLNLAHASSELLSERQALLLSQKQQLSQQHHRSVGSAMSGNSGAAGVKNG
                     LDRRISSLSASSFNEDPEASSISVEETVVTFSMGILPISMDCDPVTQLSQLFQQGSPL
                     CIIFNAVKPQYKLPVVSSDDLKICKKSIYDFILACKKYFTFSDEELFTISDVFSNDTE
                     HFIKVLDVVKTLMDSAPQVLPQIPVEHIKWSNTDRGKVVREFIETERKYVYDLEILNQ
                     YRNQLLQRGIINSEELYMLFPNLSDIIDFQRRFLISMEINGQVDPSKQRIGALFMHSK
                     HFFKLYEPWSIGQNAAIDFISSSFDKMAGSDFVIGNKLELQSFLLKPVQRLCKYPLLL
                     KELLQQAKDSANYKELELAWEISKSIARSINENQRRTENHEVVKKLYDRVVNWKGYRI
                     AKFGELLYFDKVAISTGNGNESEHEFEVYLFEKIIILFSELVQKKGNSISLKKKASSA
                     STITLQHMSGSGNNLNSHGSSGDSKLDLRGRIMIVNLNQVSPIDNRSLSIIWESPKEQ
                     GNFVLKFKNEETRDNWCSSLQSLLRQIRSESLKSSNSDRSSFSSNTYYPHYSMNSINS
                     SQNRRISDVLPKQHTHQSFENEYRSISENYRTSIPESTLLVRISYQNDFYTVLVEVDS
                     GIDNMLQIVKRKLTHVGNISKIKYQDEDGDYVMLESEDDWNVVKDMLRESSERILNVW
                     AHA"
     gene            complement(<108037..>109977)
                     /locus_tag="KLTH0D01188g"
                     /db_xref="GeneID:8294996"
     mRNA            complement(<108037..>109977)
                     /locus_tag="KLTH0D01188g"
                     /product="KLTH0D01188p"
                     /transcript_id="XM_002552730.1"
                     /db_xref="GeneID:8294996"
     CDS             complement(108037..109977)
                     /locus_tag="KLTH0D01188g"
                     /note="similar to uniprot|Q08822 Saccharomyces cerevisiae
                     YOR356W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D01188p"
                     /protein_id="XP_002552776.1"
                     /db_xref="GeneID:8294996"
                     /db_xref="GOA:C5DFZ6"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ6"
                     /translation="MLKSRLLRLGQRFPTNRRAIASALPCFKTCCNVKPQVSYRRSFS
                     TTTVKRQSVEVPFGKLTDEEQAALSEERAVDKVDVCIVGGGPAGLATAIRFKQLDNLQ
                     GTGELRVVVLEKSPDMGSHMVSGVIMEPRALRELFPESEFYDESGNGIPLPPSLVTPV
                     ASGQLKYLIGDFDLPVPEPPQMKNEGNYIGSLSQVVRYLAEKAEEVGVEIYPGISVSE
                     VVYNDEGTAVVGVATKDMGISKEGKPKPSFERGMEFHARQTVFAEGCHGSLTKQIIKK
                     FDLRKGRANQTYGLGIKEVWEIRPENFQKGFASHTMGYPLSNEVYGGGFIYHFGEGLA
                     AVGLVVGLDYRNPYISPYQEFQKMKHHPYYKKFLEGGKCIEYGARALNEGGLQSVPKL
                     NFPGGVLVGASAGFMNVPKIKGTHTAMKSGMLAAEAMFDSISKIPSIAELEERGIEKV
                     VESPINLNSYEKAFKNSWVYDELYEVRNIRPSFNHALFGRLGGMAYSGIDSLLLRGQV
                     AWTFNHHESDAFLTDPAEKYEPIDYPKPDNKISFDILTSVSRTGTFHNEDEQCHLRLP
                     DQDLQKHAEKAYPKWKGIESRFCPAGVYEYVPDETSPLGVKFQINGQNCIHCKTCDIK
                     VPTQDINWVVPEGGDGPKYTLT"
     gene            complement(<110551..>111846)
                     /locus_tag="KLTH0D01210g"
                     /db_xref="GeneID:8294997"
     mRNA            complement(<110551..>111846)
                     /locus_tag="KLTH0D01210g"
                     /product="KLTH0D01210p"
                     /transcript_id="XM_002552731.1"
                     /db_xref="GeneID:8294997"
     CDS             complement(110551..111846)
                     /locus_tag="KLTH0D01210g"
                     /note="similar to uniprot|P41913 Saccharomyces cerevisiae
                     YOR355W GDS1 Protein of unknown function required for
                     growth on glycerol as a carbon source"
                     /codon_start=1
                     /product="KLTH0D01210p"
                     /protein_id="XP_002552777.1"
                     /db_xref="GeneID:8294997"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ7"
                     /translation="MALTNSRPLQMPALENEALHNSASPVFQPSSLRSSARSSCSEST
                     SEMDHALSTSDTSEGASDTRLTRKDVLALKRSATASPLTPTGAVSELSKLVPVTGQRP
                     KPTKKDLFMDDDILLAIFVILYEKDPNQEGVTVKQLCDYLVDKHPDMAGASTKLSNLI
                     SAKLNAYVKKVEKGEKTLKYALSRQWSEGSPRRMVYVYRGILAPDYKSHTQSMSSQRQ
                     DAKQTGKSTTSSSKKAHGLSNNATDANMDYSLTESKVSNQAKGTFSINNNSFTINSFG
                     SDFNIPYAASPVTMRMMPNLAPNAFQDDQLSKAARDRRPKTSLSGPPSKKPNLQASPV
                     VPPYITAAAAAPRLSKGVPKRNAASGELLNAAASSIQKLTAFPKQGEASCITDIALVP
                     LAPTTTCPSWLQTIQSGFLLEDIESPEAVSLEDLDGLLG"
     gene            complement(<112790..>114400)
                     /locus_tag="KLTH0D01232g"
                     /db_xref="GeneID:8294998"
     mRNA            complement(<112790..>114400)
                     /locus_tag="KLTH0D01232g"
                     /product="KLTH0D01232p"
                     /transcript_id="XM_002552732.1"
                     /db_xref="GeneID:8294998"
     CDS             complement(112790..114400)
                     /locus_tag="KLTH0D01232g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D01232p"
                     /protein_id="XP_002552778.1"
                     /db_xref="GeneID:8294998"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ8"
                     /translation="MSKRPLNTNVIDGSKRPSSLNSEICNSYPGYCPGFGSVTVDEIN
                     VPSSKEEIDLFYQNYVLRRRPCKFKGVSSKEVLSEPLSPLNLVKTLPEQTILQVERKV
                     QGGFGSGEKRLKMTLGELVERLRSGDEQLYLTTQYAEDDPDRDDASDVGENTEEYAED
                     DDDNEDDTKETDGGFGSAGDISDAGSFDFSNAHDDFEDLNGAESMDGESHDSKDVIAQ
                     LSTGPLTQFEADARVKELYQPPMDNLIEQLPETPSFLNSLIPQQINLWVGSSGNIGSS
                     DKFLEGFDPSAPKLGLGRAIPGGGSSSGLHHDHADNIYVPISGRKRFTLFSPRDAAKM
                     YTVGTIRKVYDSGVIDYARCETAPFWRTLRDDGAIEAEVAKNELEFNSSLTADQRQNL
                     ERVIEADSVCSSSIDSKLDPPSFSSIIPTVVHLDKVKDEGLRAEIKKVALEKWPMFFE
                     ANRLTVDLRPGEMLYLPTGWFHEVTSFGNEQTASADDRIHVAVNYWFIPPNGSSQDQL
                     YAHEDQYWQKDYERTKAALEHARFCSKD"
     gene            complement(<115317..>116630)
                     /locus_tag="KLTH0D01254g"
                     /db_xref="GeneID:8294999"
     mRNA            complement(<115317..>116630)
                     /locus_tag="KLTH0D01254g"
                     /product="KLTH0D01254p"
                     /transcript_id="XM_002552733.1"
                     /db_xref="GeneID:8294999"
     CDS             complement(115317..116630)
                     /locus_tag="KLTH0D01254g"
                     /note="weakly similar to uniprot|P13365 Saccharomyces
                     cerevisiae YAL040C CLN3 role in cell cycle START involved
                     in G(sub)1 size control G(sub)1 cyclin"
                     /codon_start=1
                     /product="KLTH0D01254p"
                     /protein_id="XP_002552779.1"
                     /db_xref="GeneID:8294999"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C5DFZ9"
                     /translation="MPESTLAEMAAVRLSVWNSRAAHPRVVQMELLAHQLACQDYSVD
                     ILRHLIDIEQASRPCLASFQAQPEINVHMRTLIFDFAMCCHTRLGLSTSTLYLCFSVI
                     DRYCSRIVVKSSTYQLVALCGLWLASKYIDRKPRVPSLRALQNLCCNQYSRSQFQDME
                     LHILKALNWSPCNAPPHDVFVDILLKNKISSLSYKGLHLNDLKYGSCMLCELACFEHV
                     LAFDYNASAVALAAVTITTHALRLSVDGQFVHYSSMLKDANLQRVCDLILRKLRSRNF
                     PSSFKLKYLGQNKLESNPILRSLLEYELMIAPPIPVQAVKKPAYASFSPSKPGSCANV
                     SPAPSLGFQDSFAGTSFRSPRVVAPPTPCSPSNLSSNSVPKVKTPHLNLSPGTIGSGK
                     QYEVSQARATAVRPTMFRRNESKRNSDIMEPDFFDMAANSNKRAR"
     mobile_element  complement(118691..120631)
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
                     /mobile_element_type="transposon"
     gene            <122364..>124418
                     /locus_tag="KLTH0D01298g"
                     /db_xref="GeneID:8295000"
     mRNA            <122364..>124418
                     /locus_tag="KLTH0D01298g"
                     /product="KLTH0D01298p"
                     /transcript_id="XM_002552734.1"
                     /db_xref="GeneID:8295000"
     CDS             122364..124418
                     /locus_tag="KLTH0D01298g"
                     /note="weakly similar to uniprot|Q08818 Saccharomyces
                     cerevisiae YOR354C MSC6 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to
                     mitochondria msc6 mutants are defective in directing
                     meiotic recombination events to homologous chromatids"
                     /codon_start=1
                     /product="KLTH0D01298p"
                     /protein_id="XP_002552780.1"
                     /db_xref="GeneID:8295000"
                     /db_xref="UniProtKB/TrEMBL:C5DG00"
                     /translation="MIPRSIKSNSALSIRARLRARWNSSAAAPAPAVHPVSQLSREVS
                     KELTDRRSSLAAFDLFKTKVNDLSQTLSNSQYTLQRSFGLNSALTQLLQASKAELAGR
                     AGSGGPAADSGRQLPPDPFEILTVMCEYGLARDAHFQVVLEHLVAANRPQEVLGLWVK
                     YLETLAENPKAVTYGSHHANNVALASVGYLQLPGNSPKLAELAQILNLAEKEDQIPIL
                     RIRYLVDTLKLGSAVRSSVIENFGALLLEFSHACQAEFRRQLLSMEQVADLQKLFTAL
                     TSAAEKSSQGLDASNVALFMDAFIGCKKPQQAIKCFNVAKEKNCVGEPVKNSLLIAVA
                     NLPVYGKDMRDQKAKRIEAVWNSYISEAPEKISVSSYTALLAALGESRNFNKLQQLWS
                     SEIPKELKSDQDLLETHLLFQCYKRDFSFEKMRDQIPEKLRSIKLANEILFKMAQEKV
                     PENVITEFYRQQFVDASAPLKPDSKSLALKMYINFLYTKDPEFQFMKSISKSKNDVNT
                     TNLIFKRFVEFCPDIEITKKLFDEIKYPLDSRKYGYMITAESRAGDITACEEIFKKFV
                     QETKNPSTITRAILDPIVDAACEQCVAEKSAASLEKAHIYATFAKKAQKMLSFQSASK
                     IIHTLALLVRSLDGKLSPQQDEAVKKLLEDVHSVKNFSPSTRDLETLTRHKVSLPDGM
                     QQ"
     gene            complement(<124574..>125463)
                     /locus_tag="KLTH0D01320g"
                     /db_xref="GeneID:8295001"
     mRNA            complement(join(<124574..125362,125428..>125463))
                     /locus_tag="KLTH0D01320g"
                     /product="KLTH0D01320p"
                     /transcript_id="XM_002552735.1"
                     /db_xref="GeneID:8295001"
     CDS             complement(join(124574..125362,125428..125463))
                     /locus_tag="KLTH0D01320g"
                     /note="similar to uniprot|P06182 Saccharomyces cerevisiae
                     YAL039C CYC3 Cytochrome c heme lyase (holocytochrome c
                     synthase) attaches heme to apo-Cyc1p in the mitochondrial
                     intermembrane space human ortholog may have a role in
                     microphthalmia with linear skin defects (MLS)"
                     /codon_start=1
                     /product="KLTH0D01320p"
                     /protein_id="XP_002552781.1"
                     /db_xref="GeneID:8295001"
                     /db_xref="GOA:C5DG01"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:C5DG01"
                     /translation="MGWFWADSGKNSTSGNKITDKPSECPLGHSTSKVTSGADGCPVL
                     HGSNAQNEINPFNNMPKNLSHEKHIGQKLELPKDRTTSSIPKGNPGEEEFWEYPSPQQ
                     MYNAMIRKGKIDPNTGEEIPEDAVESMVFVHNFLNEGCWQEILDWEKKYSEQTEMEPK
                     LLQFMGKPSQLSPRARCFSILGTLFPSKFSAELPFDRHDWVVLRPDPTSSDTKNPGFR
                     QVRYVIDFYGGPDDEDGLPTFNLDVRPALDNFTNAKDRFTRWTEPIIQEYFGSDKK"
     gene            <126137..>128377
                     /locus_tag="KLTH0D01342g"
                     /db_xref="GeneID:8295002"
     mRNA            <126137..>128377
                     /locus_tag="KLTH0D01342g"
                     /product="KLTH0D01342p"
                     /transcript_id="XM_002552736.1"
                     /db_xref="GeneID:8295002"
     CDS             126137..128377
                     /locus_tag="KLTH0D01342g"
                     /note="similar to uniprot|Q08817 Saccharomyces cerevisiae
                     YOR353C SOG2 Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0D01342p"
                     /protein_id="XP_002552782.1"
                     /db_xref="GeneID:8295002"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR019487"
                     /db_xref="UniProtKB/TrEMBL:C5DG02"
                     /translation="MNCHEHTWSPYSSHQRNQAKGYVRTALSFGLMDGRGDILSNLRQ
                     NVDRRNNLAFLASKQVSQRDPTIKLIDLGITSLTQETIDLLLSVERLSLQKNLLTSLP
                     EGFNKLAELRYLDLHDNKLQEIPATLMQCQRLEILDLSSNYITHLPHEYSRVWCENIK
                     VLSLKNNSVSSIRELYPAIMSLRSLKILEIEGNQFPAEELEQIKSEVPPSSLPDSVSP
                     DEYWCVALRKHFSDNKISKAAKRRGFINVSEEQHRQEELYSNNKYNDYFKRLSVLPEE
                     TTSQRVTQDELVVACRKLLFSFTECQQSIRKITSLCEDKAVAVNSVSLLYSVRSHIDN
                     LVELLEQSESPTSAKNDVMVKLCLTIISIFKQIFALLRKNFKSFFQGNDICFARIFYM
                     NILCSYTEMYNAWSQITPQDSIAPVKKRIARTHSLSVSQGFKHITPRSRSNTLQRSAT
                     GNSAHPTTSPIPQSSNLRSAPGSVMTTPPPSQSNLAGEVRAANDGSPSFKPDLTQQSP
                     HAGRRAADVPPQAGTPAVPVVDNKMGPEDQGSADIDAQLYHTLNTVISMVTVVYSQLT
                     SAITKSAIASTKTTEMSSITSSIAAKIKDLTDTCFQSMELSKLLKGRLSDVSLGKSEV
                     FSTTAEKAKTWESINAFLKSIISILANTKIIMKDLPILNEVRPNLASLAKITKDVTVI
                     LDLSSYRSISQAAQQQSQETATVKQQSHPQASGMLEESHNPILVTPLSTPSLVTVHAS
                     NPFDQF"
     gene            complement(<128407..>129288)
                     /locus_tag="KLTH0D01364g"
                     /db_xref="GeneID:8295003"
     mRNA            complement(<128407..>129288)
                     /locus_tag="KLTH0D01364g"
                     /product="KLTH0D01364p"
                     /transcript_id="XM_002552737.1"
                     /db_xref="GeneID:8295003"
     CDS             complement(128407..129288)
                     /locus_tag="KLTH0D01364g"
                     /note="similar to uniprot|Q08816 Saccharomyces cerevisiae
                     YOR352W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D01364p"
                     /protein_id="XP_002552783.1"
                     /db_xref="GeneID:8295003"
                     /db_xref="UniProtKB/TrEMBL:C5DG03"
                     /translation="MIKTPDTPEHTGANEELNVDEIHEIDENDVEDLDLGYGNEDEQQ
                     NDRSSLKREASTDDDIVFDQKDEFVPQVNISSPFSSTANITRLRDSHSSAQGRLSMSQ
                     QSKFVSYCDDRLMEIQRKFVQSRGLAEENGYRELSPLLQDLKSLLDFIWYSIEGIPNT
                     ELLLKQNLDDMLARQFANTRSTNFGQTYYLIRVADDFLDYLTKFDLTHLKVEEQQKTV
                     AKVFKFLMILDKVFAKCLEGLIPGNLKMNGTEMVRISGIAERTRMVLPQYLEQQKIHG
                     YHYEVSKVYEETLERCA"
     gene            <129448..>130974
                     /locus_tag="KLTH0D01386g"
                     /db_xref="GeneID:8295004"
     mRNA            join(<129448..130053,130132..>130974)
                     /locus_tag="KLTH0D01386g"
                     /product="KLTH0D01386p"
                     /transcript_id="XM_002552738.1"
                     /db_xref="GeneID:8295004"
     CDS             join(129448..130053,130132..130974)
                     /locus_tag="KLTH0D01386g"
                     /note="similar to uniprot|P24719 Saccharomyces cerevisiae
                     YOR351C MEK1 Meiosis-specific serine/threonine protein
                     kinase functions in meiotic checkpoint phosphorylates
                     Red1p interacts with Hop1p required for meiotic
                     recombination and normal spore viability"
                     /codon_start=1
                     /product="KLTH0D01386p"
                     /protein_id="XP_002552784.1"
                     /db_xref="GeneID:8295004"
                     /db_xref="GOA:C5DG04"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DG04"
                     /translation="MAVNTFESLRGQVLGVLEPLPVYRNQDVNENFAAVPIFKNKLVK
                     IGRNSRECDIIFPHPSISSIHCMFWAIRFDDDSVPMHYVKDCSLNGISINGLLLKRGQ
                     TCLLEDEDVIAIPNACEYRFQAKIKMLTSDLIEQLGFQVNVENWRLTSKVVGSGTFGH
                     VLVANEKAEPTRHQPRSYAVKIIKMKPNRLDKEAKILLRLDHPNVIKVHMTFSDDRNH
                     LYIFQDLITGGDLFSYLAKTDCLSPIPETEALVIIFQILHALKYLHSQGVVHRDLKLD
                     NILLCTPEPCTRIVLADFGIAKDLSTKHSRMHTVVGTPEYCAPEVGFKADRAAYKEFS
                     RAATMEQHGYDAKCDLWSLGVIAHIMLTGISPFYGDGSEASIICNAKIGNLDMSTKQW
                     TKVSEHAKSFVRSLLETNVTKRLDSSRSFQHPWIAKHKGHLEKIYQKKIIPDSEPRQS
                     FEETNWKRKLPKSVKLSPTSVMNKKARKLELS"
     gene            <131435..>133357
                     /locus_tag="KLTH0D01408g"
                     /db_xref="GeneID:8295005"
     mRNA            <131435..>133357
                     /locus_tag="KLTH0D01408g"
                     /product="KLTH0D01408p"
                     /transcript_id="XM_002552739.1"
                     /db_xref="GeneID:8295005"
     CDS             131435..133357
                     /locus_tag="KLTH0D01408g"
                     /note="weakly similar to uniprot|P24720 Saccharomyces
                     cerevisiae YOR350C"
                     /codon_start=1
                     /product="KLTH0D01408p"
                     /protein_id="XP_002552785.1"
                     /db_xref="GeneID:8295005"
                     /db_xref="InterPro:IPR025694"
                     /db_xref="UniProtKB/TrEMBL:C5DG05"
                     /translation="MLKKKGAPLSLQNFAAKILGGDKLVKQLENGSLKTASTKALSRS
                     DVWLREALVNTATTRRSYTLPHSGAIYPSRSIDVSLNVILSTLRRLRFANDAGGYFIL
                     LNRIKSSRVRWVSSSGKPIAGNVPVELYREVSHMLRAKSSGFQREELVCLAKFTLKLL
                     RDYNEIVAFRRPLKPDKIFLRNCADIVTRLGSMTFLNAFNNLIEHEDIKVYAMISFYL
                     QTKQIAHLVQFLESSNLGRDSLGLELASSLLLHCIREFVTLGLEDIACSTLELLLKKC
                     ALDLEKPLNDVKLIAEKFGAFKVQLAINKANDPELRSAFVPWKTFQKDLSFKDYINLF
                     DESEIDFYNETASMEFLSSKLPHHRMALEGWYHLFEETRPHPTASASLKAFHFNTILS
                     TVASTGSLGLVTLFWRHSIVKLGLTEDFLNSHNLISSRNCGGFHVILRSVGKSSSAKL
                     AGYQLFNFLKHDFKKLTSNHGVATFNLTNKDYFYLMQSATRGPNVSSVYFYLFHHLLD
                     AGDTCFSFGKDGSPSWQPGEPILSLIKSKFSKDWHLTGVGKIVERVGTWYKNEKDRGV
                     YSSHIQKDVLVDIFGPHFIQELSPKTLLQLESDSNNAMDAKSSSVYSLIADCENTERI
                     KETLGHLTQSIKGKLD"
     gene            complement(<133354..>136428)
                     /locus_tag="KLTH0D01430g"
                     /db_xref="GeneID:8295006"
     mRNA            complement(<133354..>136428)
                     /locus_tag="KLTH0D01430g"
                     /product="KLTH0D01430p"
                     /transcript_id="XM_002552740.1"
                     /db_xref="GeneID:8295006"
     CDS             complement(133354..136428)
                     /locus_tag="KLTH0D01430g"
                     /note="weakly similar to uniprot|P40987 Saccharomyces
                     cerevisiae YOR349W CIN1 Tubulin folding factor D involved
                     in beta-tubulin (Tub2p) folding isolated as mutant with
                     increased chromosome loss and sensitivity to benomyl"
                     /codon_start=1
                     /product="KLTH0D01430p"
                     /protein_id="XP_002552786.1"
                     /db_xref="GeneID:8295006"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DG06"
                     /translation="MEPQNAESILESIEEGVCGLGPLPELLKAIDQFQQDPSILEDRL
                     SEFITKLVDGFFTCRSEDQHRCSQVFYTFSKVCGIKKVMNHLSTDIFLLPKILEKLKD
                     SGDWQDSYLLLAWLKMVLMSPFKLENDSQIYKMTGKFKSLQALHPLVSAVHAELFAKN
                     IGLFRSSFSNETSDLYTVNFTLKAVLRQGQVHERQAVLDSAALNNLTSFCIDNADSAN
                     EIKLKLTFKTLPKLCKLHAAHRNWEAIEEIASWLLDSFNVPFTELRFQLAHNFAKIME
                     LLMALDPESASSLIESIVHDARHTLSSNPTNTIDEDTLHTQLLVIAESSRIKLLNPEL
                     VKLVTESIVPITIKFQQTKVNKISGHQIRDATNFVCWSLARNCDINSESENLFLNSLI
                     CSLLDRDLLIRKSSAAALQEILGRYGNTLLERENVMRVIELPNKNLETSYLQSVPQLF
                     KIFKEEDSRYSNALLDWLLDYNVLQSNDLHIVKLTCGLIRILLEKQDANYLPDCFWNR
                     VSESAALVFKGNDALRKCCFSYLATEAQLLKNDTVRKCCSEWLPSLLAVLSPRSPNPS
                     ERFKTLCVLKMLRSFSIENTGSFQIDVHTLDILFQIVRHRSISDRDYNEVKMCFVSLV
                     SILSCKKGETKVTTIVDSFKQKFETLIRQNNPLCCAGLAYIDPDQFIKVFRELCPHMD
                     CEARREVVSGISDRLLSIEAPRVLSILTATVDLLDDYTVTDRGDVGSLVRNSVVELIE
                     RHRDVFMQIDPALKSTVCSKLLRIAAEPNEKLRQKSFQVLTRGHDLNQGDSHDSAILN
                     FFQKYYQDKDTEFWVGFMFSAGAMYSTDQLIRTSIDSFLKFYEALSKERKLNLLNHLM
                     RILPSFSEIEAWQASKEHRNALGCQKKDLVKQALASITFWRRIFESGMDVDPAFNATG
                     AYAKFYNLHLIKKFAPLKLAVVRLMPFIAISFKRRAPHEDRMFANIVLKRLKTLACGA
                     KSKSQKLTQIQAMSLEGMVIIYLAFGDDKKVIELEEVSREGPKSLLTFQESI"
     gene            complement(<136785..>138086)
                     /locus_tag="KLTH0D01452g"
                     /db_xref="GeneID:8295007"
     mRNA            complement(<136785..>138086)
                     /locus_tag="KLTH0D01452g"
                     /product="KLTH0D01452p"
                     /transcript_id="XM_002552741.1"
                     /db_xref="GeneID:8295007"
     CDS             complement(136785..138086)
                     /locus_tag="KLTH0D01452g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D01452p"
                     /protein_id="XP_002552787.1"
                     /db_xref="GeneID:8295007"
                     /db_xref="GOA:C5DG07"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DG07"
                     /translation="MSFGKSFRSHFPFLDPSVTPVNHGSFGLTPGCVIEQQKRVSEAH
                     ESYSDRFHFSDAEHLYARQIQALARYLRLDPRNLALVTNATCGVNTVLRSIKWDFSRD
                     KVLVHSTSYTSCANTVKFLADYYGLQYDVVKLDYPIEDSDLLTRFHEKLATGNYRLCM
                     FDLISSMPGVMLPCEQLIQLCKQHDVLSLVDGAHGAGLVDLQFLDTLQPDFFTTNLHK
                     WLSAPKSCGLLYVNPKHHSTIQTLPISWNYSNQNCQYIPNPTTAEDRLQNENLMHNKF
                     WFVGTMNYAQYFSIEEALKFREETCGGEDRIREYQWQLQREAVPLIVAEFGPGARLLQ
                     NSTNTLAVAGMFNVNIPLPEKYSALKQKLASDPYYFMDFKQKCFALMFSRKAFLPFIY
                     HNGELWVRFSVQVYNELEDYKIGARSIKSAVMEVLDAEHGA"
     gene            <139116..>140990
                     /locus_tag="KLTH0D01474g"
                     /db_xref="GeneID:8295008"
     mRNA            <139116..>140990
                     /locus_tag="KLTH0D01474g"
                     /product="KLTH0D01474p"
                     /transcript_id="XM_002552742.1"
                     /db_xref="GeneID:8295008"
     CDS             139116..140990
                     /locus_tag="KLTH0D01474g"
                     /note="similar to uniprot|P15380 Saccharomyces cerevisiae
                     YOR348C PUT4 proline-specific permease (also capable of
                     transporting alanine and glycine) putative
                     proline-specific permease"
                     /codon_start=1
                     /product="KLTH0D01474p"
                     /protein_id="XP_002552788.1"
                     /db_xref="GeneID:8295008"
                     /db_xref="GOA:C5DG08"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DG08"
                     /translation="MKNLKCLASYRPPASYCKDTPVRLEPLRIVSAAAPTTFFHHLAS
                     YRHLNLAMSTPRDLKDAGETSIVDKQTGQVFELDTESLSALNTSGSPGSGAAAAGAEA
                     NGLKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNS
                     LGEMVCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVV
                     TYWTTAVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFW
                     GGGPTHDRLGFRYWQHPGAFAYHITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSS
                     EALDARRNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPF
                     VIAIQNAHIKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQ
                     GVPYYAVALSAAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAV
                     FFRGLYERVPFKSPLQPYGTYFFIVVVSLICLTNGYASFVNWNASDFVAAYITLPIFV
                     VLWVGHKIYTRTWSTWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKFEQWLL
                     "
     gene            <142438..>143943
                     /locus_tag="KLTH0D01496g"
                     /db_xref="GeneID:8295009"
     mRNA            <142438..>143943
                     /locus_tag="KLTH0D01496g"
                     /product="KLTH0D01496p"
                     /transcript_id="XM_002552743.1"
                     /db_xref="GeneID:8295009"
     CDS             142438..143943
                     /locus_tag="KLTH0D01496g"
                     /note="highly similar to uniprot|P00549 Saccharomyces
                     cerevisiae YAL038W CDC19 Pyruvate kinase functions as a
                     homotetramer in glycolysis to convert phosphoenolpyruvate
                     to pyruvate the input for aerobic (TCA cycle) or anaerobic
                     (glucose fermentation) respiration"
                     /codon_start=1
                     /product="KLTH0D01496p"
                     /protein_id="XP_002552789.1"
                     /db_xref="GeneID:8295009"
                     /db_xref="GOA:C5DG09"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:C5DG09"
                     /translation="MESRLGWLSNLQTDTGSNLRRTSIIGTIGPKTNSPETLVALRKA
                     GLNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNEVDY
                     PIPPNHEMIFTIDDKYAKSSDDKIMYIDYKNITKVIEKGRVIYVDDGVLSFEVLEVVD
                     DKTLKVKSLNAGKICSHKGVNLPGTDVDLPALSEKDKADLRFGVKNGVHMVFASFIRT
                     ANDVKTIREVLGEDGKDIKIIVKIENQQGVNNFDEILEVTDGVMVARGDLGIEIPAPQ
                     VLAVQKKLIAKCNLAGKPVVCATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSG
                     ETAKGNYPINAVTMMAETALMAEQAIPYIPTYDDLRNCTPKPTSTTETIAAAAVASVF
                     EQRAKAIIVLSTTGSTPRLVSKYKPNVPIILVTRNPRTARISHLSRGVFPFVYEKGTE
                     SDWTKDVESRLQFGIEQAKEFGMLKEGDTIVTIQGFAAGVGHSNTLRVLTV"
     gene            complement(<144017..>147001)
                     /locus_tag="KLTH0D01518g"
                     /db_xref="GeneID:8295010"
     mRNA            complement(<144017..>147001)
                     /locus_tag="KLTH0D01518g"
                     /product="KLTH0D01518p"
                     /transcript_id="XM_002552744.1"
                     /db_xref="GeneID:8295010"
     CDS             complement(144017..147001)
                     /locus_tag="KLTH0D01518g"
                     /note="similar to uniprot|P12689 Saccharomyces cerevisiae
                     YOR346W REV1 Deoxycytidyl transferase forms a complex with
                     the subunits of DNA polymerase zeta Rev3p and Rev7p
                     involved in repair of abasic sites in damaged DNA"
                     /codon_start=1
                     /product="KLTH0D01518p"
                     /protein_id="XP_002552790.1"
                     /db_xref="GeneID:8295010"
                     /db_xref="GOA:C5DG10"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012112"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:C5DG10"
                     /translation="MDYEELAQLLSDASSLDASPQEPPPPPPPDSPLRLYDSSRGAIA
                     RERSQRPFSQQQRLLSTLDDDSLVGLVNTFDRPTQRARLRRPAAPADDAADAEDDPCI
                     VTSSPEPPSSVVPSTPPASSRLSESDSSSDRSRSSSPTAARVGPLKFGDYAQYFSDKT
                     AHQHSRDEYMRKLYQDALNGGREYPPIFKDCTIYINGRTFPDRLQLHQKIIIHGGSFK
                     HFLSGKKSVTHIVASNLTAKKRIEFQNYKVVAPAWITESIAASKRLPWQDYALITGEY
                     GQQKLQIARPPAAALPAPEQQPADGFDANSLDCKQPGFLQSFFAKSRLHQLSAWKADL
                     RALFCEKYVEGAHLQPPPKGARLAIFHVDFDCFFATVSALSDARYDLSRDPLAVAHGN
                     NSSEIASCNYVARSFGVKNGMWVRSARRLCPNLICLPYNFEQYEVNSKLLYQILAGSG
                     FFQMILPISIDEAICVKYLDGLPDGDASAHQQCEAITRQIRRDVFDATNGCTVSIGCS
                     NSLVLARLALKKAKPNGQCVMASLEQDSIDAFIEELPLRDLPGVGATIVDKVQQHILF
                     EQTAEPTIGDLKRNSSLQLLASKLGTKTGHKLHLFLSGKDDEENSRVLRDPLDYFARK
                     SISVDINYAIRFDTIHEIDEFIDRICEHLTTKLGELDMVTPQVTLKVTRRCEHAPIEP
                     AKYLGSGECDTFSRSSRFGVPTCEAGLISTEVKSSFRMLGCPPKDLRGIAVQLNKLEK
                     VSDRVCQLRLPFREQDASSAGSRFPALNVNAFNSLPGALKEDVRTELLKRKINLPPSP
                     PSKRSASNSPVKDYWGRHGKRTETLKQEMPSTLDEDFMNHLPTQIQREIKWDHAIVKK
                     ASSSVRNRLSRKGTGVLNLSKNRPSKPEAVKFQSLERPLGISRLIKSWIDDTIDNGPH
                     IDDLNLFDKYLTKLAAKGKTHHILKIARTMSSHLEYHSSFTKSNPQGRQEWEEYLLIR
                     MIPTLTASAAKSDSGVQVTFDL"
     gene            <148109..>149155
                     /locus_tag="KLTH0D01540g"
                     /db_xref="GeneID:8295011"
     mRNA            <148109..>149155
                     /locus_tag="KLTH0D01540g"
                     /product="KLTH0D01540p"
                     /transcript_id="XM_002552745.1"
                     /db_xref="GeneID:8295011"
     CDS             148109..149155
                     /locus_tag="KLTH0D01540g"
                     /note="some similarities with uniprot|P33122 Saccharomyces
                     cerevisiae YOR344C TYE7 may be involved in glycolytic gene
                     expression TYE7 a 33 kDa serine-rich protein is a
                     potential member of the basic region/helix-
                     loop-helix/leucine-zipper protein family"
                     /codon_start=1
                     /product="KLTH0D01540p"
                     /protein_id="XP_002552791.1"
                     /db_xref="GeneID:8295011"
                     /db_xref="GOA:C5DG11"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DG11"
                     /translation="MDGPGSSTMTMAAAPSAQGAGAGASSFDDWLFPEASRMGAFGEY
                     GNDAEADAEAGGWAADAGAEADAEVDLDADADPEADADAGVGAAVGADPGAGVLAAGS
                     LSSSSSSSSAGSPLDQFSSLFDSNAMLARGSDSDTLFTASNSASGSPTFVKREDAQMC
                     GPAGLGASAGGLSAEGEAPGSLPLALDVPELSAFDGLDAAAAAADADVGGSAAANAAA
                     AAAAAAAAGARKKRAPRKRLTAHQKQAHNKIEKRYRININTKIAKLQQIIPWVASEET
                     AFEVGETSRGNSRGGESVATATPKLNKSMILEKAVDYILYLQNNERLYEMEVQRLKKE
                     VERARTERDTAARS"
     gene            <151489..>152424
                     /locus_tag="KLTH0D01562g"
                     /db_xref="GeneID:8295012"
     mRNA            <151489..>152424
                     /locus_tag="KLTH0D01562g"
                     /product="KLTH0D01562p"
                     /transcript_id="XM_002552746.1"
                     /db_xref="GeneID:8295012"
     CDS             151489..152424
                     /locus_tag="KLTH0D01562g"
                     /note="weakly similar to uniprot|Q12182 Saccharomyces
                     cerevisiae YOR342C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D01562p"
                     /protein_id="XP_002552792.1"
                     /db_xref="GeneID:8295012"
                     /db_xref="UniProtKB/TrEMBL:C5DG12"
                     /translation="MSFHHQFTLASAKNQLIPQQLTNNVFFGPLNALSQREFIQENRI
                     RFFVAVGIATKRVAQYCRDMPARDCLVVNFDSEFSPQVSLSATELELVSQYSQQHSTS
                     LSQLAAGLAGDAATGCTADSRLTPQPELDQQLHNSPAQYTCNIVTSQGAQKFASFNDL
                     LTLFKLSGSGNVLVFSSNGNDEDLVALLSSHVVITNSSASLLEAFQYVKSLRPSINQC
                     QPDSVFWCQGLMEYLEGSRSYNNPFYDNGMSPASPLSTTGVTSNAFVTKRRNSWSSDC
                     EEECPNSATGTISVSGTPKTRRIAAIRADNMALPH"
     gene            complement(<152846..>153952)
                     /locus_tag="KLTH0D01584g"
                     /db_xref="GeneID:8295013"
     mRNA            complement(<152846..>153952)
                     /locus_tag="KLTH0D01584g"
                     /product="KLTH0D01584p"
                     /transcript_id="XM_002552747.1"
                     /db_xref="GeneID:8295013"
     CDS             complement(152846..153952)
                     /locus_tag="KLTH0D01584g"
                     /note="highly similar to uniprot|P39729 Saccharomyces
                     cerevisiae YAL036C RBG1 GTPase that interacts with
                     ribosomes member of the DRG family of GTP-binding
                     proteins"
                     /codon_start=1
                     /product="KLTH0D01584p"
                     /protein_id="XP_002552793.1"
                     /db_xref="GeneID:8295013"
                     /db_xref="GOA:C5DG13"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG13"
                     /translation="MSTTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRREIVT
                     SATQGSGGGGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTV
                     PGVIRYKGARIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIVLDVNKPLHHKQV
                     IEKELEGVGIRLNKQPPDILIKKKEKGGVSITNTVPLTHLGADEIRAVMSEYKMNSAE
                     IAFRCDATVDDLIDVLEASTRRYMPAIYVLNKVDSLSLEELELLYRIPNAVPISSGRE
                     WNLDELLQIMWDRLNLVRVYTKPKGTMPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDF
                     RNALVYGSSVKHQPQYVGLNHILEDEDVVTILKK"
     gene            <154310..>157306
                     /locus_tag="KLTH0D01606g"
                     /db_xref="GeneID:8295014"
     mRNA            <154310..>157306
                     /locus_tag="KLTH0D01606g"
                     /product="KLTH0D01606p"
                     /transcript_id="XM_002552748.1"
                     /db_xref="GeneID:8295014"
     CDS             154310..157306
                     /locus_tag="KLTH0D01606g"
                     /note="similar to uniprot|P39730 Saccharomyces cerevisiae
                     YAL035W FUN12 GTPase required for general translation
                     initiation by promoting Met-tRNAiMet binding to ribosomes
                     and ribosomal subunit joining homolog of bacterial IF2"
                     /codon_start=1
                     /product="KLTH0D01606p"
                     /protein_id="XP_002552794.1"
                     /db_xref="GeneID:8295014"
                     /db_xref="GOA:C5DG14"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG14"
                     /translation="MGKKSKKSAQNYWDEEFEEDTPQPEEIGGTPAESTPEVEAATDG
                     PESSVEPSDQAEVAEDAEAIEADFMSALRQTKKKADKKEEEDVKKPVIKSKKEKEKEK
                     KEKEKQKKKEQAAKKKAQQQAQKEKNKELNKQQAEAAAEAKAKKESGAKSSEGQTATG
                     GAKKNAKKIPAGLAALKRQLELKKQLEEQERLEREEEERLEKEEEDRLKKEQELAEEA
                     RQQKREKERAKREKLKAEGKLLTRKQKEEKKLLEKRRAALLAAGNIQVAGLNKSQDGS
                     DSKPKKVVYGKKKKKTQQEKDAELAVEEAKKAAEAADAEEDAEEALVDDWENLALDDD
                     EGAASDEEDQEQEETAEDEDADATKEKPAQPSSSKVEAAPASTPASAAVSKRPSPTPS
                     SSTQKDLRSPICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIEAVKQ
                     KTQAMAQYEKQTFDVPGLLVIDTPGHESFTNLRSRGSSLCNIAILVIDIMHGLEQQTM
                     ESIRLLRDRKAPFVVALNKIDRLYDWEPTPNDSFRNSFQKQSRGVKQEFATRLEGIKV
                     ALAEQGLNSELYFENKNLAKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLMYLS
                     HVAATVLEVKVVEGFGTTIDVILSNGYLREGDRIVLCGLNGPIVTTIRALLTPQPLRE
                     LRLKSEYVHHKEVKAALGVKVAANDLEKAVSGSRLLVVGPEDDEEEMMDDVMEDLTGL
                     LDSVDTSGRGVVVQASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKATAMLDKA
                     KEFAVMLCFDVKIDKEAEHYAEEQGVKIFNADVIYHLFDAFTAYQEKLLEQRRKDFLQ
                     DAIFPCVLNTLQIINKRGPMIIGVDVMEGSLRVGTPICTVKLDPTTKEKTVLLLGKVV
                     SLEINHQAVNEVKKGQTAAGVAMRLEDPSGQQPIWGRHVDEKDTLYSLISRRSIDTLK
                     DPAFRDQVSKSDWLLLRKMKTVFSIE"
     gene            complement(<157597..>162561)
                     /locus_tag="KLTH0D01628g"
                     /db_xref="GeneID:8295015"
     mRNA            complement(<157597..>162561)
                     /locus_tag="KLTH0D01628g"
                     /product="KLTH0D01628p"
                     /transcript_id="XM_002552749.1"
                     /db_xref="GeneID:8295015"
     CDS             complement(157597..162561)
                     /locus_tag="KLTH0D01628g"
                     /note="highly similar to uniprot|P10964 Saccharomyces
                     cerevisiae YOR341W RPA190 RNA polymerase I subunit largest
                     subunit of RNA polymerase I"
                     /codon_start=1
                     /product="KLTH0D01628p"
                     /protein_id="XP_002552795.1"
                     /db_xref="GeneID:8295015"
                     /db_xref="GOA:C5DG15"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015699"
                     /db_xref="UniProtKB/TrEMBL:C5DG15"
                     /translation="MDISKPVGSEITSVDFGVMTAQDIRNFSAMQITNPTVLDNLGHP
                     ISGGLYDLALGAFLRNLCATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSC
                     LYCHGFRLKASEVHRYACKLKLLQYGLIDECYKLDELRVGTLQTAVDEAEEDDGDDDK
                     PSKLVDVALLRELKVKRREFVDISIATAISEGRTSYNGTFTATVNDERKALIHDFYKR
                     LLSRPKCDNCGMFSPKFRKDGFTKIFETSLTEKQQTNNRVKGLIRADMIKKQQQRRKL
                     ADDQNSAGEPMEVDEDFDNSRDASARPKTGSTYILSTEVRNILRSVFKKEQEVLQYVF
                     HSRPNLSKKLVRADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQLLSKILTTSLLIR
                     DLNEEMSKLQKDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQGNTGGKVPIPG
                     VKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTS
                     YNIAELRQAVINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATH
                     SLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFD
                     GDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFF
                     TREEYQQYIYGCIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMP
                     GINLLSKNKIKNEYWGKGSTENDVVFKNGELLCGILDKSQYGASKYGIVHSLHEVYGP
                     DVSAKVLSVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEV
                     TNLDKDVSANDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKK
                     FPNNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAM
                     AGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYD
                     NSVRDADGTLIQFLYGGDAVDVTQESHMTQFKFCADNYDALLKKYNPAALIEHLDVES
                     ALKYSKKALKHRKKTEKVPHYSQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFIDSN
                     NDLFKSRDTVSEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAG
                     HGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTDPQADTFCKSVTKVMLSEVV
                     DRVEVTESTGFSEGSTGSRSYFINMKFFGSDEYGEEYDVSKEELQNVVAEKFLKSLEV
                     AIVKEIKKQKKMASPEIGVAVPRSQAAIASGEGGKIDDEDNDEQESRKRTKQAVSYDD
                     PDDDEVETMREAEKSSDEEVDSEMDSDSSDSDDAEDVEEEKPLSNKTKSGLTKVQRDR
                     QSAVVSSHRFVTKYNFDDEDGEWCQFTIELAADTEKLLMVNIVEDICRKSVIREVKNI
                     DRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVEAARNTI
                     VNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKMSYETTCQ
                     FLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVLAKVPASH"
     gene            <162973..>163164
                     /locus_tag="KLTH0D01650g"
                     /db_xref="GeneID:8295016"
     mRNA            <162973..>163164
                     /locus_tag="KLTH0D01650g"
                     /product="KLTH0D01650p"
                     /transcript_id="XM_002552750.1"
                     /db_xref="GeneID:8295016"
     CDS             162973..163164
                     /locus_tag="KLTH0D01650g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D01650p"
                     /protein_id="XP_002552796.1"
                     /db_xref="GeneID:8295016"
                     /db_xref="UniProtKB/TrEMBL:C5DG16"
                     /translation="MPEKNAAAHDQGNLAGSIAGSVAGADLGNKLHLGAIGGIASSVL
                     GSGQGSKLENKLKEKMDKK"
     mobile_element  163739..164828
                     /mobile_element_type="retrotransposon"
     gene            <166143..>168788
                     /locus_tag="KLTH0D01694g"
                     /db_xref="GeneID:8295017"
     mRNA            <166143..>168788
                     /locus_tag="KLTH0D01694g"
                     /product="KLTH0D01694p"
                     /transcript_id="XM_002552751.1"
                     /db_xref="GeneID:8295017"
     CDS             166143..168788
                     /locus_tag="KLTH0D01694g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D01694p"
                     /protein_id="XP_002552797.1"
                     /db_xref="GeneID:8295017"
                     /db_xref="GOA:C5DG17"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DG17"
                     /translation="MLPHTAREEQVECDVYLYVLCDRSWAGAYVRVRRRGRATARPRS
                     ARRAAPTQLMAGSNHGLGRPQACSRCRNHKIKCVHNGEAPCTYCIHRNVAQECRLTFP
                     ENKKAKKSEAGPRVSKGEAGAREASAPLVPMDAIFTAGVRPQIEPHLCVPPVDANTLP
                     AWARGSIFEVVPLIPARVVREAVLRVVRSFPELNLFHLPTVLDSAEKLHPLLAGAAVA
                     FAGFFDPWRGGSGDGGGDSGSGSDAGDASASQWLGAGSYQVANKVCERLTLDAIFAKC
                     HFLMEPSLDVACALLILAVVKWGHSEYYAAWMLHGCATRMIQSMDSEESFLLKAKIYP
                     LLRKMQLRAFWCAYVLDKIICAGQRKTFMLPDTPDMLLPVGDYEFSLATLDAAPEMDL
                     GVKSEQKATLCDFLAQCQRNPAILKKSPYALLVFLWSIWGAVSRRVTRPDRDSPAFEC
                     PWDPDSEVYKLNSRLDGIWALVPREWKWSREAYLAEKPAVIKDNLMVTINCVYHASTA
                     LINREFMPFLPHDIDKPAGPTDLKEPPPYHENYWTESARRCFGSIRTLSRILKTLLEE
                     ELGRSPGGKFRNAVLVTPYHSFLAFTCGLLANYGANFYWMDPDSEKYNNDPTNPDRLE
                     NCYNVAISLLKAKENDFGAAKNWLAVILKMGEINRFVAQNRNSTKVSEWTKKCSKDLG
                     PSLSMPKVDIKKLEKMLPLLPPPHTNGQQNTESLYPSPAADSYYNQVGLFSQREVVPS
                     SSFYRAPPPSASQPASQYRSPALMTHSAPMSFPLAPAASQSPKLSFPALLPASACEPL
                     SSNPAPQPLASFGASSSVRSVPAASYSVVPGSSVLSPQVAPSAPYAGQQPLPAHDERH
                     VETDTDKLSLFFNDSELDLLMQFNS"
     gene            <169128..>170021
                     /locus_tag="KLTH0D01716g"
                     /db_xref="GeneID:8295018"
     mRNA            <169128..>170021
                     /locus_tag="KLTH0D01716g"
                     /product="KLTH0D01716p"
                     /transcript_id="XM_002552752.1"
                     /db_xref="GeneID:8295018"
     CDS             169128..170021
                     /locus_tag="KLTH0D01716g"
                     /note="similar to uniprot|P46669 Saccharomyces cerevisiae
                     YOR340C RPA43 RNA polymerase I subunit A43"
                     /codon_start=1
                     /product="KLTH0D01716p"
                     /protein_id="XP_002552798.1"
                     /db_xref="GeneID:8295018"
                     /db_xref="GOA:C5DG18"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:C5DG18"
                     /translation="MSSVKRSSEQKRDAEFIKRHKKVCKNPVDESNGVSKCIVQVPVS
                     MYVSIAPTYMKEPNRGIKKQHLNPMIMKYSSNVGGVVLGYENLKIEDASVSDESDSEN
                     ATKLVKITPDTPFGFTWCSVDLYVWQPQIGDVIEGWIFIQSPSHIGLLIHDAFNASIK
                     KTSIPQDWTFIHNEDADNNSDSGVGNSAQSRSLGHWVDENGQRLDGKLKFSVRNVYTT
                     GRVVSLEGSLLDDKVGQARSPAESLPVVSNKKIIFDDEVSTENRESHRDLELSKRVKE
                     DNGEEIVYEKNSSSSESSDSE"
     gene            <170277..>171152
                     /locus_tag="KLTH0D01738g"
                     /db_xref="GeneID:8295019"
     mRNA            <170277..>171152
                     /locus_tag="KLTH0D01738g"
                     /product="KLTH0D01738p"
                     /transcript_id="XM_002552753.1"
                     /db_xref="GeneID:8295019"
     CDS             170277..171152
                     /locus_tag="KLTH0D01738g"
                     /note="similar to uniprot|P39731 Saccharomyces cerevisiae
                     YAL034W-A MTW1 Essential component of the MIND kinetochore
                     complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
                     kinetochore subunits contacting DNA to those contacting
                     microtubules critical to kinetochore assembly"
                     /codon_start=1
                     /product="KLTH0D01738p"
                     /protein_id="XP_002552799.1"
                     /db_xref="GeneID:8295019"
                     /db_xref="GOA:C5DG19"
                     /db_xref="InterPro:IPR008685"
                     /db_xref="UniProtKB/TrEMBL:C5DG19"
                     /translation="MSAPTMRTTLLLTEHLGYPPISLIDDIINAVNELMYKCTQAMEK
                     YLLERSFMEGKDYTDEIKIGIAKLETLWENSVDRSFDKLELYVLRNVLHIPQELIENG
                     SFRLRHHDSLVLEDNDSKEALSTELKTKMRQLQESIETHKELRRQKVALQKVLARVRR
                     FKLLVSSFLQGQDLDNKEVAAVLSSLSPVNESVRFLASQVHSLYLESDDQCSSERVKS
                     IVSRQKELHADLSSRTGYLAQSTKKALEQLLGNQPSEVSHEVPDGAGTTGSSPSTDHA
                     IEVSSPDWNAMTEVT"
     gene            <171356..>171841
                     /locus_tag="KLTH0D01760g"
                     /db_xref="GeneID:8295020"
     mRNA            <171356..>171841
                     /locus_tag="KLTH0D01760g"
                     /product="KLTH0D01760p"
                     /transcript_id="XM_002552754.1"
                     /db_xref="GeneID:8295020"
     CDS             171356..171841
                     /locus_tag="KLTH0D01760g"
                     /note="highly similar to uniprot|P52492 Saccharomyces
                     cerevisiae YOR339C"
                     /codon_start=1
                     /product="KLTH0D01760p"
                     /protein_id="XP_002552800.1"
                     /db_xref="GeneID:8295020"
                     /db_xref="GOA:C5DG20"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5DG20"
                     /translation="MEGSSKSSIPDGHSVVSRLQSELMQLMLSPSPGLSAFPEDEEDL
                     TKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVSPMWHPNVDMSGNICLDI
                     LKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIARYEEID
                     D"
     gene            complement(<172172..>173227)
                     /locus_tag="KLTH0D01782g"
                     /db_xref="GeneID:8295021"
     mRNA            complement(<172172..>173227)
                     /locus_tag="KLTH0D01782g"
                     /product="KLTH0D01782p"
                     /transcript_id="XM_002552755.1"
                     /db_xref="GeneID:8295021"
     CDS             complement(172172..173227)
                     /locus_tag="KLTH0D01782g"
                     /note="similar to uniprot|Q06855 Saccharomyces cerevisiae
                     YOR338W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D01782p"
                     /protein_id="XP_002552801.1"
                     /db_xref="GeneID:8295021"
                     /db_xref="GOA:C5DG21"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5DG21"
                     /translation="MEFNSPQPEHAQLSTVVHPKGTSRLLAALHQQVVGAMAPRSGGP
                     GLGGCSIDSALDEHLIPSPPLSPKMSSVDEGSAAPAAPVAPQVPAESTTALWVKPDWE
                     SSRSPESYRSATSGFLSQYRCFDFMRTKRYTHPNNKTLRKTRNYTCSPNYTSGGSDFE
                     KVYRTRRSVKNAENPRTARGHAPAFQEDFTRHGMPSRPATPTNRNTHRKVNSVTSPLG
                     SSAVLGAPQYVPNMSWEKLPDYSPPLSTLPANNKCLKVEWKGSSMDLSADPLRHLLHP
                     AELQLAQILRLPCDLYLDSKRRLFVEKVHRLKQDLPFRRTDAQKACRIDVNKASRLFA
                     AYERIGWLEDENFERFF"
     gene            complement(<173650..>175608)
                     /locus_tag="KLTH0D01804g"
                     /db_xref="GeneID:8295022"
     mRNA            complement(<173650..>175608)
                     /locus_tag="KLTH0D01804g"
                     /product="KLTH0D01804p"
                     /transcript_id="XM_002552756.1"
                     /db_xref="GeneID:8295022"
     CDS             complement(173650..175608)
                     /locus_tag="KLTH0D01804g"
                     /note="similar to uniprot|P47988 Saccharomyces cerevisiae
                     YOR337W TEA1 Mutants are defective in Ty1
                     Enhancer-mediated Activation Ty1 enhancer activator and to
                     YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
                     CHA4 Zinc-finger protein with Zn[2]-Cys[6] fungal-type
                     binuclear cluster domain; DNA-binding transcriptional
                     activator or CHA1"
                     /codon_start=1
                     /product="KLTH0D01804p"
                     /protein_id="XP_002552802.1"
                     /db_xref="GeneID:8295022"
                     /db_xref="GOA:C5DG22"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DG22"
                     /translation="MGPERLDVLTSTNAGSSEDFSSGSPLLSQKRLACSNCRRRRKKC
                     DMGYPCASCVKMKLDCNVNMDDMRKKRYAAGYVKSLEAHVAYLETRLKNLDAAKISGT
                     SSLGTSEPTLLISTDGKERRLSDGAAPFSSSVGQSFRGGDNSSSFNASENDILRRKRF
                     VKGSIYPEGPASYKPQRREPAISKPQNRIADLKTTVIVRRHQDSSETLNTDKNILGSL
                     SAFYKWLYPGPFVFVHRESFLYGFFNHSEDNYENSQYCSEELVYAVASVGSRLVPGLR
                     SLSEGYYQKAKGKLLSIVFDEHSTAKITTVQALLCLAFCELGKGNNQLAWYFSGLAIR
                     VGYDMGFQLDPKVWVTDDASSSELSQSELEIRSRIYWGCYIADHFICLLLGRTSTLSV
                     SNSTVPESDELPEVDGTGEFRFNSKHVLQVSLPLKNLVILSRIVQVFTAKIFIESGST
                     AQRIGYLTRFNIKVYNWRQSLPQFLKWSKNSIKDTDWSTDPTISYFWYHYYIVLLTFN
                     KPFMEDCEESKILVLEVLGELHTLLSNFRVRFGSVDTASIYQLYSCLLAVTCLKKLTK
                     MSLDGQPASVLASLDRDLRFYTDLFHEFHLTYGLPQRLQDEPDLHVVDQLNTLAYTHD
                     FSLSDEIDDLIKQVFGFDTWTINPSHTV"
     gene            complement(<175846..>179820)
                     /locus_tag="KLTH0D01826g"
                     /db_xref="GeneID:8295023"
     mRNA            complement(<175846..>179820)
                     /locus_tag="KLTH0D01826g"
                     /product="KLTH0D01826p"
                     /transcript_id="XM_002552757.1"
                     /db_xref="GeneID:8295023"
     CDS             complement(175846..179820)
                     /locus_tag="KLTH0D01826g"
                     /note="similar to uniprot|P22023 Saccharomyces cerevisiae
                     YOR336W KRE5 Protein required for beta-1 6 glucan
                     biosynthesis mutations result in aberrant morphology and
                     severe growth defects"
                     /codon_start=1
                     /product="KLTH0D01826p"
                     /protein_id="XP_002552803.1"
                     /db_xref="GeneID:8295023"
                     /db_xref="GOA:C5DG23"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="UniProtKB/TrEMBL:C5DG23"
                     /translation="MLLWTLLVWSYAIFASCTTVRLSNASSGVKLRLWNAVVGLVNDE
                     QLVQDLYFLIAGVSDELDELKTDSTPLDQIVEALARHNPELASLLSLRYALEPGFSND
                     TSNQNYFLLNNKRFENADDIFYLKTDDLNAQKSACINDVLDNEDVVMGSNRDAPVILF
                     YGCDRVEDWEEFNRNLYMEAQAGKVRFVWRSTCPNDLPFEFEPSAVALTVKGSQWNTE
                     FGHALDVPESLVLGTEPSFRAQQVSDEQLQDLDMKVGTLVYDFYEKSQNATETIRYFR
                     QIVNNFPVLARSLAEQGDITIDNRWEAALKKLAKEGIDNTMLGLFVNGQFHKLSNLNK
                     WSVLQSVILELQRVNFLMDLLQKYQNITPGESLVLAKKLLNTFSKRSLTTQQLLQPVK
                     YDLHRIPGFSESIIYFNDIELDSDYAEKLKDDIAMFFEESEFGELPAYRENWNEIVFV
                     IDFSDLRSKDTWEALQGLLRALQVVKKGYPQRIGLLPFSTSAQDHGVLGKIYELKQNK
                     PLETLVSYLEDLSPIERPQQSVFQKLPPVLEIINDRLKINETSIVINGEIYPFKSNLW
                     NYLVSKVLKKDVSFIKSELLRINTKNFKAREILHAKSFIERNKKYAPDYFEDATYSNT
                     NVTALLSLAHRIVETSTGGGLNTIHTVTIVEDFNTPLGLQRLIHLLQIKLHGVRVRAV
                     HSGLLGKNWDKLKFTISNADTSKLQNYLRSLKSNGECNYIEPAIVGQWLLDLPRKILQ
                     RTSYLAVNGRFIHFEQGELPTIYEYEMIVQREATRVLDAVASLQEVFPDSLKEPLDPN
                     YVEMVSAVLAKMFYDGERLYNNGIDFTAEASISRINLGELLPSESFGAFQTSEEPRKV
                     EVTLILDPLEERTQNLLALASYLGSLDFLKLQVVLMPTTDLKVFPNHRLWIEGEKDLS
                     IIDTRKFYVDVEVPPYLHVGERKDNVFELEYIKVEVNAFENKEEPSKGLVEGIGNVCL
                     NLLNANHEVIDTATTTDTFGYTQFRLRRLEQGLTIESCSSNYRVSSFTSNSKADYIAS
                     DHFDVTSLAPTRLYVRLEKTQGMLPEVSEDNRIINILSIIENAEDEVSFEKQASSVMR
                     SRGSFDTKFWIILGEEPSASFLSFVEFMTAESAGEVTFEYLTVDWPRWLRPQRFRPRQ
                     LAAAKVMMLDTLFPKGVTKVVYMSPGARVPNITELWEYDFDSVFCAPRAYQRDGTPYW
                     KQGYWRNFLSKNNLKFHATEPLFIVNLGKYRQEHAGSKFRIHYQRLSPGINFLVQLDQ
                     DLLNDMQTLFPISSLNKRLLKVAPHLQTLDDNLYQSLQEKFNAKKSGQKLEDLSETIV
                     HDEL"
     gene            <180421..>183288
                     /locus_tag="KLTH0D01848g"
                     /db_xref="GeneID:8295024"
     mRNA            <180421..>183288
                     /locus_tag="KLTH0D01848g"
                     /product="KLTH0D01848p"
                     /transcript_id="XM_002552758.1"
                     /db_xref="GeneID:8295024"
     CDS             180421..183288
                     /locus_tag="KLTH0D01848g"
                     /note="highly similar to uniprot|P40825 Saccharomyces
                     cerevisiae YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase
                     required for protein synthesis point mutation (cdc64-1
                     allele) causes cell cycle arrest at G1 lethality of null
                     mutation is functionally complemented by human homolog"
                     /codon_start=1
                     /product="KLTH0D01848p"
                     /protein_id="XP_002552804.1"
                     /db_xref="GeneID:8295024"
                     /db_xref="GOA:C5DG24"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:C5DG24"
                     /translation="MTIGDRQKWTASNVRSTFMEFFKQREHTFVASSPVIPYDDPTLL
                     FANAGMNQYKPIFLGTVDPSSDYYSLKRAMNSQKCIRAGGKHNDLEDVGRDSYHHTFF
                     EMLGNWSFGDYFKKDAIQYSWELLTKVYGIPSERLYVTYFEGDQKQGLEPDLEAFELW
                     KSVGVSEDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPNVLEV
                     WNIVFIQYNREQNGTLKSLPSKHIDTGMGFERLVSVLQDVKSNYDTDVFQPLFARIQE
                     ITGARPYEGKFGAEDADGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRR
                     GARYARKYMNYPIGNFFSSLAPTLIDQSKAMFPEINRDPSYLFEILDEEEASFAKTLD
                     RGEKLFEKYAQAAAQTKDKTLDGLQVWRLYDTYGFPVDLTELMAEEKGLKIDGPGFEK
                     AKQESYEASKKGGKKSASDLIKLEVHELSTLNSENVPKTDDSPKYESANIEAIVLRIF
                     DGENFVDEISEVGKQYGVILDSTCFYAEQGGQEYDMGTLVIDDVAEFSVENVQLYNGY
                     VFHTGQLGEGKLSVGDKVIASFDELRRFPIKNNHTGTHILNFALKEVLGNDVDQKGSL
                     VAPEKLRFDFSHKKAVALDELKEVERICNEQIKANLPVYYKNVPLDLARKISSVRAVF
                     GETYPDPVRVVSVGKPVDDMLVDPTSEEWQKYSVEFCGGTHVSKTGDIKEFVIIEESG
                     IAKGTRRIVAVSGSEAYEVQRIANKFDSDLIAAEKMPFSPLKEKKLKELGVALGQLSI
                     SVVTKQELKDKFAKIEKVVKDEIKTRAKKEIKQTVDEVKNYFAENQEASFLVKYINIP
                     TNAKAITEAVNHMKTSAKDKSIYLFTGDDRVAHGCYISDVALEKGIDGRALLNTVSSN
                     IGGKAGGKGNVFQGVGDKPEGIETAVKEVENLFREKLNITK"
     gene            <184749..>185243
                     /locus_tag="KLTH0D01870g"
                     /db_xref="GeneID:8295025"
     mRNA            <184749..>185243
                     /locus_tag="KLTH0D01870g"
                     /product="KLTH0D01870p"
                     /transcript_id="XM_002552759.1"
                     /db_xref="GeneID:8295025"
     CDS             184749..185243
                     /locus_tag="KLTH0D01870g"
                     /note="similar to uniprot|P28005 Saccharomyces cerevisiae
                     YAL033W POP5 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="KLTH0D01870p"
                     /protein_id="XP_002552805.1"
                     /db_xref="GeneID:8295025"
                     /db_xref="GOA:C5DG25"
                     /db_xref="InterPro:IPR002759"
                     /db_xref="UniProtKB/TrEMBL:C5DG25"
                     /translation="MVRLKSRYVLFEVLYPEGRTLTSENNVNNLFKREVLLRHHQVTP
                     ARVTVKTILQELRRVIQFNFGDYGSGKANSLLQIKYFSNRTSTGIIRCSREDYEIVVI
                     ALTLMNKIDELEGVLLNPIKVSGTIKRIEQYAVKRSARLLNVIQGQSEIDKFDYISYD
                     ENED"
     gene            complement(<185319..>186674)
                     /locus_tag="KLTH0D01892g"
                     /db_xref="GeneID:8295026"
     mRNA            complement(<185319..>186674)
                     /locus_tag="KLTH0D01892g"
                     /product="KLTH0D01892p"
                     /transcript_id="XM_002552760.1"
                     /db_xref="GeneID:8295026"
     CDS             complement(185319..186674)
                     /locus_tag="KLTH0D01892g"
                     /note="similar to uniprot|P28004 Saccharomyces cerevisiae
                     YAL032C PRP45 Ortholog of human transcriptional
                     coactivator SKIP can activate transcription of a reporter
                     gene interacts with splicing factors Prp22p and Prp46p"
                     /codon_start=1
                     /product="KLTH0D01892p"
                     /protein_id="XP_002552806.1"
                     /db_xref="GeneID:8295026"
                     /db_xref="GOA:C5DG26"
                     /db_xref="InterPro:IPR004015"
                     /db_xref="InterPro:IPR017862"
                     /db_xref="UniProtKB/TrEMBL:C5DG26"
                     /translation="MSNSRPLSVLLPPPKHAINASAQHKSGLKELVGLLSEAGNPRET
                     LYSVESFQENSVTLESFLPLRHKYPDLKIPQISQSDIQNTYERTKAVFDKILSQKLQP
                     QGTGAVGTANKGSAKTIEYKLPDQNSEVRKLKIVDQQVDPLQPKLFKTKKVVAPSTDE
                     PFAPVLHKSDDITPQSTKEERDKWNIPSAISSWKNPNGYTINLDRRIASDGRYSKESL
                     GPHEISEGHMKLSEALDAAERKAREEVSLRADAKRMLAEQDVREKEEKLRMIALKARE
                     DRKKNTEPYSGPRALDSATRQRQEDQRERLNKIRRELQRSKMSTAERLRALATGEGRE
                     VSEKVILGAAAASDTADIQYDSRLFTKAAKARGQSGGDQVYDNPLFVQEGINTMYRPN
                     FSAAVDIQARDAADTLESKVQFELASGKRGREGPVEFSAAENTEKSEEGESSVKRHRG
                     G"
     gene            complement(<186816..>189233)
                     /locus_tag="KLTH0D01914g"
                     /db_xref="GeneID:8295027"
     mRNA            complement(<186816..>189233)
                     /locus_tag="KLTH0D01914g"
                     /product="KLTH0D01914p"
                     /transcript_id="XM_002552761.1"
                     /db_xref="GeneID:8295027"
     CDS             complement(186816..189233)
                     /locus_tag="KLTH0D01914g"
                     /note="some similarities with uniprot|P39732 Saccharomyces
                     cerevisiae YAL031C FUN21 Cytoplasmic protein of unknown
                     function potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0D01914p"
                     /protein_id="XP_002552807.1"
                     /db_xref="GeneID:8295027"
                     /db_xref="GOA:C5DG27"
                     /db_xref="InterPro:IPR026241"
                     /db_xref="UniProtKB/TrEMBL:C5DG27"
                     /translation="MYVKAAANASIVAVKGGATLDQYDAKLIQCRVAISRLTEILRIL
                     RILEGTLKRTNGTKTIIPLMNYILALYGGLTLNASEILSRRLRLLSEFRLCKITDVNP
                     PLNSSPISLDCEFPEVSSDFQEYTAHVYDRQLQNKLLQAAINITQNALQVYDRKYKQC
                     NMERSANRPTSISGRPTTFEEGSFEELIQPLDVPMILDLAVLIKDFEVDTSESSFRKL
                     SLQVLTKFKDHFNEKALPPIKTYHTSLFRFSKASSLSQSKIIMNLPYWQYTMHRIYAL
                     LLRILYILTITKAFLRQAYIPNRAFFESPRTQLHSPNVFEFRELIKNLDTICMGPNDL
                     SDLVERLQCYSQQGFSLAVQPSSVLEAYNSEVSVATRKLRFYFQIVESLLSVWKHIQA
                     SSLNNEAFGSLDELGLSKAVEERLAVDRLDFIERKNKEAQLKEKQKEAAAAASTESSV
                     KTIFRRSSIQRSKMSPSPSGSTSPSSLSPASMSRSPSQNLKRGTLPKKPLNGSSISSP
                     LASRRGSVSGSTSNAGNRKPSNEGSSNGSPRIDETLQTGGRKRSSSLQSSVLASHNQA
                     DNMHRSNSLQAAATLNQRMVRNTFAKLSANIEGNGALNSDSKTDRLATPANSSRQMMR
                     SSSPSPLRQKGKSSGASPAGPRSGIELPDVESLVLDEGKLALVSKQSPSGSTSAPTKS
                     LVESSSSEISPNSEVEYQTITLETVKKVRFTGVPPMSEKEDPRPKRKGWYKKPQVLYY
                     PPPPPQVAVQQYRLRQEGQAFRKSLRDGDGENGGVSKRTAFMSQSDVHLSPTHKFSSK
                     IRDKLSR"
     gene            complement(<189479..>190762)
                     /locus_tag="KLTH0D01936g"
                     /db_xref="GeneID:8295028"
     mRNA            complement(<189479..>190762)
                     /locus_tag="KLTH0D01936g"
                     /product="KLTH0D01936p"
                     /transcript_id="XM_002552762.1"
                     /db_xref="GeneID:8295028"
     CDS             complement(189479..190762)
                     /locus_tag="KLTH0D01936g"
                     /note="similar to uniprot|Q01926 Saccharomyces cerevisiae
                     YOR334W MRS2 Mitochondrial inner membrane Mg(2) channel
                     required for maintenance of intramitochondrial Mg(2)
                     concentrations at the correct level to support splicing of
                     group II introns"
                     /codon_start=1
                     /product="KLTH0D01936p"
                     /protein_id="XP_002552808.1"
                     /db_xref="GeneID:8295028"
                     /db_xref="GOA:C5DG28"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:C5DG28"
                     /translation="MIWSRLRPFRLLAKPFLRSRRLYHRLLPEQNSGILSLKPITPND
                     AFVSCTLFNKNGAVTAVSQKFPKWAFLKDHNLYPRDLRKIDTTSVDVIPSIVVKPTCI
                     LINLLHIKALIQHDCVFVFDTSNSEAAMKLGVLMYDLESKLSTNPNAHMAQLYEHRAL
                     ESILMNVMTSLETEYKQHYSICGIILKDLEDEISRDKLRDLLIKSKNLTSYYKKSLLI
                     RDVLDELLDSDEDLAAMYLGEHKNENDDFADLEMLLETYYKQCDEYVQQSETLLQDIR
                     STEEIVNIILDANRNALMLFELKVTIYTLGFTIATLVPAFYGMNLKNFIEDSPLGFGC
                     VVGFSVIAALCVTWSNFKALSSVKRLTMMNNHTGVNTARHAANARHELNQEAPILWKK
                     WASSLRTVWLGSNHPVRNGKHRDLIWKWLVDDNKK"
     gene            complement(<191031..>191723)
                     /locus_tag="KLTH0D01958g"
                     /db_xref="GeneID:8295029"
     mRNA            complement(<191031..>191723)
                     /locus_tag="KLTH0D01958g"
                     /product="KLTH0D01958p"
                     /transcript_id="XM_002552763.1"
                     /db_xref="GeneID:8295029"
     CDS             complement(191031..191723)
                     /locus_tag="KLTH0D01958g"
                     /note="similar to uniprot|P22203 Saccharomyces cerevisiae
                     YOR332W VMA4 vacuolar ATPase V1 domain subunit E (27 kDa)"
                     /codon_start=1
                     /product="KLTH0D01958p"
                     /protein_id="XP_002552809.1"
                     /db_xref="GeneID:8295029"
                     /db_xref="GOA:C5DG29"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:C5DG29"
                     /translation="MSTAITSLTPSQVNDELNKMQAFIKKEAEEKSKEIMLKADQEYE
                     IEKTALVRNETSNIDAAMEEKTKKATLKQQITKSTIANKMRLKVLSTREQMLDDIFES
                     AKAELKKLSSDKKKYESVLKSAILESLLRLLEPSVVVKVREQDKQLVNSFKEAVLKEY
                     KAKSGREASLTVSSEYLSKDSAGGVIASDESGKIVVDNTLEERLEILNQEALPALRLE
                     LFGISESRKFFD"
     gene            <192827..>196498
                     /locus_tag="KLTH0D01980g"
                     /db_xref="GeneID:8295030"
     mRNA            <192827..>196498
                     /locus_tag="KLTH0D01980g"
                     /product="KLTH0D01980p"
                     /transcript_id="XM_002552764.1"
                     /db_xref="GeneID:8295030"
     CDS             192827..196498
                     /locus_tag="KLTH0D01980g"
                     /note="similar to uniprot|P15801 Saccharomyces cerevisiae
                     YOR330C MIP1 Catalytic subunit of the mitochondrial DNA
                     polymerase"
                     /codon_start=1
                     /product="KLTH0D01980p"
                     /protein_id="XP_002552810.1"
                     /db_xref="GeneID:8295030"
                     /db_xref="GOA:C5DG30"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002297"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR016265"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:C5DG30"
                     /translation="MSLNRAFRGVKLWRKVRAYSTLEAPRINPVGIQHLSKHLHEQVF
                     GSINAQPQQPGLSYEEKEMLTRLSRTFLKNHGLLGKKTAISAPISFDLPQLQGRSLDE
                     HFQKLGHFASQPYRDLAGSKFTNIPPRPKTWLRKSGWVRYASGKAPEAVDYPAEATIV
                     FDVETLYKISPYPTLAVALSEEAWYCWTSPFLSGESDNPSHLIPLNTLDTTRLVIGHN
                     VGYDRARVLEEYNCQESKAFFLDTMSLHVASSGMCSRQRPQWMQKRKAQDSQSCDGAQ
                     YSNVPDEEDPWTTVSTLNSLKDVALLHCGIKLDKAQRDYFATLDRNDIINDFTQMVDY
                     CATDVEATSKVFDVVFPLFLSKCPHPVSFGALRLLSTSLLTTRGDSWKDYIEKSENLY
                     QHSKQSIEKKILAIVEEVVKLKDKKTLIEQDPWLSQLDWTIKPLRITKKGLPAKGQKL
                     PGYPEWYRQLFPTKNSKQAQITIRNRLIPLFFKLSWEGEPVIWTSSHGWCFAVPVSRS
                     EELEAKNYLKINPGDVVSPEFTLFKVPHPNGQQFNCTTLVSKQYVQFFEKGILTSHSE
                     LAHEALKINSSCAYWISARERVMSQFVVSTRDFPDQFKDLQHKTFSDEEISIILPSVI
                     PMGTVTRRSVENTWLTASNAKKNRIGSELKAQVQAPPGYVFVGADVDSEELWIASLVS
                     DSVFNIHGGTPIGWMCLEGSKSEGTDMHTKTAQILGCSRNEAKIFNYGRIYGAGVKFA
                     TQLLKNFNPGLTDYEAKETAEKLYSSTKGLVKRSKTFKKFWYSGSESILFNKLEHIAE
                     QAAPRTPVLGAGITSSLMKGNLGSNTFLPSRINWAIQSSGVDYLHLLCCSMNYLIKKF
                     SLRARLALSIHDEIRFLTAEKDKYKTAMALQISNLWTRAVFCEQMGIKDLPQNCAFFS
                     AVDIDHVMRKEVDMDCVTPSNKIPIPHGESKDIVSLLKIPESSLKDGREDIDVSGFPF
                     QKREPVFSTYDKAHSRDYLYYFLRMQIQSSKWKVEELEQEFTRRSAENDHQSKYRSDE
                     YMFLDYINDTKNKNRPTAELGGGPLENAVHGSMNLTLRTQPIAESQGKFTDELASGLN
                     VENDLEAQHFLAANNTEDTENTDKVQRCTSAVAKRKRLRKSVFGGAEAYKLFSSCVDK
                     SRAYAGRKQEELLSSDLAIKTIVNEVVATGGSRSTKKVAKIRKAASIKSPALKKDISK
                     TAASTSKVLKKMNKTLRAG"
     gene            complement(<196550..>197293)
                     /locus_tag="KLTH0D02002g"
                     /db_xref="GeneID:8295031"
     mRNA            complement(<196550..>197293)
                     /locus_tag="KLTH0D02002g"
                     /product="KLTH0D02002p"
                     /transcript_id="XM_002552765.1"
                     /db_xref="GeneID:8295031"
     CDS             complement(196550..197293)
                     /locus_tag="KLTH0D02002g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D02002p"
                     /protein_id="XP_002552811.1"
                     /db_xref="GeneID:8295031"
                     /db_xref="UniProtKB/TrEMBL:C5DG31"
                     /translation="MKRPRKRAFHHSEEEASDSGDDQDFSQYIKRKSAAVQKVQHERK
                     FDLDDASLQASAHVTPKPSSTSLIESFKASKKQREMDKLFSQSVKARIERESETCVMK
                     DKEVYITKEYEDVKKDLDKAFELAHEEEDSELRDKDGPHTPLLQATPQINSGECVIRG
                     VYASDQSCIKMPRNGDEKPKAYKNDIYVTRPSRFKPQEQGYRQLQQGVEPTLNKRALV
                     QQFLLPKKSKQMIEIEIKRYQNRTHKKAA"
     gene            <197416..>199332
                     /locus_tag="KLTH0D02024g"
                     /db_xref="GeneID:8295032"
     mRNA            <197416..>199332
                     /locus_tag="KLTH0D02024g"
                     /product="KLTH0D02024p"
                     /transcript_id="XM_002552766.1"
                     /db_xref="GeneID:8295032"
     CDS             197416..199332
                     /locus_tag="KLTH0D02024g"
                     /note="some similarities with uniprot|P34758 Saccharomyces
                     cerevisiae YOR329C SCD5 Multicopy suppressor of clathrin
                     deficiency and of ts ipl1 mutants"
                     /codon_start=1
                     /product="KLTH0D02024p"
                     /protein_id="XP_002552812.1"
                     /db_xref="GeneID:8295032"
                     /db_xref="UniProtKB/TrEMBL:C5DG32"
                     /translation="MSFDWLNVPGLSGSGNENIEAAEPPPSVSFNFGNSASEPPTERE
                     SHVTMPQRADRADAFHSQSSYDSASSSAKSQARPDNYMETKEDLQVPLSLSRTQLTRE
                     EVRTYLRWYGYIASRKHTKLIALDDVFHFMTNFPLGQDVKERIAHIFKTCKNALNIGQ
                     FFAILRLIARALTDGVLPTRKMIMKAAPVPKPKPILAAGNEEVYEEIDDSQDGPELKV
                     DFDSFASLLLTGQKKKRMRRRITNDHKRSKRVRFTDKLVTFQDHVQSPENEQGTEDEE
                     KSGDNEPLDLSLPMDQLLKKMAARKKNNSALVSEPPSQKVPESQEEKEVLEDMKESLN
                     HFHQIHNVDSVSLGGVPAQVPSAGTPSANATAQIEPLKPTATGSANYLFRSSQQQPQS
                     VNQEPLQPLKPTATGSANYLFRSSQQQATSQKPEHNSFNFMHAVSPDPSNNAMHRNNT
                     TFQSPTPEIPQIRAPLAANFAGQPLHSSSQAPSNLNVPFSNQSFLPPPSSGFGISPQP
                     TSQNNFSPNLSANNYFQNLLSSSPSPNASTLQLPQSASVGPYANAYSSNSKVAQDSNY
                     LKPNLTGPSNPQYQINPNQYQRREYQSFTPSPVPTLPSYPQAPQNTYKSHDYLGDLRA
                     LQEHVDQLQNAYNR"
     gene            <199583..>199990
                     /locus_tag="KLTH0D02046g"
                     /db_xref="GeneID:8295033"
     mRNA            join(<199583..199663,199742..>199990)
                     /locus_tag="KLTH0D02046g"
                     /product="KLTH0D02046p"
                     /transcript_id="XM_002552767.1"
                     /db_xref="GeneID:8295033"
     CDS             join(199583..199663,199742..199990)
                     /locus_tag="KLTH0D02046g"
                     /note="similar to uniprot|P33328 Saccharomyces cerevisiae
                     YOR327C SNC2 mediate the targeting and transport of
                     secretory proteins vesicle-associated membrane protein
                     (synaptobrevin) homolog"
                     /codon_start=1
                     /product="KLTH0D02046p"
                     /protein_id="XP_002552813.1"
                     /db_xref="GeneID:8295033"
                     /db_xref="GOA:C5DG33"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR016444"
                     /db_xref="UniProtKB/TrEMBL:C5DG33"
                     /translation="MSSSVPYDPYIPAEESQSQTKTAALKAEIDDTVGIMRDNINKVA
                     ERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLAVIILLVVIIV
                     PIVVHFS"
     gene            complement(<200288..>204958)
                     /locus_tag="KLTH0D02068g"
                     /db_xref="GeneID:8295034"
     mRNA            complement(<200288..>204958)
                     /locus_tag="KLTH0D02068g"
                     /product="KLTH0D02068p"
                     /transcript_id="XM_002552768.1"
                     /db_xref="GeneID:8295034"
     CDS             complement(200288..204958)
                     /locus_tag="KLTH0D02068g"
                     /note="similar to uniprot|P19524 Saccharomyces cerevisiae
                     YOR326W MYO2 One of two type V myosins involved in
                     polarized distribution of mitochondria required for
                     mitochondrion and vacuole inheritance and nuclear spindle
                     orientation moves multiple cargo"
                     /codon_start=1
                     /product="KLTH0D02068p"
                     /protein_id="XP_002552814.1"
                     /db_xref="GeneID:8295034"
                     /db_xref="GOA:C5DG34"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR008989"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG34"
                     /translation="MSFEVGTRCWYPDKNEGWVGSEVTKLSQPADGKYLLELTLENGE
                     SVEIETNTIAEGQDDRLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYT
                     YSGIVLIATNPFDRVEQLYSQDMIQAYAGRRKGELEPHLFAIAEEAYRLMKNDKQNQT
                     IVVSGESGAGKTVSAKYIMRYFASVEQANNDNTSSDHQLEMSETEQRILATNPIMEAF
                     GNAKTTRNDNSSRFGKYLEILFDQNTSIIGARIRTYLLERSRLVFQPQTERNYHIFYQ
                     LLEGLSESEKAELHLTKVEDYHYLNQGGDYRIKGVDDAAEYRTTIDALKMVGFAQDTQ
                     HQLFKILAALLHIGSIEVKKTRNDSSLSSDEPNLQIACDLLGIDAYGFSKWITKKQIT
                     TRSEKIVSNLSFNQAIVARDSVAKFIFSALFDWLVENINTVLCNPEVSNQVSSFIGVL
                     DIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYMNEQIEWSFIEFNDNQP
                     CIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVV
                     SHYALDVAYDVDGFIEKNRDTVSDGHLEVLKASKNETLLAILDTIDNNAAALAKKQEA
                     NKKPGPARMVKKPTLGSMFKQSLIDLMTTIDSTNVHYIRCIKPNEDKEAWKFDNLMVL
                     SQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSENWTKIFTSEATEDDIRDLC
                     KQILDVTVKDSTKYQLGNTKIFFKAGMLAYLEKLRGTKMHNACVMIQKKIKGVYYRNK
                     YLAIQSAIHKSQAAVAGALCRQRVDYEIKTLAATSLQSLLRAHTQRKHLKNTFCSIIR
                     VQSLVRRRITQKELLERREFDAAIAIQKKIRGFVPRKHFNTTRGSSVRIQSLVRRKLA
                     QKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLADKVKENREMTSRIEELQKSLSE
                     SANIKTLLESQKEEHSRDLQEQKNSHDAELANKRAELEQAKEEIAAAKQEIDSLMTKQ
                     EELRNDVRLKIENLNKAQQEYADAQTQNSDLKNEVKSLKDEISRLQATIRSGVSANTA
                     LAHTPTKNRRFSTHSSLADGMSPRQLNVISMNNGMEDDVRSTASALSQINDELYKILE
                     DTKSLNTEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRLGLTKQSES
                     FLAEAMSTIQKLVTGLKGEDMICHGAFWLTNVRELYSFVVFAQESILNDDSYNSGLNE
                     DEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIANES
                     SQFLPKLFTQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLKYVDSICFND
                     LIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQASKLLQLKKANLDD
                     IDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKSESSLSSNGKSQT
                     HSSDIFLHVENGPFEDPFSLIETRRFGKIEAYIPAWMNLPLTRRVVELVTQHVTVQEV
                     ERAS"
     gene            <206308..>207483
                     /locus_tag="KLTH0D02090g"
                     /db_xref="GeneID:8295035"
     mRNA            <206308..>207483
                     /locus_tag="KLTH0D02090g"
                     /product="KLTH0D02090p"
                     /transcript_id="XM_002552769.1"
                     /db_xref="GeneID:8295035"
     CDS             206308..207483
                     /locus_tag="KLTH0D02090g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D02090p"
                     /protein_id="XP_002552815.1"
                     /db_xref="GeneID:8295035"
                     /db_xref="UniProtKB/TrEMBL:C5DG35"
                     /translation="MPSANEGLGLSPYHRYSQHGSAKISSVSNSDIPRHSFHLRCSAE
                     RNAVTEHDFTSASAGKFSDCLFHSCQGGSAGLNGAASSSSPSLSSIHNTDKAPYSSSN
                     SLLNPGSARSGNTARNSSYEPPYLSAPRLRNDRKRLVHQFLNFEEEGQSKHDAQVSLA
                     SQHSLIYENSRGESLSQIVLKDLKEIPTCQDSNLDLVRSQSKAKSTALSCQPIMSEIS
                     KFDSSLKDLILSISSKDNEMSRSFNDLDVLQHNIQETRAIIQSIQSQVKENDLSRLKG
                     SFEAGSDTSFIKRFSAAISAYSDSLTSFEERIAKCKAELAAQKATVHKLETTIKLNEM
                     LEDSNTNKCTIDRIREYRGIITDAVGLLFLALVIITLKRYLAGRNSSSTYKLHVPEH"
     gene            <207735..>208643
                     /locus_tag="KLTH0D02112g"
                     /db_xref="GeneID:8295036"
     mRNA            join(<207735..207816,207874..>208643)
                     /locus_tag="KLTH0D02112g"
                     /product="KLTH0D02112p"
                     /transcript_id="XM_002552770.1"
                     /db_xref="GeneID:8295036"
     CDS             join(207735..207816,207874..208643)
                     /locus_tag="KLTH0D02112g"
                     /note="similar to uniprot|P39735 Saccharomyces cerevisiae
                     YAL027W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D02112p"
                     /protein_id="XP_002552816.1"
                     /db_xref="GeneID:8295036"
                     /db_xref="InterPro:IPR021624"
                     /db_xref="UniProtKB/TrEMBL:C5DG36"
                     /translation="MVQVQSGVVLPIRIFINRQQVAKTIQDSSTSFETPLLPNNSIIR
                     LKSPLIRVYLSNTDARDLCNDIKKEILLIIYELTSKDVHDTVTGKLKIGNCVDIKEAF
                     GKTRAFSFLYDSDPDRCNLTTLERIGKHQYKLHYDKNWELDIFITDLRKLARIRSVLL
                     ARMSWQGSVFPGAAIPVGDLSGTRILRRCREEIMSKKSPTDEPSILLESDDEGALLDT
                     AAVDSSTSTTTRPLKEADLDEDKKPAFKFIHSPMVNLGNCIDIHVLKRPKRARTNRSQ
                     AHLDVET"
     gene            <208745..>210118
                     /locus_tag="KLTH0D02134g"
                     /db_xref="GeneID:8295037"
     mRNA            <208745..>210118
                     /locus_tag="KLTH0D02134g"
                     /product="KLTH0D02134p"
                     /transcript_id="XM_002552771.1"
                     /db_xref="GeneID:8295037"
     CDS             208745..210118
                     /locus_tag="KLTH0D02134g"
                     /note="highly similar to uniprot|P54885 Saccharomyces
                     cerevisiae YOR323C PRO2 Gamma-glutamyl phosphate reductase
                     catalyzes the second step in proline biosynthesis"
                     /codon_start=1
                     /product="KLTH0D02134p"
                     /protein_id="XP_002552817.1"
                     /db_xref="GeneID:8295037"
                     /db_xref="GOA:C5DG37"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR020593"
                     /db_xref="UniProtKB/TrEMBL:C5DG37"
                     /translation="MSSTAEIIAKNARLGGNTLKTISNENRSRLLYKIHDGLKANAKS
                     IKEANQLDLQKAKEDSLADSLYKRLDLFKGDKFDTMLIGIKDVAELEDPVGKVRLARQ
                     LDENLDLYQVTAPVGALLVIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREIS
                     RIINTVISENEESTGIPASVIQLIETRQDVSDLLQQDLYIDLVVPRGSNELVRKIKSS
                     TKIPVLGHADGICSIYLDSEADLAISKRITIDAKTSYPAGCNAVETILVNPEMPKWWE
                     VLENLSKVGGVTLHVSADVKASYLDFLKQSGAQDDDAQGKIVDADESKDFDREFLSLD
                     CAVKFVHSTEDAIAHINQHSSKHTDAIITENKAKAELFMKGVDSSGVYWNASTRFADG
                     FRYGFGTEVGISTSKIHARGPVGLDGLVSYQYQLRGNGQVASDYIGSGGKKAFIHKNL
                     DISNLRL"
     gene            complement(<210244..>214179)
                     /locus_tag="KLTH0D02156g"
                     /db_xref="GeneID:8295038"
     mRNA            complement(<210244..>214179)
                     /locus_tag="KLTH0D02156g"
                     /product="KLTH0D02156p"
                     /transcript_id="XM_002552772.1"
                     /db_xref="GeneID:8295038"
     CDS             complement(210244..214179)
                     /locus_tag="KLTH0D02156g"
                     /note="highly similar to uniprot|P39524 Saccharomyces
                     cerevisiae YAL026C DRS2 Integral membrane Ca(2)-ATPase
                     potential aminophospholipid translocase required to form a
                     specific class of secretory vesicles that accumulate upon
                     actin cytoskeleton disruption mutation affects maturation
                     of the 18S rRNA"
                     /codon_start=1
                     /product="KLTH0D02156p"
                     /protein_id="XP_002552818.1"
                     /db_xref="GeneID:8295038"
                     /db_xref="GOA:C5DG38"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DG38"
                     /translation="MNHQNRKSNEDTLFDIDFLDDEFTSAPRTDSSAGNPFQQAQVVD
                     SDYDLLEDIRRGTIPEETIDLDRHSANLPHEDNIENDIIQNPFLGEEGLNDHSQGIHR
                     APKKRSGLRNVFRKFNFGLIGNKNRNNYQGFEMHSYDDLGAEDRYARSRNKFDIKVLF
                     RRFILRRNELSDEDKSSPRQIFINDREANRARSYGDNHISTTKYNLATFLPKFLFQEF
                     SKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAVKEIVEDLKRAKSDNELN
                     DSRAEIFSDQLQDFSLNKWVNISVGDIIKVKSEEPVPADMIVISSSEPEGLCYIETAN
                     LDGETNLKIKQAKVETSKIIDTAELARMRGKVLSEHPNSSLYTYEGTMTLNGKNIALT
                     PEQMVLRGATLRNTAWVYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGV
                     LIVLALISSIGNVIKVTSDAKHLGYLYLQGTNKAGLFFKDILTYWILFSNLVPISLFV
                     TVEMIKYYQAYMIASDLDLYDEATDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM
                     EFKSCSIAGKCYIETIPEDKTPTMEDGIEVGYRKFEEMQEKLGEHSDPESGVINDFLT
                     LLATCHTVIPEFQEDGSIKYQAASPDEGALVEGAASLGYKFIVRKPNTVAIVLEGSGQ
                     EQEYQLLNICEFNSTRKRMSGIFRMPDGQIKLFCKGADTVILERLSESGNPYVEATLR
                     HLEDYAAEGLRTLCLATRTIPESEYSEWKAIYDEASTTLDNRTQKLDDAAELIERDLH
                     LIGATAIEDKLQDGVPETIHTLQDAGIKIWVLTGDRQETAVNIGMSCRLLSEDMNLLI
                     VNEETREATKKNLVEKLKAISEHQVSQQDMNSLALVIDGKSLGFALDSEIEDYLLSVG
                     KLCKAVICCRVSPLQKALVVKMVKRKTGSLLLAIGDGANDVSMIQAAHVGVGISGMEG
                     MQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANA
                     YSGQSIMESWTMTFYNVFFTVLPPFVLGVFDQFVSSRLLDRYPQLYKLGQKGQFFSVT
                     IFWGWVINGFYHSAVTFIGSILFYRNGDVLNMHGETADHWTWGVSIYTCSVIIVIGKA
                     ALITNQWTKFTAFAIPGSFVFWLVFFPIYASIFPHANVSTEYYGIVSHVYGSATFWLM
                     CIVLPVFALLRDFAWKYYKRTYTPESYHVVQEMQKYNIGDYRPRVEQFQKAIRRVRQV
                     QRMKKQRGFAFSQSEDSGQDKVIRMYDTTLKRGVHGELQDASANPFRDS"
     gene            complement(<214421..>215329)
                     /locus_tag="KLTH0D02178g"
                     /db_xref="GeneID:8295039"
     mRNA            complement(<214421..>215329)
                     /locus_tag="KLTH0D02178g"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_002552773.1"
                     /db_xref="GeneID:8295039"
     CDS             complement(214421..215329)
                     /locus_tag="KLTH0D02178g"
                     /note="some similarities with uniprot|P10962 Saccharomyces
                     cerevisiae YAL025C MAK16 Essential nuclear protein
                     required for normal concentration of free 60S ribosomal
                     subunits required for maintenance of M1 satellite double-
                     stranded RNA of the L-A virus"
                     /codon_start=1
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_002552819.1"
                     /db_xref="GeneID:8295039"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:C5DG39"
                     /translation="MSDEIIWQVINQHFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCP
                     LANAKYATVKNVDGRLYLYMKTAERAHTPAKMWERIRLSKNYAKALKQVDDHLLYWNK
                     FLIHKCKQRLTRLTQVAVTERRMELREEERHYVGIAPKVKRRDENRERKALAAAKIEK
                     AIEKELLDRLKSGAYGDKPLNVDEKIWRKVLGHVEDEQEDDEEEYDDEEEDESDAEIE
                     YVEDDGDEELVDVEDIERWLDDPEASDSDSFEEDEMSDSSEDEPESGFTSGKGKKGTS
                     AARKKRPRVEIEYEEETQPAHRELAH"
     gene            complement(<215729..>219868)
                     /locus_tag="KLTH0D02200g"
                     /db_xref="GeneID:8295040"
     mRNA            complement(<215729..>219868)
                     /locus_tag="KLTH0D02200g"
                     /product="KLTH0D02200p"
                     /transcript_id="XM_002552774.1"
                     /db_xref="GeneID:8295040"
     CDS             complement(215729..219868)
                     /locus_tag="KLTH0D02200g"
                     /note="similar to uniprot|P07866 Saccharomyces cerevisiae
                     YAL024C LTE1 Putative GDP/GTP exchange factor required for
                     mitotic exit at low temperatures acts as a guanine
                     nucleotide exchange factor (GEF) for Tem1p which is a key
                     regulator of mitotic exit physically associates with
                     Ras2p-GTP"
                     /codon_start=1
                     /product="KLTH0D02200p"
                     /protein_id="XP_002552820.1"
                     /db_xref="GeneID:8295040"
                     /db_xref="GOA:C5DG40"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5DG40"
                     /translation="MVPEDLQDEIEQGGRIFGTDDYYPMPSEEKLSFSKRGSSTLIIK
                     TDISALIVKLTSPMDPIDYPFLSDFFLSYRKFLAPQELLKLLVSRLQWAFNESLSADS
                     NKQQIGQIASVRTFVLIRHWILNYFAQDFLTDDALRSQFVNSVNSLSWGASDVAPKSI
                     CGIVINIKKSWGFCLRLMWEGLSFEDQPTSANEWLEFKIKDVATHLSTKNGKRLSFYA
                     LQSSQNPEFRNRSVLSLYVGKENFQLPEHNARVNTKQGAKIKQRTASMFLFPQDNLSS
                     AVLKVSNDKVGNSDEVSQNAPNSSGVSEVIKDLQYPPSPSIDKVIPPTPAKKVEFILR
                     SSYFPSEILSEEEANTSSTSQKLKKEPHLHSYNKGMMGLLSKWKKNHTLRSANQKINQ
                     ESPSAEFENLIKLVFSITSLENKQYSSEELKSVVSSKFDILSARTIDEVEYFLAVEND
                     LLSKIRKQDHFTTVEGGADEQTQERDAETVSAMDNLNLYKTVSSIASSVISLSKTLQF
                     QHAVSPSAAARERRRVRSTDGLLGNKSVLNFTDALLTSDVNTRILENDAPRKLVFHGH
                     STTRERHTNSELKFRYSNMADAVIRLNHSTPSVMQTSALTKSTNGTRSRGSPTKGVRI
                     SSSITEIDDTFSKHNESTPQAEEVSNAGSHISRPLKRKESLDNLREFNFEENFDQKNG
                     SQSKLDHKINHNELQSDADDDNSSFFTTLDDMSMSRNSKHMTPASSAAQKSVTSSGRI
                     SIIRSRGPSVSNAVTISTTNLVAKDGAFLKLDEELLNNQEEIRNLEERTSALFFDKVE
                     EEGAKNIRSSIATSVSTQLLFSSKQSSPNKIEKNDLLDNDEFPQGNKLIRLSSIPSMH
                     SIVSGDSFSSFHTINSFEQNSRADISHKLTVDTPSTGAKPEKNAPNDSLLVPDAEGSS
                     GNKYLFSPDTDSLDFASPEKNMEDLKNKFISPITSETTSFNEDDLSRDNEGEEGEPTE
                     EQQLDNGYQEKPHNEHHRRSITPIVSPYKANDSRLNRFAKLTDESLHGDPVNVALMKL
                     EGTFSKTDQNKEQSDSDMERLKERRLTGLGARERNSFLIERRRQVKSEVPFTPCTKDF
                     SYERDQKVTNDQITELLQNYKIQDSRLNISNAEQHVPFILMYDSKSIAEQLTLIEREI
                     LNEIDWKDLLDLRVKRKVLPVTSWLQLLLQNEQLSGIDLAIARFNLTVDWIISEIVLT
                     RDNKLRRNTIQRFIHVAEHCKLFQNYNTLMQIVLALSSLVVQSYRDAWRLVEPGDLLS
                     WESLKNVPSLEKNYYNIRMLLNDIEPIKGCIPFIVVYLSDLTLNSEKSNWITPHQVLN
                     YSKFQTNVQIVKNFIQRAQWSKFYNISVNDELLSKCVYISCLTHEEIDHLKSQQTKSA
                     T"
     gene            <220570..>223113
                     /locus_tag="KLTH0D02222g"
                     /db_xref="GeneID:8295041"
     mRNA            <220570..>223113
                     /locus_tag="KLTH0D02222g"
                     /product="KLTH0D02222p"
                     /transcript_id="XM_002552775.1"
                     /db_xref="GeneID:8295041"
     CDS             220570..223113
                     /locus_tag="KLTH0D02222g"
                     /note="weakly similar to uniprot|P52960 Saccharomyces
                     cerevisiae YOR363C PIP2 peroxisome induction pathway 2
                     (PIP2) transcriptional activator of peroxisome
                     proliferation may form heterodimer with Oaf1 to activate
                     oleate-inducible gene expression activator of peroxisome
                     proliferation"
                     /codon_start=1
                     /product="KLTH0D02222p"
                     /protein_id="XP_002552821.1"
                     /db_xref="GeneID:8295041"
                     /db_xref="GOA:C5DG41"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DG41"
                     /translation="MDRNGLTNSTSSDSLELAVRSKKSRLRLSFVCRNCRKRKIKCDK
                     AQPKCGRCAKLGLECNYDLSEQISLKKTPGRPVTIHEQLEELEHKFEDMRHSLNLSGM
                     RAWNEDLDNRSKPIKINFFVGLQPNCFESIFKRDCKPFSDMGMIQKHKRLNPFLKFVT
                     RSFKPLNYAVKKILQSVGDSLDPHSDELESVAEILFLTPQVREVLKQHSMNPEGITQE
                     TANAIRRCLLEKGSRGDEKSLFEPVDLEFSSSKISQAELIDQIVAVLPPRDQIEHLLA
                     YFMKVVYPLVPYVNKSCFFRRVTETIKYSENGKVIGLDIGDYQDAIRKIGCMAIFLVV
                     LRISHTALTLVKNLPYNGEHLDRFISVSQKCLAHLITLSHKTNEDILSCLILMRWSLI
                     YSPTEGEVVAGSVTDMLLSLIVNHAIRIGLYRDRIQANGPKKNDKMERYFIHYRAKLW
                     MGCLILLRSDLFLKGNFPVVSPEYAAMAPKEENPENYEDEAEAQIHRILHKQLDIYSK
                     MSILDKLTLQVEESTDIEEIYSKIRRLEYDLQSYCPLSDVENLNNTTLENTIIQSMNN
                     ALYFKVNVMVKIYFLAIRASIVAILERQITEALTDTEHLSLRYREVTAECFESAVDLC
                     EILCAYMSVADDDQNSPVMPDHRYILNQIVQIGIFRVSYYFIGVILTLLQVKNGLENF
                     MWQNENKQSLVTEIEYKITLIESTSKAIFQSVQKLIHLGSHTLSDRYFTSFKQFLFLE
                     YAMQVIQNEINPNTPSRLREVLGDIGLPVAMDYSPSDWEKFASYVKKAIGQAEPTPPF
                     TSSDDIPSAPSTHAKSAPNDPALDSMLLFDDQVNIQNMLDGDYTWTDFI"
     gene            <223460..>225718
                     /locus_tag="KLTH0D02244g"
                     /db_xref="GeneID:8295042"
     mRNA            <223460..>225718
                     /locus_tag="KLTH0D02244g"
                     /product="KLTH0D02244p"
                     /transcript_id="XM_002552776.1"
                     /db_xref="GeneID:8295042"
     CDS             223460..225718
                     /locus_tag="KLTH0D02244g"
                     /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
                     YOR322C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D02244p"
                     /protein_id="XP_002552822.1"
                     /db_xref="GeneID:8295042"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:C5DG42"
                     /translation="MVFSKLGHQSDKKSASNGALDRVFSDSSNDGLVELLIDIESPPC
                     VLYGSATESTGALLSGLLKLRVRSRSDHISHSEPLTPTTSHGRKKKSSSGLNALSQTL
                     SNLSLSNSAMSPVTSPKPSRTSSMMFTKVSVKSVSLSLVQKVRYTKPFVAHSSSIQSC
                     LNCRMKQTELARWDIVKKETEIPVGDHAYPFSHLIPGSVPATVCLGSEAHTEVKYELV
                     GEATYRAVPSHNSRGEKTSTVHLKLPIPVTRSILRGPDKNSLRIFPPTDLTATVVLPN
                     IVYPKSTFTLELKLDGVSSEGRRWRMRRLNWKIEEKGRVRLQACATHKGKLKQLEKEV
                     KETETGKKPSKGKPLKRTHDAAPQVTTTVCTLEDALSMTNAPEDPNAPDETETQEETS
                     NRNQGEDDGLIHPSDSAMRQARVEEQQRLRQEMLQKELSEGTALFTEELRTIAHGEVK
                     NGWKSDFTGSGKIELVTEVNCMGLNSGVSNPVNRASSSKPVHDNGRQHVTVACDVEDP
                     HLGIYVQHLLILEIIVAEEALQYANGQPLHTEHSPLTKTSSNATNPDQRLAELSPMLA
                     ARSSVPQNINDEAHPNQPEHGAPSPHSASRRNSNSRIVGVPTGAARVLRMQFRLNITE
                     RSGLGISWDDEVPPTYQDVRLLSPPSYNNATSGSNTPLVHSDMDRNDYSTRTNFNSGR
                     SEFTELSRPPQAHAYDSPYQSLSPVQSPQLENVVSIQGNAHHTHLLTPQNTQEVHLPS
                     LSELLDTDRITQ"
     gene            complement(<225886..>228108)
                     /locus_tag="KLTH0D02266g"
                     /db_xref="GeneID:8295043"
     mRNA            complement(<225886..>228108)
                     /locus_tag="KLTH0D02266g"
                     /product="KLTH0D02266p"
                     /transcript_id="XM_002552777.1"
                     /db_xref="GeneID:8295043"
     CDS             complement(225886..228108)
                     /locus_tag="KLTH0D02266g"
                     /note="highly similar to uniprot|P31382 Saccharomyces
                     cerevisiae YAL023C PMT2 Transfers mannosyl residues from
                     dolichyl phosphate-D-mannose to seryl and threonyl
                     residues in proteins acts in complex with Pmt1p dolichyl
                     phosphate-D-mannose:protein O-D-mannosyltransferase"
                     /codon_start=1
                     /product="KLTH0D02266p"
                     /protein_id="XP_002552823.1"
                     /db_xref="GeneID:8295043"
                     /db_xref="GOA:C5DG43"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DG43"
                     /translation="MSSTGFSDRTSDGSLKQRNVSKIDQISDSEAEDAPKDIKVQTSP
                     LAHLESIVMPIVFTLLGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPL
                     GKMLVGLSGWIAGYNGSWDFPSGEEYPEYLDYVKMRIFNATFSALCIPVAYFTAKAIG
                     FSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVTSMLCFVTFHNQRSKPFSRKW
                     WKWLLLTGLSLGCAISVKMVGLFIITLVGIYTVIDLWTMLSDKGVSKKTYVNHWLARI
                     LCLIIVPFLVFLACFKVHFDLLSHSGTGDANMPSLFQAGLVGSDVGVGPRDVALGSSH
                     VSIKNQALGGSLLHSHVQGFPEGSNQQQVTCYGHKDSNNNWIFDRIRPLPFWTEEETE
                     IEYVVPGESYRLVHPNTGKNLHTHPIPAPISKSAWEVSGYGSATVGDPKDHWVLEVVA
                     QYGSENQSRVHPLTSSFRIKNAELGCYLAQTGESLPEWGFRQSEVACLKNPFKRDKRT
                     WWNIESHTNERLPDRPADFQYPKLNFIKNFIHLNLAMMATNNALVPDPDKLDTLASSA
                     WQWPTLNVGIRLCGWGDETVKYFLMGSPASTWPSTAGVLAFMVLVVVLLLRWQRQYAD
                     FSSPRDFNLFMMGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALLILCYLFEAG
                     LKNLQKHKGGRLARTLIYFTYGAIVICGFYYFSPISFGLVGPSSNYAYLNWIKTWTIK
                     "
     gene            complement(<229079..>230371)
                     /locus_tag="KLTH0D02288g"
                     /db_xref="GeneID:8295044"
     mRNA            complement(<229079..>230371)
                     /locus_tag="KLTH0D02288g"
                     /product="KLTH0D02288p"
                     /transcript_id="XM_002552778.1"
                     /db_xref="GeneID:8295044"
     CDS             complement(229079..230371)
                     /locus_tag="KLTH0D02288g"
                     /note="similar to uniprot|P31381 Saccharomyces cerevisiae
                     YAL022C FUN26 Nucleoside transporter with broad nucleoside
                     selectivity localized to intracellular membranes"
                     /codon_start=1
                     /product="KLTH0D02288p"
                     /protein_id="XP_002552824.1"
                     /db_xref="GeneID:8295044"
                     /db_xref="GOA:C5DG44"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DG44"
                     /translation="MDNFREGSPSTELHRHIGEELELENATLWVKLQDLNYTTFLLIG
                     IALLWPWNSFLSASLYFQHDVFHDKTVFAKIYISTMMSISTISSVIFNYWLSKRQHSY
                     SRRIVRGLIWEIMVFGLLSMFVFVHKSLPDWLNFTFLMSTVLVSSLGTAMTQNGAMAL
                     ANVFGPQFSQGVMVGQAVAGVLPSLVLFLVSYIGDPRDQSVGGIFAYFGSTVLVSVAC
                     IVLYRVSSIGSADKHDFLNRELDPEATVSVPFSLLFDKLRYLVLSIFTTFVVTLLFPV
                     FAANTFVSGLPMRNAQYIPFIFTVWNLGDLYGRAISDYSFFQSPSFTPFKTFLYSIAR
                     IGLVPLFFCFNLNSSARPSSSFSAIVSDLLYILLQFAFGVTNGNVLSVSFMKVSSQLN
                     SDKQRKAAGGFTNIFLSAGLAFGSLLSYLFTYIVLSKS"
     gene            complement(<230632..>232851)
                     /locus_tag="KLTH0D02310g"
                     /db_xref="GeneID:8295045"
     mRNA            complement(<230632..>232851)
                     /locus_tag="KLTH0D02310g"
                     /product="KLTH0D02310p"
                     /transcript_id="XM_002552779.1"
                     /db_xref="GeneID:8295045"
     CDS             complement(230632..232851)
                     /locus_tag="KLTH0D02310g"
                     /note="similar to uniprot|P31384 Saccharomyces cerevisiae
                     YAL021C CCR4 Component of the CCR4-NOT transcriptional
                     complex which is involved in regulation of gene expression
                     component of the major cytoplasmic deadenylase which is
                     involved in mRNA poly(A) tail shortening"
                     /codon_start=1
                     /product="KLTH0D02310p"
                     /protein_id="XP_002552825.1"
                     /db_xref="GeneID:8295045"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DG45"
                     /translation="MNNPAPMMGYSGLAGQQNAVQPAIPSVIGTPGTMHQQLHMQQPH
                     MQNPQQAQNAQVQQPLPPGLVNGGQPIMGLTNSAGAGVANVTSNAGNPLYHPHQGDPA
                     LLNNPIWKLQLQLAAVSRQSAGRANVYARQSAMRKYLLNKNQGAAGTLNEMSASLVDH
                     TKQLLLDMAGEPAGSLNNTSSSAASTPITPNAELSNGNPTTPSLLLQHKKLSQYNIDE
                     DDEIEHRMVAPTDTKHDDQLWHALDLSNLQVFNLTESLFKYEFLTRLYLNGNNLTTLP
                     KSVKALTNLRVLDVSHNKLTELPAELGLCHQLKYLYFFDNMVSSLPWEFGNLFNLQFL
                     GLEGNPMDRQIIKILTEKSVTGLIFYLRDNAPEIPLPTERKFIDINIDGEATQECSSL
                     QESDAHQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSY
                     NTDIVCLQEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKD
                     SEFKLMFKEAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHIKSGEHVWAAT
                     THLHWDPQFNDVKTFQVGVLLDYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQTNSA
                     VYELLNTGNVSKHRDIEGRDFGYMSQKNYAHNLPLKSSYDSIGELPFTNLTPTFTDVI
                     DYIWYSSQGLRVRGLLGEIDPEYASKFIGFPNDKFPSDHIPLITRFEFTKGGGSRKA"
     gene            complement(<233733..>234704)
                     /locus_tag="KLTH0D02332g"
                     /db_xref="GeneID:8295046"
     mRNA            complement(<233733..>234704)
                     /locus_tag="KLTH0D02332g"
                     /product="KLTH0D02332p"
                     /transcript_id="XM_002552780.1"
                     /db_xref="GeneID:8295046"
     CDS             complement(233733..234704)
                     /locus_tag="KLTH0D02332g"
                     /note="weakly similar to uniprot|P31386 Saccharomyces
                     cerevisiae YAL020C ATS1 Protein with a potential role in
                     regulatory interactions between microtubules and the cell
                     cycle as suggested by genetic and physical interactions
                     with Nap1p and genetic interactions with TUB1"
                     /codon_start=1
                     /product="KLTH0D02332p"
                     /protein_id="XP_002552826.1"
                     /db_xref="GeneID:8295046"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:C5DG46"
                     /translation="MITPQSTFKSLSKPLKVTGGGNFTAILLENGELYVAGECTLVSR
                     EKTAGWCQIEGLFRDVACGWSHIIAVTCEQEVVTAGIGVKGELGLGSKNKTNQFERVL
                     AVQSPGAQVFACFYNTYVQDGGKLYGWGSNTKCQVLSPKSKAVSCPALVYEGKISNVC
                     VGKNSVCFVGDGLIRAQGAIAKYLPQMRSEPVLGEKLELRSMWTSITAFDHRNFRFFG
                     PAGQMQDAITFCKQPPAYAVSCWGTGSEHGVMCCEDRVYCWGWGEHGNCGPTNATTAA
                     SLTSGINDQSNTKSGVNMVYITSHQEEVVSCFGGCATTWICIKKTGA"
     gene            <235169..>238312
                     /locus_tag="KLTH0D02354g"
                     /db_xref="GeneID:8295047"
     mRNA            <235169..>238312
                     /locus_tag="KLTH0D02354g"
                     /product="KLTH0D02354p"
                     /transcript_id="XM_002552781.1"
                     /db_xref="GeneID:8295047"
     CDS             235169..238312
                     /locus_tag="KLTH0D02354g"
                     /note="some similarities with uniprot|P31380 Saccharomyces
                     cerevisiae YAL019W FUN30 Protein whose overexpression
                     affects chromosome stability potential Cdc28p substrate
                     homolog of Snf2p"
                     /codon_start=1
                     /product="KLTH0D02354p"
                     /protein_id="XP_002552827.1"
                     /db_xref="GeneID:8295047"
                     /db_xref="GOA:C5DG47"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG47"
                     /translation="MSSMTPKKDEEIQVPGSSPVEDTKVASSSPLKTDSSTAALLRDK
                     FVYKPLERRELGANLKNGSGDNASDNSGGHSDADVAKLINEYPDFSETLVKAVFKSNS
                     YDLNLTRERLRRIHSQKSSRSWAWRPGEKKPTSRLMSLGSYSDSVNTSSNGGHVPRHS
                     STIVASPEKSSKVTLEKQKTSIFDRYSHVMNQRHKPTMESVVVDPSTISQLEPSTRKR
                     RKLLRADDPNRDPSMAAISNTKKSSVSLSDEDEDEISGDENVSGEDYQEYTPDVNIDD
                     EILKFINDADEKDIADVADTTLDKASMVVKSRPFKSLVEFSQMDFLTEQEIQKQQEKK
                     KSSRRGQQKKDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGSLIASQIQKWGVNVEDIQ
                     SGELNFIDIGDDESESDEGAEIGITQESGSTGITKKSGKTKKSGDESDFDDEEDDYQD
                     SEDEDYGSRRTRHSGRGRGRPKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYQ
                     NNMSCILADEMGLGKTCQVIAFLSYLKQNNEHGPHLVVVPSSTLENWLREFNKFCPDM
                     KIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKHDVSFLKNRGFNAVIYDE
                     GHMLKNSMSERFNKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFVSKKSDLS
                     AVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYC
                     EMTDVQRSIYNKEIQQVLEHKKMVKEREERGETAPLPSKNGGAQASKNLIMSLRKASL
                     HPLLFRHIYDDKVLDKMSRAILKEPEYAENGNKEYIQEDMSYLNDFELHRLCLKFPKS
                     LGKFQLKNDEWMESGKIGALGKLLKDIIEHKKEKVLVFSLFTQMLDILEMALTTLNIN
                     FLRLDGSTQVNDRQALIDKFYEDESIPVFILSTKAGGFGINLVCANHVIIFDQSFNPH
                     DDKQAADRSHRVGQTKTVHITTLVTRNSIEEKILQLAKNKLALDTYISEDDNKATEAL
                     ENKVSDMLEDIIYDESK"
     gene            <238729..>241989
                     /locus_tag="KLTH0D02376g"
                     /db_xref="GeneID:8295048"
     mRNA            <238729..>241989
                     /locus_tag="KLTH0D02376g"
                     /product="KLTH0D02376p"
                     /transcript_id="XM_002552782.1"
                     /db_xref="GeneID:8295048"
     CDS             238729..241989
                     /locus_tag="KLTH0D02376g"
                     /note="some similarities with uniprot|P19659 Saccharomyces
                     cerevisiae YOL051W GAL11 Component of the Mediator complex
                     interacts with RNA polymerase II and the general
                     transcription factors to form the RNA polymerase II
                     holoenzyme affects transcription by acting as target of
                     activators and repressors"
                     /codon_start=1
                     /product="KLTH0D02376p"
                     /protein_id="XP_002552828.1"
                     /db_xref="GeneID:8295048"
                     /db_xref="GOA:C5DG48"
                     /db_xref="InterPro:IPR008626"
                     /db_xref="UniProtKB/TrEMBL:C5DG48"
                     /translation="MEADWRTTLSNQERSKYITELAQILAQISQVNGGDRGNFNLEKL
                     KKTAEQFEKSLYASSSSKELYLDSMRKRIAAMDTAKKKAIANIQHNAANVAAHQQSQQ
                     QAAVAAAQSAQQQRASQFPPSNMNSQMFFNQQAQVRQQAAQQFRNGVGSNMPVNSAPT
                     RPQLTPQQQQLINEMKGAEIPRELLQRIPNLPPGVNTWQKVTELAQQKRLGPKDLQIA
                     KQVYKMHQQIVFKSKMQQASANNRGIPQQRAMPQGPNMAQMPQPRSVVNQPLQQQQHQ
                     QQQQQQQHQQHQQQQQQQQQHQQHQQQQQQQQQHQHQQHQQQQQQQQQQRQTGQVPQP
                     SGQEMPNVLNRLNQIFTPAEQKALYENGKKLIEDLQRTNRLPTVLTPQQQAIYIKKYI
                     NQMALKKLQAARMNQMGTTNPQQQMAPAPAPQGQSVPAMSQFTSNVAPSNANLAGMAQ
                     RRAYERANAGGASDVNSVGSSTQAQLSSGSSQQAPPAQQQPQPQPKFSLPRPTEQDLM
                     VLRRISAEIQKSHLRLSNITNQISQEQKQAIRNKLQLNRQLFTNVDSFIPTLYMITRN
                     EENVRQLLQIRMLAKEITEHATRGVFIVPPEVVDKVIFRYQKYYEFIKDQVLRRHQQI
                     IAARQQQQQQQQAPSTTIDPAFNQQRIQGSFQQIQQQMQMRQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQKIQPSPQLNNWTRLNADGRSTSGADGDNAVAPQ
                     TAPEHVRRSSSGMDFLNSPEFMNARSSPQQPGLSPAKKQAQMRKKMAMKQVPGQGTPG
                     STVPTSNNTPVPVSGPVPAVASRTGTPQVGTAGISSISPMVNRATGLNQSPSPRSHPN
                     GTLPPPADYPYKEDEENLKKMAIRKTEIIARFKCRQEILGKSSVDLFLCSLGDCLGLP
                     SASVDLISPIPSEIVEHVNGGCKGKNNGAPGQRVKGQDLTDVSIVNNSIVFADSNSPE
                     AKAEPYVIGLNDVASVFRDVYGSTDLSSFSFETKTFSGEGGAKKRKAGDLDNSPDASP
                     ASSAIMSESKKLKIDSPEDMYFTAPGEDTKQLLTKSGAMKFSPENKIWDWSFWETS"
     gene            <242227..>243681
                     /locus_tag="KLTH0D02398g"
                     /db_xref="GeneID:8295049"
     mRNA            <242227..>243681
                     /locus_tag="KLTH0D02398g"
                     /product="KLTH0D02398p"
                     /transcript_id="XM_002552783.1"
                     /db_xref="GeneID:8295049"
     CDS             242227..243681
                     /locus_tag="KLTH0D02398g"
                     /note="similar to uniprot|Q08220 Saccharomyces cerevisiae
                     YOL049W GSH2 Glutathione synthetase catalyzes the
                     ATP-dependent synthesis of glutathione (GSH) from
                     gamma-glutamylcysteine and glycine induced by oxidative
                     stress and heat shock"
                     /codon_start=1
                     /product="KLTH0D02398p"
                     /protein_id="XP_002552829.1"
                     /db_xref="GeneID:8295049"
                     /db_xref="GOA:C5DG49"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:C5DG49"
                     /translation="MVGEYPKFPQFSRSEISEQLVPEIRHWALTNGLVMYPPNPNFVQ
                     GAVAPTTLYPTPFPRQSFDQAISVQTLYNGLYAKIAQDQDGWLSKEIESLAEFDPEFT
                     GRLWNLYVQAKEKGISQKLALGVFRSDYLLDVGNLEVKQVEFNTVSVSFGGLSTRVGQ
                     LHKFLNDSGRYSGGSGRPFYREEIPVSDSAFLLAKSLADAAHHFQASNDTTIVAFVVQ
                     KGERNVFDQRILEYNLFEHFGIKSVRLTIHEVNTKTFVDPDTSRIYYKPSGEEISVVY
                     FRAGYSPSDFVEEQDWQNRLTLETSYAIKAPNLLTQLAGAKKIQQLLTDESILQCFIS
                     DASARRKLGSSFVKIHPMDNSEAGLSARKLALKSPERFVLKPQREGGGNNIYKGDIPA
                     FLRSIPEQDWSGYILMELIKPKPTTENFVVKADQFAQEPILSELGIFGYVLFDESTIY
                     LNEYAGWLLRSKSSSSDEGGVAAGFGCVDSVVLY"
     gene            complement(<243691..>244697)
                     /locus_tag="KLTH0D02420g"
                     /db_xref="GeneID:8295050"
     mRNA            complement(join(<243691..244410,244482..>244697))
                     /locus_tag="KLTH0D02420g"
                     /product="KLTH0D02420p"
                     /transcript_id="XM_002552784.1"
                     /db_xref="GeneID:8295050"
     CDS             complement(join(243691..244410,244482..244697))
                     /locus_tag="KLTH0D02420g"
                     /note="similar to uniprot|Q870H5 Saccharomyces cerevisiae
                     YOL048C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D02420p"
                     /protein_id="XP_002552830.1"
                     /db_xref="GeneID:8295050"
                     /db_xref="UniProtKB/TrEMBL:C5DG50"
                     /translation="MSDAHLVAPLNNNSATAATTAPAEAEVHLVKRLRRETFVQALAV
                     KLRRRVSYVRKNFLFGLFVDQTYVYPVLGFLRFVVTPSFWLYSFVLAFCFAFIFVTVA
                     VLYYLFLLPILLIWAVSTLGPVGFVIVHIQWLLQSNALAITLTNILIAPIFADSIFDA
                     TLTKLGHAEFLERAKHLPVTSPKQASWRSLEFWLVVFPSKTVSLMFSLSSKVALSMLS
                     LIPIVGPTIVNQLLSPTRGFSYGKRFYVLKNLSGSQLKDKFYEHLGQYTAFGMMAGLL
                     ELIPIMSIITIPSNVIAGALWASNELKKGEMSINA"
     gene            complement(<244834..>245499)
                     /locus_tag="KLTH0D02442g"
                     /db_xref="GeneID:8295051"
     mRNA            complement(<244834..>245499)
                     /locus_tag="KLTH0D02442g"
                     /product="KLTH0D02442p"
                     /transcript_id="XM_002552785.1"
                     /db_xref="GeneID:8295051"
     CDS             complement(244834..245499)
                     /locus_tag="KLTH0D02442g"
                     /note="some similarities with uniprot|P31379 Saccharomyces
                     cerevisiae YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D02442p"
                     /protein_id="XP_002552831.1"
                     /db_xref="GeneID:8295051"
                     /db_xref="UniProtKB/TrEMBL:C5DG51"
                     /translation="MIIFLIYVSKFLLFTLLYYFTLFPFVLGISTVLFGPLGITIAVV
                     HSMLHVNLYATSVTRVGCLGHAAAILEKLFTDKGTPKENIRRLHQPAYPVVLEKRNWT
                     QSLSIFAAKTMAHFIIFSVLLCISLIPIIGIVLAKLLRSAPIGYDYYLIHLARRKALE
                     KRGRDEFYREIGKFTAFGIVSGALELIPILSGITITSNFLGSGICVLEQSQSFENSSL
                     SSI"
     gene            complement(<246019..>247056)
                     /locus_tag="KLTH0D02464g"
                     /db_xref="GeneID:8295052"
     mRNA            complement(join(<246019..246765,246832..>247056))
                     /locus_tag="KLTH0D02464g"
                     /product="KLTH0D02464p"
                     /transcript_id="XM_002552786.1"
                     /db_xref="GeneID:8295052"
     CDS             complement(join(246019..246765,246832..247056))
                     /locus_tag="KLTH0D02464g"
                     /note="similar to uniprot|P31379 Saccharomyces cerevisiae
                     YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D02464p"
                     /protein_id="XP_002552832.1"
                     /db_xref="GeneID:8295052"
                     /db_xref="UniProtKB/TrEMBL:C5DG52"
                     /translation="MSFTGSLVLSGIGGLVFKYGGQQSEKEKDVPTGFRDLTLGFIEA
                     KGKLIRERSEAVTINFWRELVQTGAYQYPIRGISELFSSGIYFFSSARCFGFYLVLYL
                     TTALLYFLTILPMYLACFAFLGPLGLAVAYVQFLLQSNMLAMMVMRTTQLNNPLFDEC
                     LIKNGKEAFVKTALQKPTLPVRFYVPFNTYYFWLNYLPWRIAVYTLGFLSIVALLSIS
                     FIPIAGPIIFNALISPFIARIYFSRFLRLKKLDNKQRNDEFYLNFGTYVSFGFVAGQL
                     EVLPFVSGFTYSSNMVGSGLFAIKTLDSESLVPVTLESHLENARTFS"
     gene            <247566..>251237
                     /locus_tag="KLTH0D02486g"
                     /db_xref="GeneID:8295053"
     mRNA            <247566..>251237
                     /locus_tag="KLTH0D02486g"
                     /product="KLTH0D02486p"
                     /transcript_id="XM_002552787.1"
                     /db_xref="GeneID:8295053"
     CDS             247566..251237
                     /locus_tag="KLTH0D02486g"
                     /note="similar to uniprot|P31374 Saccharomyces cerevisiae
                     YAL017W PSK1 One of two (see also PSK2) PAS domain
                     containing S/T protein kinases coordinately regulates
                     protein synthesis and carbohydrate metabolism and storage
                     in response to a unknown metabolite that reflects
                     nutritional status"
                     /codon_start=1
                     /product="KLTH0D02486p"
                     /protein_id="XP_002552833.1"
                     /db_xref="GeneID:8295053"
                     /db_xref="GOA:C5DG53"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DG53"
                     /translation="MPCTSPPLSPTKNEQVEREAVRMAAQNKVKADETDEKQHANNSG
                     GMGDYKPTGALGGAANLGPLSTQPLSSSDSDVRELLTFPNESTHAYSYNPLSPNSLAV
                     RLRILKRSLEIMIRNPTLLQENRSGRHLRVETPNGTQKEFRFSTDSAISPKKRPQFSR
                     SYSHEGVTPLSTSKLRNASSAALSALVTNAKGPSVAELSESSQPWTRPIAPFHSSQTS
                     PRSAAGRFASPYQRVASAEGPSRAQRRSLDANADPNSMPQMNEVEPFYKTGNNTSAEL
                     IDAKRSELESLLLLLNETLENNSSEKASDLHMISLLNFNKLSLDMDHEEKDKDDASQH
                     SSRYEQTLKRSLLESLAQPFFESSNTASTAGFDESGTLQGQDSFILPDSSFADMRTAP
                     VSNRLLHTFVSSKNSSPQAIFTCLQQYPWQFKSANDLACLTFGISQNALKALTLLDLI
                     HTDSRNFVLHKIMSTEGQELVFTGEIVAIVQPGESSNDLVWSSVWAKRRDGMIFCVFE
                     KVPCDFMDVLLDLDDFSVEHISGGAGLKGLKQQTSNRGNQFSSVEKEKGGKKTVKFPN
                     EVHDVADISISLKKLIEDVESGKVRSVDDDLLPMSIRVSNTINNVRYFTLNHLSLNIP
                     CAISSSILENEMKLKIHSLPYQAGIFILDSNNFSMISFNKSISKNMFGMHASELVGQS
                     ICKVIPSFAELVSFIKIKYPALDITLQKNRGLVLTEHFFRKMQAEMSNNTESFFESIG
                     IDAIHRDGSVLKVDIQLRVINSSNSLLWITHSRDVVFENYKTNPSQLLMLKESEVALV
                     GSGTSSRSSMKAPSGTIHVDDLPNLKDSLKLDGSTVGSFDSASGDSRDNMEEPPDTPT
                     EDKKQQDSDKLEMHKLGDQISAKFDVAKNYVQDKASFVKDKNFKLDENLIMSLKSLSP
                     NKGNGSLASTSPPVPNSSSEEAGGQGEVFLSTPEPNIGSLKHVKKFSEFEVLQKMGEG
                     AYGKVDLCLHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMATLNTKPHEN
                     ILMLLDFFEDDEYYYIETPIHGTSGSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHL
                     HDNGIVHRDIKDENVIVDSNGFVKIIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGEP
                     YEGKPQDIWAIGVLLYTIIFKENPFYNIDEILDADLRVDSNHRVSDECIALIRKILNR
                     PISKRPSISKINDDKWLEL"
     gene            <252131..>253195
                     /locus_tag="KLTH0D02508g"
                     /db_xref="GeneID:8295054"
     mRNA            <252131..>253195
                     /locus_tag="KLTH0D02508g"
                     /product="KLTH0D02508p"
                     /transcript_id="XM_002552788.1"
                     /db_xref="GeneID:8295054"
     CDS             252131..253195
                     /locus_tag="KLTH0D02508g"
                     /note="some similarities with uniprot|Q08215 Saccharomyces
                     cerevisiae YOL044W PEX15 Phosphorylated tail- anchored
                     type II integral peroxisomal membrane protein required for
                     peroxisome biogenesis cells lacking Pex15p mislocalize
                     peroxisomal matrix proteins to cytosol overexpression
                     results in impaired peroxisome assembly"
                     /codon_start=1
                     /product="KLTH0D02508p"
                     /protein_id="XP_002552834.1"
                     /db_xref="GeneID:8295054"
                     /db_xref="UniProtKB/TrEMBL:C5DG54"
                     /translation="MSSPQVSSTKLLEELLENKAFQPDSHKALESETENQLQDCLNAF
                     LKGDCKGCLEKMFQAGLLRGEYLENDPKLWKLYLSACSQIKFDVLEVSLSKVGRSNFS
                     KADVSRAQRILAQEPLCEQMAGVLMYLTCCYKCARADNSMEAMKNLEMASGDYIRKCS
                     ECSEHSGDTREANQVLELVWFYMFSLQGGRSHKRMSRILYEQLCKSAPAVPRVLQAPS
                     KTNPAVTLENQLISRIEALAPEKPNIVQPLQQRKLKPTNSHPFSSDRTSEAIPVLAPV
                     PTIIKPDKAASINTSKFKALITRLQPFLNSKSIPVLVFVLLLSLKKAQKVAGLPNKLA
                     HILNVILRRLGGIINIILSI"
     gene            <253509..>255377
                     /locus_tag="KLTH0D02530g"
                     /db_xref="GeneID:8295055"
     mRNA            <253509..>255377
                     /locus_tag="KLTH0D02530g"
                     /product="KLTH0D02530p"
                     /transcript_id="XM_002552789.1"
                     /db_xref="GeneID:8295055"
     CDS             253509..255377
                     /locus_tag="KLTH0D02530g"
                     /note="highly similar to uniprot|P31383 Saccharomyces
                     cerevisiae YAL016W TPD3 protein phosphatase 2A regulatory
                     subunit A"
                     /codon_start=1
                     /product="KLTH0D02530p"
                     /protein_id="XP_002552835.1"
                     /db_xref="GeneID:8295055"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C5DG55"
                     /translation="MSGNKQAKNKSGDKDDNGQNSEDLYPLALLMDELKHDDIANRVE
                     AMKKLDTIALALGPQRTRDELVPFLTEVAQDDEDEVFAVLAEQLGKFVPFIGGAKFAT
                     LLLPALEILASTEETLVRDKAVESLNNIAQELSEEQLFHDFIPLIEHLATAEWFSSKV
                     SSCGLFKSVLARVKDDKFRKELLALYLQLVQDDTPMVRRAAGKNLPVLIDLLTQNPDL
                     STSEDWDYISSMFQKIVSDTQDSVKFLAVDILVSILKFFNTKHDTTHSKDLLRSAIQL
                     ITDEAWRVRYMAADRFDDLASQFKSNPEYIEELSGPFLALCEDNESDVRKGVAKQLPG
                     FSKLLGDPQVVLKKVLPAVQNLSMDESEIVRASLASEITNLAPLIPKQDAIDSLIPIL
                     LNMLKDEYPDVRLNIIAKLKVVNEVVGIDLLSESLLPAITELAKDVNWRVRMAIIDYI
                     PLLAEQLGVQFFDQQLGDLCLSWLWDTVYSIRSAAVVNLKNLTKIFGSEWSSSKIISR
                     LLKSDSQLLENFVYRITLLSALTELVPVVSTEVTTEKILPFINHLAEDSVPNIRFNVA
                     KSYAVVVESLAEEKGKYKDLINKSIISSLEKLCQDSDIDVRYFASQSLEKCQNLLA"
     gene            complement(<255490..>256641)
                     /locus_tag="KLTH0D02552g"
                     /db_xref="GeneID:8295056"
     mRNA            complement(<255490..>256641)
                     /locus_tag="KLTH0D02552g"
                     /product="KLTH0D02552p"
                     /transcript_id="XM_002552790.1"
                     /db_xref="GeneID:8295056"
     CDS             complement(255490..256641)
                     /locus_tag="KLTH0D02552g"
                     /note="similar to uniprot|Q08214 Saccharomyces cerevisiae
                     YOL043C NTG2 DNA N-glycosylase and apurinic/apyrimidinic
                     (AP) lyase"
                     /codon_start=1
                     /product="KLTH0D02552p"
                     /protein_id="XP_002552836.1"
                     /db_xref="GeneID:8295056"
                     /db_xref="GOA:C5DG56"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:C5DG56"
                     /translation="MVMRTRRAKRARVEVEYEGGEESKYFKKEKPAAEVVPERPKPGP
                     PEDSKVDVEMVKKMGSDTYYDWVNARTKDEITYAPLKDEPHFPRNFVPIYSKIRLMRS
                     KIETPVDHVGCAMIPMTVGHEFGIEQEQITPRTYRFQLLIALMLSSQTKDEVNAKAMF
                     NLVEYCKEELGEPEGVTLDAMFKIDQETIAQLIYPVSFYTRKALYIKKTIELLRDNFD
                     GDMPPDIAGLVSLPGVGPKMGYLALQKAWGKVDGIGVDVHVDRLCKMWKWVDPSKAKS
                     PEHTRKLLEEWLPYEYWYEINPVLVGFGQVICLPRGKRCDLCMASDVCNAADQKLLQK
                     VRNPKEERKSRGNVSEWVKYMEKSTHAKEVVKEEGDVKIALDQDEIKDA"
     gene            <257847..>258953
                     /locus_tag="KLTH0D02574g"
                     /db_xref="GeneID:8295057"
     mRNA            <257847..>258953
                     /locus_tag="KLTH0D02574g"
                     /product="KLTH0D02574p"
                     /transcript_id="XM_002552791.1"
                     /db_xref="GeneID:8295057"
     CDS             257847..258953
                     /locus_tag="KLTH0D02574g"
                     /note="similar to uniprot|Q08213 Saccharomyces cerevisiae
                     YOL042W"
                     /codon_start=1
                     /product="KLTH0D02574p"
                     /protein_id="XP_002552837.1"
                     /db_xref="GeneID:8295057"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DG57"
                     /translation="MFTRKLLPVSNSALKPSLPEIRNSVSRSTFTLMTYNMLSPYYMW
                     PQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYEGFWKNHFKTKMNY
                     GSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIGLFNISELNYLK
                     STIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNTHLYWKYDEV
                     KLCQCLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNSAPDSPVIKFLKGESVHR
                     ADLSLINPLRPYLNRYIYQDTSADLFEHTCYSGKLKGIFDYIWYHDKDFRLKRILSGA
                     EVSQELRELQEFGLPNKDHPSDHIPVLAELELLD"
     gene            <259063..>259707
                     /locus_tag="KLTH0D02596g"
                     /db_xref="GeneID:8295058"
     mRNA            <259063..>259707
                     /locus_tag="KLTH0D02596g"
                     /product="KLTH0D02596p"
                     /transcript_id="XM_002552792.1"
                     /db_xref="GeneID:8295058"
     CDS             259063..259707
                     /locus_tag="KLTH0D02596g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D02596p"
                     /protein_id="XP_002552838.1"
                     /db_xref="GeneID:8295058"
                     /db_xref="UniProtKB/TrEMBL:C5DG58"
                     /translation="MKRIQIITTHKHSYQKRAATEMLGMGLNLQTNVTHANNDKQTVS
                     LQDAPHRLLQQHQETILRDARIRLNSKKSFMDDEFYLPEMTPFGVSRIPSENGRGFAS
                     PANMRAVPKSGYPLAQTHKKAKENSLKAMQASEANGRALEQQFYQNQLAAAVQQQQQQ
                     QQQQQQQQQQQQQQQQHHQQQIHQHNPYLTNNGFRGYSMQQEACVMDGPRNWQH"
     gene            complement(<260346..>261161)
                     /locus_tag="KLTH0D02618g"
                     /db_xref="GeneID:8295059"
     mRNA            complement(<260346..>261161)
                     /locus_tag="KLTH0D02618g"
                     /product="KLTH0D02618p"
                     /transcript_id="XM_002552793.1"
                     /db_xref="GeneID:8295059"
     CDS             complement(260346..261161)
                     /locus_tag="KLTH0D02618g"
                     /note="similar to uniprot|P31377 Saccharomyces cerevisiae
                     YAL014C SYN8 Endosomal SNARE related to mammalian syntaxin
                     8"
                     /codon_start=1
                     /product="KLTH0D02618p"
                     /protein_id="XP_002552839.1"
                     /db_xref="GeneID:8295059"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5DG59"
                     /translation="MEVLKISYGVEKLQGLVDERRRLVSVLKMKPSTNDTINMKRQMN
                     AVLDSLQAAANAATSEDFVQLNALIEKYNDAVADIPDDSLDKELYKFASIDKPPETAI
                     SKLPEPKKVRFKDDVLEYDESTQDAPTAFAPYSDDVSDEERLEHDKTRLFQTGSSEST
                     GLDGLAVAPQLSNQELFIQQQQQLLEQDSHLDNLSRSVHSSHVLSLDIHHEVADQNDG
                     VLQDLESLVNNSGRNLDRAKKRLRIFENTARENGPCFIIVVLFVILIVLLIIL"
     gene            complement(<261313..>262701)
                     /locus_tag="KLTH0D02640g"
                     /db_xref="GeneID:8295060"
     mRNA            complement(<261313..>262701)
                     /locus_tag="KLTH0D02640g"
                     /product="KLTH0D02640p"
                     /transcript_id="XM_002552794.1"
                     /db_xref="GeneID:8295060"
     CDS             complement(261313..262701)
                     /locus_tag="KLTH0D02640g"
                     /note="similar to uniprot|Q08208 Saccharomyces cerevisiae
                     YOL041C"
                     /codon_start=1
                     /product="KLTH0D02640p"
                     /protein_id="XP_002552840.1"
                     /db_xref="GeneID:8295060"
                     /db_xref="GOA:C5DG60"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DG60"
                     /translation="MGSIDKLFGPAASKVESGLSKLFGSSAGPVDVAKVKSKIRTVLP
                     GVEPEAKPETKEASAEASTEQGSQGEGESGSEEGAKPAKRGLEAEEAPAQPKKLSKRQ
                     KRKALDADNENLESEYYSKLLEKEQGEAEETSAAEPESKDGEAEASVQATAASASRKD
                     LKEEELQKAERTVFVGNVPVDVVTSKPLKKQFKKLFAVAKKHSGGDDSDEDKATGPDT
                     FAVESIRFRSISFEEALPRKVAFVQQKLHKSRDSANAYVVYAEKAAVKAACQTLNGTV
                     FYDHHLRVDSVAHPAQHDNKRSVFVGNLDFEEAEENLWKHFEKSGEIEYVRVVRDSKT
                     NMGKGFAYVQFRDFQDINKALLLNDQKLNGTGRKLRVTRCKNMKKTQPSSQKHPKALT
                     DDQRTKLGRAKKVLGKADRSTVGKDVTIEGLRATKGASTPILKKKKQRSKSGRVTKRS
                     TAFKKANASNSR"
     gene            <263089..>265008
                     /locus_tag="KLTH0D02662g"
                     /db_xref="GeneID:8295061"
     mRNA            <263089..>265008
                     /locus_tag="KLTH0D02662g"
                     /product="KLTH0D02662p"
                     /transcript_id="XM_002552795.1"
                     /db_xref="GeneID:8295061"
     CDS             263089..265008
                     /locus_tag="KLTH0D02662g"
                     /note="some similarities with uniprot|P31385 Saccharomyces
                     cerevisiae YAL013W DEP1 Transcriptional modulator involved
                     in the regulation of structural genes involved in
                     phospholipid biosynthesis also participates in regulation
                     of metabolically unrelated genes as well as maintenance of
                     mating efficiency and sporulation"
                     /codon_start=1
                     /product="KLTH0D02662p"
                     /protein_id="XP_002552841.1"
                     /db_xref="GeneID:8295061"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:C5DG61"
                     /translation="MLTKTADENRLTKENLALVDAASATEDRKKSSNEDDKSSVLSKI
                     DSKHSGDLDLSEYCVSSDAETEKMDEESVSQRNSEHPVLSELAGASAPGDAGAAESGE
                     TNGAAAGNAAVESTPKAPEQHSPREEAAAPAVEEPTVSAVNEGVAAAAAAAAVDPPNE
                     PEKAIMTAAPAEQPVDITGSGSLGEPPAAGGPSTEVAVSEPTITEPAAEPAAEPVAEP
                     AAIEEQAAVPEQILQEAVPPVESPVVDPLKPSSPVPPSEEPLGPSSVVGPAEVASKQS
                     GPVEPVEDTLGLAQGDAAPTKRAHEDEEDHDAHFKKPRPPAHELKHVENNNYDDNDND
                     NDNDNDNDNDNDADEDEDEVEEDYQDKTDGAEVLAAAAAGASAAGGPSKVGTGAKKPV
                     PSIKGDGNSPMEQETLRMNALREITDIEHQFAELRQRLFESKLAKLQTETQMCLEGSH
                     PALQSYYQKIDSVRDYKLRRAYQRQKYELECIDKETKATRCFIHQDFYRKVADLKHEL
                     LVSTTQKWYDINKERREMDVVVSDVGYHVPVKIDGKTLSCITGYAAPAQPRREGDPLA
                     EDLQCEGIRFRFKNNPVDKLEVIVDRMRFNNELSDLEGLRQFFQGFPGAPGLSGLKDS
                     EIYEDLQSAGRPGRA"
     gene            complement(<265105..>265533)
                     /locus_tag="KLTH0D02684g"
                     /db_xref="GeneID:8295062"
     mRNA            complement(<265105..>265533)
                     /locus_tag="KLTH0D02684g"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_002552796.1"
                     /db_xref="GeneID:8295062"
     CDS             complement(265105..265533)
                     /locus_tag="KLTH0D02684g"
                     /note="highly similar to uniprot|Q01855 Saccharomyces
                     cerevisiae YOL040C"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_002552842.1"
                     /db_xref="GeneID:8295062"
                     /db_xref="GOA:C5DG62"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:C5DG62"
                     /translation="MSTAAAPRKRSFKSYSYKGVDLEKMLEMPTEEFVKLAPARVRRR
                     FARGLSSKPAGLMKKLRAAKLAAPENERPAVVKTHLRNMIVVPEMIGSVVGVYNGKVF
                     NQVEVKPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
     gene            <266107..>266430
                     /locus_tag="KLTH0D02706g"
                     /db_xref="GeneID:8295063"
     mRNA            <266107..>266430
                     /locus_tag="KLTH0D02706g"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_002552797.1"
                     /db_xref="GeneID:8295063"
     CDS             266107..266430
                     /locus_tag="KLTH0D02706g"
                     /note="similar to uniprot|P02400 Saccharomyces cerevisiae
                     YDR382W RPP2B Ribosomal protein P2 beta a component of the
                     ribosomal stalk which is involved in the interaction
                     between translational elongation factors and the ribosome
                     regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in
                     the cytoplasm"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_002552843.1"
                     /db_xref="GeneID:8295063"
                     /db_xref="GOA:C5DG63"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:C5DG63"
                     /translation="MKYLAAYLLLNAAGNSAPSAENVKTVLESVGIEVEEDKVSSLVS
                     SLEGKSVEELVAEGNEKLSAVPAASGSGAPAAGAAAGGEAAEEDAPEEAAEESDDDMG
                     FGLFD"
     gene            <267019..>268197
                     /locus_tag="KLTH0D02728g"
                     /db_xref="GeneID:8295064"
     mRNA            <267019..>268197
                     /locus_tag="KLTH0D02728g"
                     /product="KLTH0D02728p"
                     /transcript_id="XM_002552798.1"
                     /db_xref="GeneID:8295064"
     CDS             267019..268197
                     /locus_tag="KLTH0D02728g"
                     /note="highly similar to uniprot|P31373 Saccharomyces
                     cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
                     catalyzes one of the two reactions involved in the
                     transsulfuration pathway that yields cysteine from
                     homocysteine with the intermediary formation of
                     cystathionine"
                     /codon_start=1
                     /product="KLTH0D02728p"
                     /protein_id="XP_002552844.1"
                     /db_xref="GeneID:8295064"
                     /db_xref="GOA:C5DG64"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DG64"
                     /translation="MTVLPSDKFATLAIHAGAHTDVHGSVIEPISLSTTFKQSAPAQP
                     IGAYEYSRSQNPNRANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGD
                     VYGGTHRYFTQVAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRR
                     VADAAHAANPDILVVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATN
                     NEPLYERLRFLQNAIGAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEASDRV
                     EHVNYPGLSSHPAYAVVQKQHRDALGGGMISFRIKGGAGAAARFTSTTRLFTLAESLG
                     GIESLVEVPAVMTHGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEKAGAQ
                     "
     gene            <268438..>269559
                     /locus_tag="KLTH0D02750g"
                     /db_xref="GeneID:8295065"
     mRNA            <268438..>269559
                     /locus_tag="KLTH0D02750g"
                     /product="KLTH0D02750p"
                     /transcript_id="XM_002552799.1"
                     /db_xref="GeneID:8295065"
     CDS             268438..269559
                     /locus_tag="KLTH0D02750g"
                     /note="similar to uniprot|Q6B1H9 Saccharomyces cerevisiae
                     YOL031C SIL1 ER-localized protein required for protein
                     translocation into the ER interacts with the ATPase domain
                     of the Kar2p chaperone suggesting some role in modulating
                     its activity homolog of Yarrowia lipolytica SLS1 GrpE-like
                     protein in the ER"
                     /codon_start=1
                     /product="KLTH0D02750p"
                     /protein_id="XP_002552845.1"
                     /db_xref="GeneID:8295065"
                     /db_xref="UniProtKB/TrEMBL:C5DG65"
                     /translation="MRWLLLAVPALANQLVTLAPEPQLTTSVAPAVSAASLEPSAQAA
                     SIFEPKPFWQPILPSQHIPAGLEVRMNLESGLREARLPQEDQDQSYEFSSQFDHAREL
                     AHSGDFAATDAALDDLLEFSHDYRYGYKIIGHEFPWLAQLLCDSQTPVSTKKICLSML
                     AACLRNNPPAVELVHQADPHFVSAVFTEMRALAQLPATSDRAVLAKRYLSVVQALAPE
                     SSPQIDQDVLLELCRWGDQHVRMKALDIAALLYRDAQPGGSQALAKRSQDTHDVQKWV
                     DEFSSGIQQEHVDELHIRNFFNSLYNIKQQMGRNVKVSSGFLDWLSKEAAARKESLGS
                     GLHERDPDQLEFDRRLVESRHLVFGNPMAHRAKHFDDEL"
     gene            complement(<269632..>270336)
                     /locus_tag="KLTH0D02772g"
                     /db_xref="GeneID:8295066"
     mRNA            complement(<269632..>270336)
                     /locus_tag="KLTH0D02772g"
                     /product="KLTH0D02772p"
                     /transcript_id="XM_002552800.1"
                     /db_xref="GeneID:8295066"
     CDS             complement(269632..270336)
                     /locus_tag="KLTH0D02772g"
                     /note="similar to uniprot|Q08202 Saccharomyces cerevisiae
                     YOL032W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D02772p"
                     /protein_id="XP_002552846.1"
                     /db_xref="GeneID:8295066"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="UniProtKB/TrEMBL:C5DG66"
                     /translation="MFAAIASGNPLQLSTEVPNSGGLQHTIVLSSTKPKSYSHISLFI
                     LPNVTFPSEFAGTVYFKLSPTEEFKLFGYLSAEKPSAIFKVKLPNANMNSAADPGDGL
                     GEIDMEDDTPGGGLPSSNISELIIGISIEPKDQAILKLQESKAKQTALQGSSSLVLAR
                     SGTNSIATPGQLARVYPLLTQQLAAKIVQHAYNYLTGFLDPQGNVSIKRFDTWWDKFK
                     ARLENDAQFLDEVTQD"
     gene            complement(<270516..>272156)
                     /locus_tag="KLTH0D02794g"
                     /db_xref="GeneID:8295067"
     mRNA            complement(<270516..>272156)
                     /locus_tag="KLTH0D02794g"
                     /product="KLTH0D02794p"
                     /transcript_id="XM_002552801.1"
                     /db_xref="GeneID:8295067"
     CDS             complement(270516..272156)
                     /locus_tag="KLTH0D02794g"
                     /note="similar to uniprot|P48525 Saccharomyces cerevisiae
                     YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
                     encoded by a nuclear gene"
                     /codon_start=1
                     /product="KLTH0D02794p"
                     /protein_id="XP_002552847.1"
                     /db_xref="GeneID:8295067"
                     /db_xref="GOA:C5DG67"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="UniProtKB/TrEMBL:C5DG67"
                     /translation="MIDGMRFILARRWNSVLSRPNRLFTSKKSILSKKPVKDIQPKTP
                     ARTRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYES
                     LSWCGIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCTKERLDGLR
                     ESAQKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLD
                     MQPQVNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEWLPSTPKHIAL
                     YHAFGWNPPEFIHIPLLTSVTDKKLSKRRGDADVMALRAKGVLPEALVNFSVLFGWSP
                     PREEAAKNHECFSLPDLVRLFNLNSLTKGNAKVDEKKLWFFNKHYLTLRLQNPEVLDK
                     MANELLGSMQSLYPSVTVSQIRRALGLVGASLNTPNELATDFPYLFSKPQYERNQYVR
                     EFIQKQDLYQIRALLQKMEGKMSTENSVLTVIERLSRDNGIRKNVVFEAARFALTGSV
                     PGVKLPLLIEFLGAEEANLRISEALDKLDSVLCLKGEE"
     gene            complement(<272310..>275594)
                     /locus_tag="KLTH0D02816g"
                     /db_xref="GeneID:8295068"
     mRNA            complement(<272310..>275594)
                     /locus_tag="KLTH0D02816g"
                     /product="KLTH0D02816p"
                     /transcript_id="XM_002552802.1"
                     /db_xref="GeneID:8295068"
     CDS             complement(272310..275594)
                     /locus_tag="KLTH0D02816g"
                     /note="similar to uniprot|Q08204 Saccharomyces cerevisiae
                     YOL034W SMC5 Structural maintenance of chromosomes (SMC)
                     protein interacts with Rhc18p and Nse1p to form a large
                     complex S. pombe homolog forms a heterodimer with S. pombe
                     Rad18p that is involved in DNA repair"
                     /codon_start=1
                     /product="KLTH0D02816p"
                     /protein_id="XP_002552848.1"
                     /db_xref="GeneID:8295068"
                     /db_xref="GOA:C5DG68"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR027131"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG68"
                     /translation="MLSSGEERHKYDPNALPRTHNEEDGAPSSKRLKLGEDDLALFRA
                     GSIVTLRLENFVTYALTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST
                     KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVASDGTTKVTRVLHRNRKASEYFLNGQSV
                     TESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKSDKLLVETARSVDVNMVADLEDL
                     KALQGEELVEAKELELKSSRVLELKATRDKLTASVRALENFKKKKEELGMHEKLLPYV
                     QVKDHKVRIKQYKREYEKMRKQLKDLISDKKPFRHTQQLIETETVERNENKKKLEVQL
                     KVSKRTFPSYLEKLEHLKEKVRGKQAQLKYYEDRTGKIKDEIVVVEHNLKEEQAKREA
                     LPVPDQGAFERIQAERKEITDKGVELEQQRTDLNANLVNADYHMDILKRKLQQENESL
                     VSTDRIGILDGKRFEELRNAVLFMRSRPEMQGKVLEPPIMSISVKDPQFASYLGTCTD
                     FATSLALTVVDSDSYRTFGDELLNKFRVNIRELSAAPTTSPLPLSELRKLGFQGYLSD
                     FLSGDNGVLKMLCQQHKLHTIPVSRTAMSSRLMDYLMKPDESNNLKFRRVIAGNYVYD
                     FKRSAYGRRQIFSSEFKVRPCQFFKGSVLTEERKGEIKESMARINGQIQAKKDEVQFI
                     TQKIQELRSELQSNKQEDAELHKITSKLNDQKKTIAHCSHRIKALENKLSMLKTDLQQ
                     DVTTKINDCRESIKSSLREQVKVMSGITQFVAKLQGLQREISLATIEHLEAFNTERSM
                     NEVIGFFNEKEEQLRGAYEEAKNKYASMKETDEYRGWMDKIRHYTDAEKTQLADLAEK
                     YQQSNNFDLSFISNTIDRLRSEIGMLNQDESVLEIMRQTEAELGELDCVVPRKEAALL
                     EIRRTIQEKRSQLEPKLDAIVEKISQNFCALFKNVGSAGAVRLDKPEQFSDWKIEIMV
                     KFRDNATLKRLDSHTQSGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIV
                     HKSMVESACSQNNSQYILVTPKLLTQLHYHEKVRIHCVMAGAWIPDPIVDHDKIRFGQ
                     TSNYVF"
     gene            <275812..>277566
                     /locus_tag="KLTH0D02838g"
                     /db_xref="GeneID:8295069"
     mRNA            <275812..>277566
                     /locus_tag="KLTH0D02838g"
                     /product="KLTH0D02838p"
                     /transcript_id="XM_002552803.1"
                     /db_xref="GeneID:8295069"
     CDS             275812..277566
                     /locus_tag="KLTH0D02838g"
                     /note="weakly similar to uniprot|P31376 Saccharomyces
                     cerevisiae YAL011W SWC3 Protein of unknown function
                     component of the Swr1p complex that incorporates Htz1p
                     into chromatin required for formation of nuclear-
                     associated array of smooth endoplasmic reticulum known as
                     karmellae"
                     /codon_start=1
                     /product="KLTH0D02838p"
                     /protein_id="XP_002552849.1"
                     /db_xref="GeneID:8295069"
                     /db_xref="UniProtKB/TrEMBL:C5DG69"
                     /translation="MSRSSRLRTRTVGAERSRSSKRGKSEEELDTYGLVEENGGRPFQ
                     LIEGLPCSIELPQYASTLTHPLSVKDSAVLYSSMLSSRRTWISSEMFDMLWSKQYLSP
                     SEKERLEQEGIDPESVDASAAREKMHKLCDCAMAGGPHAFSVRLFILKNDEIEKKWND
                     AIEQKRRNKADRKNRELEEKKKKQEERKQQQWIKKQEKEHGTSTAADSSRNSGSTDGA
                     KKPVKRRSRKEDTTQQRSRSHTPRQRKSVPQSTEDQKMITNLNLMAQKNPELNSLMIV
                     VAGGRASTDQVEEFKKYIEKARKMPVPPGWKPTANASSSTPQKLKSGGSDSSLDRADS
                     VAAPARAAKSLGASQVKSEETAQLSSETNSAGGTAEPRKKRKYTKRKNVDTPVEPEDK
                     SMQLTTFQQKYMHNADIVFEYVENPNKRFSLPKDAILEPLEDGESYLMSWILIHNRKE
                     LEKYKEKRKKTLDKKAKPEKTAEVSTEDSANKEEEDDYDIFEDPKAPDPLFTPMTVKF
                     SNIHKKFQPIMTNSVNPAEKVRKRMSNIIERGTRLSGYNLWFQLDAYDDSGFAESLRC
                     DLKDYESGFRSKRHRKQL"
     gene            complement(<277582..>278958)
                     /locus_tag="KLTH0D02860g"
                     /db_xref="GeneID:8295070"
     mRNA            complement(<277582..>278958)
                     /locus_tag="KLTH0D02860g"
                     /product="KLTH0D02860p"
                     /transcript_id="XM_002552804.1"
                     /db_xref="GeneID:8295070"
     CDS             complement(277582..278958)
                     /locus_tag="KLTH0D02860g"
                     /note="similar to uniprot|P18409 Saccharomyces cerevisiae
                     YAL010C MDM10 Subunit of the mitochondrial sorting and
                     assembly machinery (SAM complex) has a role in assembly of
                     the TOM complex which mediates protein import through the
                     outer membrane required for normal mitochondrial
                     morphology and inheritance"
                     /codon_start=1
                     /product="KLTH0D02860p"
                     /protein_id="XP_002552850.1"
                     /db_xref="GeneID:8295070"
                     /db_xref="GOA:C5DG70"
                     /db_xref="InterPro:IPR022197"
                     /db_xref="InterPro:IPR027539"
                     /translation="MIDYMEHVLRSFEQCTGWNRDNSYENVTATSENLLSFRVPSGVK
                     FQVSNKSTPNTFTTFELSNNKVINGSLAYLYTNCQGLENYVSNSRDILLQEASETYRQ
                     IRPLYPCHSLRSSSDGAKEFGPSSLWYGRMYYPTSTLEAMVVSRSSAQTQFVAKCISS
                     LANASVLTLYWQKDSGQNCQEWVASTNEGLLGYRILHNFVGSQSKLNTSLYNDSSLSV
                     GGELWFGVLNTTPACSTTLRYCTHSANTGKPLTLTLSWNPLFGHVSSTYSVKTSSGAT
                     FSSKYDFNLYSIESNLSFGCDLWRRGHTKQLDQRRTEPLDAPNTNSSVFSKERVQKKQ
                     GPKEDSPMFYHLMAGSTSSQKLIEDLNVTFASSLQKLTKEKSTIQRFENSLIDANFAS
                     VWKLSTSLRHKNLRVLWEGKYKGFLISAGAEFTGAPLELPSNLAGESKTPALIRPGKF
                     GIQLQYST"
     gene            <279103..>280044
                     /locus_tag="KLTH0D02882g"
                     /db_xref="GeneID:8295071"
     mRNA            <279103..>280044
                     /locus_tag="KLTH0D02882g"
                     /product="KLTH0D02882p"
                     /transcript_id="XM_002552805.1"
                     /db_xref="GeneID:8295071"
     CDS             279103..280044
                     /locus_tag="KLTH0D02882g"
                     /note="similar to uniprot|P18410 Saccharomyces cerevisiae
                     YAL009W SPO7 Integral nuclear/ER membrane protein of
                     unknown function required for normal nuclear envelope
                     morphology and sporulation"
                     /codon_start=1
                     /product="KLTH0D02882p"
                     /protein_id="XP_002552851.1"
                     /db_xref="GeneID:8295071"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="UniProtKB/TrEMBL:C5DG71"
                     /translation="MDHSLELSTDKIGKLDEPQIEPGNALGNAFPVVKIEEYQDNSDE
                     TPIKVRRRGGKAQSKPSSPQPASLNISQGATRRRRSSSRTSSKNLKSTTDISPASMIF
                     RNLLILEDDLRRQAREQKILKWQFTLFLSALVGIAAAAFYELYFSQESVKGIYKVMLE
                     FVLIFILVTVVLFHLSGEYRRTIVIPRKFFTSTNKGIRQFNVKLVKVKSSIPDLCIDL
                     VRWVCRKSAVVNLLLSRKCLPARIAEDSWLLRFWTSVALRSQPRIGAVDVKLILNPRA
                     FSAEIREGWEIYRDEFWAREGARRRKKVNETSPRKDE"
     gene            <280411..>282445
                     /locus_tag="KLTH0D02904g"
                     /db_xref="GeneID:8295072"
     mRNA            join(<280411..280434,280502..>282445)
                     /locus_tag="KLTH0D02904g"
                     /product="KLTH0D02904p"
                     /transcript_id="XM_002552806.1"
                     /db_xref="GeneID:8295072"
     CDS             join(280411..280434,280502..282445)
                     /locus_tag="KLTH0D02904g"
                     /note="similar to uniprot|P38903 Saccharomyces cerevisiae
                     YOR014W RTS1 B-type regulatory subunit of protein
                     phosphatase 2A (PP2A)"
                     /codon_start=1
                     /product="KLTH0D02904p"
                     /protein_id="XP_002552852.1"
                     /db_xref="GeneID:8295072"
                     /db_xref="GOA:C5DG72"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DG72"
                     /translation="MMRGFKQKLIKKTTGSSSSGQKKKDKEEAKKTSSGTSSPGSASG
                     TSKSAAEKKSASSSSSSKHTKSKTATNNGSEKKSNPPPSSAQNDSPNAAPTSKNKLEV
                     MGNINQPSRSSQPTLIAAAALPPSPTTATVSLAVPGTQSSKEPTTASGIEIPRSSHSF
                     ERLPNASKLNPEADLDLIKTPQRHSSSRFEPSRYTQITKLPHFDDVSPEEQIPLFIAK
                     VDQCNTIFDFGDPSFDIQGKEIKRVTLQELIEFVVTNRFAYTEEMYAHVVNMFKNNLF
                     RPIPPPVNPIGDVFDPDEDEPVNELAWPHMQCIYEFFLRFVESPDFNHQIAKQYIDQD
                     FILRLLELFDSEDIRERDCLKTTLHRIYGKFLSLRSFIRRSINNIFLQFVYETERFNG
                     IAELLEILGSIINGFALPLKEEHKVFLVRVLMPLHKVRCLSLYHPQLAYCIVQFLEKE
                     PLLTEEVVMGLLRYWPKINSTKEIMFLNEIEDIFEVIEPLEFIKVEVPLFVQVAKCIS
                     SSHFQVSEKVLSYWNNEYFLNLCIENAEVILPIIFPALYELTSQLDLESQSDENGHPT
                     SDPYVLVEQAISSGSWNRAIHAMAFKALKIFLETNPVLYDNCNSLYLTSVKETQRRKV
                     EREENWHRLESYVEKLKISGTAGGDESSPQD"
     gene            <282956..>283561
                     /locus_tag="KLTH0D02926g"
                     /db_xref="GeneID:8295073"
     mRNA            <282956..>283561
                     /locus_tag="KLTH0D02926g"
                     /product="KLTH0D02926p"
                     /transcript_id="XM_002552807.1"
                     /db_xref="GeneID:8295073"
     CDS             282956..283561
                     /locus_tag="KLTH0D02926g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D02926p"
                     /protein_id="XP_002552853.1"
                     /db_xref="GeneID:8295073"
                     /db_xref="InterPro:IPR007014"
                     /db_xref="UniProtKB/TrEMBL:C5DG73"
                     /translation="MSFARPFLFQKTALGQLRKFLSPFSFGKSRLMSSGARAAKAPLY
                     SGFVGYKTVGFAAGTSLAMLLSTISSKNIIRSDTILDVKQRNAGLPEEIGLPGQRGKS
                     AVSKKVNYRELCLGSVLGLMIGVVVGKISSVLVFVTACGLLSLQWLSNRGLVDKNATW
                     GLSKYIVKTGRESVDLNTLIWDKPSFKVPFILTFVLAALNV"
     gene            <283762..>284394
                     /locus_tag="KLTH0D02948g"
                     /db_xref="GeneID:8295074"
     mRNA            <283762..>284394
                     /locus_tag="KLTH0D02948g"
                     /product="KLTH0D02948p"
                     /transcript_id="XM_002552808.1"
                     /db_xref="GeneID:8295074"
     CDS             283762..284394
                     /locus_tag="KLTH0D02948g"
                     /note="highly similar to uniprot|Q06102 Saccharomyces
                     cerevisiae YPR107C YTH1 Essential RNA-binding component of
                     cleavage and polyadenylation factor contains five zinc
                     fingers required for pre-mRNA 3'-end processing and
                     polyadenylation"
                     /codon_start=1
                     /product="KLTH0D02948p"
                     /protein_id="XP_002552854.1"
                     /db_xref="GeneID:8295074"
                     /db_xref="GOA:C5DG74"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C5DG74"
                     /translation="MSRIHPDTSNYPFRFEPFLRQEYSFSLDPDRPVCEFYNPREGPS
                     SCPNGNSCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFSKNG
                     YCTQSPECQYLHINPSSKIQECEDYRMGFCPAGAQCKKRHIKKTMCPRYITGFCPLGR
                     LDCEMEHPPFVIPNELSKLRIKNDDEINTKKQDEEKERRLNAIINGEIIA"
     gene            complement(<284533..>285945)
                     /locus_tag="KLTH0D02970g"
                     /db_xref="GeneID:8295075"
     mRNA            complement(<284533..>285945)
                     /locus_tag="KLTH0D02970g"
                     /product="KLTH0D02970p"
                     /transcript_id="XM_002552809.1"
                     /db_xref="GeneID:8295075"
     CDS             complement(284533..285945)
                     /locus_tag="KLTH0D02970g"
                     /note="weakly similar to uniprot|Q06098 Saccharomyces
                     cerevisiae YPR106W ISR1 Predicted protein kinase
                     overexpression causes sensitivity to staurosporine which
                     is a potent inhibitor of protein kinase C"
                     /codon_start=1
                     /product="KLTH0D02970p"
                     /protein_id="XP_002552855.1"
                     /db_xref="GeneID:8295075"
                     /db_xref="GOA:C5DG75"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DG75"
                     /translation="MRPRVSRWRSSAVRGEPFQRHFLRWGAISPCFPSSRAPLTSPSA
                     LQQHTALLPVSTRMDCGHTETPPSSPAVLALRKRRGLDSAVLSTPPAQAKQDTKLFQQ
                     QLPSPVTPTASSGFPALSPVRPCDADPVREAVSEICSSINNNTDLVNNLSFHTSGHSA
                     VSIQQARALLSPIDPIHDPEWKTSSTPLGRGTYACVYDLCNASRQAAFALKVPQTSRK
                     SSHIYKEATILSRLQCTRAPLYAPVIPFYGLTLVNKSHHKKLRSNETVPAIVLERMNC
                     SLKHFYTYNTEFDNTHWRVLAESLLSGLQLLKSRSVVHGDIKTENILMDFDSDAMPRY
                     YLADFSSARVVFAGDTRPPSLETTLEYCAPEQMSQCANSSFETDLYSVGLTLLAAITK
                     AEPYAELMAAMTHGEPGGGASLPQTQWLMSAISKNSPLEFNVLREELWVQWRNELAFL
                     AQILQDRMPLEHCLRSLQDI"
     gene            <286526..>287836
                     /locus_tag="KLTH0D02992g"
                     /db_xref="GeneID:8295076"
     mRNA            <286526..>287836
                     /locus_tag="KLTH0D02992g"
                     /product="KLTH0D02992p"
                     /transcript_id="XM_002552810.1"
                     /db_xref="GeneID:8295076"
     CDS             286526..287836
                     /locus_tag="KLTH0D02992g"
                     /note="highly similar to uniprot|P53252 Saccharomyces
                     cerevisiae YGR086C PIL1 Long chain base-responsive
                     inhibitor of protein kinases Phk1p and Phk2p acts along
                     with Lsp1p to down-regulate heat stress resistance via
                     regulation of the Pkc1p and Ypk1p pathways phosphorylated
                     by Phk1p and Phk2p"
                     /codon_start=1
                     /product="KLTH0D02992p"
                     /protein_id="XP_002552856.1"
                     /db_xref="GeneID:8295076"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:C5DG76"
                     /translation="MPSSALTACGTRFRADGAQRAAAAQTGAHADASRTDASGLAPRV
                     AKFSQSQPLNHFRNRGRGLGVYKGKPWNGPPVSPLKKRALFQSTLSVAATSQQQALQL
                     QPPNPMHRTYSLRNSRAPTAAQLQNPPPPPSSTKNRFFGKGGLANSFRKNTAGAFGPE
                     LARKLSQLVKIEKNVLRSIEVAANERRDAAKQLSIWGLENDDDVSDITDKLGVLIYEM
                     SELDDQFIDRYDQYRLTIKSIRDIEGSVEPSRDRKAKITDKIAYLKYKDPQSTKIEVL
                     EQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSVIEHSEKLALIAGYGKALLELL
                     DDSPVTPGETRPAYDGYDASKQIIIDAETALNDWTLDSAQVKPSLSLRHADYDYEGEE
                     DEDEEEVADHEHHWVDEDEPQHEHTTTEATETTTTNTTAAPTTA"
     gene            <288113..>290551
                     /locus_tag="KLTH0D03014g"
                     /db_xref="GeneID:8295077"
     mRNA            <288113..>290551
                     /locus_tag="KLTH0D03014g"
                     /product="KLTH0D03014p"
                     /transcript_id="XM_002552811.1"
                     /db_xref="GeneID:8295077"
     CDS             288113..290551
                     /locus_tag="KLTH0D03014g"
                     /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
                     YPR105C COG4 component of oligomeric Golgi complex"
                     /codon_start=1
                     /product="KLTH0D03014p"
                     /protein_id="XP_002552857.1"
                     /db_xref="GeneID:8295077"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="UniProtKB/TrEMBL:C5DG77"
                     /translation="MDALDLDKLSTNLARYHTLLSKITTVSQLTKLQSAIENEQSSTA
                     RQLDAFLQPSHTNTNQAVRTLELNRARLTQTLSKLHHALESVAESKQLALQVSTRIRA
                     VDRERQLVTRVLQFVSHVTSLRQNIFMVHQAIDRSDYKLAAAGIDTILKLPEESVYSE
                     FARRVVPSAEIPEDPQDLLKQWINQLAQVFHDNFVKAAREQDITQLTAVFQLFPLIRK
                     SDMGLDLYSKYVCDMIATQSRKVMTSTTSKSPGFFAQALLHLFKIVSTIINEHSKIIA
                     KYYGKQHMVHIMAKVQREADMQAGLVLDSFFESRNFKEILQDIRAFKENVSPEEEGLT
                     SNAPSMSEVSGIINESSSILQNWSMYCRFFALKWREFSDQSSEDPLTLPAPICDGIFY
                     SKIHSSGFLSDLKKLNEFYLNRSFKKSLELEELPSLNEQISKAPLKHDDISSYGFSSI
                     IEDLTVLIRSCLVVNVNTGESTLLGQFLDMLVRFLQNEYLIRFLQHRLRQLQPRLTSN
                     VVLKKYVPQTESTMNSRAASPGAVEQSKLSHLRFNFKGAATSAFSNIQSNLQAVYADE
                     ETVLKLHQYLIYLNTLSIGCVFLQKLLTKELLQDNPQLLPDNFPFGDKSQSLVKKIEA
                     TEQTLLAQSSKLLQWGVRLLFDGVLQSKIQKILGPLFTQGTETEYLASTANFEDMSHL
                     KQFSDGWLETMNPYINVLYKDCYAQLLTYAVDFLVAQISPRLWSLKLNELGSIKLDRE
                     LGALIAIVCGEHYLLREKFTKLTQIVLIAGFEDDDFDSETSDLKEEVIKGISWVLNPT
                     ERIRAGELRVDRRH"
     gene            <290948..>293524
                     /locus_tag="KLTH0D03036g"
                     /db_xref="GeneID:8295078"
     mRNA            <290948..>293524
                     /locus_tag="KLTH0D03036g"
                     /product="KLTH0D03036p"
                     /transcript_id="XM_002552812.1"
                     /db_xref="GeneID:8295078"
     CDS             290948..293524
                     /locus_tag="KLTH0D03036g"
                     /note="similar to uniprot|P39521 Saccharomyces cerevisiae
                     YPR104C"
                     /codon_start=1
                     /product="KLTH0D03036p"
                     /protein_id="XP_002552858.1"
                     /db_xref="GeneID:8295078"
                     /db_xref="GOA:C5DG78"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:C5DG78"
                     /translation="METSVDALTPSGPAAEDPAEERHNSDEHRSPKDEPENFGEPFAK
                     KPSRSNSQVAADEAAAEAKRLIDDPNLKLEIPDSLDHEHFSKLLELDSKNDDDLFSST
                     DLLEHEIAEHPEKLANDIAETVPTDDATQHLHSLENLESLGKLSEEAGGDVHSNPGTE
                     SPSKIKNENQSPSVLVDPVLADDRAIHPDIYNSDPLSTGAGTREDTPASILEDKHELL
                     DDQKQDASTKLGYVSLQPPLPENAVNKIEITQPIEPNSELPMTEFHDGANSETEQSKI
                     SAYARLDFQSFTFYVQTLQVIIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGTG
                     RFELSIMGKNGAFVDDTFVERGITVQLKNKAKVQIGQIPFQFVLPDQEGKEKKAIEPV
                     DAISLKTALNNNNKLAEISRSVTPIPIPSGESTELKDEELKDQPAKKKTPPKKKEKKE
                     PKAPKPPKKIYTLEEIPPEYRTKPTGSYSNLITACLRKFSSPKGMSLSGIYAGIRELF
                     PYYKYCPDGWQSSVRHNLSLNKSFRKVSKEGKGWLWGLNEEYIAEREKQKKKQAEAAA
                     EKAKAAQLKLEQQQQQKAKKAAESGSMIKSVASIPARPKVKQPNISQTLAANRADRKA
                     TADANQRTMKYLQEQLMILTKDRKGLDKHVMASILTQALAMTINQVTQAAKSKGITGN
                     PLTALIDKNPQHLNLILAAAVNAATVKVTNGSVKQLVSMPPPTVTAPQERRAASPSTS
                     NIQPTSGGTSNLVASANPGPAATVKSSESFDPTSLSKFFQPKQPSRVPTPSPARSVLP
                     LKRASSETESSSDDESTSGDESGSADSDASDGSDSDDDSSSSSGGSSKGSSSDEGSSD
                     GE"
     gene            complement(<293867..>294730)
                     /locus_tag="KLTH0D03058g"
                     /db_xref="GeneID:8295079"
     mRNA            complement(<293867..>294730)
                     /locus_tag="KLTH0D03058g"
                     /product="KLTH0D03058p"
                     /transcript_id="XM_002552813.1"
                     /db_xref="GeneID:8295079"
     CDS             complement(293867..294730)
                     /locus_tag="KLTH0D03058g"
                     /note="highly similar to uniprot|P30656 Saccharomyces
                     cerevisiae YPR103W PRE2 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="KLTH0D03058p"
                     /protein_id="XP_002552859.1"
                     /db_xref="GeneID:8295079"
                     /db_xref="GOA:C5DG79"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DG79"
                     /translation="MQAIAEKYSLKSTLATELEYDNEEGLSRDFVTGNSMFQRLAPQI
                     AMPPISSPQEFLRAHTDDSQNPDCKIKIAHGTTTLAFRFQGGIVVAVDSRATAGSWIA
                     SQTVKKVIEINPFLLGTLAGGAADCQFWETWLGTQCRLHELKEKERISVAAASKILSN
                     LVYQYKGAGLSMGTMVCGYTKKEGPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSN
                     YKWDLSVEEALYLGKRSILAATHRDAYSGGSVNLYHVTEQGWVYHGNQNIETLFWEVK
                     EKEGSFNNVIG"
     gene            <295808..>297730
                     /locus_tag="KLTH0D03080g"
                     /db_xref="GeneID:8295080"
     mRNA            <295808..>297730
                     /locus_tag="KLTH0D03080g"
                     /product="KLTH0D03080p"
                     /transcript_id="XM_002552814.1"
                     /db_xref="GeneID:8295080"
     CDS             295808..297730
                     /locus_tag="KLTH0D03080g"
                     /note="similar to uniprot|P32581 Saccharomyces cerevisiae
                     YJL106W IME2 Serine/threonine protein kinase involved in
                     activation of meiosis associates with Ime1p and mediates
                     its stability activates Ndt80p IME2 expression is
                     positively regulated by Ime1p"
                     /codon_start=1
                     /product="KLTH0D03080p"
                     /protein_id="XP_002552860.1"
                     /db_xref="GeneID:8295080"
                     /db_xref="GOA:C5DG80"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DG80"
                     /translation="MGYLGRKHGLKSSTNVPPDVNNPPFYIPVRPIANRYTLMQELGN
                     GSFGSVTLAKLAGSEGADKDARGQHDHKRLAASTRQHYHNTLMDDAVVPSIEQENYHN
                     KQRGVLAIKTMMTRLPTLNDYTRVREVKFILSMPAHKNLVQIWELFIDDINYQLHIVM
                     ECMEQNLYQLMRARRKRVFSLPSLKSILSQILAGVRHIHAHNFFHRDLKPENILISPS
                     SHYFSKEWILEGHYSDNYVVKIADYGLARHITNKSPYTAYVSTRWYRSPEILLRKGLY
                     SRPLDIWAFGCVVVEVATFRPLFPGSDEMDQIWKILEVLGTPHTMPESTLSGYHPHGG
                     LWEKAQVLASRLNLKFPYVEGVSIESIMDNPHLQPLCDVVKACLVWDPKKRATVDEIF
                     CMPYFEEAKPWAEPKGLNDSNTDNCPLNDENLNKGLGLRHYWSGGLNRGSRHPHGENA
                     SLAPIEVDSNGAKIRGPKETEISFRQFLKESLLPLPMSKETSRGSDGNRLHNEAGPED
                     VADLPLSEDSVANISPVSSLNDAENVGVLEPPEVDDSFAAFFVSKSAEFEYPAGAEVA
                     AGNLEPSYIHYGDSTDDRIIPHHRCNVLDDMSVDSSGSNRVPRTFAVPRISEECNVSA
                     QASHNHSFSHTNSLTF"
     gene            <299166..>301421
                     /locus_tag="KLTH0D03102g"
                     /db_xref="GeneID:8295081"
     mRNA            <299166..>301421
                     /locus_tag="KLTH0D03102g"
                     /product="KLTH0D03102p"
                     /transcript_id="XM_002552815.1"
                     /db_xref="GeneID:8295081"
     CDS             299166..301421
                     /locus_tag="KLTH0D03102g"
                     /note="similar to uniprot|P36124 Saccharomyces cerevisiae
                     YKR029C SET3"
                     /codon_start=1
                     /product="KLTH0D03102p"
                     /protein_id="XP_002552861.1"
                     /db_xref="GeneID:8295081"
                     /db_xref="GOA:C5DG81"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DG81"
                     /translation="MGGNDISERSVYEDASALLMLSRGKDSSTNHTPLQDIKQPIGSP
                     GLRSSSQVHSEPRSPLTSGDVRSRASSISLIQHNSTASPGPAYATLSAEDEDGLSSRM
                     HEKTESPSSRSNSNKGIVAAAALAAAATVPLPLRKQDPEHRESKHNSRKSDHSEQRPK
                     RSWPVPNSYVVDPDSGIITCICGYDDDDGFTIQCDHCNRWQHAICHGIRNIETAPDDY
                     LCSNCHPRKLDVKRAKRKQQERLNPRNNKKRRKSSQGEESSGKSNSSHASDSANTSVN
                     NLGGNEVASSAELKPTQRHLNSLEHHPVVYVPLTANDFKDRYVEMFVERHCDDDWVLP
                     YSHRIFQPVPLEVKSCSESSRSFTGLPKLGLFAKQPCTVGSYIEEVVGEVDFTKKYYG
                     DSRNNYRVCGTAKPKVFIHPHWPIYIDCRLSGNLTRFIRRGCQPNVELVSVHLNGDAP
                     QVKFVLRALKDIGDGDELQIGWQWDLRHPIWHLIKGDNKSVDSLDDPDKFTLVHSVDT
                     ILSCADCACGAHNRDCYLLKVKKFSQSLIKSVKSKMNGRYKLNEVLQNAQNKNKKLQT
                     PILSRLAHEAISNAARANELLVDFHAAKLKYLKEEGIPVSQLISRQPSLSDTENFDHA
                     KPFKLYLVNKHFTTLRGGGEQENHRPSITTGTSNSLRYDESHITDLKSLPLPVELQLP
                     RLSSMGEKALSIRENSNGDVAPELSTKAPVTPSVALPAVAVAAGPAINSRHTLKKKLS
                     FADYKKKMKPI"
     gene            <301688..>302095
                     /locus_tag="KLTH0D03124g"
                     /db_xref="GeneID:8295082"
     mRNA            <301688..>302095
                     /locus_tag="KLTH0D03124g"
                     /product="KLTH0D03124p"
                     /transcript_id="XM_002552816.1"
                     /db_xref="GeneID:8295082"
     CDS             301688..302095
                     /locus_tag="KLTH0D03124g"
                     /note="similar to uniprot|P42949 Saccharomyces cerevisiae
                     YJL104W"
                     /codon_start=1
                     /product="KLTH0D03124p"
                     /protein_id="XP_002552862.1"
                     /db_xref="GeneID:8295082"
                     /db_xref="GOA:C5DG82"
                     /db_xref="InterPro:IPR005341"
                     /db_xref="UniProtKB/TrEMBL:C5DG82"
                     /translation="MAHRALFQVIFTGAQVFGRAFSEAYKQAAVQATKTGANAARAGA
                     AKAEYGGITLDESCKILNIENEADMASPEKIEERFKYLFDVNDKEKGGSFYLQSKIYR
                     AAERLKYELAEKQQVDKAAEGQKGPEKPPSAEQ"
     gene            complement(<302961..>304298)
                     /locus_tag="KLTH0D03146g"
                     /db_xref="GeneID:8295083"
     mRNA            complement(<302961..>304298)
                     /locus_tag="KLTH0D03146g"
                     /product="KLTH0D03146p"
                     /transcript_id="XM_002552817.1"
                     /db_xref="GeneID:8295083"
     CDS             complement(302961..304298)
                     /locus_tag="KLTH0D03146g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D03146p"
                     /protein_id="XP_002552863.1"
                     /db_xref="GeneID:8295083"
                     /db_xref="GOA:C5DG83"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C5DG83"
                     /translation="MSSDIGKTELLAKLERLDQEINDYFDLTLDKARLRYKRVGRGNK
                     VKVVDKIQEKRVAVQKWRDSVKTDYETAVTKFKRAWDLLQNNPELDLCAVTDNLGNSR
                     IFQVHKLGAVLENVSLTNLEVSALKQHDTEFPRTLASMGASKEDYDGFLEWQVNILGR
                     SATLYEQLPKVYWNSHKYQWSKNSYRICATAKNLGSYATYCKFFSKLGICTNANCKFV
                     HDPRNIAACKDFLASDNCKYGSKCRLSHKLGNEYVTPHCKDFAQRSCKFERGAEQWTQ
                     SREQDSAVCCRYIHSTIVNSSYPVCRQFAHMGFCYRGLHCKFPHYLECPDSNYTSTCF
                     LNHCKFPHIERKVLPDERAVALIDIPSSCLLLPPAREKDHRAPNSSWYGLRTKQQSIN
                     IKDGPGEKFTTEAVPALQLEPGSSTDDVSSSEVSSTGSSDISSDELDADFIKL"
     gene            <304459..>306024
                     /locus_tag="KLTH0D03168g"
                     /db_xref="GeneID:8295084"
     mRNA            <304459..>306024
                     /locus_tag="KLTH0D03168g"
                     /product="KLTH0D03168p"
                     /transcript_id="XM_002552818.1"
                     /db_xref="GeneID:8295084"
     CDS             304459..306024
                     /locus_tag="KLTH0D03168g"
                     /note="similar to uniprot|P36119 Saccharomyces cerevisiae
                     YKR023W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D03168p"
                     /protein_id="XP_002552864.1"
                     /db_xref="GeneID:8295084"
                     /db_xref="GOA:C5DG84"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:C5DG84"
                     /translation="MGKSSAISFAVREIPHIIPIDEESARQLCEQILSEYGEDPQAIA
                     EKFMDILGPEDASLNFVLQFTEKLSHEESEKASKSALSPKPSTKNDTFASRSGRQGVN
                     KPESAELRKSEEPSGVPAAPKANAPRKAVVRPSTRPNPKESSKKASKTRKVQSLTEID
                     DILKALELEQTESDPTKYACNCQGTRHPLFEVAPNCLSCGKIICLREGLNLNHCTFCH
                     TEFLSAEERAQIIEVLNQEKQDLESSKPVAALEKPKKPKGYKITSGAGTNLFSEQDKL
                     FDRVEKERQRELKRAEVLEGIDKEQSKAMHSQNGEDNADPELKVAQERLEKLLHFQDT
                     SAQRTKIIDNASDFSMSNDGSVWGSAQDRALLLKKQQRNMRRWEKLERERHGGRDKVV
                     MDLSIGKDGKVTMTEARRAPKTAHAFDEENVEDISDEEDLQDLQEITELKSTLMDEKK
                     RIDKDLESNVWDPEKDKKQFQKPVYVNNESEISPEKGKPEKDGTRDRGWKNRVQISQG
                     DENSLEQNILAVL"
     gene            complement(<306459..>308609)
                     /locus_tag="KLTH0D03190g"
                     /db_xref="GeneID:8295085"
     mRNA            complement(<306459..>308609)
                     /locus_tag="KLTH0D03190g"
                     /product="KLTH0D03190p"
                     /transcript_id="XM_002552819.1"
                     /db_xref="GeneID:8295085"
     CDS             complement(306459..308609)
                     /locus_tag="KLTH0D03190g"
                     /note="similar to uniprot|P36120 Saccharomyces cerevisiae
                     YKR024C DBP7 Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /codon_start=1
                     /product="KLTH0D03190p"
                     /protein_id="XP_002552865.1"
                     /db_xref="GeneID:8295085"
                     /db_xref="GOA:C5DG85"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG85"
                     /translation="MSDDDGMMLLNLDTTSSVDQTPGKVKVSGGRWKDRRKAKAMLNG
                     KSVNSKDDRLVTSGSVKRPVSTEQGVEERKEQPARKQAKKVQIKATPADQQIVSSLFT
                     SNRGIVTSINNNVHDENSGVGPSNAPLLQDSFEALGITSPLLQHLSEVMHITKPTRVQ
                     KMSIPTLLEADNDVFVHAQTGSGKTLAFLLPILSRILSMGARVDRQSGCFGMIITPTR
                     ELASQIHSVMLTLTKCCHYLIPCLLIGGERKKSEKARLRKGCNFIIGTPGRILDHLQN
                     TQVIKEQLSSSLRYLVLDEGDKLMELGFEETITQIIKFLYEVPLNHFKYPELPKRIIH
                     VLCSATLKGGVNKLGNLALQDYKLISSGRKQQEVNTVPDQLIQKIVMVPPKLRLVTLA
                     AELNNITVRHLASETGETRRTIVFLSCSDSVEFHYAAFSSDSGHGRALVGDSVKVLSG
                     NSTSLPCLADVSQPSVVCYKLHGSLSQQIRTATLKSFSSDSDATKGKHLIMFCTDVAS
                     RGLDLPCVSSVIEMDPPFAVEDHLHRIGRTARAGVSGESLLFLLPGEEEGYMDHIKPH
                     HPQGWKLLKYDVDILKPAFMESKVQRSDGVSGKPISDEWDNNATTWHLNIERRVLGDP
                     TFKEIAAKGYTSHIRAYATHLSQEKKFFSIKCLHLGHLAKSFALRERPKVMGGMNAKN
                     SANGEQKKPKETSKSKMLRMAKKALDQSMSEFNY"
     gene            <308786..>309532
                     /locus_tag="KLTH0D03212g"
                     /db_xref="GeneID:8295086"
     mRNA            <308786..>309532
                     /locus_tag="KLTH0D03212g"
                     /product="KLTH0D03212p"
                     /transcript_id="XM_002552820.1"
                     /db_xref="GeneID:8295086"
     CDS             308786..309532
                     /locus_tag="KLTH0D03212g"
                     /note="similar to uniprot|P36121 Saccharomyces cerevisiae
                     YKR025W RPC37 RNA polymerase III subunit C37"
                     /codon_start=1
                     /product="KLTH0D03212p"
                     /protein_id="XP_002552866.1"
                     /db_xref="GeneID:8295086"
                     /db_xref="GOA:C5DG86"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:C5DG86"
                     /translation="MSEQIENQLFVTEDSGDVVMEDANLQESEEGDPIVREIPINLTN
                     GPFPLHILQYPNKPKKNGNDPVLHPPVSQVRYKSKSSLWELDVPVNTEIFYDKNRAED
                     EWDSVAQQTLKGVGVQTEGQYVGMVVDEEVYLLPVQAVAQMRPFFKYIDTVAQSKREN
                     EARGAQPSNPAARRAQVVTMSVKSSSEANQPRLGGALLAHKVADEEPPQDLEWIEGTF
                     NQFRESVITEDSRTMMLPLGDENDYLSKAM"
     gene            complement(<309575..>310492)
                     /locus_tag="KLTH0D03234g"
                     /db_xref="GeneID:8295087"
     mRNA            complement(<309575..>310492)
                     /locus_tag="KLTH0D03234g"
                     /product="KLTH0D03234p"
                     /transcript_id="XM_002552821.1"
                     /db_xref="GeneID:8295087"
     CDS             complement(309575..310492)
                     /locus_tag="KLTH0D03234g"
                     /note="highly similar to uniprot|P14741 Saccharomyces
                     cerevisiae YKR026C GCN3 Alpha subunit of the translation
                     initiation factor eIF2B the guanine-nucleotide exchange
                     factor for eIF2 activity subsequently regulated by
                     phosphorylated eIF2 first identified as a positive
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="KLTH0D03234p"
                     /protein_id="XP_002552867.1"
                     /db_xref="GeneID:8295087"
                     /db_xref="GOA:C5DG87"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:C5DG87"
                     /translation="MSEEFNITETYLKFLEEDSEMTMPIAAIESLVTMLRVKNPETSA
                     EMINTIKSAADTLTSSIPNSMSLRAGCDIFMRFVFRNTHLYGDWESCKKHLIENGQLF
                     VSRANRSREKIAQIGLDFISDDDIILVHGFSRAVYSVLSHAASKFIRFRCVVTESRPT
                     KQGAQLYKLLQEKNIPVKMVVDSAVGSIIHKVDKVLVGAEGVAESGGVINLVGTYSIG
                     VLAKNTNKPFYVVSESHKFVRMFPLSPDDLPATAGPLDFTRHEDCEQSLLEPAIDYTS
                     HEYITALITDLGVLTPSAVSEELIKMWYD"
     gene            <310691..>313087
                     /locus_tag="KLTH0D03256g"
                     /db_xref="GeneID:8295088"
     mRNA            <310691..>313087
                     /locus_tag="KLTH0D03256g"
                     /product="KLTH0D03256p"
                     /transcript_id="XM_002552822.1"
                     /db_xref="GeneID:8295088"
     CDS             310691..313087
                     /locus_tag="KLTH0D03256g"
                     /note="similar to uniprot|P39677 Saccharomyces cerevisiae
                     YJL102W MEF2 mitochondrial elongation factor G- like
                     protein"
                     /codon_start=1
                     /product="KLTH0D03256p"
                     /protein_id="XP_002552868.1"
                     /db_xref="GeneID:8295088"
                     /db_xref="GOA:C5DG88"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG88"
                     /translation="MRLPRLKLWSQCRHIASRTDVTKLRNIGIIAHIDAGKTTTTERM
                     LYFSGKTKRIGNVDEGDTVTDFLPQERSRGITIQSAAITFNWQNSFGINLIDTPGHAD
                     FTFEVIRSLKVLDGCVTILDAVAGVEAQTEKVWSQAKGIPKICFINKMDRVGAGFSRT
                     VKELIVKMNTRVLLINIPVFSQPGPTMEPIFEGVLDVVNKTVLRWTATDVNLVNIEDV
                     TSDSPHWNELVKLRESLIETLSEYDEDLVEYFLETANGDYMAIPAKKIDHSVRKCSLA
                     NFATPVLCGASFRNIGVQPLLDAVIKYLPSPVEARLPDFNHNLPVEVSNKKGVVVNKN
                     HNLCVAQAFKVITDPIRGIMVYVRVYTGVLNSGFAIFNSTTGAKFKVGKLVIMHANVA
                     EEVKQLNAGEIGVLTGSTVSENVRTGDTIIAHNMKRDGLRSLNKEKELSLKINPIITP
                     PPVFSAAIEPRTLGNRKAMEESINALIREDPSLRVSVDEESGQTLLSGMGELHLEIAK
                     DRLLNELNADVEVGKVVVSYNETLNVSSPLQEHKSEDGYHFGIQVEPLEVATETRNEN
                     EEWHYLSNDNNYLVMEKGAHRLKESNWPYQIPYDSIVNAILSSCLVAFQRGGKRARFP
                     LHSCVVRVKSDWSIPPDLNSVTPILKISKSMILEGLDKIADRDYSILEPIMNITVTVK
                     QQDMGQVLQDLTGACKANILSIEDEHDVSSEENFDLTFQKIAEEQYLPSDNTMDKANI
                     SSGSSINKIIKALVPVGEMVSYTSKLRSLTQGRGSYHMEYSGMEKVTGDRLPMILENY
                     "
     repeat_region   314187..314449
                     /rpt_type=long_terminal_repeat
     gene            314511..314600
                     /locus_tag="KLTH0D03300r"
                     /db_xref="GeneID:8295090"
     tRNA            join(314511..314547,314565..314600)
                     /locus_tag="KLTH0D03300r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove"
                     /db_xref="GeneID:8295090"
     gene            complement(<314732..>316684)
                     /locus_tag="KLTH0D03322g"
                     /db_xref="GeneID:8295091"
     mRNA            complement(<314732..>316684)
                     /locus_tag="KLTH0D03322g"
                     /product="KLTH0D03322p"
                     /transcript_id="XM_002552823.1"
                     /db_xref="GeneID:8295091"
     CDS             complement(314732..316684)
                     /locus_tag="KLTH0D03322g"
                     /note="similar to uniprot|P32477 Saccharomyces cerevisiae
                     YJL101C GSH1 Gamma glutamylcysteine synthetase catalyzes
                     the first step in the gamma-glutamyl cycle for glutathione
                     (GSH) biosynthesis expression induced by oxidants cadmium
                     and mercury"
                     /codon_start=1
                     /product="KLTH0D03322p"
                     /protein_id="XP_002552869.1"
                     /db_xref="GeneID:8295091"
                     /db_xref="GOA:C5DG89"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:C5DG89"
                     /translation="MGLLSLGTPLEWPESRQYNDHVRKNGIEQLLYIFLAANGRKNDP
                     LLWGDEIEYMMCKIDDAGRNAVLAVDDDDVLCALNTEDVGVCQAHNTSFHPEYGRYMI
                     EATPARPYTGFMSNYVEENMGERRAIVDSKLEKRGVELLSLAVFPRMGCPGFTDLSES
                     WDHHNSASRSLYLPDEIINRHARFPTLTANIRTRRGEKVCMNVPMYKDKRTPDHDDTV
                     FVRDWFTIEDKEGPLASKPGHIYMDSMGFGMGCSCLQLTFQAPTVDKARYLYDSLVNF
                     APIFLAATAASPAFKGWLADQDVRWNVISGAVDDRTPYERSTEPLLPEYNNGNGKSLN
                     EHPMRIPKSRYSAVDLYLGGNSFFDREFNDTDVPVNQEVLERLQSNDIFPMDFDLARH
                     FSHLFIRDPLVVFQERVDQDNKHSTDHFENIQSTNWQTLRFKPPTQEATPENKKCPGW
                     RVEFRPMEIHLTDFENAAYANFIYLVVECLLTFSDDINAYVPMSEVWKNMEIAHRRDA
                     VLDEEFYWKIGFNKEGTRKLSFTEIFHHPESGIFPQFIDRILVHKGFVSSSWTELKNS
                     RQSAHLRLYYYLKLISDRATGALPTTARFLRDFILNHPDYKEDSRLTSVINYDMLKLA
                     SRLTHLDDTNGELTRFFGEEIVQFLR"
     gene            <317628..>319313
                     /locus_tag="KLTH0D03344g"
                     /db_xref="GeneID:8295092"
     mRNA            <317628..>319313
                     /locus_tag="KLTH0D03344g"
                     /product="KLTH0D03344p"
                     /transcript_id="XM_002552824.1"
                     /db_xref="GeneID:8295092"
     CDS             317628..319313
                     /locus_tag="KLTH0D03344g"
                     /note="similar to uniprot|P42951 Saccharomyces cerevisiae
                     YJL100W LSB6 Phosphatidylinositol 4-kinase that binds
                     Las17p which is a homolog of human Wiskott-Aldrich
                     Syndrome protein involved in actin patch assembly and
                     actin polymerization"
                     /codon_start=1
                     /product="KLTH0D03344p"
                     /protein_id="XP_002552870.1"
                     /db_xref="GeneID:8295092"
                     /db_xref="GOA:C5DG90"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="UniProtKB/TrEMBL:C5DG90"
                     /translation="MAQQSNNLGNANQVVTTNTYDWLQNREQQERLSDTAHNSTAFIG
                     TLGRWTSFVWHGGDGTPSRLTLGEEHYEIQYSVFEPLRGYTEIPVLPDRDALTQHFRC
                     VVKDCVDAITNYNIELQRIKAGSSGSYFVYGTGDSQTPLGVFKPKDEEPYGPLSPKWT
                     KWAHRTFFPCFFGRSCLIPNLGYICESAASVLDELLGTGLVPHTDTIVLMSQNFYDKR
                     RAWFATEPRKLQKSGSFQLFVKDYVGAGEFLDKHPFPGMFRERVDHKQEEEFHWNAQT
                     LQTFRLKLEKLIILDYIMRNTDRGLDNWMIRVRKLSDNTWDLELAAIDNGLAFPWKHP
                     DEWRSFPYGWLYLPVNILAQPFSESTRRHFLPLLTNKKWWENCHSQLREQFSRDAEFK
                     TRMWKKQWSVLKGQAFNVVETLKNPTQGPLELVRRTRTLVIDEIMQVPSSTLPLAIIQ
                     SAMRESIPFSPSSPMVLSSLPEEGTNSGTAKDFISQRPNFTEHLQEVGEGGRPMTGES
                     RVHNTKPSTTTDAQHGPSEEGTSVGIQASYKTKKVVIERLMLVNSKPPVFTWW"
     gene            <319479..>321656
                     /locus_tag="KLTH0D03366g"
                     /db_xref="GeneID:8295093"
     mRNA            <319479..>321656
                     /locus_tag="KLTH0D03366g"
                     /product="KLTH0D03366p"
                     /transcript_id="XM_002552825.1"
                     /db_xref="GeneID:8295093"
     CDS             319479..321656
                     /locus_tag="KLTH0D03366g"
                     /note="similar to uniprot|P36122 Saccharomyces cerevisiae
                     YKR027W FMP50 The authentic non-tagged protein was
                     localized to the mitochondria and uniprot|P40955
                     Saccharomyces cerevisiae YJL099w CHS6 chitin biosynthesis
                     protein"
                     /codon_start=1
                     /product="KLTH0D03366p"
                     /protein_id="XP_002552871.1"
                     /db_xref="GeneID:8295093"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:C5DG91"
                     /translation="MNILPWRKKNASSVAVNEHPRDALFKDDDHLVQKLGANLEENPR
                     ILEVKFGESFGIRGRLLRTLAEQDLLGIGPPDMAHVTQFDRFHQTETGEYHYLTGLDT
                     SSEATPIAYLNTLKLAGGSSKNKNRVSTYCCTNVFSNVDIRIRYESPKHYQINVIDCI
                     SGSSNIQLTPALWEEAFVSGFVRSIITNMDRERKLPGLVELPFALENGLAYCKKCISL
                     VCRYLPRGPELGCDMTKHSFPSYKNNYILDSLLSLLQVANKLNGFVVGTLEDLCMQDP
                     ENSVCYKTAMAAVLIKSEAKDIVAIQTINSSMQNLFPNGLKDLEQSQLIHAADLLNLQ
                     IDFLMVRGDFALALPLAQKVTSICSDGFEAWNKLARCYVELGNHEQALFAINSLPALP
                     SSDPCKDAMLQEAAKEHFYNRPLCSTPRSRLQSNEYHFISSTLGSVKDHDLTSMIYGR
                     IVMPPQAKRGCIKEIWEGPCVELGPIYGPQSKNLINFVSPQEVASLGDKNLLARNSMA
                     SQLSWSMTCAYDLLVHIISKIGWNSLLELRSSIFVMERERGLGDAGVLRPEFKAKRLC
                     EKWLDQLFLNLYEDLKITFNSQEHREELYSGLEWELLGLTHLRTWLWADAVACLRTSI
                     MARFDPVSAEKLLDLYLTRRYPSSDVLDQDVLLALVVDKISYESRFYNFLNLADLRVL
                     IDLSASSGVDTVRNHIYTLPSAQTGIVALTDKLLNYVQELNDD"
     gene            <322117..>325185
                     /locus_tag="KLTH0D03388g"
                     /db_xref="GeneID:8295094"
     mRNA            <322117..>325185
                     /locus_tag="KLTH0D03388g"
                     /product="KLTH0D03388p"
                     /transcript_id="XM_002552826.1"
                     /db_xref="GeneID:8295094"
     CDS             322117..325185
                     /locus_tag="KLTH0D03388g"
                     /note="similar to uniprot|P36123 Saccharomyces cerevisiae
                     or to YJL098W uniprot|P40856 Saccharomyces cerevisiae
                     YJL098W"
                     /codon_start=1
                     /product="KLTH0D03388p"
                     /protein_id="XP_002552872.1"
                     /db_xref="GeneID:8295094"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:C5DG92"
                     /translation="MSGSFWKFGQNYASESPLSKLLNRAFIKVSSEEGAQDKQQDNDS
                     QEKINRLLASPGGSSSDGSESLEKSDADAEHGSADQNNALPDSEAEYRDYEPNMEVLD
                     ELLDDEELYTELMCSNFKLLIFFKYPQVLAKLVDYVTNEHVLSESLEESEEEDEKPIS
                     DAPKSGADDSEEPQNKESLGGDKNDREPMSDQLSVSSNETSITLPPDSEEQSDSRRAR
                     MAAEILSADVWPISSAFMDHEELLGRLWAMLDHPAPLSIVASTYFMKINERLLDMDIS
                     GMLHFILAQDDLVDRFLKHTDNPPLMDYLLKVISTDKPDTSTGVIEKLGSQELIPKLL
                     DHLAAGHSSSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRELVSPPMVEKLMNI
                     MLSGGTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCAAE
                     HLPEFNKMLVETELPPLETPFGSIEPLGFERFKICELVAELLHCSNMTLLNEPSGGSI
                     VAERDAVREKILQQEKSEGSHKKDENEDVLQKMSDLRIAATNSENSSDEDGIQTKEDA
                     DAAGEEIQSEGSSENELSEKSLRENPVVGDQLKIALQDNRVITSILEMFFDFPWNNFL
                     HNVVFDIVQQIFNGPLKTGFNRFLIADLFTGAKLTHMIMDGDRKCEDYENETGLRLGY
                     MGHLTLIAEEVAKFAAYVDEMKITFSNSAIVESLNEPRWKEYTETVLADTRENYSSVL
                     GDFEEEEDDHEDPDIEDENPGGKTSVTGNDEGDGYRDFDNGAGSTGNYTEYDSVDNPR
                     YYQYEDEHGNKTELHLNPDIDYDIGPGTFSENNAQELEDHDITEGGKDGKNKFSNYMS
                     RQLSKDYNTSSSSDDDDEDIWGSSAPGSAQSSEFLKHGSKAGSSEFKDSGAFNPSHFG
                     LEDDDDDYMDPNDDGQSYAKPHHPLYDSMLSQGKSENQLYYDQGDASLAENDDEDSDD
                     SDKEDAGDEDDQYSLCRTSSKDNMAWDHAEQNRIINTAQYRQNQQELADK"
     gene            <325452..>326096
                     /locus_tag="KLTH0D03410g"
                     /db_xref="GeneID:8295095"
     mRNA            <325452..>326096
                     /locus_tag="KLTH0D03410g"
                     /product="KLTH0D03410p"
                     /transcript_id="XM_002552827.1"
                     /db_xref="GeneID:8295095"
     CDS             325452..326096
                     /locus_tag="KLTH0D03410g"
                     /note="similar to uniprot|P40857 Saccharomyces cerevisiae
                     YJL097W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0D03410p"
                     /protein_id="XP_002552873.1"
                     /db_xref="GeneID:8295095"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:C5DG93"
                     /translation="MGKVSFVNPLALYNLFSAGLWGYLLYNAIVVYPKIGQPEFFYEI
                     KSTLNAIQCGALIEVFNSLFGIVRAPLLTTFAQVASRLLLTIGVFQYLPEAENAHNKT
                     FVSLVIAWSITEVVRYSFYYFNLTLTCGAPKLLVLLRYNLFWVLYPLGVASELLIIYS
                     ALPVGESKYSANVRWALIAAMLTYIPGFPMLFSHMVVQRKKIMRSIRSTTKKEN"
     gene            <326296..>326769
                     /locus_tag="KLTH0D03432g"
                     /db_xref="GeneID:8295096"
     mRNA            <326296..>326769
                     /locus_tag="KLTH0D03432g"
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /transcript_id="XM_002552828.1"
                     /db_xref="GeneID:8295096"
     CDS             326296..326769
                     /locus_tag="KLTH0D03432g"
                     /note="some similarities with uniprot|P40858 Saccharomyces
                     cerevisiae YJL096W MRPL49 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /protein_id="XP_002552874.1"
                     /db_xref="GeneID:8295096"
                     /db_xref="GOA:C5DG94"
                     /db_xref="InterPro:IPR028909"
                     /db_xref="UniProtKB/TrEMBL:C5DG94"
                     /translation="MNSLRRLFPALNSFRQCAHFPTAQFSRSISSTAVSSQKFDITPL
                     KLSNELYAVIRIHNRPYLVTKGDKVTLPFKLKQAEVGDILNMNDVTAIGSRNYKVVDS
                     PLDPSLYTIKATILEKTKRPMRVREVTKRRNRKVRHAVSKPDLTVLRISELSLND"
     gene            <327039..>331340
                     /locus_tag="KLTH0D03454g"
                     /db_xref="GeneID:8295097"
     mRNA            <327039..>331340
                     /locus_tag="KLTH0D03454g"
                     /product="KLTH0D03454p"
                     /transcript_id="XM_002552829.1"
                     /db_xref="GeneID:8295097"
     CDS             327039..331340
                     /locus_tag="KLTH0D03454g"
                     /note="similar to uniprot|Q01389 Saccharomyces cerevisiae
                     YJL095W BCK1 Mitogen-activated protein (MAP) kinase kinase
                     kinase acting in the protein kinase C signaling pathway
                     which controls cell integrity upon activation by Pkc1p
                     phosphorylates downstream kinases Mkk1p and Mkk2p"
                     /codon_start=1
                     /product="KLTH0D03454p"
                     /protein_id="XP_002552875.1"
                     /db_xref="GeneID:8295097"
                     /db_xref="GOA:C5DG95"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DG95"
                     /translation="MAFLKKKLANVNHSSRSRSGSTSSSRFHASPSTPNSPEFKLPEL
                     PPKIPADKNSLKATPFHSHTHPIARIVPRPLDEKTDVQNSSGFTFEEDQSNEVRQNEA
                     RQNEVKFPSKKNSTVKNTPNYAVSNSAPGSTYTGITNSPQQGLLFSWDVTNPDEWNMV
                     RVLSWFRFNDFDESWVAYFKKRQIHGRSFLKLMAYDNFLEHENNLIQTKTSSYKRFQY
                     LLKRTLEQNVVSGHNRNRSDKSNGSRSSSDSVKIRNKMKQEFEHSRSISETMVAENKS
                     SAIDVNDEKIVPLRSHQKTSSASSLYRRSFISLLGSSSQDQIKPDPNINIKIPPRPVS
                     SAESINQPDRCNNRTCSSPISPSYSGIFRRQHKSSSSESSIFNTLFGSNTGGSSNSIA
                     EKPAEEHKKPRPVKSSSLESLPREKSSLNSSEFPLPKQSYPLNDEKSRLWGKLKRKSL
                     QPDLSATRSTSAPSEIELSEENTLVNTNLPESQEFNWEDFVLEKRFYPLKNSKTDDRF
                     ILITKDNKSFIPLNIGIITNLDELKDSMALTLGIKHKNYTIHLTDFGCDIGCAIEDDL
                     LETLRGNMFSNVPSKLFIKDQTPIQSKPEIVEPSSEVTASGQLVKNKRTELSANSSII
                     NSNDDTSTITSCSDATSFDDIARAAGRAVYPQTPNSYYGAVVTNPNSEVDYWTVKDNL
                     PEDPQQSRGSKTRQRFRPRKSSGADSNVPSGSTDSDQSFQIIRKKSNDEIDFNNRRAS
                     PYVNPDFAPRREAPKPPSSSQNSLVSTGSNSLANSPKFNRIRANTASLKRKARPPPPA
                     SILNQLSTRSSNGSLRTSKNTAVSPSESVVHSYTPGSTQVLVPQPYKGNSDTIKPGIL
                     EDSIISYTHPPFVSRSGSLQSTANSVLPSPPHLSKRFSTKRIVSSASAADIFDENDIS
                     FADAPNLTESDEDRHSDSSDEIIWSSQRKQCEPKKLDGTKQATEDSDCDIDEKSLNSV
                     DSATNTHLHFPTRKMTLRPSPEVVYQNLERFFPGTDLDRPIVEGTTPPPSPRIVKASS
                     PKISSLGNDQPGPDPEPRSPNNSRVGTPQTMISKSMNDSQEVLSQSSNVLKIPRRTKT
                     IRIIAREASDARRNSKTRSLGRKNTKMWGTRVVEVTDKKTVAINKSKNSNGEYKEFAW
                     IKGEIIGKGSFGSVYLGLNVTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLK
                     DLDHVNIVQYLGFENKNHVYSLFLEYVAGGSVGSLIRLFGRFDEDLIRFLAVQVLRGL
                     AYLHSKGILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRGTVFWMAPE
                     MVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQK
                     LLSAEAKSFLDACFEIDPEKRPTADDLLSHPFCGVRSRFVFQETSLARFIRSKPA"
     gene            complement(<333077..>334864)
                     /locus_tag="KLTH0D03476g"
                     /db_xref="GeneID:8295098"
     mRNA            complement(<333077..>334864)
                     /locus_tag="KLTH0D03476g"
                     /product="KLTH0D03476p"
                     /transcript_id="XM_002552830.1"
                     /db_xref="GeneID:8295098"
     CDS             complement(333077..334864)
                     /locus_tag="KLTH0D03476g"
                     /note="similar to uniprot|P40310 Saccharomyces cerevisiae
                     YJL093C TOK1 Target Of K1 Killer Toxin outward- rectifier
                     potassium channel"
                     /codon_start=1
                     /product="KLTH0D03476p"
                     /protein_id="XP_002552876.1"
                     /db_xref="GeneID:8295098"
                     /db_xref="GOA:C5DG96"
                     /db_xref="InterPro:IPR003280"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="UniProtKB/TrEMBL:C5DG96"
                     /translation="MVRKNSSDAEREYKRLLDESLSFNRDKVIILNAEPSSRSFVIWF
                     IISSYFPVITACLGPISNTIAVAGIVGKWRADAAGKTHPDPKGVYAVNVVSLALGCVS
                     NFVLLLHFSKRVGYIRAQLTNIVGWTLAGGLLLADVIVCSQRDFPPNLQRTVGFWYAS
                     FTVLLYFGSTVLLSIHYCGYKAGKYPAKFNLTDSERNVMIFTFVLSIWFIWGSAMFSK
                     LIEISFDEALYFCTVSILTIGLGDIVPLSVSAKIMTLVYSMSGVIILGLIVALTRSIL
                     QSSSGPILFFNRVETARTKVYEKLIASGEQLEGREAFEVIKNIRKVSVQRQKRWSVLS
                     TLVIFIAFWLLGALVFHFAERWNYFNCLYFCFLCLITIGFGDYAPKTGCGRAFFVIWA
                     ICAVPLMTAIINTVGETLHSMSSNLEINIAKSSALLLSPVFSMFDKICSFCSNSPKET
                     QMDHSVADEHGPQSASESQAEGNGELLSIHSPERPPSKPDFDSGSDSSIDSKIATKLK
                     DYLQVIKWLRELSHRKPDSKLDFDEWARLFSSISDDGDRTLGDPHFWVSEDSPLRYPI
                     DEPRYVMHNLLINLENDIERLVRKNSDEA"
     gene            <335566..>338838
                     /locus_tag="KLTH0D03498g"
                     /db_xref="GeneID:8295099"
     mRNA            <335566..>338838
                     /locus_tag="KLTH0D03498g"
                     /product="KLTH0D03498p"
                     /transcript_id="XM_002552831.1"
                     /db_xref="GeneID:8295099"
     CDS             335566..338838
                     /locus_tag="KLTH0D03498g"
                     /note="weakly similar to uniprot|P12954 Saccharomyces
                     cerevisiae YJL092W HPR5 DNA helicase and DNA-dependent
                     ATPase involved in DNA repair required for proper timing
                     of commitment to meiotic recombination and the transition
                     from Meiosis I to Meiosis II potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0D03498p"
                     /protein_id="XP_002552877.1"
                     /db_xref="GeneID:8295099"
                     /db_xref="GOA:C5DG97"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DG97"
                     /translation="MERLLSSLNERQCESVTFDHTKALQVVAGPGTGKTKVLTTRVAY
                     LLLEKGINPGDIIITTFTKKATLEMIERLSFLLEGTNINPSSLWIGTFHSICARILRQ
                     HGWKIGLPKDWRTFSDSDTDPIIHKLVEKVPDQIRDYAHSYTRKANLLRPNSKGNWEV
                     HPASVKKMISWLKSEGVMADEYRANNEHDPALLHFYEAYQCELHSQHALDFDDLLLHA
                     FKLLSKERCLPHIKHVLVDEFQDTNSIQLNLMYLFARGNSTTSQGITAVGDPDQSIYA
                     FRNALASNFEDMAAKCPIPCSRIVLVENYRSSQKILTTSEMLIKQQLSGREDRLPLKA
                     QFDSDFPPVYIEFPAKFLEARALAREILYLRSLPKLWNYNSFALLVRHRRQIRPLETS
                     LIEHRIPYKIVNGRAFWELKEINGLMDLLKCVYSNYEKNAILRALQYPNRGLGPATVR
                     KVEATFADYESPFVALKNIVANPNNGAYASKALNVITEFLSLIESCRELMAEATDLSA
                     MTEIFDKLYEGSGLKFEYLHVDGKRKAEVDPNGEPNLLNKRHINVNILRKHLANFKPF
                     EEDLSQRQGPGDDEVDVKEEDTDVEGKINAHDILREFINSVNLYSTETEVEESQMSEK
                     ERRQKKKREKDGFVTISTIHGAKGLEWPVVMIPGCVEGVIPCVFGGKDDADDSDSATD
                     GGEEGNNRGNNGTSSPKKNRPRRNEGTLDEERRMFFVAQTRAKFLLYLTATNSNDTES
                     RYESSTPSRFLTTDLVNTMCEDQKVFTDVESVRKLYHNLNQPPPQESATFSLDVLVKD
                     YEQFVNARRERLTWKGRAVFDASRLNLGENITPSPTGFGITTAAAQLRNASTNHIEGR
                     QNSPYGISGVSHNQGNRNMAPVYRPSRNNSNTVLAPSRTFAPKTSPTQVKNAQAPVYA
                     PKVEDSAKVLREKAKASSESANSSKIKTGQLSRSASFECSKRRTGGRSRRTIVADSIN
                     LGAMNYNHDGTDVETNEGQVLVKGEMSAGERGNLNKTAGEMLHNPRDLRNDSRPILTN
                     AKTLADSVRSQTSKRSSAPSEVPKKKVKSEPMDKGYDIMSRLSQARRRADSDKDTVIV
                     ID"
     gene            complement(<338875..>340320)
                     /locus_tag="KLTH0D03520g"
                     /db_xref="GeneID:8295100"
     mRNA            complement(<338875..>340320)
                     /locus_tag="KLTH0D03520g"
                     /product="KLTH0D03520p"
                     /transcript_id="XM_002552832.1"
                     /db_xref="GeneID:8295100"
     CDS             complement(338875..340320)
                     /locus_tag="KLTH0D03520g"
                     /note="similar to uniprot|P47026 Saccharomyces cerevisiae
                     YJL091C GWT1 Protein involved in the inositol acylation of
                     glucosaminyl phosphatidylinositol (GlcN-PI) to form
                     glucosaminyl(acyl)phosphatidylinositol (GlcN(acyl)PI) an
                     intermediate in the biosynthesis of
                     glycosylphosphatidylinositol (GPI) anchors"
                     /codon_start=1
                     /product="KLTH0D03520p"
                     /protein_id="XP_002552878.1"
                     /db_xref="GeneID:8295100"
                     /db_xref="GOA:C5DG98"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="UniProtKB/TrEMBL:C5DG98"
                     /translation="MEDLKLRKEQFVSGLTGSSIQEINAVASVALCGYVCWSLLRSTV
                     ADGKVMLLADFFFNWCAILLSITTYADNPLALNLLLVVPPLLLWLCVRPTRSQRDISR
                     NSLQKAEFKLMRHPFITAYRGSMMIVTALAILAVDFRIFPRRFAKVETWGTSLMDLGV
                     GSFVFSGGLVSSRALLQNKLSGGRVSALKKIIHALRSSGTILLLGLLRLYFVKNLEYQ
                     EHVTEYGVHWNFFITLSLLPMAMIPIDAIAEYIPRVAIALVISTVYELFMVFNKDLLT
                     FLISGPRETFVGANREGIFSFVGYCAIFLWGQSTGFYTLGNVATKNNLLKPSVQPIKN
                     LNNIGTWEKLASKGPLCGLLTWSFITLSATQIVFAWHPFNVSRRFANLPYVLWVVSFN
                     LGALSLFCLVDKVFENSAIGSQTSVSLEAMNSNGLFLFLLANVTTGLVNMIMPTIDIA
                     PVEAFSILFLYASFLASVSIFMLKKRIFIKL"
     gene            complement(<340512..>342635)
                     /locus_tag="KLTH0D03542g"
                     /db_xref="GeneID:8295101"
     mRNA            complement(<340512..>342635)
                     /locus_tag="KLTH0D03542g"
                     /product="KLTH0D03542p"
                     /transcript_id="XM_002552833.1"
                     /db_xref="GeneID:8295101"
     CDS             complement(340512..342635)
                     /locus_tag="KLTH0D03542g"
                     /note="similar to uniprot|P47027 Saccharomyces cerevisiae
                     YJL090C DPB11 Essential BRCT repeat protein required on
                     the prereplicative complex at replication origins for
                     loading DNA polymerases to initiate DNA synthesis also
                     required for S/M checkpoint control"
                     /codon_start=1
                     /product="KLTH0D03542p"
                     /protein_id="XP_002552879.1"
                     /db_xref="GeneID:8295101"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:C5DG99"
                     /translation="MQKPLQGITFCPTALPEDASRSVSRKVAKLGGGFSKDLTKLVNV
                     LVVGSVATNKYRFAVQNRADMAFVGVDAIDTIYDLWLAGDDISMESHSNFSGIKNPRE
                     RMLSVLRTRHQLGALKDFVVFIGRVGDDQEGKLSPDSLERLCVEQGVHSCNTRHFVKE
                     SHWNRPTVFVTDCSRGARVDAARSQGLPIVHPKWVLDCHNRSALLDFAYYLLENNEHV
                     SFEVVGAGSCMCWDQISFQPSSAAANAHEDDSRLSQRVVLDKFASDGHRLWNSVMHKT
                     KKISPAETFPLPNAEKTKELPGLFHDKHCYLLGFPQKHKAVLHNIIVRNSGSCYDYED
                     GVQVREPSYLVIPSNVPRYTPASVDELFTHVVTEFFFERCLHYKKLLKPDPWCSPFFS
                     NFEVIPSDHLRQNLTVSEPLKVAITGFQGVELLHITKILEYLEPSGLKLSQKLNKETN
                     VLIINLGALNSIPESHPLWKNQYASMFGEGKKLEQNQIHRNSMKRKIEFIKQRHSIPV
                     VTAAFILELFSRVSKAKAQLKVSSRIHLNDVNWCISCPKGNKDQFYCDLLAKETDSTD
                     SGLEIASSANDCVNRSIKQNRQEALDIFRNGPTVNSKRSLYEEGIEARHSAEKVPSPL
                     PKIPRLVPTEALKPVQRSSSWGNLLSDQARKVDGLHDSDVEPSTGERELQHTQVTYGS
                     PKQINDVQAPPTRRLTRQRMKEIDT"
     gene            <343546..>346134
                     /locus_tag="KLTH0D03564g"
                     /db_xref="GeneID:8295102"
     mRNA            <343546..>346134
                     /locus_tag="KLTH0D03564g"
                     /product="KLTH0D03564p"
                     /transcript_id="XM_002552834.1"
                     /db_xref="GeneID:8295102"
     CDS             343546..346134
                     /locus_tag="KLTH0D03564g"
                     /note="weakly similar to uniprot|P46954 Saccharomyces
                     cerevisiae YJL089W SIP4 Possibly involved in Snf1p
                     regulated transcriptional activation shows homology to DNA
                     binding domain of Gal4p has a leucine zipper motif and
                     acidic region lexA-Sip4p activates transcription"
                     /codon_start=1
                     /product="KLTH0D03564p"
                     /protein_id="XP_002552880.1"
                     /db_xref="GeneID:8295102"
                     /db_xref="GOA:C5DGA0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DGA0"
                     /translation="MAKRKYGSPLSPKATQLLLSKHARMSQACDRCRLKKIKCDGIKP
                     TCTPCTKIGFHCQTSDKLSRRGFPRGYTEMLEKEVVRLQQRLVRAGYDPGDSTEVSVS
                     QQAAIGATADNSESFAGETSGQSEAPGSGATSTEPSASVQPSSEPQKQQLFHLPFIND
                     TFHLHENRVAADGRFLGHAAWNDIVGTLGKLPTEAMPDEDEWLCRYLVRQFQLSQHRV
                     PAALLIKYHNDAGFCKKRIRRSITHFLQTSMSLVPILNSSTWEERLFKINESKNTHPA
                     ALLAYLFIIQWQWSCFSDDKLFAATKIVVLNATQPLFRLQCLLLASYYFMGTPSMSLV
                     YNTSTAPYASQLLKLSFAEMINLGLFINSHRLVPLQNSPLSHSERLITFWCFQFLDSW
                     WTLLQGTPKSNFTMDEFLPPKISSLRNPRLKPFELLIDFVVGCLDGCNLLYALSQGAN
                     THMIFELESFRKRLFQYSLYHHLKDHDYHNLSTLATCVDKPQAIEIQLTLHYLIMTFF
                     ANLKAARSAGRSSAKAAESLRDTSYEILTLYYLIVVDSYDMKASIPQQLQVLHLLPCD
                     NLAIVNMCLECLSQWAVASENKAGTDSEYRMNYEKHRSIVKAWCKIWYFDEPEDELLT
                     RLQKNYQFSSQLPSGRSGQLAKLQYLNAMRTHNRRSLLLNLPDDNQVHDNVGSLNILG
                     VESTQFRIPAADSANNLFESLAIQEEDEGYAEDDDDDDDTPLELPFFKKKRSNKTTIA
                     QPPPIPVRSRSLFDQHHPGPIIRRQSDAVAANNGRLFSGIDESHLKVLKDNSVQKETE
                     DAKLRSEHYLLVQGFQKSPPEVDTPRSLADILSLSGAECKFPASSGSIPEDNAHDKQQ
                     ASVDHT"
     gene            <346309..>347241
                     /locus_tag="KLTH0D03586g"
                     /db_xref="GeneID:8295103"
     mRNA            <346309..>347241
                     /locus_tag="KLTH0D03586g"
                     /product="KLTH0D03586p"
                     /transcript_id="XM_002552835.1"
                     /db_xref="GeneID:8295103"
     CDS             346309..347241
                     /locus_tag="KLTH0D03586g"
                     /note="weakly similar to uniprot|P36118 Saccharomyces
                     cerevisiae YKR022C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0D03586p"
                     /protein_id="XP_002552881.1"
                     /db_xref="GeneID:8295103"
                     /db_xref="GOA:C5DGA1"
                     /db_xref="InterPro:IPR028211"
                     /db_xref="UniProtKB/TrEMBL:C5DGA1"
                     /translation="MFRKRAKLQPSVGSNKASGSSQKDSSETSKRRSRVDISTSYEIE
                     DENEHIRTSPSSRLKEKKKRAIKPNAHQYLPFEEEDITEIAYRKPLPKSGVQIMNLEE
                     LGDDCEDDTLEGVPTRREIESIRTQRAMLQQQTDTLKTGFYDSSKNPVEHDEHQYIKL
                     LSKDDKHDLMEIIGGESQGAKDVQDSYMDAYLEIHGLEDGRLALSKNDLDRDEQERKL
                     AITSALKNVEGDEWEARQLEKMDRGLSLIAHPILHENDFELEELVSELDSMLLSIQTK
                     KKMFISQRDSVQKENKKLCEAQDKLITSLQKHVA"
     gene            <349672..>355387
                     /locus_tag="KLTH0D03608g"
                     /db_xref="GeneID:8295104"
     mRNA            join(<349672..349685,349747..>355387)
                     /locus_tag="KLTH0D03608g"
                     /product="KLTH0D03608p"
                     /transcript_id="XM_002552836.1"
                     /db_xref="GeneID:8295104"
     CDS             join(349672..349685,349747..355387)
                     /locus_tag="KLTH0D03608g"
                     /note="similar to uniprot|P37297 Saccharomyces cerevisiae
                     YLR305C STT4 Phosphatidylinositol-4-kinase that functions
                     in the Pkc1p protein kinase pathway; required for normal
                     vacuole morphology, cell wall integrity, and actin
                     cytoskeleton organization"
                     /codon_start=1
                     /product="KLTH0D03608p"
                     /protein_id="XP_002552882.1"
                     /db_xref="GeneID:8295104"
                     /db_xref="GOA:C5DGA2"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:C5DGA2"
                     /translation="MSAFRESPGSLRALALAKLVNHSEGSRSIDKLVASLPVSYSSHP
                     AKLYTIPLTLNELEVLLGVCQFVPSTAQSAQSLLKKCIIPYFLSNPRQKFTDYVINKY
                     RQRGLKHPTEILSFELSRSIIRISRIFPQFIDEIREQIDEYLQYMSSNLTVENLLSFA
                     GFLEALVYEQNNLLSSFVISVLQAFISEDFLYAVEKTVRNSVSKDVLIDYFDHNREIS
                     SLLFCELIEKLQVTYAASLLNVPKKQTLDSYLLDLKHAQFLDGENKALKDFEKKVGQQ
                     RSKLLELCKFSFRQITEVEEGAKYIDLSSQNRLESAYTAKSYMLQILSLGLFLSHEVE
                     EVIEMIRDAVIDLPTNSFALKTSLLTTVVCVASLLNYFTDSVSADLLRVFPLMVTTKL
                     ITKQKVATISSAVSKGLKPLTEDVIVGTIYNINNLLALAQDGLHMTPVKDRRLTTVLG
                     TSNHFDRLLSSRPTRSNTVGTYQSLQKLKIAETSIVLQHESKLENYTSRQEEVESNST
                     LYHDSLYENVVTATTTMASVYNDQSITALTITILTQKIKSASPRLDRKILEGLAHLAL
                     KVNRSEFNLLMKFFHLSTNSALDNQDEKMMKSLIAAKSIIAEGLAKEDLHNNLFRIYL
                     RYLLDAIVARGDVDRSEHHRSHSEISKVADQIAVYLKPLASLLPKPGEKPLDLIHDEE
                     ITNVFRNVWFNAAVHGFHGAAALTSKNHEELLVIAYNSPPLASDFASGNRETSLDMNT
                     ILRRGSSNHNLKQQKLILSDHLSMSPVQARTLSSSKVMFLAATLLLEGLRCEAGDCSK
                     TLLYCSDRSIVKSGLDKFVSSISVSMVQRYTKLVIKGDSVIFSAENVAKQLDNILLLL
                     THRDAPLQDAAYQSCDRFIERIPSSLCHRDSLYTLLDSLTMLFDSVIACEANKHEAVF
                     EFTLKHSNRKMMLPDSLNWRSLTLEKLQKYATRWVTMILKTANQDTKILLQSYISDVS
                     STRRLNSIEFGVSFALEMAAKILPVDRELANISQGGYRRPDSISGFLSQHAWRSRFIM
                     DQSVLSTYDGIEAERNFSRRKILAHLENKKPLDYKDISAFLDLSASLLILRQGNTASL
                     VYDIVCIPFQIFTSDTIKIATNVWLSVINERSDVGYLLLSEIGHCWRDSIDNNTGLFS
                     MKHNLVAEEFQYMEYSPYNKKEINRRAHAASKSLQPHLQLIRFLSSHFEGTMFDSLHL
                     LHIFTKLCLYGLKNLGKASLHPFARIARSELLYFGTLVFATNVKHNTLYVPEISRFLV
                     DGALTWFEKPKSWPFGANELKIRADLALLIEVYRKLKSQEANLKVHCSKDVSLLEHFL
                     LSEIYSVETWLRPLAKPTDMVKPPTDLVSHAFKKKPELAINLVERYPFKKSSEILTQL
                     VKENPLLCAHSQKTLSFFLAGGKDMHYVLYWAPASPLKSINLFLPQWAQNTFVIQYNV
                     RAIETHDVNLTFFYVPQIVQCLRYDPLGYVERFIIDTAKISVLFSHQIIWNMLANSYK
                     DDDGEIPDDLKPTLDRIHDKMLASFSAEQKDFYEREFSFFNEVTGISGKLRPYIKKTK
                     AEKKIKIDEEMQKISVLDGVYLPSNPDGVVVDIDRSSGKPLQSHAKAPFMATFKIEKT
                     EQDPDTGEDKKVEKWQGAIFKVGDDCRQDVLALQLISLFRTIWSAVGLDVFVFPYRVT
                     ATAPGCGVIDVLPNSISRDMLGREAVNGLYEYFTTKFGHENTVEFQHARNNFVKSLAG
                     YSVISELLQFKDRHNGNIMYDDQGHCLHIDFGFIFDIVPGGVKFEAVPFKLTKEMVKV
                     MGGSPDTQAYREFEELCIKAYLAARPHMDLVLECVTPMLGSGLPCFNGNKTIRNLESR
                     FVPHKTDYEAAQHMLSLIKKSYESLFTKGYDEFQRLTNGIPY"
     gene            <355806..>358145
                     /locus_tag="KLTH0D03630g"
                     /db_xref="GeneID:8295105"
     mRNA            <355806..>358145
                     /locus_tag="KLTH0D03630g"
                     /product="KLTH0D03630p"
                     /transcript_id="XM_002552837.1"
                     /db_xref="GeneID:8295105"
     CDS             355806..358145
                     /locus_tag="KLTH0D03630g"
                     /note="highly similar to uniprot|P19414 Saccharomyces
                     cerevisiae YLR304C ACO1 Mitochondrial aconitase required
                     for the tricarboxylic acid (TCA) cycle mutation leads to
                     glutamate auxotrophy"
                     /codon_start=1
                     /product="KLTH0D03630p"
                     /protein_id="XP_002552883.1"
                     /db_xref="GeneID:8295105"
                     /db_xref="GOA:C5DGA3"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:C5DGA3"
                     /translation="MLSARSIAQKPVARGLATVSKLTRDSKVHQNLLEDHSFINYKQN
                     LENVDIVRKRLNRPLTYAEKILYGHLDDPHGQDIERGVSYLKLRPDRVACQDATAQMA
                     ILQFMSAGLPQVAKPVTVHCDHLIQAQVGGEKDLKRAIDLNKEVFDFLATATAKYNMG
                     FWKPGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMSDLPW
                     ELKAPKILGVKLTGKMSGWTSPKDIILKLAGITTVKGGTGKIVEYYGEGVNTFSATGM
                     GTICNMGAEIGATTSVFPFNHSMVDYLKATRRGEIADFAKLYNSDLLSADKGAEYDEV
                     IEINLSELEPYVNGPFTPDLATPISKMKEVAVHNNWPLEVKVGLIGSCTNSSYEDMSR
                     AASIAEDAASHGLKSKSLFTISPGSEQVRSTIARDGQLKTFQDFGGVVLANACGPCIG
                     QWDRQDIKKGDKNTIVSSFNRNFTSRNDGNPETHSFVASPEITTALAIAGDLRFNPMT
                     DKLKDKDGNEFMLKPPTGVGLPVKGYDQGVNTYQAPPAERSSVEVKVSPTSDRLQLLT
                     PFDAWDGKDPVDLPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENK
                     KANCVKNFFTGEYAGVPDTAREYKKRGQKWVVVGGENFGEGSSREHAALEPRYLGAYA
                     IITKSFARIHETNLKKQGLLPLTFGKPEDYDRINPDDLVDLVGVTELAPGKPVTMRLK
                     TKSGETWETPLNHTFNSEQIGWFKAGSALNMITQSKKSA"
     gene            complement(<358612..>359946)
                     /locus_tag="KLTH0D03652g"
                     /db_xref="GeneID:8295106"
     mRNA            complement(<358612..>359946)
                     /locus_tag="KLTH0D03652g"
                     /product="KLTH0D03652p"
                     /transcript_id="XM_002552838.1"
                     /db_xref="GeneID:8295106"
     CDS             complement(358612..359946)
                     /locus_tag="KLTH0D03652g"
                     /note="highly similar to uniprot|P06106 Saccharomyces
                     cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
                     serine sulfhydrylase required for sulfur amino acid
                     synthesis"
                     /codon_start=1
                     /product="KLTH0D03652p"
                     /protein_id="XP_002552884.1"
                     /db_xref="GeneID:8295106"
                     /db_xref="GOA:C5DGA4"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DGA4"
                     /translation="MPSHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVFNDSQHGA
                     QLFGLEKPGYMYSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGD
                     NIVSTSFLYGGTYNQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPK
                     YNVPDFEKIVAVAHKHGIPVVVDNTFGAGGYFAQPIKYGADIVTHSATKWIGGHGTTI
                     GGVIVDSGKFPWKEYPEKFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPA
                     LNPFAAFQLLQGVETLSLRCERHATNALKLAQYLEKSPYVSWVSYPGLSSHSHHENAK
                     KYLQNGFGGVLSFGVKDLPNAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAP
                     YFTTHQQLTDEEKLASGVTKDLIRVSVGTEFIDDIIGDFEQAFEKVFNGQKP"
     gene            complement(361666..361766)
                     /locus_tag="KLTH0D03674r"
                     /db_xref="GeneID:8295107"
     tRNA            complement(join(361666..361709,361730..361766))
                     /locus_tag="KLTH0D03674r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAG) cove"
                     /db_xref="GeneID:8295107"
     gene            362623..362694
                     /locus_tag="KLTH0D03696r"
                     /db_xref="GeneID:8295108"
     tRNA            362623..362694
                     /locus_tag="KLTH0D03696r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=67.63"
                     /db_xref="GeneID:8295108"
     gene            complement(<362790..>364790)
                     /locus_tag="KLTH0D03718g"
                     /db_xref="GeneID:8295109"
     mRNA            complement(<362790..>364790)
                     /locus_tag="KLTH0D03718g"
                     /product="KLTH0D03718p"
                     /transcript_id="XM_002552839.1"
                     /db_xref="GeneID:8295109"
     CDS             complement(362790..364790)
                     /locus_tag="KLTH0D03718g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D03718p"
                     /protein_id="XP_002552885.1"
                     /db_xref="GeneID:8295109"
                     /db_xref="GOA:C5DGA5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DGA5"
                     /translation="MSRAPEDGFESMPSSRESEAGGQKRPNDCDQDHLSQKKRVTRRR
                     HRNSRLGCDECKRRRIKCDETIPECRNCQNRQKREPGKRCSYLSMNEEELQSFKLKKQ
                     QNRLVEGTRVNKILEDHPDEIAYEIKMIAHESVELPVSVWTCVSGMESVRVPKALYLQ
                     VLLNANQDWDMSSRSFVVLALYSIMNSMSHKITLADQGQGDSAQEILLAEREILERIA
                     VKYKKEFLTYAREIISMFLTSKAAVGNEYLGTRLLITNTVLQYIQLYSNAQYDSNHYA
                     AMIDMCLEIYKNNDPEKVVRTVQFYWSSMPRNLFHLYFPAYSTDLLFELKAVLKEFEP
                     IILAAGDERVQLHHKELGDFIHYVIGLLPLSTSVLPLPVDELYEMYRTWFLGIPSEAF
                     CISRTMPGVQRVFYTFYHSIASYLNNLFPAGCYLMSRPFHGPTSLYPFSLNIVFEDLD
                     HLLGPFAEFSVRLLSFMERREHILQNFFEVKDPLPPGLHKFRFQKGEVRNLKEKFISS
                     LREELITWDNYPDLVPNTEHSEGKDMKYFVLTEREAAKSQIQRWRQAKNTYSGAEHFP
                     TESNGLLIDQILEQMKSADPFLAMQRKKPLGSFGIEYSSDRGYQMGDRGLFQQDCDVS
                     LFFEQSSPAFLSVLPSVEHVQDYKADRICVVSNTGSRKLYNY"
     gene            complement(<365191..>366253)
                     /locus_tag="KLTH0D03740g"
                     /db_xref="GeneID:8295110"
     mRNA            complement(join(<365191..366136,366198..>366253))
                     /locus_tag="KLTH0D03740g"
                     /product="KLTH0D03740p"
                     /transcript_id="XM_002552840.1"
                     /db_xref="GeneID:8295110"
     CDS             complement(join(365191..366136,366198..366253))
                     /locus_tag="KLTH0D03740g"
                     /note="similar to uniprot|P53290 Saccharomyces cerevisiae
                     YGR163W GTR2 Cytoplasmic GTP binding protein functions as
                     a negative regulator of the Ran/Tc4 GTPase cycle
                     downstream of its binding partner and homolog Gtr1p
                     homolog of human RagC and RagD proteins"
                     /codon_start=1
                     /product="KLTH0D03740p"
                     /protein_id="XP_002552886.1"
                     /db_xref="GeneID:8295110"
                     /db_xref="GOA:C5DGA6"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGA6"
                     /translation="MNSEENSDKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLEST
                     SNPTMEHFSTLIDLAVMELPGQLNYFEPNYDSERLFKSVGALVYVIDSQDEYMNALTN
                     FAIIVEYAYKVNPDINIEVLIHKVDGLSEDFKVDTQRDIMQRTGEELLELGLDGVQVS
                     FYLTSIFDHSIYEAFSRIVQKLVPELPFLENMLDNLVQHSKIEKCFLFDINSKIYVST
                     DSSPVDIVTYETCAEFVDVTIDLHDLYKIQGKEDALAGSTGNKPPPEVKGVSALNNGV
                     VIYLRQMIRGLALVALIRPDDTDVESCLTVVDYNVDIFKKGLEQVWAHARITSPEGK"
     gene            <366599..>367396
                     /locus_tag="KLTH0D03762g"
                     /db_xref="GeneID:8295111"
     mRNA            <366599..>367396
                     /locus_tag="KLTH0D03762g"
                     /product="KLTH0D03762p"
                     /transcript_id="XM_002552841.1"
                     /db_xref="GeneID:8295111"
     CDS             366599..367396
                     /locus_tag="KLTH0D03762g"
                     /note="similar to uniprot|P53177 Saccharomyces cerevisiae
                     YGL050W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D03762p"
                     /protein_id="XP_002552887.1"
                     /db_xref="GeneID:8295111"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:C5DGA7"
                     /translation="MVQDAFQQKKEHILAEIKSSSLDLSPKGTIDELCFPIMNLINSH
                     MDMVTTSSCSGRLSVFVEGNKVHDKEIKTGGKGEGGKWLFVTHDREQVKSWFEKLEEP
                     VSFQPDYNPGYMDASTRYILYKYEPFILHVKCRDFRSASALFNTAMSCGFRESGIGSN
                     NIVALRVNIKLDVPIGYLNELTSKLVFFVDSKYIELMDHITLGKFTENENKMQELYKK
                     IEAHILKAPLETPKDLDKVETKEERRERKIKEGLLRQKMVRSQDTQN"
     gene            complement(<367647..>370937)
                     /locus_tag="KLTH0D03784g"
                     /db_xref="GeneID:8295112"
     mRNA            complement(<367647..>370937)
                     /locus_tag="KLTH0D03784g"
                     /product="KLTH0D03784p"
                     /transcript_id="XM_002552842.1"
                     /db_xref="GeneID:8295112"
     CDS             complement(367647..370937)
                     /locus_tag="KLTH0D03784g"
                     /note="some similarities with uniprot|P39935 Saccharomyces
                     cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4) gamma
                     mRNA cap-binding protein (eIF-4F) 150K subunit highly
                     homologous to Tif4632p homologs of mammalian p220"
                     /codon_start=1
                     /product="KLTH0D03784p"
                     /protein_id="XP_002552888.1"
                     /db_xref="GeneID:8295112"
                     /db_xref="GOA:C5DGA8"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022745"
                     /db_xref="UniProtKB/TrEMBL:C5DGA8"
                     /translation="MSEQQTGEKPSGTESQQPVQPNQPYQQQQRYPRNSGQKSSGQKG
                     SRSNSKSYNGYQGNNGGNGGGNHRYNKNGFHHKNNRSAGAVPGMQWAYGSYGMAGQPQ
                     FYPSYGYGYVPAMAAQGYNPAGGPSSSASPVEPAATLTPTTPVSKKIEITNRSGEHVD
                     LNAIHSQHISSSAGQPAHSPVKESSTPAAPTPEPKAAVEPSKPATPEPSKTEPSADDL
                     LKMSFLEQVRMRKAMRAQKKAGDSPSVQTAEVIASAPEVKTESAPEAATPTPKVPSEN
                     SSNDVTNATQEAVSSDAQGIHEESIPKDAPKDDSATTQNPSVETVAEATSKAPVATDA
                     DAPSEQSETVVVKAVSKAAPEVISEAVPEAATEAAPETAPETAPETAPETAPEATPEA
                     TPEATPEAVPEVAPEAAPESAPEPEKETSIVTENTEASEPVKEDAQPARPLTFSEKLK
                     LKTKASAKSDADTTATDTQPGETASTSEPTGEAEPQDASEKASEASEEAEVANTAPVE
                     EEQKIDSAAEPELQVSAEAKEPTGEEPKAEGDQEDSDVDDGRITMTEFLARLDQVSPV
                     DDIYSFKYPEGIEAPDARYKREKAKYTYGPTFLLQFKDKVNVRPDAEWKEKVASKIVI
                     PPGSVRPGGRSRGDSKFGPGAGFKKSGSLRGMEGRSNSRSSSKRKSKKMGDDRKSNRA
                     YTSRKDRERMAEEDDKPKEDVAPLIPSANRWVPKSKQKKTEKKFAPDGVTELLNKEEA
                     QRKMKSLLNKLTLEKFDPISEEIIKIADQSKWETDCETLKVVIEEIFMKACDEPHWSS
                     MYAQLCGKVVKDMDPEIKEEGNEGKAGPKLVLHYLVDRCHAEFQKGWTDKLPTKEDGS
                     PLEPEMMSDEYYQMAAAKRRGLGLVRLIGFLYRSHLLTAKMMFECFRRLMKDLADSPT
                     EETLESVIELLNTVGEQFEKDRLVQPSGSLEGSTVLDQLFYMLDKITESSEISSRIKF
                     KLVDMKELREVKHWNSTKRDEGPKTIQQIHEEEAAKKAMEERERKMKGSSRSGSRRNN
                     SNSMMGNRSNSRREPVSVSKDSFISTRSSSLRHVQSAAPAKEETPAQKTAVNMFDALM
                     GAESDDDE"
     gene            complement(<371457..>372674)
                     /locus_tag="KLTH0D03806g"
                     /db_xref="GeneID:8295113"
     mRNA            complement(<371457..>372674)
                     /locus_tag="KLTH0D03806g"
                     /product="KLTH0D03806p"
                     /transcript_id="XM_002552843.1"
                     /db_xref="GeneID:8295113"
     CDS             complement(371457..372674)
                     /locus_tag="KLTH0D03806g"
                     /note="highly similar to uniprot|Q01939 Saccharomyces
                     cerevisiae YGL048C RPT6 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates bound by
                     ubiquitin-protein ligases Ubr1p and Ufd4p localized mainly
                     to the nucleus throughout the cell cycle"
                     /codon_start=1
                     /product="KLTH0D03806p"
                     /protein_id="XP_002552889.1"
                     /db_xref="GeneID:8295113"
                     /db_xref="GOA:C5DGA9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGA9"
                     /translation="MSAAAVSEVTLNTHESGIKPFFDQKIQDTELKIRAKTQNLRRLE
                     AQRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKIQPEGKYIVDIAKDIN
                     VKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIK
                     EVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELV
                     QKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELL
                     NQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIHSRK
                     MNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVMNK
                     NDETAISVAKLFK"
     gene            <372909..>373505
                     /locus_tag="KLTH0D03828g"
                     /db_xref="GeneID:8295114"
     mRNA            <372909..>373505
                     /locus_tag="KLTH0D03828g"
                     /product="KLTH0D03828p"
                     /transcript_id="XM_002552844.1"
                     /db_xref="GeneID:8295114"
     CDS             372909..373505
                     /locus_tag="KLTH0D03828g"
                     /note="similar to uniprot|P53178 Saccharomyces cerevisiae
                     YGL047W"
                     /codon_start=1
                     /product="KLTH0D03828p"
                     /protein_id="XP_002552890.1"
                     /db_xref="GeneID:8295114"
                     /db_xref="GOA:C5DGB0"
                     /db_xref="InterPro:IPR007235"
                     /db_xref="UniProtKB/TrEMBL:C5DGB0"
                     /translation="MGSTVVVTCGATVPFPELIAALLDKQVLDTLLRMHYTRLIVQYG
                     RGYTSKFAQLLGCVRAHVEEPADNGASNLAAGVEVQVRGHYQSLEVCGFEFTGAIHEL
                     LRDNADLVISHAGTGSIVDALRLGKRLLVVANTSLMDNHQLQIARKFESRGHLQSAAA
                     QPKALIAALRRVEAAPQVPLPNGYNSSFERLLMDVAQS"
     gene            complement(373652..373725)
                     /locus_tag="KLTH0D03850r"
                     /db_xref="GeneID:8295115"
     tRNA            complement(373652..373725)
                     /locus_tag="KLTH0D03850r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8295115"
     gene            <374437..>375381
                     /locus_tag="KLTH0D03872g"
                     /db_xref="GeneID:8295116"
     mRNA            <374437..>375381
                     /locus_tag="KLTH0D03872g"
                     /product="KLTH0D03872p"
                     /transcript_id="XM_002552845.1"
                     /db_xref="GeneID:8295116"
     CDS             374437..375381
                     /locus_tag="KLTH0D03872g"
                     /note="some similarities with YGR161c, uniprot|P53289
                     Saccharomyces cerevisiae Hypothetical ORF, RTS3
                     SGDID:S0003393"
                     /codon_start=1
                     /product="KLTH0D03872p"
                     /protein_id="XP_002552891.1"
                     /db_xref="GeneID:8295116"
                     /db_xref="UniProtKB/TrEMBL:C5DGB1"
                     /translation="MEVTTHAQHKAVTLYKEPHHLDSVNWEEGLGKGCGKSAQQDLDQ
                     LTVVDSIVVTPDAAPQSPQDYTRSGRPAVPHYTLSSSGSAMADKQHTFKAPSPARTPG
                     RPTRPTLNVQSSSSSSLSSLRSRARRLSSEEIINEMENEQDAIVVRLLREIDQLKDEN
                     NRLRKNLCAVLNGDPQTPAGPALSRRSSLNSCASNSSGSGSLSSSHAGTTPGVLAATP
                     TASSPALSRRPSSSATPIDTLTPTLLLQRKRNSLSSSVPATPKNSGDFVDLYAPAPVS
                     KFGAVDVSLDAPGSCGYRRRRSSMKSTEGSNKLQRSTR"
     gene            <376254..>378374
                     /locus_tag="KLTH0D03894g"
                     /db_xref="GeneID:8295117"
     mRNA            <376254..>378374
                     /locus_tag="KLTH0D03894g"
                     /product="KLTH0D03894p"
                     /transcript_id="XM_002552846.1"
                     /db_xref="GeneID:8295117"
     CDS             376254..378374
                     /locus_tag="KLTH0D03894g"
                     /note="some similarities with uniprot|P08068 Saccharomyces
                     cerevisiae YIR019C GPI-anchored cell surface glycoprotein
                     required for diploid pseudohyphal formation and haploid
                     invasive growth"
                     /codon_start=1
                     /product="KLTH0D03894p"
                     /protein_id="XP_002552892.1"
                     /db_xref="GeneID:8295117"
                     /db_xref="UniProtKB/TrEMBL:C5DGB2"
                     /translation="MLCRPILLLFTAFGGFASCISALSTTTITTESITTSFVCGRCTT
                     NQHETTLSSSSTTAVETSACHQCVTSQYESSLSSISTSVSSTSTIPTSPLSSTTISST
                     IVSTSYVCGKCTTNISFREVVVSSTSETVPSAKHSSSTPTSSTSASDESSSATPSSAM
                     PSSATPSSAMPSSATPSSTTTASSTASSTTISTTTSSSSASSSSTISSFTISSTTPSS
                     IASSNATPSIITISSDTSSSSTLSSASSSVARTSSGNVESSPSGPKTTTTLNKSTTTE
                     TESCDCTTYPGSSISTTTTLVSTISTSSSATTQSSTQSSTTSGTSSLSSEMSSSKSSA
                     SSVSLSSSSKVSSRTGFSSTETSRATTVSETQHSLSSESNTPTTLTSIPGSLSTSATF
                     SSFSSTAFSSVSTSSPTAESVSSLVSSTPSVGSQTSSTLTSSTSFPGVPSSVTSSGNV
                     PSSFSDIGTSSTSVLTTTYSTTNSGSTSITLTTDSSFRTLESSASSTPASSTPASSTP
                     ASSTPASSTTASSTTASSTTVTVSSSLPGLNMSTTLSSSTLLSTTSPGQPISTASTST
                     GPLTIPTASNSLPVLLVSTSCTAANDTNCAVPTTDSAPAPTSTSTPPSSSSSNASKSE
                     EVPSSAASSSSPATVSGPTSSQSSVHTTSSTFASYAPKSFSFGSTSTQPFPTASSTAS
                     LLSSYTGGASKAVPRIAFAVLLLL"
     gene            <378839..>380356
                     /locus_tag="KLTH0D03916g"
                     /db_xref="GeneID:8295118"
     mRNA            <378839..>380356
                     /locus_tag="KLTH0D03916g"
                     /product="KLTH0D03916p"
                     /transcript_id="XM_002552847.1"
                     /db_xref="GeneID:8295118"
     CDS             378839..380356
                     /locus_tag="KLTH0D03916g"
                     /note="some similarities with uniprot|P27476 Saccharomyces
                     cerevisiae YGR159C NSR1 Nucleolar protein that binds
                     nuclear localization sequences required for pre- rRNA
                     processing and ribosome biogenesis"
                     /codon_start=1
                     /product="KLTH0D03916p"
                     /protein_id="XP_002552893.1"
                     /db_xref="GeneID:8295118"
                     /db_xref="GOA:C5DGB3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DGB3"
                     /translation="MAKQVAKKVSKKDVKSKKQEKEAVAAKSESSSSSSSSESSSSSS
                     ESSSSSSESESESSSSSSSSDSESSDSSSDSEEEQEVKKDTKKDTKKDTKKEAKKDSK
                     KDSKKEAKKETVKEAKKGSKKAVAPESDSESGSESDTESSDSESSDSDSSSSSESESE
                     AEAEAETESKKAKESATSSSSSNSSSGSDSSSSSSSSESEGSSSSSDSDSSSEEEEAK
                     EKDTSSKKRKAEESDVSEESEDATESKKAKTESNGEPATIFVGRLSWSVDDEWLKTEF
                     EPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKEMHGKEIDGRPINCDMSTS
                     KPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFETFAEHGEVVSVRLPTHP
                     ETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFSTPKPRDEGSRGGFRGGR
                     GGSRGGSRGGFGGGRGGFGGGNRGDFKPSGSGSNSAPLGKGRQTAEFQGNKKKFD"
     gene            <380728..>382380
                     /locus_tag="KLTH0D03938g"
                     /db_xref="GeneID:8295119"
     mRNA            <380728..>382380
                     /locus_tag="KLTH0D03938g"
                     /product="KLTH0D03938p"
                     /transcript_id="XM_002552848.1"
                     /db_xref="GeneID:8295119"
     CDS             380728..382380
                     /locus_tag="KLTH0D03938g"
                     /note="similar to uniprot|P53180 Saccharomyces cerevisiae
                     YGL045W RIM8"
                     /codon_start=1
                     /product="KLTH0D03938p"
                     /protein_id="XP_002552894.1"
                     /db_xref="GeneID:8295119"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DGB4"
                     /translation="MGFLTKLKAVSSRNSDPSISSTKVSAVSDAKTRYNYAKRSRFRH
                     ACAARDFYINQESPHKVWKPNEQISGEAVLVLKDDLENVAVRLSLIGEVRIRGSGSKT
                     HCDQLFEKTTLVYGDQEEVAPETRSIVNGLTKGEHRFPFRLKVPSKNIFTSIKFERGS
                     ISYCIRCTLEPLRCSDPEKVLAACEKSISVMVPLDVSDMPKPNTKSVVLQSPSAVKQI
                     KLANGEQDASSSFTRRTGGSKNSGSTVNTSGSLKTVTINVDLPSSGYVIGEVIPVKLN
                     LCHYREYSHSTGLIATLVRICRVGGASKENPMEMYRKDICQTVSPIYVNPDTFECSVT
                     VYLKIPLDAFPTLRLPDRKFSFQYYVEVLVNLSRKNIAFTESNRVVDTTTNSHVSASP
                     GKTIEETFTLLQRKIRSGSETEPFKNNDRESMIFFKDLINVDKLKRLRNVTGMSIEVI
                     VGTNRSEIPQDSSLDEVEENPETTNSGLQSIDYTNTAVNNYTVAGYSPLGDCKDVLNF
                     DGGSVLPLPVYTPNSHYNAADDKDELELQRLQELESEPPMAT"
     gene            <382557..>383288
                     /locus_tag="KLTH0D03960g"
                     /db_xref="GeneID:8295120"
     mRNA            <382557..>383288
                     /locus_tag="KLTH0D03960g"
                     /product="KLTH0D03960p"
                     /transcript_id="XM_002552849.1"
                     /db_xref="GeneID:8295120"
     CDS             382557..383288
                     /locus_tag="KLTH0D03960g"
                     /note="similar to uniprot|P48240 Saccharomyces cerevisiae
                     YGR158C MTR3 3'5' exoribonuclease exosome subunit
                     nucleolar protein involved in export of mRNA and ribosomal
                     subunits homologous to the E. coli exonuclease RNase PH"
                     /codon_start=1
                     /product="KLTH0D03960p"
                     /protein_id="XP_002552895.1"
                     /db_xref="GeneID:8295120"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DGB5"
                     /translation="MNITDRRRILGPSNAKPLVFERLESSEQAAQPPQEKNNENESMY
                     IKNGLVSNANGSSYLELKRGESSEQCTILLSSVYGPRPSRGAFSSKASLSVQFKEVTI
                     EKIPSGELKEICNFLSNIFSAVINLERYPKSGIDIFLSLIKNPITSDEANLEPIIAAC
                     VNGITLALADAGIEIFDTVSAGTYKRNVVAFSKNGTEVVGLWKDKEDDTANDILSVIE
                     NCRGNYLQNRKGIIEYLIRSKNADI"
     gene            complement(<383372..>385900)
                     /locus_tag="KLTH0D03982g"
                     /db_xref="GeneID:8295121"
     mRNA            complement(<383372..>385900)
                     /locus_tag="KLTH0D03982g"
                     /product="KLTH0D03982p"
                     /transcript_id="XM_002552850.1"
                     /db_xref="GeneID:8295121"
     CDS             complement(383372..385900)
                     /locus_tag="KLTH0D03982g"
                     /note="similar to uniprot|P05374 Saccharomyces cerevisiae
                     YGR157W CHO2 First step in the methylation pathway for
                     phosphatidylcholine biosynthesis Phosphatidyl-
                     ethanolamine N-methyltransferase"
                     /codon_start=1
                     /product="KLTH0D03982p"
                     /protein_id="XP_002552896.1"
                     /db_xref="GeneID:8295121"
                     /db_xref="GOA:C5DGB6"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR016219"
                     /translation="MIKERKPSKSRAPGKGHKQIPGVAKESQPIARTRTGNVEFTPAK
                     THDMVRSLFDPTLKKSFLECWISLAILSNVVLCYFMATKFGASFTKKFFLWQYVFWRL
                     CYNVGIGVVLHFQSNYETLTNFAKMRSLFSKKNQQWLARFCRFEIESKMPNTYCLEEY
                     PEEFNVWLLFRQFVDLILMQDFTTYILFVVLSIPKTVLSSHTVSFALGVIMILFNVWV
                     KVDAHRVVKDYAWYWGDFFFFQDSKLVFDGVFNVSPHPMYSIGYMGYYGLSLISGDYK
                     VLLVSIGGHLLQFLFLKYCENPHIEKIYGSDAVENDNAHIDELLVKENPNYSKPLITK
                     GLWFTNVDKLRLTDYFTILTVASIVLFTFFLKPSTKALFWATLVAKITTSLFISLVLH
                     KQSTSKWFTRLFLKNGYTQVHSFYQWQFLYNYCLTVSYTLLILQTWSQFRHLESRNYT
                     QIIFGFLLCWLQKWCDDEILTAISEFGWFYGDFFLTNYISSRKLNSRGIYRYLSNPER
                     FLGVAGCWGAVLITHFSPYNLILAALWTAANIALVKLVEEPHVSKVYGTSERKSGVSK
                     TLMGFKPIRRFSEIMDKMELRLVRHLTSNDSPFEEEAPTSEEAQWNEVVQLALQSVTA
                     NLAPNCEFKLGDGKCDTFIIPGPVEAHWKLPSKLYNNDDWIGLYKVFETGEDRQRTRV
                     SSNGRWTGTNEAAFPYSGRPKKSIVKFQRTGDFVNGTVKFDHSLMFYEEGVYELRYHS
                     GNTHKVLMISQPFRLSLPIVKAESAEELSEGLHQFLAEVHALDGNSFNPNSNRYLGDR
                     FLKGLIKKASGVDLSVKYLRRINYDVSIIGKRVQEIKAVLENLE"
     gene            complement(<386364..>387077)
                     /locus_tag="KLTH0D04004g"
                     /db_xref="GeneID:8295122"
     mRNA            complement(<386364..>387077)
                     /locus_tag="KLTH0D04004g"
                     /product="KLTH0D04004p"
                     /transcript_id="XM_002552851.1"
                     /db_xref="GeneID:8295122"
     CDS             complement(386364..387077)
                     /locus_tag="KLTH0D04004g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D04004p"
                     /protein_id="XP_002552897.1"
                     /db_xref="GeneID:8295122"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:C5DGB7"
                     /translation="MSHQCEHEHDHHHDSPPPATNNAQSLFSFVNTPNVQCLNTNSHG
                     SSDSAACFIKSRDDQYDVSKYLESDADCQMILHIPFTCICRIFSLVLRTSRSSSGTTS
                     PKTIKIFKNFSKNIDFDTLEDSKPQHEVEHPRDVGIDLDGAPRTEITDTDDSSFVEHH
                     LPRHLFQNAHSLTLFMQSAWEDDEDITRCFYLEMRGESAGQKRGNNAVPLLTVYESAP
                     NPVDHQKLENEQQGSSLGM"
     gene            <387535..>388557
                     /locus_tag="KLTH0D04026g"
                     /db_xref="GeneID:8295123"
     mRNA            <387535..>388557
                     /locus_tag="KLTH0D04026g"
                     /product="KLTH0D04026p"
                     /transcript_id="XM_002552852.1"
                     /db_xref="GeneID:8295123"
     CDS             387535..388557
                     /locus_tag="KLTH0D04026g"
                     /note="highly similar to uniprot|P05373 Saccharomyces
                     cerevisiae YGL040C HEM2 Delta-aminolevulinate dehydratase
                     a homo-octameric enzyme catalyzes the conversion of
                     delta-aminolevulinic acid to porphobilinogen the second
                     step in the heme biosynthetic pathway localizes to both
                     the cytoplasm and nucleus"
                     /codon_start=1
                     /product="KLTH0D04026p"
                     /protein_id="XP_002552898.1"
                     /db_xref="GeneID:8295123"
                     /db_xref="GOA:C5DGB8"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DGB8"
                     /translation="MHTAEFLDAHPTEISSILAGGYNHPLLREWQNERQLTKNMFIFP
                     LFISDDADEETPIDSLPNIKRFGVNRLAQYLAPLIEKGLKAVILFGVPMKEGCKDQYG
                     TAADDPEGPVIQGINLLRREFPDLYIICDVCLCEYTSHGHCGVLYDDGSINREESVRR
                     IAAVAVNYAKAGAHSIAPSDMIDGRIRDIKYGLIKAGLAHKTFVMSYAAKFSGNLYGP
                     FRDAACSSPSSGDRKCYQLPSGGRGLARRALRRDLDEGTDGIIVKPSTFYLDIMADAS
                     EIARDVPICAYHVSGEYAMLHAAAEKGVVDFKTIAFESHQGFLRAGARLIISYLTPEF
                     LEWLGQ"
     gene            complement(<388657..>389301)
                     /locus_tag="KLTH0D04048g"
                     /db_xref="GeneID:8295124"
     mRNA            complement(<388657..>389301)
                     /locus_tag="KLTH0D04048g"
                     /product="KLTH0D04048p"
                     /transcript_id="XM_002552853.1"
                     /db_xref="GeneID:8295124"
     CDS             complement(388657..389301)
                     /locus_tag="KLTH0D04048g"
                     /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
                     YMR077C VPS20 vaculolar protein sorting (putative)"
                     /codon_start=1
                     /product="KLTH0D04048p"
                     /protein_id="XP_002552899.1"
                     /db_xref="GeneID:8295124"
                     /db_xref="GOA:C5DGB9"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DGB9"
                     /translation="MGQKGSKIEVTKTDKAILQIKLSKDELHRYTRRTEILIGREREK
                     LKALLREDPKNGKKNPRARILLKKIHYQNHLLEQAADQLINLENLVSTVEFKLVEQQF
                     MMGLKQGNEVLTKLNKEFSGAEDLMDSVADQIAYQDEVDQILSSSVVGGFEEELDREL
                     QQLDQEVNGPAHEPAKAEPNLPSTEGLPALSEPEAEEPQQEPQSDGRQREAVLT"
     gene            <389632..>390534
                     /locus_tag="KLTH0D04070g"
                     /db_xref="GeneID:8295125"
     mRNA            <389632..>390534
                     /locus_tag="KLTH0D04070g"
                     /product="KLTH0D04070p"
                     /transcript_id="XM_002552854.1"
                     /db_xref="GeneID:8295125"
     CDS             389632..390534
                     /locus_tag="KLTH0D04070g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D04070p"
                     /protein_id="XP_002552900.1"
                     /db_xref="GeneID:8295125"
                     /db_xref="InterPro:IPR018959"
                     /db_xref="UniProtKB/TrEMBL:C5DGC0"
                     /translation="MSSNLTFVSQRSEKKNYGKPKPIPAYFPTSKKSILIPNFEFYDR
                     VKAAPRKLAATHAVPVRSGKAWKASKGSIVRISTPEGPQVCDFNCWEANSGFKEHMWA
                     SRTRQLHSAHVSVYDKLWSNLPYLRPLLTIIDDSLAGYGPDEHGGRVHDLLGTRCDPY
                     VDKLLSGEDNDFHCHSNLYRAIREFGGEEEHVHDVLNIFQLTGLNENDQYFMETCPAK
                     PGDYFEFFCEVDVVCAVSSCPGGDLSDWGWGEGGTDSEANVGDMSAKCRPLKVEVFEL
                     ENPEEALEGWESPQPVKYQGNHGF"
     gene            <391381..>392862
                     /locus_tag="KLTH0D04092g"
                     /db_xref="GeneID:8295126"
     mRNA            <391381..>392862
                     /locus_tag="KLTH0D04092g"
                     /product="KLTH0D04092p"
                     /transcript_id="XM_002552855.1"
                     /db_xref="GeneID:8295126"
     CDS             391381..392862
                     /locus_tag="KLTH0D04092g"
                     /note="highly similar to uniprot|P32582 Saccharomyces
                     cerevisiae YGR155W CYS4 Cystathionine beta-synthase
                     catalyzes the synthesis of cystathionine from serine and
                     homocysteine the first committed step in cysteine
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0D04092p"
                     /protein_id="XP_002552901.1"
                     /db_xref="GeneID:8295126"
                     /db_xref="GOA:C5DGC1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005857"
                     /db_xref="UniProtKB/TrEMBL:C5DGC1"
                     /translation="MTQYDSRTSVADLVGNTPMVHLTKLPKALGVKPQVYAKLELYNP
                     GGSIKDRIAKSMIEDAEKSGRIHPSRTTLIEPTSGNTGIGLALMGAVKGYRTIITLPE
                     KMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPHAVILDQYNNMKNP
                     EAHYQGTGKEIQGQLQQLGEYENLHGVFAGAGTGGTISGISKYLKEQNPEIKIIGADP
                     EGSILAQPESLNETEAAEYKVEGIGYDFIPKVLDRGLVDTWYKTNDIDSFRYARQLIA
                     NEGLLVGGSSGSAFSAMMKYCKDHPELTEKDVLVIILPDSIRSYLTKFADDEWLKKNN
                     LWDDDILKPLGRSQKDIFKGATVKDLNLKPVVSVKENASTSDVVKILTDNGFDQLPVL
                     TEDGKLCGLVTLSQLLKGLSSGEEVSSIKGHFFDFRKLNNFDEVSSYNENKSGKKKFV
                     NFDVNSKLSDLNQFFEKNSSAVITDGLKPIHIVTKMDLLAFLA"
     gene            complement(<392935..>393360)
                     /locus_tag="KLTH0D04114g"
                     /db_xref="GeneID:8295127"
     mRNA            complement(<392935..>393360)
                     /locus_tag="KLTH0D04114g"
                     /product="KLTH0D04114p"
                     /transcript_id="XM_002552856.1"
                     /db_xref="GeneID:8295127"
     CDS             complement(392935..393360)
                     /locus_tag="KLTH0D04114g"
                     /note="similar to uniprot|P0C5N3 Saccharomyces cerevisiae
                     YGL041W-A Identified by expression profiling and mass
                     spectrometry"
                     /codon_start=1
                     /product="KLTH0D04114p"
                     /protein_id="XP_002552902.1"
                     /db_xref="GeneID:8295127"
                     /db_xref="InterPro:IPR024558"
                     /db_xref="UniProtKB/TrEMBL:C5DGC2"
                     /translation="MFKTLLRSASSVPFRQPALPRAIVQTPRSLFYAKRCYAKSWDGN
                     NSSPDVEAHLKVQKLLDDIQQHPGVAAKLHAVSEIMVSKGLANESAPPGPWQVVKILT
                     DKDVRKAMGEFKAELEKSGIELGPDQLGPLMTVLGMEKK"
     gene            complement(<393617..>394498)
                     /locus_tag="KLTH0D04136g"
                     /db_xref="GeneID:8295128"
     mRNA            complement(<393617..>394498)
                     /locus_tag="KLTH0D04136g"
                     /product="KLTH0D04136p"
                     /transcript_id="XM_002552857.1"
                     /db_xref="GeneID:8295128"
     CDS             complement(393617..394498)
                     /locus_tag="KLTH0D04136g"
                     /note="similar to uniprot|P07273 YGL043W Saccharomyces
                     cerevisiae DST1 General transcription elongation factor
                     TFIIS"
                     /codon_start=1
                     /product="KLTH0D04136p"
                     /protein_id="XP_002552903.1"
                     /db_xref="GeneID:8295128"
                     /db_xref="GOA:C5DGC3"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR006289"
                     /db_xref="InterPro:IPR016492"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:C5DGC3"
                     /translation="MESKEVITLVKNLEKSKNNDESVIEILSLLDKDLKPTEKLLRET
                     KVGVVVNQFKKSSNAKIAGLVKKMIGEWRDAISREKKQRAMAKTGTTAASSSSATSSS
                     EPKRQGKFVSTKPRNAKNDGVVTTIYNHKLRDMVIRAFYDALAKESEHPPQSILTTAI
                     AIEKELNKVNNCELNEKAYKDKYRVVYANVISKNNPDLKHRITGGDVSPEYLVNCDPK
                     ELAPEHLKKKNEEIARQNLFNAQGATLERSVTDRFTCGKCKEKKVSYYQLQTRSADEP
                     LTTFCTCEVCGNRWKFS"
     gene            <394755..>395537
                     /locus_tag="KLTH0D04158g"
                     /db_xref="GeneID:8295129"
     mRNA            <394755..>395537
                     /locus_tag="KLTH0D04158g"
                     /product="KLTH0D04158p"
                     /transcript_id="XM_002552858.1"
                     /db_xref="GeneID:8295129"
     CDS             394755..395537
                     /locus_tag="KLTH0D04158g"
                     /note="similar to uniprot|P25299 Saccharomyces cerevisiae
                     YGL044C RNA15 Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of mRNA
                     3' ends interacts with the A-rich polyadenylation signal
                     in complex with Rna14p and Hrp1p"
                     /codon_start=1
                     /product="KLTH0D04158p"
                     /protein_id="XP_002552904.1"
                     /db_xref="GeneID:8295129"
                     /db_xref="GOA:C5DGC4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="InterPro:IPR026896"
                     /db_xref="UniProtKB/TrEMBL:C5DGC4"
                     /translation="MMNRSVHNNPPARTVYLGSIPYDQTEEQILDLCSNVGPVANLKM
                     MFDPQTGKSKGYAFIEYKSLEASASAVRNLNGYQLGNRLLKCGYYSGGDMGGGGMPGN
                     GNANDEDRSTVFSGLPPGVDVNINMTTPAMMISSVLSQGSKEEQLDLLKTLQKMAQAD
                     SDQFASLLEQCPQLSFVVAELLLTAGLSSVDDLTQLAVQQNSTNSTPEASQDPKVQEQ
                     QRELLRQVLQLTDSEIAVLPDDEKMTLWDLKQRAMRGEFGML"
     gene            <395761..>396993
                     /locus_tag="KLTH0D04180g"
                     /db_xref="GeneID:8295130"
     mRNA            <395761..>396993
                     /locus_tag="KLTH0D04180g"
                     /product="KLTH0D04180p"
                     /transcript_id="XM_002552859.1"
                     /db_xref="GeneID:8295130"
     CDS             395761..396993
                     /locus_tag="KLTH0D04180g"
                     /note="weakly similar to uniprot|P39927 Saccharomyces
                     cerevisiae YGR156W PTI1 Pta1p Interacting protein"
                     /codon_start=1
                     /product="KLTH0D04180p"
                     /protein_id="XP_002552905.1"
                     /db_xref="GeneID:8295130"
                     /db_xref="GOA:C5DGC5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="UniProtKB/TrEMBL:C5DGC5"
                     /translation="MSDPRWRKARHLLTPELLSSSIQITNLPASWNESTISSIVAGSG
                     PIVNVSTKTDPRNGKLLGITVDYATSKDSKRALDVLRKIKKFPCDLERIMPNNKEQKE
                     PRKPLDLNRDAFPWEFGLELPFELVSEVPLPRRPTNPVPVSNSGPSGSDASSGVVAFP
                     DILKEASKHLPGLQPNSMTSPDAISANLGKIAPLQLLEMISNLKILASQDANRDQLTK
                     FLASNPDISVAVTQALLEMGFVNYSVVTKVIAEQPASRAHASPVPNNVQSIYSNGSTP
                     GTTPMNNSAPLNTFTAPVQQPQPQQPAPAPAVAPPMMFNAPPVPAFGFNGVAGPAPFM
                     PAPMGAPMGTPMAPPVVPPMPVANGAPRVNTMKLATLPQNQQDMIKQVLQLSPDQIRL
                     LPPGQVAMVENFKREYLM"
     gene            complement(397110..397223)
                     /locus_tag="KLTH0D04202r"
                     /db_xref="GeneID:8295131"
     tRNA            complement(join(397110..397153,397186..397223))
                     /locus_tag="KLTH0D04202r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8295131"
     gene            <397596..>398858
                     /locus_tag="KLTH0D04224g"
                     /db_xref="GeneID:8295132"
     mRNA            <397596..>398858
                     /locus_tag="KLTH0D04224g"
                     /product="KLTH0D04224p"
                     /transcript_id="XM_002552860.1"
                     /db_xref="GeneID:8295132"
     CDS             397596..398858
                     /locus_tag="KLTH0D04224g"
                     /note="similar to uniprot|P23542 Saccharomyces cerevisiae
                     YLR027C AAT2 Cytosolic aspartate aminotransferase involved
                     in nitrogen metabolism localizes to peroxisomes in
                     oleate-grown cells"
                     /codon_start=1
                     /product="KLTH0D04224p"
                     /protein_id="XP_002552906.1"
                     /db_xref="GeneID:8295132"
                     /db_xref="GOA:C5DGC6"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DGC6"
                     /translation="MSCTIFNNVEQLPPDALFGIKQRLSQDPRPVKVDLGIGAYRDDS
                     GKPWVLPSVREAEEVIRQDPGYNHEYLGISGLTALIQGAAKVLFGEDSAALAEGRVVS
                     TQSLSGTGALHVAARFISKFCGDKVVYLSDPTWANHNAIFETMGLKTATYPYWDAASK
                     SLNLEGYLEAIKTAPKGSVFVLHACAHNPTGLDPDQSQWTSILDAIIEREHIVLFDSA
                     YQGFASGDLDRDAFAVRLGLQKLADVSPVIVCQSFAKNVGMYGERAGCFHLVLPRQDA
                     SVDTSAIKSAVLSQLNKITRSELSNPPAYGAKIVATVLNTPRLTEQWHKDMVTMSSRI
                     IKMRHALRDHLAKLNTPGNWDHIVNQTGMFSYTGLRPEMVKRLEEEHAVYLVSSGRAS
                     IAGLNSGNVEYVAKAINEVVTHFGGAKL"
     gene            <399391..>400305
                     /locus_tag="KLTH0D04246g"
                     /db_xref="GeneID:8295133"
     mRNA            <399391..>400305
                     /locus_tag="KLTH0D04246g"
                     /product="KLTH0D04246p"
                     /transcript_id="XM_002552861.1"
                     /db_xref="GeneID:8295133"
     CDS             399391..400305
                     /locus_tag="KLTH0D04246g"
                     /note="similar to uniprot|Q01590 Saccharomyces cerevisiae
                     YLR026C SED5 Sed5p is a t-SNARE (soluble NSF attachment
                     protein receptor) required in ER to Golgi transport"
                     /codon_start=1
                     /product="KLTH0D04246p"
                     /protein_id="XP_002552907.1"
                     /db_xref="GeneID:8295133"
                     /db_xref="GOA:C5DGC7"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR021538"
                     /db_xref="UniProtKB/TrEMBL:C5DGC7"
                     /translation="MDIRNRTTEFQRSVFAYSKRNGGGAPKPAAGDAAARKSEFQQKA
                     STVAHEIAQTAQLLAKLAQLAKRKPMLNDNPVEIAELTYVIKRKIYSVEQSMLELSRL
                     GGKPGAPLPAQHSKNVMNLLNTKMKNISGDFKSVLEQRQRLEATNRDRWEKLSAQTDD
                     EKARSPQVQQTYNSSNPFMSSVLEESPAGGSEAQLALPQDSSMLLLEEQNASSAYLQE
                     RSRAVETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVDDIDVNISGAQRELLKYF
                     DRVSSNRWLAVKIFAVLFVFFLVWVLVN"
     gene            complement(<400463..>401158)
                     /locus_tag="KLTH0D04268g"
                     /db_xref="GeneID:8295134"
     mRNA            complement(<400463..>401158)
                     /locus_tag="KLTH0D04268g"
                     /product="KLTH0D04268p"
                     /transcript_id="XM_002552862.1"
                     /db_xref="GeneID:8295134"
     CDS             complement(400463..401158)
                     /locus_tag="KLTH0D04268g"
                     /note="some similarities with uniprot|P39929 Saccharomyces
                     cerevisiae YLR025W SNF7 Involved in derepression of SUC2
                     in response to glucose limitation involved in glucose
                     derepression"
                     /codon_start=1
                     /product="KLTH0D04268p"
                     /protein_id="XP_002552908.1"
                     /db_xref="GeneID:8295134"
                     /db_xref="GOA:C5DGC8"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DGC8"
                     /translation="MLSYFFGGGSTSKNKDAPKKAILDLREHITLLGKKEAHLQTQVA
                     SQEQQARTLLGKNNKTGAKNALKRKKTYESQLVKIQAQMDSLEQQLYSIESANLNLET
                     MKAMKQGASAMKNIHKGMDIDKVDETMDEIREQVELGEEISDAISRPLHAGAEVDEDE
                     IDEELAALAQESVKQEVVAPPQGLPSVPLGKVSTPHAATLPAGQEQDAEAEEEEEDED
                     ERALRELQAEMGL"
     gene            <402264..>402911
                     /locus_tag="KLTH0D04290g"
                     /db_xref="GeneID:8295135"
     mRNA            <402264..>402911
                     /locus_tag="KLTH0D04290g"
                     /product="KLTH0D04290p"
                     /transcript_id="XM_002552863.1"
                     /db_xref="GeneID:8295135"
     CDS             402264..402911
                     /locus_tag="KLTH0D04290g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D04290p"
                     /protein_id="XP_002552909.1"
                     /db_xref="GeneID:8295135"
                     /db_xref="UniProtKB/TrEMBL:C5DGC9"
                     /translation="MHSESNTSPQQRIITSEQWVFDRRGSREESKAGGRPKRTPISKQ
                     ERELRRKQRELENEQLQQEHQTVANENARLKAVVARLKQDIDAYTRLILEATAHASPA
                     PAQAVAQAQSTQGQAARETQDRGVALPQQALPQLLDELPPMETLLVNTAKRRKHAAAG
                     GVRTGAGADAGAQEQDPPVLKSTHADVMLAPQSAEVGPEEVALMRKLKDVLAEME"
     gene            <403678..>404184
                     /locus_tag="KLTH0D04312g"
                     /db_xref="GeneID:8295136"
     mRNA            <403678..>404184
                     /locus_tag="KLTH0D04312g"
                     /product="KLTH0D04312p"
                     /transcript_id="XM_002552864.1"
                     /db_xref="GeneID:8295136"
     CDS             403678..404184
                     /locus_tag="KLTH0D04312g"
                     /note="some similarities with uniprot|Q04487 Saccharomyces
                     cerevisiae YMR118C Hypothetical ORF and to YKL141W
                     uniprot|P33421 Saccharomyces cerevisiae YKL141W SDH3
                     Cytochrome b subunit of succinate dehydrogenase (Sdh1p
                     Sdh2p Sdh3p Sdh4p) which couples the oxidation of
                     succinate to the transfer of electrons to ubiquinone,
                     member of GLR.231"
                     /codon_start=1
                     /product="KLTH0D04312p"
                     /protein_id="XP_002552910.1"
                     /db_xref="GeneID:8295136"
                     /db_xref="GOA:C5DGD0"
                     /db_xref="InterPro:IPR000701"
                     /db_xref="InterPro:IPR014314"
                     /db_xref="InterPro:IPR014361"
                     /db_xref="InterPro:IPR018495"
                     /db_xref="UniProtKB/TrEMBL:C5DGD0"
                     /translation="MFSLGLNSGAFWARPLRTASRRMIATAKTSPARQQEILIAQRKN
                     RPVSPHLTIYQPQLTWYLSSLHRVSGVILAFGFFATTIAFGTSALLGLGLTSNNLARW
                     YHEKVPRWMDLTAKGSFAYLFAFHFANGLRHLIWDAGKALTLRGVYTTGYAVMAVMAL
                     GGTYLLTW"
     gene            <404397..>405824
                     /locus_tag="KLTH0D04334g"
                     /db_xref="GeneID:8295137"
     mRNA            <404397..>405824
                     /locus_tag="KLTH0D04334g"
                     /product="KLTH0D04334p"
                     /transcript_id="XM_002552865.1"
                     /db_xref="GeneID:8295137"
     CDS             404397..405824
                     /locus_tag="KLTH0D04334g"
                     /note="similar to uniprot|P34163 Saccharomyces cerevisiae
                     YKL140W TGL1 Steryl ester hydrolase one of three gene
                     products (Yeh1p Yeh2p Tgl1p) responsible for steryl ester
                     hydrolase activity and involved in sterol homeostasis
                     localized to lipid particle membranes"
                     /codon_start=1
                     /product="KLTH0D04334p"
                     /protein_id="XP_002552911.1"
                     /db_xref="GeneID:8295137"
                     /db_xref="GOA:C5DGD1"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DGD1"
                     /translation="MPTVVPFLGRISFTDYVILFLVSLEKLLAVLLNCIPQALFDAAA
                     LLINCVTRKAVNPVDAMARQLRDARGIHEMGRLFDVDIEDHIVRTEDDYLLTVHRIAP
                     REGSSNGQVVYLHHGLLMCSDVWMCNTARERNLPLVLHDLGFDVWLGNNRGNKYSTQH
                     LYRRPGSHEFWDFSIDEFAFFDIPNSIEFVLEHTQLPQLICIGFSQGSAQTFASLSVR
                     EDLNSKISLFVAISPAMTPQGLHNRIVDSLLKSSPRLMYLFFGNRILLPSATVWQKTL
                     HPTIFNFIIDVANRVLFNWRSENISPHQKQASYAKLYSTTSVKSVVHWFQILHAQKFQ
                     MFEEYDIVINSWNPTRSYQITTFPTRTNIRIPVLLLYGGSDSLVDIEVMKSNLPSSQV
                     FDVMIPEHEHLDLIWGRDVANLVIPNVLRFIWFFNDVKALDKEASFEGDADDYDDATG
                     ALDSVQDLASPFNKSYSASTSTKDI"
     gene            <405904..>407401
                     /locus_tag="KLTH0D04356g"
                     /db_xref="GeneID:8295138"
     mRNA            join(<405904..405987,406076..>407401)
                     /locus_tag="KLTH0D04356g"
                     /product="KLTH0D04356p"
                     /transcript_id="XM_002552866.1"
                     /db_xref="GeneID:8295138"
     CDS             join(405904..405987,406076..407401)
                     /locus_tag="KLTH0D04356g"
                     /note="similar to uniprot|Q03957 Saccharomyces cerevisiae
                     YKL139W CTK1 Catalytic (alpha) subunit of C-terminal
                     domain kinase I (CTDK-I), which phosphorylates the C-
                     terminal repeated domain of the RNA polymerase II large
                     subunit (Rpo21p) to affect both transcription and pre-mRNA
                     3' end processing"
                     /codon_start=1
                     /product="KLTH0D04356p"
                     /protein_id="XP_002552912.1"
                     /db_xref="GeneID:8295138"
                     /db_xref="GOA:C5DGD2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DGD2"
                     /translation="MLKNWKLYFLVLRHRKTTRCIKTTPLLDRTGPRPTGPSDASRNG
                     PHSAFPERSNGHQVSAAGSLGPERKRPRVGNSRYAGSRYQDAGFHSSSKQRLNVQNIP
                     TGHRDVPKRQSRYDPGNAKPKAVPVTVVVRERDSSVYERIQQVGEGTYGKVYKARNTL
                     TGQLVALKRLRLEGEREGFPITSIREIKLLQSFDHRNISTLSEIMVESQKTVYMIFEY
                     ADNDLSGLLMNEQIVLSSANCKHLFKSLLEGIHYLHSNGILHRDIKGSNILIDNKGQL
                     KITDFGLARKMRDDSDYTNRVITLWYRPPELLMGSTNYGTAVDMWGCGCLLVELFQKT
                     AIFQGTNEVEQLNAIFSIMGTPSVEQWPTLFEMPWFFMMIPQQNRKYEPRFDEKFGAV
                     LPSPAAVSLAKGLLLYDEKRRLSASEALRHQYFREEPQPQPLDLSGFDGWHEFEAKRH
                     RRKEREEQKRREKSESQGS"
     gene            <407803..>408396
                     /locus_tag="KLTH0D04378g"
                     /db_xref="GeneID:8295139"
     mRNA            <407803..>408396
                     /locus_tag="KLTH0D04378g"
                     /product="KLTH0D04378p"
                     /transcript_id="XM_002552867.1"
                     /db_xref="GeneID:8295139"
     CDS             407803..408396
                     /locus_tag="KLTH0D04378g"
                     /note="weakly similar to uniprot|Q04477 Saccharomyces
                     cerevisiae YMR117C SPC24 Component of the evolutionarily
                     conserved kinetochore-associated Ndc80 complex
                     (Ndc80p-Nuf2p-Spc24p-Spc25p) involved in chromosome
                     segregation spindle checkpoint activity and kinetochore
                     clustering"
                     /codon_start=1
                     /product="KLTH0D04378p"
                     /protein_id="XP_002552913.1"
                     /db_xref="GeneID:8295139"
                     /db_xref="InterPro:IPR013252"
                     /db_xref="UniProtKB/TrEMBL:C5DGD3"
                     /translation="MSEEALIENPSNLIRETRTNFSIVNDTEALSNISKNLNELQRIV
                     KEKLDRKSNELSQSESALEKNEARLDTLRRARTESGSGQLQGGSSEDVLEMARELESL
                     ERRLVELRQEVDRGLEQLIEKNADDGKVQELEESQTEDPEHRTNVLKIQLYRSLGVVL
                     DADNNRALISKDGTLDVVPVGGDASAYFRTKYLWDRI"
     gene            complement(<408480..>408875)
                     /locus_tag="KLTH0D04400g"
                     /db_xref="GeneID:8295140"
     mRNA            complement(<408480..>408875)
                     /locus_tag="KLTH0D04400g"
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /transcript_id="XM_002552868.1"
                     /db_xref="GeneID:8295140"
     CDS             complement(408480..408875)
                     /locus_tag="KLTH0D04400g"
                     /note="similar to uniprot|P14063 Saccharomyces cerevisiae
                     YKL138C MRPL31 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /protein_id="XP_002552914.1"
                     /db_xref="GeneID:8295140"
                     /db_xref="InterPro:IPR016340"
                     /db_xref="UniProtKB/TrEMBL:C5DGD4"
                     /translation="MFGPFKSSNTLLGGLLWKIPWRMSRPQKQRQRHRLQDVDSVIKS
                     LNLGLHAERSVQKGISYDEAINSSKQLKPGVKQLRLLNKPSLFPNEPQMSYKDKYTYF
                     NKQAKGYRKGIHKLPKWTKITQRRNPAFF"
     gene            <409088..>409414
                     /locus_tag="KLTH0D04422g"
                     /db_xref="GeneID:8295141"
     mRNA            <409088..>409414
                     /locus_tag="KLTH0D04422g"
                     /product="KLTH0D04422p"
                     /transcript_id="XM_002552869.1"
                     /db_xref="GeneID:8295141"
     CDS             409088..409414
                     /locus_tag="KLTH0D04422g"
                     /note="similar to uniprot|P36064 Saccharomyces cerevisiae
                     YKL137W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D04422p"
                     /protein_id="XP_002552915.1"
                     /db_xref="GeneID:8295141"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:C5DGD5"
                     /translation="MAQEQDTPQARRLPVWVLGPREEKEARQNLKKFAYSKCDEYVKA
                     MVECSKLHGLKVFPACEPQRDKMAECILSYQGDNYLDQQRDKLVQRKIEKLEEQLKQQ
                     QQNELK"
     gene            complement(<409499..>411616)
                     /locus_tag="KLTH0D04444g"
                     /db_xref="GeneID:8295142"
     mRNA            complement(<409499..>411616)
                     /locus_tag="KLTH0D04444g"
                     /product="KLTH0D04444p"
                     /transcript_id="XM_002552870.1"
                     /db_xref="GeneID:8295142"
     CDS             complement(409499..411616)
                     /locus_tag="KLTH0D04444g"
                     /note="similar to uniprot|P36000 Saccharomyces cerevisiae
                     YKL135C APL2 Beta-adaptin large subunit of the
                     clathrin-associated protein (AP-1) complex"
                     /codon_start=1
                     /product="KLTH0D04444p"
                     /protein_id="XP_002552916.1"
                     /db_xref="GeneID:8295142"
                     /db_xref="GOA:C5DGD6"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:C5DGD6"
                     /translation="MEKMLKKFIQNATRVAPKISKKGELFELRNGLVSQYPQTRKDAI
                     KKTIQQMTLGKDVSSLFPDILKNIATSDVEQKKLVYLYVMNYAETHPELCILAVNTFV
                     SDAQDTNPLIRCMAIRTMSMIRVDKILEYVEIPLRKTLQDDNPYVRKTAVICVAKLFA
                     LNKELCQELGVLEDLISALEDSNPMVVANAIAALSDIYEADESVVPLPKLIQSHVSQF
                     LLALNECTEWARIIILGALAEYTAKDSLEAQEIIDRVTPHLQHVNAAVVLASIKVVIK
                     NLPQVQANTESPIFSKLSSALVSLMSTPPEMQYVALRNIRIVLEKYPHILSRELRIFY
                     VKFNDPLYVKLEKIDTLVRLVDPSNLKQCTLLLAELKEYAMEFEPEFVSRAILALSQL
                     GVKYSEPKFITKVLEIIIELCNTRDSFQDDCLVAMCNLLRHAGPDQEGMVTQVCSLAE
                     AWSSVENLLQTDYAKCNYIWLLGQFPQKFNNVERKLQASIDSFTQEESLTQMSLLISV
                     VKLHSILPGSMLQNLLELATTSTDEVDVRDMAIMYWRCLSVESSHDGLINELCNSSLP
                     EIATTLDTFSPELLETLLRELSLLSSVYFKPVSTMTKPKSSSGNHLKGKQLDELQFMA
                     QDEILKNMNEDNLLDFDNDWPAASNSNYKSEAQGSTVDYLNDIFGLSSPAPPVENSMA
                     DLSLNKKDEKQKSSNTQDLLDLF"
     gene            <413024..>414238
                     /locus_tag="KLTH0D04466g"
                     /db_xref="GeneID:8295143"
     mRNA            join(<413024..413560,413816..>414238)
                     /locus_tag="KLTH0D04466g"
                     /product="KLTH0D04466p"
                     /transcript_id="XM_002552871.1"
                     /db_xref="GeneID:8295143"
     CDS             join(413024..413560,413816..414238)
                     /locus_tag="KLTH0D04466g"
                     /note="highly similar to uniprot|P38011 Saccharomyces
                     cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
                     protein) involved in translation regulation required for
                     repression of Gcn4p activity in the absence of amino-acid
                     starvation core component of the ribosome ortholog of
                     mammalian RACK1"
                     /codon_start=1
                     /product="KLTH0D04466p"
                     /protein_id="XP_002552917.1"
                     /db_xref="GeneID:8295143"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DGD7"
                     /translation="MSSAEVLVLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLIT
                     WKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCIQR
                     FVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNE
                     TPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDG
                     QIMLWNLTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSGIKIFNLEERKVVDELKP
                     EFAGYTKAAEPHAISLAWSADGQTLFAGYTDNVIRVWQVMTAN"
     gene            413639..413725
                     /gene="SRN24"
                     /locus_tag="KLTH0D04488r"
                     /db_xref="GeneID:8295144"
     ncRNA           413639..413725
                     /ncRNA_class="snoRNA"
                     /gene="SRN24"
                     /locus_tag="KLTH0D04488r"
                     /product="snR24"
                     /note="C/D snoRNA intronic SNR24 (U24 RNA)"
                     /transcript_id="XR_002432183.1"
                     /db_xref="GeneID:8295144"
     gene            <414739..>415074
                     /locus_tag="KLTH0D04510g"
                     /db_xref="GeneID:8295761"
     mRNA            <414739..>415074
                     /locus_tag="KLTH0D04510g"
                     /product="KLTH0D04510p"
                     /transcript_id="XM_002552872.1"
                     /db_xref="GeneID:8295761"
     CDS             414739..415074
                     /locus_tag="KLTH0D04510g"
                     /note="similar to uniprot|Q04438 Saccharomyces cerevisiae
                     YMR107W SPG4 Protein required for survival at high
                     temperature during stationary phase not required for
                     growth on nonfermentable carbon sources"
                     /codon_start=1
                     /product="KLTH0D04510p"
                     /protein_id="XP_002552918.1"
                     /db_xref="GeneID:8295761"
                     /db_xref="InterPro:IPR020485"
                     /translation="MGGIFDAFEVYNKKKHSSNPHMFGNTSNTGGTKTDYVYSSEYRA
                     PKKNKLMKDELLAPDSEHADGAKAMLTESAAQAGTPNMVDLSKLSQHELESLMKDLRK
                     GEPNNRVNF"
     gene            <417085..>419121
                     /locus_tag="KLTH0D04532g"
                     /db_xref="GeneID:8295145"
     mRNA            <417085..>419121
                     /locus_tag="KLTH0D04532g"
                     /product="KLTH0D04532p"
                     /transcript_id="XM_002552873.1"
                     /db_xref="GeneID:8295145"
     CDS             417085..419121
                     /locus_tag="KLTH0D04532g"
                     /note="highly similar to uniprot|P07342 Saccharomyces
                     cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
                     the first common step in isoleucine and valine
                     biosynthesis and is the target of several classes of
                     inhibitors localizes to the mitochondria expression of the
                     gene is under general amino acid control"
                     /codon_start=1
                     /product="KLTH0D04532p"
                     /protein_id="XP_002552919.1"
                     /db_xref="GeneID:8295145"
                     /db_xref="GOA:C5DGD9"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DGD9"
                     /translation="MMRQSAGKMMLRRGISAALARNSARIGSLRLYSASATSTQTADD
                     QRPRPAPSFDMEPSRSVKASKLRKSEMPLEAMDDSFIGLSGGQIFHEMMRRHKVNTVF
                     GYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSGKPGVVLVTSGPGATN
                     VVTPMADALADGVPMVVFTGQVATSSIGTDAFQEADVIGISRSCTKWNVMVKNVEELP
                     RRINEAFEIAVSGRPGPVLVDLPKDVTSAILRTPIPVKSTLPSNALSKITKSAAKEFT
                     LANLQRAADLINIAKKPLIYVGGGIFGKEQGPKLLRELAERAQIPVSTTIQGLGAFDQ
                     EDPKSLDMLGMHGSAFANLSVQNADLIIALGARFDDRVTCNVAKFAPEARKAALENRG
                     GIIHFEISPKNINKVVEAQVAVEGDVTDNLERLIPLVNNVKERKEWFAQIDAWKKEYP
                     YDYQRETKDSKIKPQTLVARLSEVASSTGRDVIVTTGVGQHQMWAAQHWTWRHPRTFI
                     TSGGLGTMGYGLPSAIGAQIARPDALVIDIDGDASFNMTLMELSSAVQAGAPVKIVVL
                     NNEEQGMVTQWQSLFYEHRYSHTHQLNPDFVKLAEAMGLKGMRLSKQEDMDSVLKEFV
                     NTEGPVLLEVIVEKKVPVLPMVPAGKGLHEFINFDAEVEKEQNELRHKRTGGKH"
     gene            <419630..>423418
                     /locus_tag="KLTH0D04554g"
                     /db_xref="GeneID:8295146"
     mRNA            <419630..>423418
                     /locus_tag="KLTH0D04554g"
                     /product="KLTH0D04554p"
                     /transcript_id="XM_002552874.1"
                     /db_xref="GeneID:8295146"
     CDS             419630..423418
                     /locus_tag="KLTH0D04554g"
                     /note="similar to uniprot|Q04439 Saccharomyces cerevisiae
                     YMR109W MYO5 One of two type I myosins contains
                     proline-rich tail homology 2 (TH2) and SH3 domains MYO5
                     deletion has little effect on growth but myo3 myo5 double
                     deletion causes severe defects in growth and actin
                     cytoskeleton organization and to uniprot|P36006
                     Saccharomyces cerevisiae YKL129C MYO3"
                     /codon_start=1
                     /product="KLTH0D04554p"
                     /protein_id="XP_002552920.1"
                     /db_xref="GeneID:8295146"
                     /db_xref="GOA:C5DGE0"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGE0"
                     /translation="MAIIKRGARNKTAQQPAKRSGQIKKATFESNKKKEVGVSDLTLL
                     SKISDESINDNLKKRFQNGTIYTYIGHVLISVNPFRDLGIYTDSVLKSYMGKNRLEVP
                     PHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASNTHSDSIGKI
                     KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLLEKQRVV
                     GQLKDERNFHIFYQFTKGASDNYRQLFGVQMPEQYIYTSASGCTSVDTIDDLSDFQAT
                     LKAMQVIGITQQEQDELFRLLSAILWIGNISFTENEEGNAQVCDTSVTDFVAYLLQVD
                     AHFLTQALVERVMETNHGMKRGSVYHVPLNVVQATAVKDALAKAIYNNLFDWIVDRVN
                     VSLQAFPGANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKSEQEEYA
                     REQIQWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSNAADQAFAQRLNLF
                     SSNPHFELRSTKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELIGTSSNTFLSSIFP
                     TTVDKNSKRRPPSAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDHQVLH
                     QVKYLGLQENVRIRRAGFAYRQTFDKFVERFYLLSPQCSYAGDYIWQGDTLDAVKLIL
                     KDASIPPSEYQLGVSKVFIKTPESLFALETMRDKYWYNMAARIQRAWRRFLLRRVDAA
                     SRIQRAIREKKGGNKYEKLRDSGTKLLAGRKERRSMSLLGYRAFMGDYLSCNEPKAKG
                     AYIKRQAGINEKVIFSINGESLHSKFGRSALRLRKAFILTPSHFYVIGQNAVQNQITY
                     TVDYKIDVKQIKYVSLTNLQDDWVGIFVANSTLPDPLINTYFKTELITHLKSLNKGIE
                     VKIGPTLEYQKKPGKIHVVKCQISESAPKYGDIYKSSTISVRKGHPATSKSHPKPKKK
                     STYQDYAPQHRTSTSIGQPSIPTATRSTVVPTTGKQAPAKPPAPKIRQKKPAPPPPAK
                     KQSQPAPSSNVANIAATAAQAAYHPQPAVHNSEQEAGVNHGTPPRQTPMGASQGSRSR
                     QEPKSNFATASSPAKSAVPPPPPPPPPASKPSVPKFEAAYDFVGTGSPSELPLSKGDI
                     VYISRQEPSGWSLAKTLDGAKEGWVPTSYMTEHKGTAHAVSSSRPSQSTQPGVSSSTE
                     NSASTATSATFTAHSSGPDQNSISNASSNPLASALAARANKVRQDSDEEEAEASEDDW
                     "
     gene            complement(<423550..>425121)
                     /locus_tag="KLTH0D04576g"
                     /db_xref="GeneID:8295147"
     mRNA            complement(<423550..>425121)
                     /locus_tag="KLTH0D04576g"
                     /product="KLTH0D04576p"
                     /transcript_id="XM_002552875.1"
                     /db_xref="GeneID:8295147"
     CDS             complement(423550..425121)
                     /locus_tag="KLTH0D04576g"
                     /note="similar to uniprot|Q04458 Saccharomyces cerevisiae
                     YMR110C"
                     /codon_start=1
                     /product="KLTH0D04576p"
                     /protein_id="XP_002552921.1"
                     /db_xref="GeneID:8295147"
                     /db_xref="GOA:C5DGE1"
                     /db_xref="InterPro:IPR012394"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DGE1"
                     /translation="MSLQYTPVDDIDEIVKLSKASFEERQAEISKFKNPRNHDLKLRL
                     DTLKSLYYSVKDHEAEIIEALLNDFKRSKHETVVMELVVLYNSILQYIKKLPHWIKPE
                     KIRESSALFMFSNVSVDRISLGSVLVISPFNYPVLLGLEPVAAAIAGGNSVVWKPSEL
                     VPNTSRLLGNIISCHVSSKWLKVVQGAVTETTRLIQNPNFDKIFYTGSTKVGAIVAQE
                     AAKHLTPYTLELGGKSPVFITEHFSESNMRAALKRVFFGAFSNSGQTCVASDYVIVHE
                     SQIKKIKELAKGVLDEFWPILDKDTDYTCMVHEKAYESAKKKLECTDGTTVQPSNVAA
                     ELPKNCLPPTVVFDVGWDHALMKEENFAPFLPFVTYVDLDDAIAKVKKYHNNPLAMYI
                     FSNNKHETERIMTQVKSGACMIGDTLVHVAAQNAPFGGIRQSGSGSYHGRWSYSAFTH
                     ERTVIRQPFWTELMNGVRNPPYTPTKPKMAQAFIEAKPGFNRDGSTKWDSKKLVVYTV
                     SGALVALGTYRLAQS"
     gene            <425236..>425946
                     /locus_tag="KLTH0D04598g"
                     /db_xref="GeneID:8295148"
     mRNA            <425236..>425946
                     /locus_tag="KLTH0D04598g"
                     /product="KLTH0D04598p"
                     /transcript_id="XM_002552876.1"
                     /db_xref="GeneID:8295148"
     CDS             425236..425946
                     /locus_tag="KLTH0D04598g"
                     /note="similar to uniprot|P36068 Saccharomyces cerevisiae
                     YKL130C SHE2 RNA-binding protein that binds specific mRNAs
                     and interacts with She3p part of the mRNA localization
                     machinery that restricts accumulation of certain proteins
                     to the bud"
                     /codon_start=1
                     /product="KLTH0D04598p"
                     /protein_id="XP_002552922.1"
                     /db_xref="GeneID:8295148"
                     /db_xref="GOA:C5DGE2"
                     /db_xref="InterPro:IPR024261"
                     /translation="MKNVTFPANENVLKSLQLAIQSYSNYLSSYIDALNKYISHQRRV
                     STLRFERATLIKYVKKLRFFNEELMSMDMVQQYRGGNLIKTAVCSLASFFIRCLEVMD
                     LLNYYLTQSLKNETISKTLNRDLVVSEDCVVFLESTYRHYVKFTQWMLEALDIHDATL
                     TVEVLQFARKCAKEDGLDLEETDDILLQEVGVVSSASEYQELLDEWCLVLSEQYMGLT
                     KAFEAETTRWSEIFEGRK"
     gene            complement(<425980..>427110)
                     /locus_tag="KLTH0D04620g"
                     /db_xref="GeneID:8295149"
     mRNA            complement(<425980..>427110)
                     /locus_tag="KLTH0D04620g"
                     /product="KLTH0D04620p"
                     /transcript_id="XM_002552877.1"
                     /db_xref="GeneID:8295149"
     CDS             complement(425980..427110)
                     /locus_tag="KLTH0D04620g"
                     /note="weakly similar to uniprot|Q04461 Saccharomyces
                     cerevisiae YMR111C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D04620p"
                     /protein_id="XP_002552923.1"
                     /db_xref="GeneID:8295149"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DGE3"
                     /translation="MMRNELVSNEEAEQNTPNKNSRVSDSVPSPTPVASAFQAVVLDQ
                     LAKIQEQNEFLKTRVVQLEQEQEDFYIETCKKLEMGLKQFEKCATDVGALKEIFKEVV
                     GVMSEKRVLSWDHSNEHVTGQEAEDLVGSHLLHENHEAYRQQRDNEHRLEAAHAGGGT
                     GWCKTEESDMWTRLNYQDFEPPSSLVERSQSVSDAYKDDRSRYPCYKLNRSLRTVYEV
                     AQEYFAGLRGQPSLLALERRFGPSWRRKPSERTFYAKRMHIINKIIDIKNHPEKYNLP
                     AGTTRLQATSVVENIRLKNNSFPGKGRELSLNQLYIYFAKKMDRPSDYSLTLQTAPRR
                     HVEGRSSDVRHQQSTPLSNGSGEEDSEDPNVDSHHEGSDQEA"
     gene            complement(<427725..>428060)
                     /locus_tag="KLTH0D04642g"
                     /db_xref="GeneID:8295150"
     mRNA            complement(<427725..>428060)
                     /locus_tag="KLTH0D04642g"
                     /product="KLTH0D04642p"
                     /transcript_id="XM_002552878.1"
                     /db_xref="GeneID:8295150"
     CDS             complement(427725..428060)
                     /locus_tag="KLTH0D04642g"
                     /note="similar to uniprot|Q99278 Saccharomyces cerevisiae
                     YMR112C MED11 14 Kd mediator subunit of RNA polymerase II
                     holoenzyme"
                     /codon_start=1
                     /product="KLTH0D04642p"
                     /protein_id="XP_002552924.1"
                     /db_xref="GeneID:8295150"
                     /db_xref="GOA:C5DGE4"
                     /db_xref="InterPro:IPR019404"
                     /db_xref="UniProtKB/TrEMBL:C5DGE4"
                     /translation="MPQPEFIQERLESLNAVDNQLLSTLLHASQAVGTIEELKRGNEN
                     MKSQFENHIRSFYGSLEEATVALRREIRHLDENVGTRLLPINVNKKAVGQDNEKMREQ
                     FEHLEHEAS"
     gene            <428209..>429474
                     /locus_tag="KLTH0D04664g"
                     /db_xref="GeneID:8295151"
     mRNA            <428209..>429474
                     /locus_tag="KLTH0D04664g"
                     /product="KLTH0D04664p"
                     /transcript_id="XM_002552879.1"
                     /db_xref="GeneID:8295151"
     CDS             428209..429474
                     /locus_tag="KLTH0D04664g"
                     /note="similar to uniprot|Q12676 Saccharomyces cerevisiae
                     YMR113W FOL3 Dihydrofolate synthetase involved in folic
                     acid biosynthesis catalyzes the conversion of
                     dihydropteroate to dihydrofolate in folate coenzyme
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0D04664p"
                     /protein_id="XP_002552925.1"
                     /db_xref="GeneID:8295151"
                     /db_xref="GOA:C5DGE5"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="UniProtKB/TrEMBL:C5DGE5"
                     /translation="MSIELGLSRITNLLSHLGNPQDKFRVLHVAGTNGKGSVCSLLQS
                     VLQQNTLNLVGKFTSPHLIHITDCISVNNKPISTLDFNSIRTRLDHMNAAHQIGCTEF
                     ELLTCTALEYFHLKKCNWCVLEVGLGGRLDATNCTVGSQKVCGITKIGMDHQGFLGNT
                     LQEIAAEKAAIVTSGVPFVAVDGTNDKRVLDIVEKRASLVGATFSPTTTRISGHFIHT
                     DSWGKVAREAVALNGDYQKSNVAVALSMLDFLQREDQVSISREELIDGLKTVSWPGRL
                     QNAELILPQGQQTLKILLDGAHNGDAAEALASYIKEHVRRDSEPLRFLVAVTQGKDLE
                     PLLSPLIRSCDEVVVTKFGPVDRMPWISAMDPSDLARFVSKYTDHVLIQPNLQDAVAY
                     LQNTSPRQTVICGSLYLCGQLLQSTEVKW"
     gene            complement(<429482..>430489)
                     /locus_tag="KLTH0D04686g"
                     /db_xref="GeneID:8295152"
     mRNA            complement(<429482..>430489)
                     /locus_tag="KLTH0D04686g"
                     /product="KLTH0D04686p"
                     /transcript_id="XM_002552880.1"
                     /db_xref="GeneID:8295152"
     CDS             complement(429482..430489)
                     /locus_tag="KLTH0D04686g"
                     /note="similar to uniprot|Q04471 Saccharomyces cerevisiae
                     YMR114C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D04686p"
                     /protein_id="XP_002552926.1"
                     /db_xref="GeneID:8295152"
                     /db_xref="InterPro:IPR003738"
                     /db_xref="UniProtKB/TrEMBL:C5DGE6"
                     /translation="MCGRYALGYSGIDVGRRLTELDITYESPEDGPVNFESSYNIAPT
                     QRAPVLTNHEHLRSMQWGLVPHWTKDVAKSQPYKTFNARKENIATSKMWATPCNYKRC
                     VVPVSGYYEWQTKGKTKIPYYITRKDRELMFLAGMYDHVEAQDFYSYTIITGPAPPEL
                     EWLHFRMPVVLERGSKEWNMWLDESKTSWKESELEQTLKAYCDKSVLEWWQVSSEVGK
                     VANNGKCLVSPAKGAVRDFFKKEDKTKKSLVKGEQSSRSDFESSWKHEEKDDKKPSLH
                     ERDENSQKHSKEEPRKLEEASDVKQEPEVSLKSDLNQKTTSKRGIENMLRGSINKRQK
                     R"
     gene            <431011..>432444
                     /locus_tag="KLTH0D04708g"
                     /db_xref="GeneID:8295153"
     mRNA            <431011..>432444
                     /locus_tag="KLTH0D04708g"
                     /product="KLTH0D04708p"
                     /transcript_id="XM_002552881.1"
                     /db_xref="GeneID:8295153"
     CDS             431011..432444
                     /locus_tag="KLTH0D04708g"
                     /note="similar to uniprot|Q04472 Saccharomyces cerevisiae
                     YMR115W FMP24 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0D04708p"
                     /protein_id="XP_002552927.1"
                     /db_xref="GeneID:8295153"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DGE7"
                     /translation="MMLGSRFGVRSALRRAIQVKPKIKIPARALNTFASSASKYSTWQ
                     RWAYTAGAFGALSLGLYYLYWPRHTFPQSVAKILRKALWEESDKKDHDYQCALKFYLQ
                     AIGECDKLSMDRVSDEYTGIELKIAEMYERLNMNDEAHDLYLEMLYRYFDALHTPGRI
                     PDDKRPHLIQKDLRILIKSLEINKDIQVGKRNLLAHLLLAQEEVLSRSPELKEYFDKR
                     KERTTKLFQGKLDDEGVDFDNFLSEDNIKLNDESYLIVNLAKNSSAWEPFKEEFFTAR
                     DLYTAYCLSTKDISSALSCKLTTVEWMVMADMPPGQILLSQANLGSLLYLQAETFETK
                     IHQLNKRREQDKSKAEDETMIRALRQLNRNKDTCFKMATQCYDSVIKFSRKNKKLRFN
                     VKDFMDPSAAHAIALSVYGMGVIHLHKHNLAKAERLLNDSINMAEETGFHELLKEAKQ
                     ELKKVAKASQVDAIKLEDRDSSASDTV"
     gene            <432572..>434890
                     /locus_tag="KLTH0D04730g"
                     /db_xref="GeneID:8295154"
     mRNA            <432572..>434890
                     /locus_tag="KLTH0D04730g"
                     /product="KLTH0D04730p"
                     /transcript_id="XM_002552882.1"
                     /db_xref="GeneID:8295154"
     CDS             432572..434890
                     /locus_tag="KLTH0D04730g"
                     /note="similar to uniprot|P35999 Saccharomyces cerevisiae
                     YKL134C OCT1 Mitochondrial intermediate peptidase cleaves
                     N-terminal residues of a subset of proteins upon import
                     after their cleavage by mitochondrial processing peptidase
                     (Mas1p-Mas2p) may contribute to mitochondrial iron
                     homeostasis"
                     /codon_start=1
                     /product="KLTH0D04730p"
                     /protein_id="XP_002552928.1"
                     /db_xref="GeneID:8295154"
                     /db_xref="GOA:C5DGE8"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="UniProtKB/TrEMBL:C5DGE8"
                     /translation="MLSQALHVRKPSLLKSVCQLRVYSSFPVYHAKHDLRKVFDNQNY
                     WREINKDIYKYEESKGIGIFGKLGKHATPLQTGLFKNPFLTSSQGLRNFSMQSLKEAQ
                     QLVDQMRQDRSHQGHLNYIRNLDRLSDMLCRVIDLCEFIRASHPDSQFVRAAQLCHEE
                     MFEFMNVLNTDSTLCEILKRVLSDDLIASKLSEEELKVGKILLEDFEKSGIDMAPEVG
                     EQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLLLNHLSRDTKGQNY
                     KVPTYGYIAFSILRSCPSENIRMKVWTAVHSCPEKQITRLKHLVKLRGLLAQIMGKNS
                     YSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEV
                     LKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIRLEPA
                     VAKVGETWSPEVRRINVVSDQEGVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEET
                     DLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIH
                     SMLGRTSLQNISGTRCATDFVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELLHL
                     NQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDKS
                     NWCGRFGHLLGYGASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGGSR
                     DPWNCIADALDKQSLSKGDEEAMKFIGNTEDV"
     gene            435155..435227
                     /locus_tag="KLTH0D04752r"
                     /db_xref="GeneID:8295155"
     tRNA            435155..435227
                     /locus_tag="KLTH0D04752r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8295155"
     gene            <435339..>437147
                     /locus_tag="KLTH0D04774g"
                     /db_xref="GeneID:8295156"
     mRNA            <435339..>437147
                     /locus_tag="KLTH0D04774g"
                     /product="KLTH0D04774p"
                     /transcript_id="XM_002552883.1"
                     /db_xref="GeneID:8295156"
     CDS             435339..437147
                     /locus_tag="KLTH0D04774g"
                     /note="similar to uniprot|Q04437 Saccharomyces cerevisiae
                     YMR106C YKU80 Forms heterodimer with Yku70p known as Ku
                     binds chromosome ends and is involved in maintaining
                     normal telomere length and structure in addition to
                     participating in the formation of silent chromatin at
                     telomere-proximal genes"
                     /codon_start=1
                     /product="KLTH0D04774p"
                     /protein_id="XP_002552929.1"
                     /db_xref="GeneID:8295156"
                     /db_xref="GOA:C5DGE9"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:C5DGE9"
                     /translation="MGSEATTFIVDVSPSMVGLGYVEQATAYIEYTLFLKSKKQRKTD
                     WVNCFLANCPYSRNNHETANVFELMPFTAPIGAHKVIEILKELKSLVTRSAPGKHNIN
                     SMVQCLLVSSVSMRDEFKKRKVRKRIIVFTDNLDGLDLTEEELATLEQELDCSIVLVT
                     CGLKVEERKTSEIPIWEKCIQKISGSMEVSMTALLQEISTHRPAVVKPVRIFQGELRL
                     GAPISDEDVTGPSYDSITVKVEGYPATKAVSSLNRRVVAKSEDGTFGPVKSVIEYEAI
                     DDGEDSEGGVASVSKEYVTKAYRYGSDYVVLPQAIESERTYKTKPGLDLRGFVGNESI
                     PRHFLSSESTFIIPATKDGTRADFVSFSALVDSMIKLRKFAIARYVQKLNGEVQMCLL
                     CPILIPKKRKEPGDDETYTRALVLNRLPFAEDERCSDYPRLAQAAASSDAETAEIDAL
                     MGELIDTMDLGPGPDQTWCSTTLYRSFDPTVLEPTLPLPRPTEPRDSSVQDALCVPAI
                     GIYRQQQILIEYMHQRIVQGSADFEVPGLPNDLQKKLFPSNELSKGTLLKLQELLAIE
                     VNNSRASSATPNDEQQDEDEFQEIPSLESLLARGRT"
     gene            <437416..>439128
                     /locus_tag="KLTH0D04796g"
                     /db_xref="GeneID:8295157"
     mRNA            <437416..>439128
                     /locus_tag="KLTH0D04796g"
                     /product="KLTH0D04796p"
                     /transcript_id="XM_002552884.1"
                     /db_xref="GeneID:8295157"
     CDS             437416..439128
                     /locus_tag="KLTH0D04796g"
                     /note="highly similar to uniprot|P37012 Saccharomyces
                     cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
                     conversion from glucose-1-phosphate to glucose-6-phosphate
                     which is a key step in hexose metabolism functions as the
                     acceptor for a Glc-phosphotransferase and to YKL127W
                     uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
                     Phosphoglucomutase, minor isoform; catalyzes the
                     conversion from glucose-1-phosphate to glucose-6-
                     phosphate, which is a key step in hexose metabolism"
                     /codon_start=1
                     /product="KLTH0D04796p"
                     /protein_id="XP_002552930.1"
                     /db_xref="GeneID:8295157"
                     /db_xref="GOA:C5DGF0"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:C5DGF0"
                     /translation="MSLQIETVPTKPYNDQKPGTSGLRKKTKVFMNEPHYTENFIQAI
                     MEAIPEGSQDAVLVVGGDGRYYNNEVLQKIGEIGAANGVKKLIVGQNGLLSTPAASHI
                     IRSYPEKSTGGIILTASHNPGGPENDFGIKYNLSNGGPAPESVTNSIFEKSKQLASYK
                     TVKNFPKINLSKIGKNQEYGSLLVDVIDVTAEYVKLMKEIFDFDLIKKFIDHQRSTKG
                     FKILFDALNGITGPYGKAIFADELGLPAEEVLQNYEPKPDFGGLHPDPNLTYAHTLVE
                     RVDKEQIAFGAASDGDGDRNMIYGCGPAFVSPGDSVAIIAEYASEIPYFKKQGIYGLA
                     RSFPTSAAIDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVREKD
                     GVWAIVAWLNILAIYNREHPDSDVSIKVVLDEFWAKYGRTFFTRYDFEQVSGEAAAKV
                     LRVLEDLVVSKESAIGKLLPGNTDLTVTDCGDFSYTDLDGSVSEHQGLYAKLSNGCRF
                     VVRLSGTGSSGATIRLYLERYTDDASKYSLNVEQFMKDDIKAVLKFLKFREYLGTDEP
                     TVRT"
     gene            <439491..>441566
                     /locus_tag="KLTH0D04818g"
                     /db_xref="GeneID:8295158"
     mRNA            <439491..>441566
                     /locus_tag="KLTH0D04818g"
                     /product="KLTH0D04818p"
                     /transcript_id="XM_002552885.1"
                     /db_xref="GeneID:8295158"
     CDS             439491..441566
                     /locus_tag="KLTH0D04818g"
                     /note="similar to uniprot|P12688 Saccharomyces cerevisiae
                     or to YMR 104C, YKL126W YPK1 Serine/threonine protein
                     kinase required for receptor-mediated endocytosis involved
                     in sphingolipid-mediated and cell integrity signaling
                     pathways localized to the bud neck cytosol and plasma
                     membrane homolog of mammalian kinase SGK"
                     /codon_start=1
                     /product="KLTH0D04818p"
                     /protein_id="XP_002552931.1"
                     /db_xref="GeneID:8295158"
                     /db_xref="GOA:C5DGF1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C5DGF1"
                     /translation="MYSWKLASKFKFGRSKEEKEKEKEREKNKDKEKHGLFHHKSHRS
                     ESPYMEPPRGSVDRKETIVPSSSSIAPVRLSSDVNKSSATNSSASTGRTSMSTSGDQD
                     TVEDKNAASSFVGDKSSGKDSLIEEPRFSGIMTIKVYGGEGFMLPVSITSNVQILKKL
                     LQSGVINQASDDANVDELISSLSQLQVADPGDDENIIDGETAARYIPATITLPTSTTL
                     NPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKMDVFARIPSILLP
                     SKAWQQMNSSDPYIKDILDRINSNQDIHVGSCNLPLTLDFDSASTFRLYNHQWISLEQ
                     GNGKLNISVDYKPATNRALSIDDFDLLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKS
                     YIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPDKLYIVLAFINGGELFYHLQRE
                     GRFSLSRARFYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMK
                     GQEKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYK
                     KILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGAEEIKSHPFFSQLNWKRLWMK
                     GYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLGS
                     SMAPTKSIR"
     gene            <441811..>443730
                     /locus_tag="KLTH0D04840g"
                     /db_xref="GeneID:8295159"
     mRNA            join(<441811..442005,442087..>443730)
                     /locus_tag="KLTH0D04840g"
                     /product="KLTH0D04840p"
                     /transcript_id="XM_002552886.1"
                     /db_xref="GeneID:8295159"
     CDS             join(441811..442005,442087..443730)
                     /locus_tag="KLTH0D04840g"
                     /note="some similarities with uniprot|P36070 Saccharomyces
                     cerevisiae YKL125W RRN3 Required for transcription of rDNA
                     by RNA Polymerase I DNA-independent RNA Polymerase I
                     transcription factor"
                     /codon_start=1
                     /product="KLTH0D04840p"
                     /protein_id="XP_002552932.1"
                     /db_xref="GeneID:8295159"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="UniProtKB/TrEMBL:C5DGF2"
                     /translation="MMAIEKAAKRGADGMINSVETKKRRVEFADEVMVHDEDGEKHSN
                     QDFSAKLYRNFVLSAIEDVERNDASQINTLASQLSLPSSSPDRISPGNLSILLQTLSY
                     NISKLDTPLCTSLIQSVINFEKWWELPTATLGTYIFFIKILCSSLPKWWQDVSLPLIS
                     EFTLPVDQTVQHHEMLKYFLRTIPTCTGFIDSYIAKFFPNKNDSKRNLVNYIANVLLL
                     TDYCNELRFQSWSLVIEKVISIDVELQNELDELDDDLENNIDDELDDGEVESDEDDQN
                     LDNDSDDDSANDLDDDDLMDGQEEYNVDVTQNIKQLSSKLDAILSLITKRLSQSLTAQ
                     SIENGDGVSIFNTLISLFKSHILPTYYTRSIQYILFHVSQQQLELMDAFLVTLIDIAF
                     SPNETIEKRIKSLQYIGSFIARAKKLTNTQIIFVSSYLTSWLNRYVLEREEEVNQPGG
                     VERFKHFYAAFQALCYVFCFRHAIFRDGDTWECEIDKFFQRMVLSKFNPLKYCNENVM
                     MMFARIAQHEGVAYCFSIIENNNNERMKGIMGKSDSQGYNGVVSNWSLATRQQFIDLQ
                     SYFPYDPLFLKTYKRMMRDYYIEWSDVSREYESDESDELDELNRDL"
     gene            complement(<443978..>445681)
                     /locus_tag="KLTH0D04862g"
                     /db_xref="GeneID:8295160"
     mRNA            complement(<443978..>445681)
                     /locus_tag="KLTH0D04862g"
                     /product="KLTH0D04862p"
                     /transcript_id="XM_002552887.1"
                     /db_xref="GeneID:8295160"
     CDS             complement(443978..445681)
                     /locus_tag="KLTH0D04862g"
                     /note="similar to uniprot|Q03162 Saccharomyces cerevisiae
                     YMR100W"
                     /codon_start=1
                     /product="KLTH0D04862p"
                     /protein_id="XP_002552933.1"
                     /db_xref="GeneID:8295160"
                     /db_xref="GOA:C5DGF3"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:C5DGF3"
                     /translation="MRDSNHRCVLLNRPSVTITSAVYDRRGLDCISEIPLINSLNHLT
                     YLTSNSAKVRETVANDGALVRLVSILHDCNIPLSEISEVQLTDEITPVERIQRQRKLA
                     MVAWKWTLAFQCLVLTGTRGTEHIRKQVVSSGVIPILATVLDNYLLLEKNYDFMAGGD
                     LDFDFKRTVLDGSISFEELTSSCGDEGLVEKCRELRTPSVMQLNTDFSSLWRASLGPG
                     SNEDLEVDTYDNIAVSVPRTFIWGKIAPKADDVIWSLQLLAFISKYTHMKPYLQRVHL
                     VKSLSLRTEVSTVRKHLEQAFDISPLKISTEEEAKPVQNESDVAEEPKERTVDHNDPY
                     LIEMEAFCKNLNGSGLVFHNSRHCSSHREEFIDAPHRVIKMAKIEDKFSTKWDYDVFP
                     KVLDEGTWNHIIGTQYLNLFPLVERFTVKKENERDMTYWSSVVMRNSCRKNETTGVRQ
                     CANFACGKWEDYPKRFAKCRRCKRTKYCSRECQLQSWNFHRYWCQEVTSSSAGNGSVN
                     NGSERNTPHEATSTAGSAVENATTDIPSATNEHSAFDATGSNTDNSQHINNRNTITGE
                     T"
     gene            <445884..>446492
                     /locus_tag="KLTH0D04884g"
                     /db_xref="GeneID:8295161"
     mRNA            <445884..>446492
                     /locus_tag="KLTH0D04884g"
                     /product="KLTH0D04884p"
                     /transcript_id="XM_002552888.1"
                     /db_xref="GeneID:8295161"
     CDS             445884..446492
                     /locus_tag="KLTH0D04884g"
                     /note="similar to uniprot|P32341 Saccharomyces cerevisiae
                     YKL119C VPH2 Protein involved in vacuolar H - ATPase
                     assembly or function required for the biogenesis of a
                     functional vacuolar ATPase (V-ATPase) but not part of the
                     final enzyme complex"
                     /codon_start=1
                     /product="KLTH0D04884p"
                     /protein_id="XP_002552934.1"
                     /db_xref="GeneID:8295161"
                     /db_xref="InterPro:IPR021013"
                     /db_xref="UniProtKB/TrEMBL:C5DGF4"
                     /translation="MFGIKLNSTLTKLLERLEGNAEAQDILEKGSISMKALLAFHSEH
                     WSHVGVKELLTPLDFAFKKVPERGTAYTDEFKEHLEKLRSEQEEKDYQAMVRRDGLGA
                     MLEDREELTPAQMAKQVKEQITTVFNVLVSVVSVVFAVWYWTGSSTHMEPPTRVLLCL
                     FGGILVLVADVVVYNSYLRKIEEARVRERSKKERKTVVKTLD"
     gene            complement(<446504..>447592)
                     /locus_tag="KLTH0D04906g"
                     /db_xref="GeneID:8295162"
     mRNA            complement(<446504..>447592)
                     /locus_tag="KLTH0D04906g"
                     /product="KLTH0D04906p"
                     /transcript_id="XM_002552889.1"
                     /db_xref="GeneID:8295162"
     CDS             complement(446504..447592)
                     /locus_tag="KLTH0D04906g"
                     /note="similar to uniprot|Q03175 Saccharomyces cerevisiae
                     YMR101C SRT1 Cis-prenyltransferase involved in dolichol
                     synthesis"
                     /codon_start=1
                     /product="KLTH0D04906p"
                     /protein_id="XP_002552935.1"
                     /db_xref="GeneID:8295162"
                     /db_xref="GOA:C5DGF5"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:C5DGF5"
                     /translation="MVEHNRSSNTVDVIEKELKQTKERFKPKAPPFPYVLSPMSILEY
                     AHAQKLRLWSFILSLACVSWALLQIQMTLTNILKMGPLPEHVSFIMDGNRRYAKSLSL
                     PVKSGHEAGAITLLNLLTVCRALGVKTVSAYAFSIENFNRPQEEVDTLTSLLAEKLDE
                     VARRAQDCNSELFGLRLCVVGERSRISKELNDRISSVERMTSEGDSMMLYICFPYTSR
                     NDIYHAIYDCAETAKYHGFPAAQIDESVLTNHMMLRENSNNCDLLVRTSGHTRLSDYM
                     LWQVHQNGHVEFSSTLWPDYGFLEFFRVLLKWSFFTSVQRRRNSRRLLRLHTACHLKE
                     TLFPRAPKHVSIEDLPSPPQAISVADRS"
     gene            complement(<447820..>448797)
                     /locus_tag="KLTH0D04928g"
                     /db_xref="GeneID:8295163"
     mRNA            complement(<447820..>448797)
                     /locus_tag="KLTH0D04928g"
                     /product="KLTH0D04928p"
                     /transcript_id="XM_002552890.1"
                     /db_xref="GeneID:8295163"
     CDS             complement(447820..448797)
                     /locus_tag="KLTH0D04928g"
                     /note="highly similar to uniprot|P32332 Saccharomyces
                     cerevisiae YKL120W OAC1 Mitochondrial inner membrane
                     transporter transports oxaloacetate sulfate and
                     thiosulfate member of the mitochondrial carrier family"
                     /codon_start=1
                     /product="KLTH0D04928p"
                     /protein_id="XP_002552936.1"
                     /db_xref="GeneID:8295163"
                     /db_xref="GOA:C5DGF6"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DGF6"
                     /translation="MSKEAEISRVKTDADKPAAQKVTKTGSFIAGGLAACIAVTVTNP
                     IELVKTRMQLQGEMSAESQRIYKNPWQSLKIIFKNEGIRGLQKGLSCAYIYQIGLNGS
                     RLGFYEPIRSLLNKTFYPNQDPHKVQNVAVNVVSGASSGIIGAIMGSPLFLIKTRMQA
                     YSNAIQIGQQTHYTSIWNGLSSIYRAEGLKGLYRGVDAAILRTGAGSSVQLPIYNTAK
                     RFLLNHDIMKEGTGLHLVASTLSGIGVGVVMNPWDVILTRVYNQKGNLYKGPIDCLIK
                     TVRIEGVSALYKGFEAQLFRIAPHTILCLTFMEQTMKFVYAVEKQILGA"
     gene            complement(<449060..>451402)
                     /locus_tag="KLTH0D04950g"
                     /db_xref="GeneID:8295164"
     mRNA            complement(<449060..>451402)
                     /locus_tag="KLTH0D04950g"
                     /product="KLTH0D04950p"
                     /transcript_id="XM_002552891.1"
                     /db_xref="GeneID:8295164"
     CDS             complement(449060..451402)
                     /locus_tag="KLTH0D04950g"
                     /note="weakly similar to uniprot|Q03177 Saccharomyces
                     cerevisiae YMR102C Protein of unknown function
                     transcription is activated by paralogous transcription
                     factors Yrm1p and Yrr1p along with genes involved in
                     multidrug resistance"
                     /codon_start=1
                     /product="KLTH0D04950p"
                     /protein_id="XP_002552937.1"
                     /db_xref="GeneID:8295164"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DGF7"
                     /translation="MHGPKPEFELSGSSTEDLILSKPSSQNSSETTSESSHSNGGDTE
                     SGRRSVGGATCREFTTHIAPVQFEMSKPSFKIQDFSTRVLGPKEEAKELQKAHTASDD
                     PADPVLNNIFGRINREQFKRYLKQPAYLRVFNKQPRIKQFRRLFLAQELRLDNGDITS
                     SSNTTLSTLSENNGRAVWATKFSRDGRFLATGGKDCTLRIWKVIASPLERNDLSNSTT
                     KPQAKRISLRMPPSAATGRSNKDELDQVTAPGLMDLYAPVFHPLPYRTFQGHTQDILD
                     LDWSKNGFILTTSMDKTARLWHCDRPKALKTFEHPDFVTCAKFHPNDDRFFLSGCLDH
                     KLRLWSILDHSVSFEHYCGDIITAIDTSFGDGKYTAIGTFNGHISILYTRGLEMISTF
                     HVMESSKGRIRKSTESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFSVKNRTLLEV
                     LRGFENAHSQISAHTLSTTRKKMYVIAPSENQWVYCWKLESSAGAADLDESSNNKAHR
                     HGSIRGLLRRSLSIGSAHSSEKRSPPASDQLSGLTPSHKGKHEPIKNHHYIAFHAHHC
                     TVTTTAVAPVNTAKTLALSDDFICELTMALSEGEDDVAVMRQQHRKSLLHTKKQHQRE
                     NDLLQKRFPSMIEAIGTIFVSTDSSGVIRVFRSDISTNVRKKVLSCLKRSSTPPKSES
                     GSESNGSYMHSGLLGSTVKAATSTLTKSRALGSSPSIKSLKSVSPSNEAPTSASPQAP
                     CDLCGSTDLTRTKGDPKLRLNTQAPVYICNSCGNQLVRAS"
     gene            <451606..>452004
                     /locus_tag="KLTH0D04972g"
                     /db_xref="GeneID:8295165"
     mRNA            <451606..>452004
                     /locus_tag="KLTH0D04972g"
                     /product="KLTH0D04972p"
                     /transcript_id="XM_002552892.1"
                     /db_xref="GeneID:8295165"
     CDS             451606..452004
                     /locus_tag="KLTH0D04972g"
                     /note="weakly similar to uniprot|P32342 Saccharomyces
                     cerevisiae YKL122C SRP21 Component of the signal
                     recognition particle (SRP) ribonucleoprotein (RNP) complex
                     that functions in protein targeting to the endoplasmic
                     reticulum (ER) membrane"
                     /codon_start=1
                     /product="KLTH0D04972p"
                     /protein_id="XP_002552938.1"
                     /db_xref="GeneID:8295165"
                     /db_xref="UniProtKB/TrEMBL:C5DGF8"
                     /translation="MSVDALDSFITNSVTLLEANPSETVLSVTYNPKAKSGKVAFKTH
                     NSKLSTRFKFTTSRSKDVSRLLSALGPRGVSINNGKIEKKRTGKKVQAVGGMSTLLAN
                     VDVPEALEEPIQQAKPSKPASGKKKKNKKR"
     gene            complement(<452121..>453644)
                     /locus_tag="KLTH0D04994g"
                     /db_xref="GeneID:8295166"
     mRNA            complement(<452121..>453644)
                     /locus_tag="KLTH0D04994g"
                     /product="KLTH0D04994p"
                     /transcript_id="XM_002552893.1"
                     /db_xref="GeneID:8295166"
     CDS             complement(452121..453644)
                     /locus_tag="KLTH0D04994g"
                     /note="similar to uniprot|P32343 Saccharomyces cerevisiae
                     YKL124W SSH4 Suppressor of SHR3 confers leflunomide
                     resistance when overexpressed (putative) involved in ER
                     functions"
                     /codon_start=1
                     /product="KLTH0D04994p"
                     /protein_id="XP_002552939.1"
                     /db_xref="GeneID:8295166"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DGF9"
                     /translation="MQKLSAYSPTGFQISGDPLFDPPIGDHQDGEAISLVFLISLSVT
                     FAVLMLMLIIVAVYVTFCSTDESEYDEEVASALPNLFKKKRSGVLLDGSFLTPGQYDD
                     EQALLEQEAQELPRMSTFEVELYQRCREFQKMCPPIVKEFGTYTNINDKQFIKDRGIQ
                     SYYFLPSINDNVDQYGNFLPSFIVQDKLDVTFTKFNRSSSAVMNYPLPHNKKDAVYFE
                     VKVFKYPAKSNSIFSCGLVTCPYPYFRMPGMAQFSIAYESTGKLRMNNPFYANTLLPK
                     LQEGDVIGFGYRYKTGTILITHNGKKLMDLTHNVGIDLFIGIGAMNAAYTRSYTREGL
                     MEDCDNVSLRERILASDMDQKAPRAIHEQLENVHDSHDEDLASDEIELQVNLGQLGFV
                     YVEANVKKYAFGSVYGEIGVPPAYNGDEIKKDVVLQKGEDLPPMYPTEELAPLAETTV
                     TIREGEPSSKDLEEYENRSSTFDREDGAEEVRPLKPRSNKKKNRKKNRKRGAKRGFK"
     gene            454939..455011
                     /locus_tag="KLTH0D05016r"
                     /db_xref="GeneID:8295167"
     tRNA            454939..455011
                     /locus_tag="KLTH0D05016r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8295167"
     gene            <455340..>455918
                     /locus_tag="KLTH0D05038g"
                     /db_xref="GeneID:8295168"
     mRNA            <455340..>455918
                     /locus_tag="KLTH0D05038g"
                     /product="KLTH0D05038p"
                     /transcript_id="XM_002552894.1"
                     /db_xref="GeneID:8295168"
     CDS             455340..455918
                     /locus_tag="KLTH0D05038g"
                     /note="similar to uniprot|P28707 Saccharomyces cerevisiae
                     YKL117W"
                     /codon_start=1
                     /product="KLTH0D05038p"
                     /protein_id="XP_002552940.1"
                     /db_xref="GeneID:8295168"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:C5DGG0"
                     /translation="MSPTITPEVLWAQRSSSTDAEKNYLLVTIVIPDCSEPSLDLEST
                     HLEFKAKSPGHVGDEQEHQYHLRIDFFKEIDAKKSLGRVANGRNYFLKLYKKDLEEEY
                     WPRLTKEKLKYHYIKTDFNKWVDEDEQEEQEEEDFGFPGAGAGAGGQDAQAAALQELL
                     KGGGQGAGQQDQAAALQELLKNGGQGLGGEDA"
     gene            complement(<456032..>456922)
                     /locus_tag="KLTH0D05060g"
                     /db_xref="GeneID:8295169"
     mRNA            complement(<456032..>456922)
                     /locus_tag="KLTH0D05060g"
                     /product="KLTH0D05060p"
                     /transcript_id="XM_002552895.1"
                     /db_xref="GeneID:8295169"
     CDS             complement(456032..456922)
                     /locus_tag="KLTH0D05060g"
                     /note="highly similar to uniprot|Q03161 Saccharomyces
                     cerevisiae YMR099C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D05060p"
                     /protein_id="XP_002552941.1"
                     /db_xref="GeneID:8295169"
                     /db_xref="GOA:C5DGG1"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:C5DGG1"
                     /translation="MSVEETDTEVILTHPENSKTFVKILKYGATVYSWSLEGQEQLWL
                     SSAAKLDGSKPVRGGIPLVFPVFGKNEDDEFLSKLPQHGLARNSTWEFLGQVSANPPT
                     VQFGLGPELANPELTKLWPMDYSLILTVELGSGHLKTHIEVSNTSSSQPLKFNWLFHT
                     YLKIADIEDTLVSNLTGAKLYDQMLQESYVDRQPVVSFHEELDRIYQRVQEDRLIQVI
                     DKGHPIHTVKRHNLPDVVTWNPWVEKSKGMADFEPKSGFKEMVCVESGHVHSLLELQP
                     GQSWTAYQLLYKDELNYQVL"
     gene            complement(<457124..>458680)
                     /locus_tag="KLTH0D05082g"
                     /db_xref="GeneID:8295170"
     mRNA            complement(<457124..>458680)
                     /locus_tag="KLTH0D05082g"
                     /product="KLTH0D05082p"
                     /transcript_id="XM_002552896.1"
                     /db_xref="GeneID:8295170"
     CDS             complement(457124..458680)
                     /locus_tag="KLTH0D05082g"
                     /note="similar to uniprot|P28708 Saccharomyces cerevisiae
                     YKL116C PRR1 Protein kinase with a possible role in MAP
                     kinase signaling in the pheromone response pathway"
                     /codon_start=1
                     /product="KLTH0D05082p"
                     /protein_id="XP_002552942.1"
                     /db_xref="GeneID:8295170"
                     /db_xref="GOA:C5DGG2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DGG2"
                     /translation="MDDKSAAMYRNSAAQAPKIAQAEFPAVEERPGHSDSIEVATTPP
                     KLSTSQFGEGDMNMLPTPLVYTPCSPGSAVRSPMEQKFPSTPSSATARAKKGYGGLMP
                     IGAELLNRSHILEDRQRILSEYAPHSALAPATASSLSQRVSSLSGVELKLDAIHEYAP
                     ASQSSLTAADPAQSDSEDVLTGYSVNDTSTPLYWRKVKQIGVGNFSDVYLYEVTEQNA
                     AMPQKVAVKRVKYPEALTLSASPKSPRFREVLSRVENSLTRELEALLCVSHPCIIQFL
                     AINDPTFLNNKRPLSSRDLSRGLPPCDMVMSYCAGGDLFELASQNTLPDWLLRRIFTE
                     LTLAVKYLHENLIVHRDLKLENVLIKYPLDDILAMREQPELLHNHHLVELADFGLCRR
                     IEPEEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPSAA
                     PGKRQRRSSTAHRISRFEWRWIKMPESDSPAKEIVGNCLTRKNLRYSIQEIYKNPYVH
                     ELVPTLRFAS"
     gene            complement(<458869..>460086)
                     /locus_tag="KLTH0D05104g"
                     /db_xref="GeneID:8295171"
     mRNA            complement(<458869..>460086)
                     /locus_tag="KLTH0D05104g"
                     /product="KLTH0D05104p"
                     /transcript_id="XM_002552897.1"
                     /db_xref="GeneID:8295171"
     CDS             complement(458869..460086)
                     /locus_tag="KLTH0D05104g"
                     /note="highly similar to uniprot|P22936 Saccharomyces
                     cerevisiae YKL114C APN1 Major apurinic/apyrimidinic
                     endonuclease 3'-repair diesterase involved in repair of
                     DNA damage by oxidation and alkylating agents controls
                     spontaneous mutations"
                     /codon_start=1
                     /product="KLTH0D05104p"
                     /protein_id="XP_002552943.1"
                     /db_xref="GeneID:8295171"
                     /db_xref="GOA:C5DGG3"
                     /db_xref="InterPro:IPR001719"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="InterPro:IPR018246"
                     /db_xref="UniProtKB/TrEMBL:C5DGG3"
                     /translation="MRVSPASYHAFHPASNMYVKEFDSKKVVMLSKKNVVTHSTYSLT
                     ETVMSQFSRCSTSKYKFGAHISTAGGISNSVTNAYNIGCNAFAMFLKSPRKWVSPDYT
                     QEEIDKFKQKCKELGYNPLTDVLPHGQYFINLANPEPEKAEKSYASFIDDLKRCEQLG
                     VGLYNFHPGSSLKGNHAKQLRQLASYINKAIAETKFVKIVLENMAGTGSLVGSDLQDL
                     KDVIDMVENKDRVGVCVDTCHTFAAGYDISSKDSYDKFWQTFDKTVGFKYLSAIHLND
                     SKAPLAANRDLHEKLGQGFLGLEVFKLVANSEFLRGIPVILETPHTKDEGYGHEIKLL
                     EWLEGLDEAKDQPEFESKSKDLLSEGAKSRNEQLAKFDKKKTKATKVSKKRANNGTDI
                     SQQLSSKRAKKET"
     gene            complement(<460113..>461270)
                     /locus_tag="KLTH0D05126g"
                     /db_xref="GeneID:8295172"
     mRNA            complement(<460113..>461270)
                     /locus_tag="KLTH0D05126g"
                     /product="KLTH0D05126p"
                     /transcript_id="XM_002552898.1"
                     /db_xref="GeneID:8295172"
     CDS             complement(460113..461270)
                     /locus_tag="KLTH0D05126g"
                     /note="similar to uniprot|P26793 Saccharomyces cerevisiae
                     YKL113C RAD27 5' to 3' exonuclease 5' flap endonuclease
                     required for Okazaki fragment processing and maturation as
                     well as for long-patch base-excision repair member of the
                     S. pombe RAD2/FEN1 family"
                     /codon_start=1
                     /product="KLTH0D05126p"
                     /protein_id="XP_002552944.1"
                     /db_xref="GeneID:8295172"
                     /db_xref="GOA:C5DGG4"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /translation="MGIKGLNAIISEHVPSAVRKSEIKNFFGRKVAIDASMSLYQFLI
                     AVRQQDGVQLASESGETTSHLMGIFYRTLRMIDNGIKPCYVFDGKPPVLKSHELSKRS
                     ARRATTEEKLKEAVEEAEKLKHERRLVKVTPEHNEEAKKLLRLMGLPYVEAPCEAEAQ
                     CAELAKAGKVYAAASEDMDTLCYRTPFLLRHLTFSEAKKEPIHEINTEILLQGLELSI
                     EQFIDLGIMLGCDYCDSIRGVGPVTALKLIKEHKTLENIVEYIESGQANNKWKVPENW
                     PFKEARQLFLDPDVVKGSEVDLKWSEPQEQELVDFMCKEKGFNEERIRSGIKRLQKGL
                     KTGVQGRLDGFFKVKPKNKEQLAAANAKAKSTKAGKQATKGKVGKPGRPRK"
     gene            <462673..>464220
                     /locus_tag="KLTH0D05148g"
                     /db_xref="GeneID:8295173"
     mRNA            <462673..>464220
                     /locus_tag="KLTH0D05148g"
                     /product="KLTH0D05148p"
                     /transcript_id="XM_002552899.1"
                     /db_xref="GeneID:8295173"
     CDS             462673..464220
                     /locus_tag="KLTH0D05148g"
                     /note="some similarities with uniprot|P14164 Saccharomyces
                     cerevisiae YKL112W ABF1 DNA binding protein with possible
                     chromatin-reorganizing activity involved in
                     transcriptional activation gene silencing and DNA
                     replication and repair"
                     /codon_start=1
                     /product="KLTH0D05148p"
                     /protein_id="XP_002552945.1"
                     /db_xref="GeneID:8295173"
                     /db_xref="GOA:C5DGG5"
                     /db_xref="InterPro:IPR006774"
                     /db_xref="UniProtKB/TrEMBL:C5DGG5"
                     /translation="MSLYEYKHPIINKELATGPDAASRKQFPTLEAWYDVVNDYEFQA
                     RCPIILKNSHRNKHFTFACHLKSCPFKVLLSYSGHNKDGPFEQHGGPGGAEHEVGGEH
                     GHGHPGASAGSPGAHNGGLKDEHDDVSAAIAAAVAAVTDGSNGNAAGGNGAGGNGLGG
                     QVGAGQAPGMGARSGSGSGPASGSPSDHNGSGDDSLLDPDDPQQMSSVRGPFTVTKID
                     PYHNHPLESNLSLSKFVLTKVPRILQNDLKFDSILESLCNDEDNTVAKFRVSQYVEES
                     GILDILKERYGLTDQDLDKKLLSHIARRITTYKARFVLKKKKNGTYGVPSSSMSAAAA
                     AAAAINANGGAGAGSGPHDQTDELGGKKRGYGAGHHHHNGVNGDVPGDHEDELEGRKR
                     TRTNKISTAVKMGTRSSLVNDPALAQLDDVNDSEDNKPPEDLAEQLRLLSSHLKEVEQ
                     QQQQQQQQQQHQEQQHHQHHQHHQHQDDHQLHQHHQQHSQMAGHHHSPGKEDIPDENI
                     QPELRGQ"
     gene            <464410..>466272
                     /locus_tag="KLTH0D05170g"
                     /db_xref="GeneID:8295174"
     mRNA            <464410..>466272
                     /locus_tag="KLTH0D05170g"
                     /product="KLTH0D05170p"
                     /transcript_id="XM_002552900.1"
                     /db_xref="GeneID:8295174"
     CDS             464410..466272
                     /locus_tag="KLTH0D05170g"
                     /note="weakly similar to uniprot|Q03153 Saccharomyces
                     cerevisiae YMR098C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D05170p"
                     /protein_id="XP_002552946.1"
                     /db_xref="GeneID:8295174"
                     /db_xref="GOA:C5DGG6"
                     /db_xref="InterPro:IPR025210"
                     /db_xref="InterPro:IPR025656"
                     /translation="MIERLILFNFQSDKNTKHTRVRNMLLRRAAAALPARKTPLHCYR
                     RLGGSYRALSGSLLLRDEEKRLPHRVQDERDEAKADTDLAADGDSAATKPWYLNIVER
                     PAQNMPLHQQEIVFPANSPKSLETIATFLRDKLGLSDVLIFDLRDSQDEQVTAASKIS
                     DFMVMATAKSGRHGHKSFIELNTLLKQEFKTVGQVEGNISANELRRRQKRLARHTNLS
                     KSMGSRTATTRSGSNLESWYMIDCRLDNIFVNILTENKRQDLNLEELYAPPDQKHLYR
                     REAPAEDVAPKEGDDNVLAGLKRLAARNQRRYFTTVPARVQIIDALSRQDFDLVLNVV
                     SASKMDSLDILKAANQTLRSMPYGVKIEGESWITFLDEVWPLAPYSQDFWSTRLELFK
                     LLNCAAPGQVNVDRVFTGYLKFKLASGESLTKSDLVEFLQLVETNLSENSHVDYEDLV
                     AKNKCVLEALKLYKGLDPRLILDSEVMCLLLSTLSITQSGSTSTLRAFYEMVEFASRE
                     FSQEPPVPVTATVLRILADKQDYARILRFWEKSIASSPEKDHRPWPLFLDTVASTGDQ
                     EFAKKVIRDGHLLWIKRNGVKASPELREAIERLFAVADPAEVAFKDVKEFLTVE"
     gene            complement(<466301..>467233)
                     /locus_tag="KLTH0D05192g"
                     /db_xref="GeneID:8295175"
     mRNA            complement(<466301..>467233)
                     /locus_tag="KLTH0D05192g"
                     /product="KLTH0D05192p"
                     /transcript_id="XM_002552901.1"
                     /db_xref="GeneID:8295175"
     CDS             complement(466301..467233)
                     /locus_tag="KLTH0D05192g"
                     /note="similar to uniprot|P34253 Saccharomyces cerevisiae
                     YKL110C KTI12 Protein associated with the RNA polymerase
                     II Elongator complex involved in sensitivity to G1 arrest
                     induced by Kluyveromyces lactis toxin zymocin"
                     /codon_start=1
                     /product="KLTH0D05192p"
                     /protein_id="XP_002552947.1"
                     /db_xref="GeneID:8295175"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGG7"
                     /translation="MPLVLFTGFPSSGKTSKAKELVELLSAKIEQEPELSKYSIVCHS
                     DESLGIQHTDYVTSQDERKLRSKIMSAVKRDLSRHKIVVVDSLNYIKGFRYQLHCEVK
                     NLMTTYCLVHVMSPSAKILEWNESTADGRVPWPTDLLNQLIQRYEEPNPQTRWDSPLI
                     PVLASEDSLQSFAEPIYKALFPQLYRSDNDREADKLLNSLKPNNATILKPATQTNALQ
                     VLDSETTAVVKKVMSALQSNVVAGVSRIIVSDVQDINDERCMYVEMPPQGVTVAQLQR
                     IRRQFVAMNRLRSLEKHRIAPLFVDYLNKNLRDM"
     gene            <467366..>468493
                     /locus_tag="KLTH0D05214g"
                     /db_xref="GeneID:8295176"
     mRNA            <467366..>468493
                     /locus_tag="KLTH0D05214g"
                     /product="KLTH0D05214p"
                     /transcript_id="XM_002552902.1"
                     /db_xref="GeneID:8295176"
     CDS             467366..468493
                     /locus_tag="KLTH0D05214g"
                     /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
                     YMR097C MTG1 Peripheral GTPase of the mitochondrial inner
                     membrane essential for respiratory competence likely
                     functions in assembly of the large ribosomal subunit has
                     homologs in plants and animals"
                     /codon_start=1
                     /product="KLTH0D05214p"
                     /protein_id="XP_002552948.1"
                     /db_xref="GeneID:8295176"
                     /db_xref="GOA:C5DGG8"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGG8"
                     /translation="MFKRCYTTFVPRFKFPEYRIPLTDFKGHQVRALQRFQQLLPQLN
                     LLLELRDSRAPISTRNVIFDDLVARGRGEKTQRLVLYTKSDLCPKETIDKLRNWHGEM
                     GDEFMTLDCRSAREVKSLVKLLEWKYDRVVEKMVGQAAGEGGGLPLGYRVLVAGMPNV
                     GKSTLVNSLRFVGAARTGNSSESVHGSVAHRRRKVAKTGGQAGVTRATSECIRIADHR
                     GGIYLYDTPGVSLPGRVTTREKMLSLSQCGCVKSNLVDPVIQADYLLYLMNLQSPAVY
                     EQYTKGVPTNNIYKLLGGVRRTTGIRDDNGAAIHWVDKWRQGPRRGAHRVSFDVETLL
                     DDTSFSYRELVSRELELLGPWSVAPSKPSAKAKNSNQLFDL"
     gene            <469109..>470785
                     /locus_tag="KLTH0D05236g"
                     /db_xref="GeneID:8295177"
     mRNA            <469109..>470785
                     /locus_tag="KLTH0D05236g"
                     /product="KLTH0D05236p"
                     /transcript_id="XM_002552903.1"
                     /db_xref="GeneID:8295177"
     CDS             469109..470785
                     /locus_tag="KLTH0D05236g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D05236p"
                     /protein_id="XP_002552949.1"
                     /db_xref="GeneID:8295177"
                     /db_xref="GOA:C5DGG9"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="UniProtKB/TrEMBL:C5DGG9"
                     /translation="MPLKHLPIQPATVSIAPNPHPHAGTRDARKPGGAGLVIRTSRQW
                     VLPPRPKPGRKPSADPAAGGRAGAHKTTTAAAPAKPELKPIQQVQQSASAQSALSGQS
                     ATGTASATSRRSSAAPSTAASTTSTPVTAPAAARRASPAPPVSPHSQDPGLAPQPKQR
                     SSVAGTATVSAPATSTATAAAKKPTKTALKKEIQQLKLENFKLKQELGQLAGNLQDLK
                     HRYSQCDTSAKACPTFPKKRSFLDSLVDAEFDTTDSFLKFEDDDEDTGHPLIQGVCMK
                     PTMSFSSQYSSRTNLTDDEDPGFSSSTPSSLFSAELQRSVTNTSFAGGSSAGGSGSGG
                     CGNASGLATSYHCMHSSASATSPHHHTSSPCNVAGVKLAAASIDTAKFLDDYEQSVFQ
                     NKYRHLLEQDTRAKSVVTTASAKDQLYAAATASVMTPTFTGDLHLDAIKEEDLNFKLD
                     HDFGNDDISILNFLEDNAPDGGPATTTTATAVTDHIPPWVVKEEEQAADINLFQDFDT
                     SPTLPKPDFRIPPSLEELMGDAEPAERHLDNEIKREDDDSLLKMDVFEFA"
     gene            complement(<471090..>471977)
                     /locus_tag="KLTH0D05258g"
                     /db_xref="GeneID:8295178"
     mRNA            complement(<471090..>471977)
                     /locus_tag="KLTH0D05258g"
                     /product="KLTH0D05258p"
                     /transcript_id="XM_002552904.1"
                     /db_xref="GeneID:8295178"
     CDS             complement(471090..471977)
                     /locus_tag="KLTH0D05258g"
                     /note="highly similar to uniprot|P43545 Saccharomyces
                     cerevisiae YFL059W SNZ3 Member of a stationary
                     phase-induced gene family transcription of SNZ2 is induced
                     prior to diauxic shift and also in the absence of thiamin
                     in a Thi2p-dependent manner forms a coregulated gene pair
                     with SNO3 and uniprot|P53824 Saccharomyces cerevisiae
                     YNL333W SNZ2 and YMR096W uniprot|Q03148 Saccharomyces
                     cerevisiae YMR096W SNZ1"
                     /codon_start=1
                     /product="KLTH0D05258p"
                     /protein_id="XP_002552950.1"
                     /db_xref="GeneID:8295178"
                     /db_xref="GOA:C5DGH0"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DGH0"
                     /translation="MSEFKVKAGLAQMLKGGVIMDVVNAEQAVIAERAGACAVMALER
                     IPADMRKSGQVCRMSDPKMVREIMAAVSIPVMAKVRIGHTVEAQILQALQIDYIDESE
                     VLTPADKQNHIRKSEFTVPYVCGAKNLGEALRRISEGAAMIRTKGEAGTGDVSEAVKH
                     ITQIRAEIAWAKENLRTAEELEAHAKELRVPVELLKDVLSRGKLPVVNFAAGGVATPA
                     DAALLMQLGCDGVFVGSGIFKSSNPDKLARAIVQATTHYEDPMKLLEVSTDLGDLMAG
                     VSIDSINKGNGIRLSEVGW"
     gene            <472544..>473308
                     /locus_tag="KLTH0D05280g"
                     /db_xref="GeneID:8295179"
     mRNA            <472544..>473308
                     /locus_tag="KLTH0D05280g"
                     /product="KLTH0D05280p"
                     /transcript_id="XM_002552905.1"
                     /db_xref="GeneID:8295179"
     CDS             472544..473308
                     /locus_tag="KLTH0D05280g"
                     /note="similar to uniprot|P43544 Saccharomyces cerevisiae
                     YFL060C SNO3 Protein of unknown function nearly identical
                     to Sno2p expression is induced before the diauxic shift
                     and also in the absence of thiamin and uniprot|P53823
                     Saccharomyces cerevisiae YNL334C SNO2 and uniprot|Q03144
                     Saccharomyces cerevisiae YMR095C SNO1"
                     /codon_start=1
                     /product="KLTH0D05280p"
                     /protein_id="XP_002552951.1"
                     /db_xref="GeneID:8295179"
                     /db_xref="GOA:C5DGH1"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR021196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DGH1"
                     /translation="MSRVKSSIASYETKCVTSDANNIAHNGKSRTVGVLALQGAFAEH
                     VEYLEACIAQHGYPVHVMPVRTAAQLERCDALVIPGGESTAMTQIASRMGLHEALARF
                     VQDPRRSVWGTCAGLILLAREAADAAPAAAPQRPAALVEPLKALEVAVRRNAFGRQAQ
                     SFVATCDFSAFLGPSETQGFPAVFIRAPVIDHVIDPERVEVLHRLAGADGAPGTGPIV
                     AVRQGRILGTSFHPELADDTRFHDWFLRDFVLGDHK"
     gene            complement(<473487..>474623)
                     /locus_tag="KLTH0D05302g"
                     /db_xref="GeneID:8295180"
     mRNA            complement(<473487..>474623)
                     /locus_tag="KLTH0D05302g"
                     /product="KLTH0D05302p"
                     /transcript_id="XM_002552906.1"
                     /db_xref="GeneID:8295180"
     CDS             complement(473487..474623)
                     /locus_tag="KLTH0D05302g"
                     /note="weakly similar to uniprot|P35203 Saccharomyces
                     cerevisiae YMR094W CTF13 Subunit of the CBF3 complex which
                     binds to the CDE III element of centromeres bending the
                     DNA upon binding and may be involved in sister chromatid
                     cohesion during mitosis"
                     /codon_start=1
                     /product="KLTH0D05302p"
                     /protein_id="XP_002552952.1"
                     /db_xref="GeneID:8295180"
                     /db_xref="UniProtKB/TrEMBL:C5DGH2"
                     /translation="MNGQLTQLRPPTNYELFAEAYPVYKVNKKRKRNRELWTKLHKFV
                     ELFEYLPGFVDLWLEYMECLRYDSITLDYMRMNRELDGKLTELEWIVVGSEAKLAMFS
                     REGVLQVQYQIKEYHKFIDSEFRPRVTMNTAHLDEGAEAPSVVRALQKLELLDLVNSV
                     VFYQDEDSASEETILQMVANLEALRGLESVRVVGQMLFERVVNFHGVRDHPGRTIGYV
                     VRKRVSQLLVERCASIGGKRNIADFTRWDHVSRIKLSKVRELDLTRTMLPLGCRWLRL
                     ENIDKLKWWEQRTVEAELPESCLVCSNPPRAGEPAVWQVDRAAMGEEVLLRCQALLWE
                     IYGRLSCLQLINVREIDRAPVVPRAWRGARFYCWRSMVSRITFV"
     gene            <474688..>475833
                     /locus_tag="KLTH0D05324g"
                     /db_xref="GeneID:8295181"
     mRNA            <474688..>475833
                     /locus_tag="KLTH0D05324g"
                     /product="KLTH0D05324p"
                     /transcript_id="XM_002552907.1"
                     /db_xref="GeneID:8295181"
     CDS             474688..475833
                     /locus_tag="KLTH0D05324g"
                     /note="weakly similar to uniprot|P34252 Saccharomyces
                     cerevisiae YKL108W SLD2 Protein required for DNA
                     replication phosphorylated in S phase by S-phase
                     cyclin-dependent kinases (Cdks) phosphorylation is
                     essential for DNA replication and for complex formation
                     with Dpb11p potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0D05324p"
                     /protein_id="XP_002552953.1"
                     /db_xref="GeneID:8295181"
                     /db_xref="InterPro:IPR021110"
                     /db_xref="UniProtKB/TrEMBL:C5DGH3"
                     /translation="MFPNLTLLRANTSLDINKPKFHDFSDELTKNIINRLNMDMGQLK
                     LELKRFEKQFQRKYKRLPARDDVRALPEIKEKYKQYSAFQLARQRKDAAPNVGATPRR
                     YEGGTPRRHEEVELGPTPQIYGKAISLFEMKLSPLKPVTVVSPQASSHSPQAVTTEVH
                     QVTTAEIHQFKSQPDLSLTPKRSPKKTTYGPNSPMKFDNVQLSVHTPRRNLRALLDDS
                     VNDTTGSPSPIIKRPPGKPLRQILEEHEKLMEDLEEMSDEEVVRANVKDIFQDDSDAT
                     EDEETDEAMLIKKPKRKHILRPAKNALAAQQPFQVNIHEEMERLKQQAASGIDGTIPV
                     KKPASDAKASNPKTRRGNRKYNLVSNNFRRLKLPKAKGKGGKRWGRR"
     gene            complement(<475917..>477440)
                     /locus_tag="KLTH0D05346g"
                     /db_xref="GeneID:8295182"
     mRNA            complement(<475917..>477440)
                     /locus_tag="KLTH0D05346g"
                     /product="KLTH0D05346p"
                     /transcript_id="XM_002552908.1"
                     /db_xref="GeneID:8295182"
     CDS             complement(475917..477440)
                     /locus_tag="KLTH0D05346g"
                     /note="highly similar to uniprot|Q04305 Saccharomyces
                     cerevisiae YMR093W UTP15 Nucleolar protein component of
                     the small subunit (SSU) processome containing the U3
                     snoRNA that is involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="KLTH0D05346p"
                     /protein_id="XP_002552954.1"
                     /db_xref="GeneID:8295182"
                     /db_xref="GOA:C5DGH4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018983"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DGH4"
                     /translation="MSSSRPRATLVRAPVLPEQTTPEQRYWRSYGSTQLVKEHNSVTS
                     ISFNPTHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDAT
                     GRVSIYDSYNPRTQLVSIAASSHPTHVAKFHPADSRTLVTASDDRVVRVWDITQAQEP
                     QVELTGAADYVRSVCMVPQAPHLVVTGSYDGFVRLFDTRSNEAATTLVQGMPVEDVIA
                     VSPTQLVSCGGPKFKVWDLTAQRQLLERVNFAKTVTCLDHVELMEDSPMSSTLVASSL
                     DGHVKVFDPLDGYKVKFGWKFSSPVLSCAVSPGNAQGNKHLVAGLSSGLLAIRTKRRA
                     EKSEKIDIEKVAKSSNFQRMMRGSEYAGDQEHIIHNDKTRPQRKLRAFERHMNQFKWA
                     EALDAAFVSGMAKELTLTALHELRRRGKIRVALIGRDESSLEPLLNWCLRGIEDVRSA
                     TVVADWVAVVLELYGDLIAKSSVLEEMIVALKDKVKQEVHRAEEAQKIEGMLQLLVS"
     gene            <479606..>481438
                     /locus_tag="KLTH0D05368g"
                     /db_xref="GeneID:8295183"
     mRNA            <479606..>481438
                     /locus_tag="KLTH0D05368g"
                     /product="KLTH0D05368p"
                     /transcript_id="XM_002552909.1"
                     /db_xref="GeneID:8295183"
     CDS             479606..481438
                     /locus_tag="KLTH0D05368g"
                     /note="similar to uniprot|P46680 Saccharomyces cerevisiae
                     YMR092C AIP1 Actin cortical patch component probable
                     binding site on actin lies on front surface of subdomains
                     3 and 4"
                     /codon_start=1
                     /product="KLTH0D05368p"
                     /protein_id="XP_002552955.1"
                     /db_xref="GeneID:8295183"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DGH5"
                     /translation="MANLDLKTVFPPVPAAERNFATKISFNPQIKCVAYGCGKAVYVR
                     SLDDDFCVQFIGHGTAKVTVVRFSPAKGSQYLCSGDEHGRVMVWDWTRDENGQVSTAL
                     KSEFQVLAGPITDISWDMEARRLCVVGEGRDKFGAFISWDTGNSLGELSGHSQRVNAC
                     HIKQSRPMRCFTVGDDGACVFFQGPPFRFSGSDRTHHDQGKFIRDVKFSPGPGAYAVS
                     VGSDRKIVCFDGKSGEFVKYIEDPTDPVQGGLYAVDWIDEGDSSKKFVTASADAAVRM
                     WDVESGKCVQKWTLEPTLPNQQVGIATISETQVVSVSLDGSLNIFQVGQKSPVKRIVG
                     HNKTITALATSPLVSGSYDGRIIEWSSDPNSAKMLNYHSNLVVAIENMNHTATTSWDS
                     TFQIDGKVCCTFSSQPKVAASHEGVKAVVTLDNKLQILDCENGNILSSRELSGNASSV
                     GLGKQFIAVGYEQSNDIEVFKLSDLSVSFTLTNGLRATPSCLSLSPSEKYLAAGDVMG
                     KILLFDLETKGVKTSRWAFHTGRINGMSWRPTEKGSEEEEEDLIATASLDTHVFVYSL
                     KRPMKSIKHLNAHKDGATCVAWDGPSTLYSAGADSCIREWHLTL"
     gene            <481640..>482977
                     /locus_tag="KLTH0D05390g"
                     /db_xref="GeneID:8295184"
     mRNA            <481640..>482977
                     /locus_tag="KLTH0D05390g"
                     /product="KLTH0D05390p"
                     /transcript_id="XM_002552910.1"
                     /db_xref="GeneID:8295184"
     CDS             481640..482977
                     /locus_tag="KLTH0D05390g"
                     /note="similar to uniprot|P32832 Saccharomyces cerevisiae
                     YMR091C NPL6 Nuclear protein that may have a role in
                     nuclear protein import"
                     /codon_start=1
                     /product="KLTH0D05390p"
                     /protein_id="XP_002552956.1"
                     /db_xref="GeneID:8295184"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:C5DGH6"
                     /translation="MSIDSPSYEGESPVGRRSTSVSERPDYTIEDDGIELKEDDKDED
                     YQEEAAEEEEEANGDGEADGEASGNEEKAPPVTESFPKVHRLPAQPRRGRPPKRKNVA
                     DNNLTAVDDSRNSSNSSMSGHLKRPHLSFPVDENGEPLPVVNDEYALPDDPEGETKIN
                     RDGDLLGGRQFLVRTFTLSSRGERKYMLSTEPARAVGFRDSYLFFQYHPNLYKLIISQ
                     EERNDLIDRGVIPYSYRSRTIALVTARAVFKEFGAKIIVDGKNITDDYYVGRLREEGR
                     VVEGTYAREPTNKLMGRSANGLNIPNVSVNPAKNAVEFFDRRNHNIAPGSNISSTNWL
                     YQHAAACSRFNSDLFYDRERALLIEHQGLRDPYTNTLHLPQSTQPTQVLRYVKKPIEF
                     SDKKVIYETVIEDKDLTRRNIGLANVPVEVFEDVVDDDVKQAILEQQRFEQNI"
     gene            <483268..>485709
                     /locus_tag="KLTH0D05412g"
                     /db_xref="GeneID:8295185"
     mRNA            <483268..>485709
                     /locus_tag="KLTH0D05412g"
                     /product="KLTH0D05412p"
                     /transcript_id="XM_002552911.1"
                     /db_xref="GeneID:8295185"
     CDS             483268..485709
                     /locus_tag="KLTH0D05412g"
                     /note="similar to uniprot|P40341 Saccharomyces cerevisiae
                     YMR089C YTA12 Component with Afg3p of the mitochondrial
                     inner membrane m-AAA protease that mediates degradation of
                     misfolded or unassembled proteins and is also required for
                     correct assembly of mitochondrial enzyme complexes"
                     /codon_start=1
                     /product="KLTH0D05412p"
                     /protein_id="XP_002552957.1"
                     /db_xref="GeneID:8295185"
                     /db_xref="GOA:C5DGH7"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGH7"
                     /translation="MSTLLRPYSRLLWARLRCTRAFTSPRFTPMYKIARLHTNPSLFQ
                     KPPSDKGSNKDANDEDLENVRREVERYIEEAKNDKSVDWEQRKKRIDEGIARLEETIL
                     RQQNKHHDEPKEQSGREAEPSESKEEGPSEFEKKQAFEQNKKLNDRKKAEEEKLSKIM
                     NDPNARVLAVNIGFLEIGVLLFLLSFLLNRLYNTEEQREITWQEFRTKLLAKGYVAKL
                     VVVNKSFVKVVLNENGKNHPEHNGHDFYFFTIGSVESFEHKLQRAQEEIGIAEDFKTP
                     VVYVQEGNWAKAMYQILPTALMIGGLIWITKRSASGAGGGGPGGIFSVGKSKAKRFNK
                     DTDVKVTFKDVAGCDEAKEEIMEFVSFLKEPSRYEKMGAQIPRGAILSGPPGTGKTLI
                     AKATAGEAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKA
                     RQKGNFSGANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRH
                     INIDRPELEGRKQIFQVHLAKVKLAGSMEDLKNRLAALTPGFSGADISNVCNEAALTA
                     ARNECTSVKLEHFEQAIERVIGGVERKSKLLSPEEKKIVAYHEAGHAVCGWYLEFADP
                     LLKVSIIPRGQGALGYAQYLPGDVYLLSEQQLKDRMTMALAGRVSEELHFPSVTSGAS
                     DDFQKVTRMATAMVTELGMSDKIGWLNYQKKSESDLTKPFSEETAAIVDAEVFRLVQE
                     CHDRCTALLKEKAEDVEKITQLLLEKEVLTREDMIRLLGKRPFPERNDAFDKYLNESE
                     TKRLRKNEADQGMSS"
     gene            <486319..>488049
                     /locus_tag="KLTH0D05434g"
                     /db_xref="GeneID:8295186"
     mRNA            <486319..>488049
                     /locus_tag="KLTH0D05434g"
                     /product="KLTH0D05434p"
                     /transcript_id="XM_002552912.1"
                     /db_xref="GeneID:8295186"
     CDS             486319..488049
                     /locus_tag="KLTH0D05434g"
                     /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
                     YMR088C VBA1 Permease of basic amino acids in the vacuolar
                     membrane"
                     /codon_start=1
                     /product="KLTH0D05434p"
                     /protein_id="XP_002552958.1"
                     /db_xref="GeneID:8295186"
                     /db_xref="GOA:C5DGH8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DGH8"
                     /translation="MSGSPPGEDTALLGSISEENECDVGLEREYHEHNLALPKIPILV
                     SLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVA
                     TGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTA
                     KERGMYQGYANIVFGSGQLLGAPLGGLLITTIGWRAIFAIQVPMALFCMFLTGRNVNI
                     KLAHLPSRNERFTLKNLSRLDLLGSCTLVLSISGLLFLFSTSMNRTWISAFTIVTFAI
                     FIYNERFWAKERIIPFDLLCGTSGITSLLTVLSSFIMFGDVFRSPIYLQIVQNVSLAK
                     SGIFILFGSVACAATSVLTGWIIRRTTMDLVKCTYLIVLVMIFLQLVGTASNAILIAN
                     LIPNNTTYADKDVAIKVALSAKGFTWKVVYVFSTVLNSFGYGGVLVAVLVSIVFTVPK
                     SQQATLTGVFYLWRSIGNVLGTSITLALYDLILKSKLRVFMEAHGLSKSYSKLVRDSG
                     YLRNHFSGETLAELLGVYNESFLWSFGPNIVVGLVAVILAYVLVRKYRPLEQQGVHLA
                     AGERSDACKH"
     gene            complement(<487952..>488734)
                     /locus_tag="KLTH0D05456g"
                     /db_xref="GeneID:8295187"
     mRNA            complement(<487952..>488734)
                     /locus_tag="KLTH0D05456g"
                     /product="KLTH0D05456p"
                     /transcript_id="XM_002552913.1"
                     /db_xref="GeneID:8295187"
     CDS             complement(487952..488734)
                     /locus_tag="KLTH0D05456g"
                     /note="similar to uniprot|Q04299 Saccharomyces cerevisiae
                     YMR087W Putative ADP-ribose-1''-monophosphatase that
                     converts ADP-ribose-1''-monophosphate to ADP-ribose may
                     have a role in tRNA splicing contains an A1pp domain"
                     /codon_start=1
                     /product="KLTH0D05456p"
                     /protein_id="XP_002552959.1"
                     /db_xref="GeneID:8295187"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="UniProtKB/TrEMBL:C5DGH9"
                     /translation="MKVILLDKNRALVSAWKKTLDGFKHVSFHIGTLEDLPQKVLGTN
                     AAVVSPGNSFGFLGGGFDLAIQSFFGGKQFEKFFRKRIGEFYKPVGETTIVDLDHWAR
                     NGIRYIVHIPTVVAPTRKVFDTEHPVETGYQLVFNAMWSALVRAPKNVETLIVPGLGT
                     GYLGIPKAVCSKAMAFALNLFFANETMSVELRNVLIMHFLGFRYEGFFPADYKEECAK
                     LGIELDKLKHFNVCKHPIAHLLPNEHLAAQEGDTSEPIHKPV"
     gene            <488881..>490146
                     /locus_tag="KLTH0D05478g"
                     /db_xref="GeneID:8295188"
     mRNA            <488881..>490146
                     /locus_tag="KLTH0D05478g"
                     /product="KLTH0D05478p"
                     /transcript_id="XM_002552914.1"
                     /db_xref="GeneID:8295188"
     CDS             488881..490146
                     /locus_tag="KLTH0D05478g"
                     /note="similar to uniprot|Q01802 Saccharomyces cerevisiae
                     YKL106W AAT1 Mitochondrial aspartate aminotransferase
                     catalyzes the conversion of oxaloacetate to aspartate in
                     aspartate and asparagine biosynthesis"
                     /codon_start=1
                     /product="KLTH0D05478p"
                     /protein_id="XP_002552960.1"
                     /db_xref="GeneID:8295188"
                     /db_xref="GOA:C5DGI0"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DGI0"
                     /translation="MLKRQLHKVPAAIYKIPRAPPDKILGLTEEFNKDKNPNKTNLTV
                     GIYKDNWGHVTTFPSVARAQMVLDQSFEMNTDLSYLPIEGCPDFQSNVLQFLYKESCP
                     EGAEFLSKNRISFVQTLSGTGALAVASKLLSLFMSKAVWIPNPSWPNHANVFQNNGFK
                     RINYYTYYRDGGLDVDSWLQDLEQAVRDGDGSPQCIVLHACCHNPTGVDPSLEQWRTI
                     LDKINELNLIPIIDMAYQGLDTGDLHKDAYLLRMSLDEERYQWPNGLFLCQSFAKNMG
                     LYGERVGSLSVVTPADTELKLNIDSQLKKIVRGMYSSPPGYGSRVANVVLSNPELKKT
                     WFKDVQNMASRLQYVRAELGKRLDWPLLNNTRANHGMFLYTGLDPSKVDQLRRNHSVY
                     LVQDGRLSLSGLNDSNLDYVCDALKKVSE"
     gene            complement(<490531..>492828)
                     /locus_tag="KLTH0D05500g"
                     /db_xref="GeneID:8295189"
     mRNA            complement(<490531..>492828)
                     /locus_tag="KLTH0D05500g"
                     /product="KLTH0D05500p"
                     /transcript_id="XM_002552915.1"
                     /db_xref="GeneID:8295189"
     CDS             complement(490531..492828)
                     /locus_tag="KLTH0D05500g"
                     /note="weakly similar to uniprot|Q04279 Saccharomyces
                     cerevisiae YMR086W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery"
                     /codon_start=1
                     /product="KLTH0D05500p"
                     /protein_id="XP_002552961.1"
                     /db_xref="GeneID:8295189"
                     /db_xref="UniProtKB/TrEMBL:C5DGI1"
                     /translation="MFHSRRSRESRAIDSEALAAASAIGRALDSKGTKVNAEKLPRYN
                     SLSRSNSMVRAASISSRNNSLRTRRDSRRSSSLQLKGPRVRDSIDESEFYDAEDTFHA
                     FGGAQTQTKPVTVKRYVPGPSGLKLIEVPISEVQKPPSRNSSMNRRSASVHSGLSVRN
                     NSLGRKTSLNSHASQKQKSSAPVTQKQKKEPMIRRSEPPKNNKPLVEQSLKEETDEQL
                     QLDRQNKEVVNPIELTPPSKKAAPEVSILRLREKQVNIVTKTVDSGDLNETKQPPTVL
                     ISPPNEDISETQNHADLNDASPYPTEEEALKQATVSSEPAPRSGIRGKENESGKENTG
                     KTVEDVIKEESNASSRNEANSPTQSASAEEGGGTNGNSMAKYIRSANQYLNKGHKKVL
                     TSAQESNAGGLEQQASSQITGNGGGEMAPLNKVPSPMKPALKKTASDNSMRNPYKENF
                     GSKAEEAYLSLATAENTRLNAQMSDEHSRRQPPVRKTRPSSMVTNATAVQKNIPAVTK
                     PKHMSMQTPLRSEIRPPARSTMRPESIRQDKKIKPKSRTRPQQTINDKRAFFPPEPPQ
                     KRSSFEKIRPNETHMGFKKLSLRDEVSEEANYGPVVGENFHNDANSISTGRDSSSQIR
                     SQASLPASNSGWKSRFHDSDSEDEYSPISTVSPAKPTAKPGVRNGGFSLRNKKDSGFA
                     PPQPNFVQSSTAPNSKHNTPNKKISTLSLRSVSNKSDMSPAKGNNNLSQRFFSEQLSP
                     SAEEGDTKKKSSFGKKLKKIFGRKK"
     gene            complement(<493225..>495330)
                     /locus_tag="KLTH0D05522g"
                     /db_xref="GeneID:8295190"
     mRNA            complement(<493225..>495330)
                     /locus_tag="KLTH0D05522g"
                     /product="KLTH0D05522p"
                     /transcript_id="XM_002552916.1"
                     /db_xref="GeneID:8295190"
     CDS             complement(493225..495330)
                     /locus_tag="KLTH0D05522g"
                     /note="highly similar to uniprot|P14742 Saccharomyces
                     cerevisiae YKL104C GFA1 Glutamine-fructose-6-phosphate
                     amidotransferase catalyzes the formation of
                     glucosamine-6-P and glutamate from fructose-6-P and
                     glutamine in the first step of chitin biosynthesis"
                     /codon_start=1
                     /product="KLTH0D05522p"
                     /protein_id="XP_002552962.1"
                     /db_xref="GeneID:8295190"
                     /db_xref="GOA:C5DGI2"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DGI2"
                     /translation="MCGIFGYCNYLVEKSRGDVIDTLVEGLQRLEYRGYDSTGIAIDG
                     DEPDSTLIYKQIGKVAALEKEIEAEKPNRDVTFVSHCGIAHTRWATHGEPKWSNCHPQ
                     RSDTASDFVIVHNGIITNFRELKQLLINKGYKFESDTDTECIAKLFKHLYDTNLKHGN
                     EPDFHELTMQVLLELDGSYGLLCRSVHYPNEVIATRKGSPLLIGVKSERKLKVDFVDV
                     EFPDTDEAQPEIPLNSTRGEARNFLPIASNESALRRSQSRAFLSEDGAPNPVEFFVSS
                     DAASVVKHTKKVLFLEDDDIAHIYDGELHIHRSRREIGASATRSIQTLEMELAQIMKG
                     SYKHFMQKEIFEQPDSTFNTMRGRIDFENNSVMLGGLNSWLPVIRRARRLIMIACGTS
                     YHSCLATRAIFEELSEIPVSVELASDFLDRKTPVFRDDIAVFVSQSGETADTMLALKY
                     CLERGALTVGIVNNVGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLS
                     DDRVSKLDRRREIIQGLKKIPEQIRKVLLMEPRIKELCEKELKDQKSLLLLGRGYQFA
                     SALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQ
                     VTARKGRPIIICNENDEVWAAKAANSNLATLEVPLTVDCLQGLLNIIPLQLTSYWLAV
                     NKNIDVDFPRNLAKSVTVE"
     gene            complement(<495727..>497262)
                     /locus_tag="KLTH0D05544g"
                     /db_xref="GeneID:8295191"
     mRNA            complement(<495727..>497262)
                     /locus_tag="KLTH0D05544g"
                     /product="KLTH0D05544p"
                     /transcript_id="XM_002552917.1"
                     /db_xref="GeneID:8295191"
     CDS             complement(495727..497262)
                     /locus_tag="KLTH0D05544g"
                     /note="similar to uniprot|P14904 YKL103C Saccharomyces
                     cerevisiae LAP4 Vacuolar aminopeptidase"
                     /codon_start=1
                     /product="KLTH0D05544p"
                     /protein_id="XP_002552963.1"
                     /db_xref="GeneID:8295191"
                     /db_xref="GOA:C5DGI3"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:C5DGI3"
                     /translation="MSDATQEALAQIKKTLELLALQKPTTGEASQPAAVAHNSSQKYR
                     GKDYFEESSKSYINFTYESPTIYHVVEYFSRKLDEAGFSYVSEKSTWSEVKSGKYYTI
                     RNGTNLVAFILGSDWKYETGVGAIGSHIDALCAKLKPVSTKKDVEGFQLLGVAPYGGT
                     LNTYWFDRDLGIGGRVLVRDPDSGKIESRLINSAPHPIAKIPSLAVHFGEPANGPFDK
                     EDQAVPVIGYSGTGDDDEEGDSEDEKRSPLFGKHPIGLLRYIASLAKVKVSQLVQVDL
                     DLFDVQKGTLGGLKNDFLFAPRLDDRLCSFSAVNSLIDFANDGPVPRDAFSIVALFDD
                     EEVGSLSRQGARGGLLESVVQRVVANLHGDSPELLRTTFANSLIISADVNHMFNPNFS
                     SVYLEHHRPKPNVGVTLSLDSNLHMSTDVVGLAVAEELARLNGDKLQYFHIKNNSRSG
                     GTIGPFISSQTGARTIDLGIAQLSMHSIRAATGSKDIGLAIKFFKGFFANWRSVYDKF
                     GDL"
     gene            <498055..>501441
                     /locus_tag="KLTH0D05566g"
                     /db_xref="GeneID:8295192"
     mRNA            <498055..>501441
                     /locus_tag="KLTH0D05566g"
                     /product="KLTH0D05566p"
                     /transcript_id="XM_002552918.1"
                     /db_xref="GeneID:8295192"
     CDS             498055..501441
                     /locus_tag="KLTH0D05566g"
                     /note="weakly similar to uniprot|P34244 Saccharomyces
                     cerevisiae YKL101W HSL1 Nim1p-related protein kinase that
                     regulates the morphogenesis and septin checkpoints
                     associates with the assembled septin filament required
                     along with Hsl7p for bud neck recruitment phosphorylation
                     and degradation of Swe1p"
                     /codon_start=1
                     /product="KLTH0D05566p"
                     /protein_id="XP_002552964.1"
                     /db_xref="GeneID:8295192"
                     /db_xref="GOA:C5DGI4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DGI4"
                     /translation="MSMAQQAAMAATGGSDHIDRVVHSVTDATKRLSQISTSTTNTAT
                     QSSKRRSRDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKTKSSRPNALPY
                     GIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAI
                     HYFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSC
                     GSPHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQ
                     MPQAISLEAQDLISRILVVDPNKRITINDILSHPLITKYDYKRSKSNSDLHILSHTSP
                     QICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQQRQL
                     KAGPKSPPVNAPKILQKSQFSVPSIKSQSSPHKEHVASSSRVFKSNSKKRISASASKR
                     SLHNSSSKKSLHKSSSKKSLGSLKNSASKKSLRNSPIKPQHPLPSKRSLYSLNSISKR
                     SVNLKDYVSDDSKPPLPQQSEFELLCEEILFGAELGGITEEVGETSTEAARTTNPVFK
                     TGLGKTAKAPESPKSTETSNETELSGDRDGLQSRLEGTSAEVEESVAIAKKAASKAPR
                     SHQAGLGDNAQKKNTETPRKHPQTDGISQIKSERAALQVSKLKSTPSSRNLRVASAPS
                     GKDDTPVSLDPRRNVSQPNSIELLLNKYNLRAHLKSKSNLKKLRNSGDWGRTAFETSF
                     ASSGNGISLNADDLKDFESLSGTDLTNVLAHSSSIKGDDSTDAAKMQHAQRQEESKQV
                     VSLPSANLNSSATFKNLSQYILDSNSSTTRASSVVRRPAGGSLKSCTQNVSRKPSTNL
                     PKNTLTVQRSRKVSQVSAYDTRSEMPSDMSFALDIPTQTFTAQAVQVSNGSSQDQFEQ
                     AKKPVLLQEEQGEDDINIFEDAPCDNVSIATSSSGLDSQPHVHRKATSIDTLNTTSVL
                     TPSADVRVSLYANNMTSSAKLPRETTEEIISKFKLSPEKVPVPPQKRFSYQKARGSIS
                     QSVISMFKDLDDDFEDHASEPAAEGHFDSATGMQQDPSSNVEEQIPGEGPVAQKRVTM
                     LFDDESSTVFKSSPIKTSVLKPRESVAAQPRPSSTTIPFT"
     gene            complement(<502176..>503345)
                     /locus_tag="KLTH0D05588g"
                     /db_xref="GeneID:8295193"
     mRNA            complement(<502176..>503345)
                     /locus_tag="KLTH0D05588g"
                     /product="KLTH0D05588p"
                     /transcript_id="XM_002552919.1"
                     /db_xref="GeneID:8295193"
     CDS             complement(502176..503345)
                     /locus_tag="KLTH0D05588g"
                     /note="similar to uniprot|P07246 Saccharomyces cerevisiae
                     YMR083W ADH3 Alcohol dehydrogenase isoenzyme III"
                     /codon_start=1
                     /product="KLTH0D05588p"
                     /protein_id="XP_002552965.1"
                     /db_xref="GeneID:8295193"
                     /db_xref="GOA:C5DGI5"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DGI5"
                     /translation="MQRTLYRHTSSTLMQGVRQRLGGYAGLGSQRIGFVGALRFASNI
                     PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKL
                     PLVGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLSG
                     YTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVYKALKTADVRPGQWVAIS
                     GAAGGLGSLAVQYAKAMGLRVLGIDGGEDKKKLFHDLGGETFIDFRTTKDMVGAIQEA
                     TQGGPHAVINVSVSEAAISMSTEYVRPTGSVVLVGLPANAYVKSEVFSHVVKSISIKG
                     SYVGNRADTREAIDFFARGLVKAPIKIIGLSELPEAYKLMEAGKILGRYVVDTEK"
     gene            <503333..>504055
                     /locus_tag="KLTH0D05610g"
                     /db_xref="GeneID:8295194"
     mRNA            <503333..>504055
                     /locus_tag="KLTH0D05610g"
                     /product="KLTH0D05610p"
                     /transcript_id="XM_002552920.1"
                     /db_xref="GeneID:8295194"
     CDS             503333..504055
                     /locus_tag="KLTH0D05610g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0D05610p"
                     /protein_id="XP_002552966.1"
                     /db_xref="GeneID:8295194"
                     /db_xref="UniProtKB/TrEMBL:C5DGI6"
                     /translation="MFSAYYAFVRLSASLPLFFFHSLQGTLALRTKYNSSFYGSFKLC
                     AVAMPSSLVSVSCLSSFRLRGFLVYGHLYFEFPAPTNSTRCRSWKSSPLVYLIPLGLE
                     VTHARALLAKNGNSRDFAMLKAGIRAQEPEFVREKNVRFVNSYFYVPGAIVIVIYVST
                     ASLEGALRKCWRRASGEYVSTARRLRQLVSLAYKCRDVAGKRESSLLTSGAMTLVFKS
                     GKTRPLTLPKACGAAASWRTRR"
     gene            complement(<504315..>505067)
                     /locus_tag="KLTH0D05632g"
                     /db_xref="GeneID:8295195"
     mRNA            complement(<504315..>505067)
                     /locus_tag="KLTH0D05632g"
                     /product="KLTH0D05632p"
                     /transcript_id="XM_002552921.1"
                     /db_xref="GeneID:8295195"
     CDS             complement(504315..505067)
                     /locus_tag="KLTH0D05632g"
                     /note="similar to uniprot|P34247 Saccharomyces cerevisiae
                     YKL099C UTP11 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="KLTH0D05632p"
                     /protein_id="XP_002552967.1"
                     /db_xref="GeneID:8295195"
                     /db_xref="GOA:C5DGI7"
                     /db_xref="InterPro:IPR007144"
                     /db_xref="UniProtKB/TrEMBL:C5DGI7"
                     /translation="MAKLVHNVQKKQHRERSQVASRSRFGFLEKHKDYVKRAQDFHRK
                     QATLKVLREKAQQRNPDEYYHAMHSRTLDSKGLLQKSRRAADEDASLSTDQVKLLKTQ
                     DANYVRTLRQNERQALERQSQNTMFKSNGSHTVFVDDAESMHAFDAHKHFNTTPDMLH
                     RRENRLTKEQLADQGLQAGAKQAGLDPETLERKRLKKLRQLQQHQDRERQLSGVLQRM
                     EMEREGMKKGSKKKIRDAHGNTAFKWKKQRKR"
     gene            <505266..>506123
                     /locus_tag="KLTH0D05654g"
                     /db_xref="GeneID:8295196"
     mRNA            <505266..>506123
                     /locus_tag="KLTH0D05654g"
                     /product="KLTH0D05654p"
                     /transcript_id="XM_002552922.1"
                     /db_xref="GeneID:8295196"
     CDS             505266..506123
                     /locus_tag="KLTH0D05654g"
                     /note="weakly similar to uniprot|P34246 Saccharomyces
                     cerevisiae YKL098W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D05654p"
                     /protein_id="XP_002552968.1"
                     /db_xref="GeneID:8295196"
                     /translation="MSGQEPSLPPMGPTLPAALAFRKNLVCYCEDPTVVVEFLQALHL
                     PYALWENYDDIDARPKPEAEQVLVLPNVDRLLTLQQDKLAKFLQVMRSRDTPFFAAVA
                     TVSPGFVPYAHFTPYLKRQFWFACAEPMTGGATDFNEETLPQLRNSLRKVHVHHSIRR
                     YVLDIIMHLRVHRFSSQASGGGCSTHSLRDILELCQTLALAEERAFVVPDIVKTASYW
                     YFPFHLELIQNPSHEISLQYGSDPDLVAQLVNAMQQFSLQRASEIHYPLYFQYMVLRD
                     VLNLVVPAI"
     gene            <506564..>507571
                     /locus_tag="KLTH0D05676g"
                     /db_xref="GeneID:8295197"
     mRNA            <506564..>507571
                     /locus_tag="KLTH0D05676g"
                     /product="KLTH0D05676p"
                     /transcript_id="XM_002552923.1"
                     /db_xref="GeneID:8295197"
     CDS             506564..507571
                     /locus_tag="KLTH0D05676g"
                     /note="some similarities with uniprot|P28319 Saccharomyces
                     cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to a
                     beta-1 3- and beta-1 6-glucan heteropolymer through a
                     phosphodiester bond involved in cell wall organization"
                     /codon_start=1
                     /product="KLTH0D05676p"
                     /protein_id="XP_002552969.1"
                     /db_xref="GeneID:8295197"
                     /db_xref="GOA:C5DGI9"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DGI9"
                     /translation="MKFTSAFTAALLACARLALADSETFGLLVIRSGSSLQYASAYAQ
                     DSKLYLGSSSDSLSAVVTDDGKLKLSDDKYAVVSSDGSVVEGSESEGSSEFSISEGHL
                     LYGGKDGFVAVPSGSAYLLYTNNSDSSSIGVAIRATSTSGSTVPDFSPSGEDSSSAGS
                     SSTAASSGTSTASQTTLSPSSGADAAVSQIGDGQIQATTATSSKAASSAAAVSQIGDG
                     QIQATTATSSKLTSSAAAVSQIGDGQIQATTATSSKPTSSAAAVSQIGDGQIQAATSV
                     ASPSSSSSKTTVSAVSQISDGQIQATSSSASVQVQSENGGAQAVVGLGAGFAAAAALL
                     L"
     gene            <508215..>510326
                     /locus_tag="KLTH0D05698g"
                     /db_xref="GeneID:8295198"
     mRNA            <508215..>510326
                     /locus_tag="KLTH0D05698g"
                     /product="KLTH0D05698p"
                     /transcript_id="XM_002552924.1"
                     /db_xref="GeneID:8295198"
     CDS             508215..510326
                     /locus_tag="KLTH0D05698g"
                     /note="some similarities with uniprot|P28319 Saccharomyces
                     cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to a
                     beta-1 3- and beta-1 6-glucan heteropolymer through a
                     phosphodiester bond involved in cell wall organization"
                     /codon_start=1
                     /product="KLTH0D05698p"
                     /protein_id="XP_002552970.1"
                     /db_xref="GeneID:8295198"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ0"
                     /translation="MKFNSLLVSSVALAGSAVRADSQEFDMLVVRSESPLQYASVYAE
                     NGHLFLGGTSVGLSGVVTDNGKLRFSDGTYATLSNNGSLVEETRDRATAGFSISGGYL
                     SFEGSIGFTGVLARGGYEFSTVITNPDDLDVLIRANLANGSKAPDFGPSFHRPSIPIT
                     TASAKTLCTKIRNSTITITKTEHDTTTATLTSCGNGLATNSSTPIISSTPIISLTSSG
                     FVNVTSIQTSGLSNSFFTPSATVTLSSLPFSSFQNSTTIISTASLSSIPISSGFLSSS
                     TGSSSLNSTISLPTSTEIITASSFSPSQSSSTVSSSSAVSSPTAIPSSSAIPSSSAIP
                     SSPAIPSSSAIPSSSVISSSSAIPSSSVVLSSIIVTSSTTASSSSAIPSSTAASSSSA
                     ISSSSAISSSLAASSSSAALSSSAASSSLAASSSSAISSSSAISSSLAASSSSAVSSS
                     LAASSSSAISSSLAAPSSSAASSSLAASSSSAASSSSAASSSLAASSSLAASSSSAIS
                     SSLAASSSSAISSSLAASSIGSSSAPPETSSTSSSATSSQTTSSSSLASSSTASTVAS
                     VSQSSLSLTSSSTSVLSSASSVPVSTSTLVSSASGSSRSLPPLTSSTAVTSSGQLSSS
                     TVSSPSSSEMSSVSSTELSSSISTETSAVSSSSVASSQAPVSSTSPTQSSTESSTQNG
                     AGQIIPTGLGASFFFVAALLM"
     gene            <511398..>512216
                     /locus_tag="KLTH0D05720g"
                     /db_xref="GeneID:8295199"
     mRNA            <511398..>512216
                     /locus_tag="KLTH0D05720g"
                     /product="KLTH0D05720p"
                     /transcript_id="XM_002552925.1"
                     /db_xref="GeneID:8295199"
     CDS             511398..512216
                     /locus_tag="KLTH0D05720g"
                     /note="similar to uniprot|P28320 Saccharomyces cerevisiae
                     YKL095W YJU2 Essential nuclear protein putative
                     spliceosomal component involved in mRNA splicing based on
                     computational analysis of large-scale protein-protein
                     interaction data"
                     /codon_start=1
                     /product="KLTH0D05720p"
                     /protein_id="XP_002552971.1"
                     /db_xref="GeneID:8295199"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ1"
                     /translation="MSERKAINKYYPPNFNPLEAEEAARKLSKKLKTMNRDVITIRLM
                     TPFSMRCLKCSEFIPKSRKFNGKKELLPEKYLDTIKQYRLSIKCPRCNNMIAFRTDPK
                     SGDYVMEIGGVKNFVEEKPEEKLPGDETLDETLERLERQQQQDNNQTKNDDHEDKLEK
                     IEKRLAKLQKEQQDYEELEALRRENISKMKKAEALQEKSHLSAQEESQGDEEKAELAF
                     RLFNAQKADGETSGPAVHITAAPAAIPQKIRSKKKAKSNALGVIVKKKNRARQT"
     gene            <512469..>513410
                     /locus_tag="KLTH0D05742g"
                     /db_xref="GeneID:8295200"
     mRNA            <512469..>513410
                     /locus_tag="KLTH0D05742g"
                     /product="KLTH0D05742p"
                     /transcript_id="XM_002552926.1"
                     /db_xref="GeneID:8295200"
     CDS             512469..513410
                     /locus_tag="KLTH0D05742g"
                     /note="similar to uniprot|P28321 Saccharomyces cerevisiae
                     YKL094W YJU3 Protein of unknown function localizes to
                     lipid particles"
                     /codon_start=1
                     /product="KLTH0D05742p"
                     /protein_id="XP_002552972.1"
                     /db_xref="GeneID:8295200"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ2"
                     /translation="MFFFSGKKSAPIDFPYKPTSSSFIKDKHQFDGADFIYVKWFVAT
                     EQTLTAKARLLVVHGFDEYTLLYSRLMDQLSKVGIESFAFDQRGSGETSPGKQRGRTN
                     EYHTFNDLDHFIEWNLEDKDPETPLFLFGHSMGGGIVLNYGCAGRFRDQIAGIVCTGP
                     LIELHPHSAPSRLVTALSPLLAACLPNFRIDTGLDIDATTSDERYRNFLSRDPLTVPL
                     YGSLRQIYDFLARGKKLLEDKEYVAKLQKPVLIFHGISDTINDPKASEKFNKLCTATD
                     KRLELVPGARHSLCLETDEVFERMFNDMHNWLLEHAP"
     gene            <513915..>514739
                     /locus_tag="KLTH0D05764g"
                     /db_xref="GeneID:8295201"
     mRNA            <513915..>514739
                     /locus_tag="KLTH0D05764g"
                     /product="KLTH0D05764p"
                     /transcript_id="XM_002552927.1"
                     /db_xref="GeneID:8295201"
     CDS             513915..514739
                     /locus_tag="KLTH0D05764g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D05764p"
                     /protein_id="XP_002552973.1"
                     /db_xref="GeneID:8295201"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ3"
                     /translation="MEFSEVKDSKKVSCCSRASDPTENICECEDELDIFERFVQDPCM
                     NAWEDLDEEGRPSQWEDDELDPVCEGVEGFARKQVRTSKPCICSNCHHPRRWKTSSTA
                     QDFDEPVLRCSRTNSFMSQLSRQASRQSLPDPGEGTCGSPTHPGYSQPSLEIGPSRSN
                     SVSRTRSRSSFGASSAIPAHIYCLERFVSSELDSAAENFCRKDPLTLNTVSPTTSTIC
                     SPSGSDSATSPQMAGVLSSSSSTNSAKNNADIQPVFLSKRKSRVSSIEVSLLNSFS"
     gene            <515187..>518135
                     /locus_tag="KLTH0D05786g"
                     /db_xref="GeneID:8295202"
     mRNA            <515187..>518135
                     /locus_tag="KLTH0D05786g"
                     /product="KLTH0D05786p"
                     /transcript_id="XM_002552928.1"
                     /db_xref="GeneID:8295202"
     CDS             515187..518135
                     /locus_tag="KLTH0D05786g"
                     /note="highly similar to uniprot|P30771 Saccharomyces
                     cerevisiae YMR080C NAM7 ATP-dependent RNA helicase of the
                     SFI superfamily required for nonsense mediated mRNA decay
                     and for efficient translation termination at nonsense
                     codons"
                     /codon_start=1
                     /product="KLTH0D05786p"
                     /protein_id="XP_002552974.1"
                     /db_xref="GeneID:8295202"
                     /db_xref="GOA:C5DGJ4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ4"
                     /translation="MSPAAGPSVTPDAEDKTVKPVSEAGSEAAVTAEMNELYVSNSEI
                     AAVMPGENEDFGEPMEAPPSEFACAYCNVDSAKCVVKCNTCNKWFCNSKNGTSSSHII
                     NHLVLSHHNTVSLHPESDLGDTVLECYNCGCKNVFVLGFVSAKSEAVVVILCRLPCAQ
                     TKTVSWDTDQWQSLIENRQFLSWVAEDPSDEELLRARMISPSQISKLEAKWRSNKDAT
                     INDIEVPDEKEEVPHILMRYADAYQYQRSFAPLVKIEADYDKQLKESQALEHISVSWS
                     LGLSNRHLASFALSTFESNGLKVAVGDEMILRYSGVQHPEWEGHGYIVRLPNSFQDQL
                     TLELKPSKTPPPTSFNTGFTAEFVWKGTSYDRMQEAMKKFAVVKKSVSGFLYYKILGH
                     EVPDLEFDVNLPEQFSIPHFTQLNVSQANAIRHVLQRPLSLIQGPPGTGKTVTSATIV
                     YHLSKLHKERILVCAPSNVAVDHLAAKLRDLGLKVVRLTAKSREDVESSVSNLGLHNL
                     VSRSAKGELKKLLKLKEDVGELSPSDAKKFVKQVRKSELEILKKADVVCCTCVGAGDK
                     RLEAKFRTVLIDESTQASEPECLIPIVKGAKQVVLVGDHQQLGPVILDRKAADAGLKQ
                     SLFERLISLGHIPIRLEVQYRMNPHLSEFPSNMFYEGSLQNGVTIEQRSVTNSTFPWP
                     IHDLPMMFWSNYGREEISGNGTSYLNRIEAMNCERVITKLFKDGVKPDQIGVITPYEG
                     QRAYIVQYMQMNGSMDKELYMNVEVASVDAFQGREKDYIILSCVRANEQQAIGFLSDP
                     RRLNVALTRSKYGLVILGNPRSLSRNSLWSHLLVYFREKGCLVEGALGNLQLCTVQLT
                     KSRNVRPSQKTNFSKMEFSHGAEMGQTNFNDFDTQSLMSYGGIDTFGMAGNSNLNALF
                     NNFHPFGQHPQQLNTADTNTFDGYLKFDSSLARGLQAYGGSASKYEGAVKGNGDSRKV
                     PDDAVRELNV"
     gene            complement(<518280..>521462)
                     /locus_tag="KLTH0D05808g"
                     /db_xref="GeneID:8295203"
     mRNA            complement(<518280..>521462)
                     /locus_tag="KLTH0D05808g"
                     /product="KLTH0D05808p"
                     /transcript_id="XM_002552929.1"
                     /db_xref="GeneID:8295203"
     CDS             complement(518280..521462)
                     /locus_tag="KLTH0D05808g"
                     /note="similar to uniprot|P33314 Saccharomyces cerevisiae
                     YKL092C BUD2 GTPase activating factor for Rsr1p/Bud1p
                     required for both axial and bipolar budding patterns
                     mutants exhibit random budding in all cell types"
                     /codon_start=1
                     /product="KLTH0D05808p"
                     /protein_id="XP_002552975.1"
                     /db_xref="GeneID:8295203"
                     /db_xref="GOA:C5DGJ5"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ5"
                     /translation="MGTSQFNISEPTPLREGPFSNGYASSGSDQFSGMNSTESLLISN
                     IQSNRGQFKGEVQWCSNLSLDDWKTHFLQIDERGALCHALNEEGIADLRVVTEKPASS
                     NKPILKHLQSCKVQLLDSSMGNLSVIKVETYYSTIYLRATEKKTFLSLFSALIFWKSL
                     KDRGIFNKISVIQPIFSRQQKPIDLLVCQFNIYGPIPRNKNVPLKSGLATPPPIAGVS
                     VIDEMGWYSAMGRLSSDGRLDLLLQSDGSVLWSLDISSLLRSEIRILDPSLFQNDNFL
                     FLGVVRRLRDQLKISSNIPFYSSTTKTQVNSQAIYLQFPLRIDLEDWFVALNTFAQVE
                     SVSLLGTDKSNELRISNRFKVSILEADFSGINLMSYDHERHQEILPRLYSDISIWDHC
                     WARTSIVTDAQTPFWREEFDFNFSVKTSPVCVAVKIALGDDGEYSSSDKTLGVIEITQ
                     EMINDGSLSAETRIPLFDAENKHFQLGTLCIKVASSLNAILPSVNFTKLDSMLSRMSL
                     TKMTEYLNDISIADYLKLEDLSVVFLDIFQALNRTNDWFQALIEKEFSNIDNSISKNT
                     NKNLSSANIYSSLFRGNSILTKSIERYFNRIGQEYLDKAIGGTIRKVVSSDMCLELDP
                     SRIREIDAQRKSEILEGNYSRLLKVAEELWSRISSTSNDLPIGIKEQLKAFRKNLEII
                     CKNDELKSTLNCISGFLFLRFFCPVILNPKLFHIVENHPEEGPKRTLTLLTKIILNLS
                     TLTLFGKKEPWMTKMNEFILKHEGELTDYIDKVTDKKLDFSPKALKLSNSVARPRVAL
                     NESCLNDLPTNPYLIDRYLRETELISVLTIFRRDEEKSMTVPKTVSMNRLSKEPSSSF
                     PSPIIDQTKATIGELEFEKLTENNAEVFGEDLMKYLNIDKANDNVGSESPTVAGFTIE
                     EKDLTKTLEQESLLLYHRLEHLTNVLSNYEYPNEIILGKTEFALFLVDNLYMDRNNIV
                     ELDLSGSFAKQNGLSKLCSDSSLFMKDSDRHQSPPNSGQISRARTVSQRPNLGFSSSK
                     SNPLSKKKGKQSENKSDNKQGFKLLRFFRK"
     gene            complement(<521663..>522352)
                     /locus_tag="KLTH0D05830g"
                     /db_xref="GeneID:8295204"
     mRNA            complement(<521663..>522352)
                     /locus_tag="KLTH0D05830g"
                     /product="KLTH0D05830p"
                     /transcript_id="XM_002552930.1"
                     /db_xref="GeneID:8295204"
     CDS             complement(521663..522352)
                     /locus_tag="KLTH0D05830g"
                     /note="highly similar to uniprot|P24280 Saccharomyces
                     cerevisiae YMR079W SEC14
                     Phosphatidylinositol/phosphatidylcholine transfer protein
                     involved in coordinate regulation of PtdIns and PtdCho
                     metabolism products of which are regulators in Golgi to
                     plasma membrane transport functionally homologous to
                     mammalian PITPs"
                     /codon_start=1
                     /product="KLTH0D05830p"
                     /protein_id="XP_002552976.1"
                     /db_xref="GeneID:8295204"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ6"
                     /translation="MYENCEKWRKDFGVDTIFEDFHYDEKPLVAKYYPQYYHKTDKEG
                     RPLYFEELGSVNLTEMYKITNQERMLRNLVWEYESFVRYRLPACSRQAGYLVETSCTI
                     LDLKGISISAAAQVLSYVKEASNIGQNYYPERMGKFYLINAPFGFSTAFRLFKPFLDP
                     VTVSKIFILGSSYQKELLKQIPAENLPVKFGGKSEVDESQGGLYLSDVGPWRNPKFIG
                     PEGEAPTAFKL"
     gene            <522837..>524945
                     /locus_tag="KLTH0D05852g"
                     /db_xref="GeneID:8295205"
     mRNA            <522837..>524945
                     /locus_tag="KLTH0D05852g"
                     /product="KLTH0D05852p"
                     /transcript_id="XM_002552931.1"
                     /db_xref="GeneID:8295205"
     CDS             522837..524945
                     /locus_tag="KLTH0D05852g"
                     /note="similar to uniprot|P49956 Saccharomyces cerevisiae
                     YMR078C CTF18 Subunit of a complex with Ctf8p that shares
                     some subunits with Replication Factor C and is required
                     for sister chromatid cohesion may have overlapping
                     functions with Rad24p in the DNA damage replication
                     checkpoint"
                     /codon_start=1
                     /product="KLTH0D05852p"
                     /protein_id="XP_002552977.1"
                     /db_xref="GeneID:8295205"
                     /db_xref="GOA:C5DGJ7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ7"
                     /translation="MEGRLEPLIGDSMLFGPMEDQGLSFVNKSGETVHLRRKPARALM
                     DLNWKHDESYGIDINQLLQRCEDSSNAAIQSSGASRSKHSPSQLWTEKWKPHTFFDLV
                     GNEKTNRRVLKWLRQWSPLVFGQELPKKAPSVRDKVGADGANYDFDDPLQRPQKRILL
                     LNGPPGIGKTSVAHVVAKQAGFSVIEINASDERAGPHVKDRIHNALFNHTFDDRPVCL
                     IADEIDGSIETGFVKVLIDIVNSDYRATQRLASGASSAVQRGKRKQRSPGKVLTRPII
                     TICNNVYASALEKLRPHCEIVTFRRPAESALLERLSHVCRKEKLQLDKKRLKELSELS
                     QGDLRSCLNNMQFMASLHAEAPESTDTAKISDQIKDMTVSWYKICNQVFRRNPHEDAK
                     VQFGRLLRDIEINSNSQRIVQGCFSMFPEVKFSDHSLQKPSAAADWLYFNDLMFKSLF
                     EHNGDLLRYNSVVPMAFFHLFSDIANKDDVRGKVNEFDHREDLRNNESIVLSTFRRAP
                     PTLKIFMNKSSLALEVLPLLDYIIVPDFSKIRNNQTKTTVLSNIVAALSSFDLTFSER
                     VDTDLPRVTCIEPPFDKVTLMDEKRVKEVFTKRPAILNVVLAKAQESKVRKRTIEQAR
                     ADKLDLESVRKKHKTSSSKPVDYFKSQYANVQTKGSEKFKDSGSVEGDSREPVKIWVK
                     YKEGFSDAVRKDVTWNSLWE"
     gene            526061..526134
                     /locus_tag="KLTH0D05874r"
                     /db_xref="GeneID:8295206"
     tRNA            526061..526134
                     /locus_tag="KLTH0D05874r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8295206"
     gene            526221..526294
                     /locus_tag="KLTH0D05896r"
                     /db_xref="GeneID:8295207"
     tRNA            526221..526294
                     /locus_tag="KLTH0D05896r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8295207"
     gene            <526400..>527332
                     /locus_tag="KLTH0D05918g"
                     /db_xref="GeneID:8295208"
     mRNA            <526400..>527332
                     /locus_tag="KLTH0D05918g"
                     /product="KLTH0D05918p"
                     /transcript_id="XM_002552932.1"
                     /db_xref="GeneID:8295208"
     CDS             526400..527332
                     /locus_tag="KLTH0D05918g"
                     /note="some similarities with uniprot|P38749 Saccharomyces
                     cerevisiae YHL009C YAP3 bZIP transcription factor"
                     /codon_start=1
                     /product="KLTH0D05918p"
                     /protein_id="XP_002552978.1"
                     /db_xref="GeneID:8295208"
                     /db_xref="GOA:C5DGJ8"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ8"
                     /translation="MMDYSNNFSYSNQYQSSGQAQAVEQGFGADLHSCSNDDCSAASN
                     LFDGLTEENKTFHEILAANSNTITPPGSSSPGYQQDLLSSMKTVKRGTEINFDCLEGE
                     APQNLIPEALASAQGFKADTVNSFQQDSNPIEDASARKKKAQNRAAQRAFRERKEAKM
                     KQLQEQLVTSERDKQSLLRQMEELRERNLKMLTENHLLLQKNNSNLPTQSNSGLASAS
                     RKFHFPSQSEFIESAIEGHEVPVKLPLSSTYYEHDGEELLTFPATWEYLHKLSEKEDF
                     DVYSVMLNLKGHEVCHGYGPAYRKTVIDKLVKQG"
     gene            <527462..>528160
                     /locus_tag="KLTH0D05940g"
                     /db_xref="GeneID:8295209"
     mRNA            <527462..>528160
                     /locus_tag="KLTH0D05940g"
                     /product="KLTH0D05940p"
                     /transcript_id="XM_002552933.1"
                     /db_xref="GeneID:8295209"
     CDS             527462..528160
                     /locus_tag="KLTH0D05940g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D05940p"
                     /protein_id="XP_002552979.1"
                     /db_xref="GeneID:8295209"
                     /db_xref="GOA:C5DGJ9"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="UniProtKB/TrEMBL:C5DGJ9"
                     /translation="MAKKVVKRLRVADKKARSETFFPNEIFELKHQASSFEFYPFPEP
                     MLEGKVILIKKFFSDKISQALRSSFSSPGIMELHYQKGTKEYAERINDRLTTQNAEIA
                     QILWERLLKCLRQDDYVMQELGFGQAKGLNPQIRAYRYEKGHKFAKHYDSSVVVSGIG
                     SSRWTLLVYLSGGDDLVGGDTVFYAPHTGEATNIHPQTGLALLHKHGDDCLLHEAQVV
                     SNGAKWVLRSDVVF"
     gene            <529126..>530502
                     /locus_tag="KLTH0D05962g"
                     /db_xref="GeneID:8295210"
     mRNA            <529126..>530502
                     /locus_tag="KLTH0D05962g"
                     /product="KLTH0D05962p"
                     /transcript_id="XM_002552934.1"
                     /db_xref="GeneID:8295210"
     CDS             529126..530502
                     /locus_tag="KLTH0D05962g"
                     /note="similar to uniprot|P36075 Saccharomyces cerevisiae
                     YKL090W CUE2 Protein of unknown function has two CUE
                     domains that bind ubiquitin which may facilitate
                     intramolecular monoubiquitination"
                     /codon_start=1
                     /product="KLTH0D05962p"
                     /protein_id="XP_002552980.1"
                     /db_xref="GeneID:8295210"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:C5DGK0"
                     /translation="MMSSQDLALLAELFPSVNENKLRGTLKSAGGDAQVACSMILSEQ
                     ETLNQMAKNSLSNNTDGRSEGEGMGSRHAKALSEENFPDENHTKARKGAVNLKKRMWR
                     PIHSFTKGQSSRLELDQAAAVHSNAWVSATDSIQDIIHYTNAAPKSAQKAFYKKTLNS
                     ARAIIDIIYHYDEYAEDINGSRLPGDNEPEYGTPQRDFMKAGGRVQSPTGFAHKKKPV
                     GLVFSADQERANIFSPRSEENYKYDSSSLEAKELNSIITNNPSLRAISPSFSKRALEF
                     YEGDVERTTLTLIFIIEKNCAQYTFVDAASKAPSLNSQKNLSKVNKGSVKPRRMGAEI
                     GGLDPSCFASDENYDRALLIIDNILTMYTADLHGFLPYEAELIAERCLNVWWTKELAL
                     REMNGQRLNQIKAINLAPFKIITGRGLHSVGGVSKVRIKVKKFLDTCLYSYTEEASYF
                     IVEGKKKA"
     gene            <530632..>532383
                     /locus_tag="KLTH0D05984g"
                     /db_xref="GeneID:8295211"
     mRNA            <530632..>532383
                     /locus_tag="KLTH0D05984g"
                     /product="KLTH0D05984p"
                     /transcript_id="XM_002552935.1"
                     /db_xref="GeneID:8295211"
     CDS             530632..532383
                     /locus_tag="KLTH0D05984g"
                     /note="similar to uniprot|P35201 Saccharomyces cerevisiae
                     YKL089W MIF2 Kinetochore protein with homology to human
                     CENP-C required for structural integrity of the spindle
                     during anaphase spindle elongation interacts with histones
                     H2A H2B and H4 phosphorylated by Ipl1p"
                     /codon_start=1
                     /product="KLTH0D05984p"
                     /protein_id="XP_002552981.1"
                     /db_xref="GeneID:8295211"
                     /db_xref="GOA:C5DGK1"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR025974"
                     /db_xref="InterPro:IPR028386"
                     /db_xref="InterPro:IPR028929"
                     /db_xref="UniProtKB/TrEMBL:C5DGK1"
                     /translation="MDYMNLGVKSRKTGIQVKGNIGRDEYSMENIDEFFKDDDTLISA
                     RRKSRRSSLLPLSKKFLPEDFSETSRRSSNYLPPSVPTIQEEDDENLHEGSDEPAGGL
                     EINETLSRAVEDNRIHQELSEIPTGDHERRLRQPAEKSYEPDYRAEDDFTTDAVVPQT
                     PPSDYGNESYRDVPDLVADDDDDVSHGNTTFNTSDNALLEDELQREVRAESEEDRDYI
                     ERYSNTENSDSSELEDEDNSDTNSPYETHSAQSYNTRVQPALSVSRGRHPLSEPQELS
                     DTSDEEFIYDQARELASENSFTTSAGLRKSKRVKVAPLEYWRNEKVVYKRKSRKPVLE
                     IDKIITYEDEDDEEEEISRRRKSSKKPPYNYGTSGKPRGRPRKSKTTNSASSSGLQNP
                     NEDLISKIRTGDTQCSSWMRRGVFKASVKSSFHGKEENEELLACAPDSVHTEQRRKTA
                     DEDFSLAVLFDQHRDLFASGFLTIPTGSCKKLSDSRNAFINFYLIQGVIEVTVGRNKL
                     LCTDGTSFQIPAFNEYAFRNKGKNDAKMYFVQTTIFPRLSQARGIRNLSRSPAEARDN
                     QIPKSTTSPSDMSISEL"
     gene            complement(<532589..>535453)
                     /locus_tag="KLTH0D06006g"
                     /db_xref="GeneID:8295212"
     mRNA            complement(<532589..>535453)
                     /locus_tag="KLTH0D06006g"
                     /product="KLTH0D06006p"
                     /transcript_id="XM_002552936.1"
                     /db_xref="GeneID:8295212"
     CDS             complement(532589..535453)
                     /locus_tag="KLTH0D06006g"
                     /note="similar to uniprot|Q03497 Saccharomyces cerevisiae
                     YHL007C STE20 Signal transducing kinase of the PAK
                     (p21-activated kinase) family involved in pheromone
                     response and pseudohyphal/invasive growth pathways
                     activated by Cdc42p binds Ste4p at a GBB motif present in
                     noncatalytic domains of PAK kinases"
                     /codon_start=1
                     /product="KLTH0D06006p"
                     /protein_id="XP_002552982.1"
                     /db_xref="GeneID:8295212"
                     /db_xref="GOA:C5DGK2"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DGK2"
                     /translation="MSAMSSDSSPRSSSVPDTTTKKKDESIGKLAKQTEGKYELPRAP
                     ATLNVNALHAYEEHHNIDEQGYKSMDPGKPKGSQAEEVSEMLQSTTLDDPIQFTRVSS
                     SSALSNSSYEASDIITGSHEPDIGRAKEPQGSNQEPQQPNAFPEIQEQSTIGDKTNST
                     IRASDHYLAENSRLTNDSMMLVGENEMQLSQEFSTQDSSNLNLENTSHLKSSTPKSDY
                     SRDVSKKDILEPGEEGCLSEQTHNVGTPAKEFNYSSSSGEFPEKNIDIPIVDASNTSK
                     QAWTTPNLVQGGFTQVQYSTATNNRKQPPRSPFRAVSSPFNSMRRGSREEVTESPKSQ
                     SRLASPTAENKKRRSGGSRMKGVFSSLMQNMKRTSQGEKRQSSSALKISTPYNAKHVH
                     HVGVDTKTGEYTGLPDEWEKLLTSSGISKKEQQQHPQAVMDIVKFYQDVTEANGEDKV
                     FKTFHVGNSGKNISSTSSFRTPSSPSLNKLENAHSRPQHPNSLGVNSTAHELQSPVNL
                     REAPNVQGTTTNERFMPSRPAPKPPGTPTKNDLTSPLANRNSPATSPKVTHASSLSSG
                     LRSLSRKGTLAKTDHQIPPSSHGKAVVSRNGTISEKSADMAPVRPAPPPPVPKDLPRE
                     DNAQTDAQKAAEKKREDRRKKIQQLYAKLTEICTDGDPSKLYKSLIKIGQGASGGVYT
                     AYEVGTNASVAIKQMNLEKQPKKELIINEILVMKASKHANIVNFIDSYLLRGDLWVVM
                     EYMEGGSLTDVVTHCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLSMTGE
                     IKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEG
                     EPPYLNETPLRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD
                     PFIATYADDVRSLAPLVKLARMKKLAEKMEDGRDSGEESS"
     gene            complement(<535827..>540188)
                     /locus_tag="KLTH0D06028g"
                     /db_xref="GeneID:8295213"
     mRNA            complement(<535827..>540188)
                     /locus_tag="KLTH0D06028g"
                     /product="KLTH0D06028p"
                     /transcript_id="XM_002552937.1"
                     /db_xref="GeneID:8295213"
     CDS             complement(535827..540188)
                     /locus_tag="KLTH0D06028g"
                     /note="similar to uniprot|P33202 Saccharomyces cerevisiae
                     YKL010C UFD4 Ubiquitin-protein ligase (E3) that interacts
                     with Rpt4p and Rpt6p two subunits of the 19S particle of
                     the 26S proteasome cytoplasmic E3 involved in the
                     degradation of ubiquitin fusion proteins"
                     /codon_start=1
                     /product="KLTH0D06028p"
                     /protein_id="XP_002552983.1"
                     /db_xref="GeneID:8295213"
                     /db_xref="GOA:C5DGK3"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DGK3"
                     /translation="MSRDEIRHSMNRDYDSDGDFVIRPSRQNDYEDEDVAEEENEYSY
                     PEEVDDDVESYEGNMYHFGDEENERDEAYENSQDSEHSGENPTEEVDGNEGDDIEDEL
                     RNTTLRGAQRQSSLQELLGSLAQNMEGPSREHGGENSRRVNIADIFPEMFSMMGAGRS
                     TGRGNPRLIKLLDNVTNAQDDPYIAMESLRELSEQLLMMSPLAAERAVPQEDLLKGIV
                     DIFMDPLLQGELELQLIAFRCLYNLFEVNPDMISIAVDRNVIAACNDKLAEISYIDLA
                     EQVLETLEIISRLHGRSVLQSGSLLACLQYLDFFTSHAQRKAVTIVVNSCAKIRAVDL
                     GHISDIMWRLKEIFVSSQDHSLRQNMLNVFYGICAGLGRGDKTLEGLFDFELIESIMQ
                     LISNGETNLESRLKAFDILSQVLVSGEVLAPQIIGCGRVLDMLMSSMNEYKKSTASQL
                     HETVMFAPKPLLTCISRFIVVLFPGEDKQILSADTPKQYEFQGIEEQSRQLVKGLGPF
                     LVQVYVNAVDFQIRRLVLVALARVLSPHIPIETCDIDKGIVSMIASSLARNMALFEQS
                     GFKDQVSGVLLLGSLRLVTSLLEKNASEHLPAFVREGVFESFKSFSKELSSIVPESLE
                     KTQAGDPPQNNGKFTDISDTNSESNYHSDDDDYNMEFEGMESPDHTRPNRVCFRILKH
                     LKLNYVQNELANTLESVIESYGGEGAVISEISEINSLVERLRLLDVHSDTYEYWQRIW
                     LEVKSKLFMSNFVCSGFEFISSGLADEMSKLVLSNSSKSSICQRALIETFGEDLETFA
                     EIIQSALTRLESFELLDCGLHGEDGKGASLGKQVKIRLEYDGDAVEDGIPKNLQAVTV
                     AIHCVATFRSLNEFLKHRVLQSQLITSLIPALAMRVDRQDDDVKWSFDFAFNNTKCDH
                     QDTIFGAIFRPIKNAGKDSKSLWSEPHIIRYKKAQGKDSDQKLSTLYFGGPRGLNELG
                     RLEGLLVLLKCLRGSSLRPECFVNSKISAKLACQLEEPLIVAGGLLPSWTVLLTRNYP
                     FLFPFETRMFFLQSSSFGHGRLIQVWRNRVGSDKGDFADALHQLGRPTRRKLKVSRGA
                     VFLSALKILDKYGSTPNILEVEFLNEVGTGLGPTLEFFAIVSKEFAYKSLRMWRSENF
                     NSCKEGELVEEHLFPAPLLASSNQEKTLELFHKLGTFVSRSMLDDRILDFRFSKAFFE
                     LAHMYARNEKIRFDDFDLTIDYMSMVDPHLAKSMKYLFTLKNDHDFESLSLTFYLSGY
                     NIELIENGKDVAVTIENFPDYFERLSDQVLGTGVKMQIQSFIEGFSRTFPYTSLLALT
                     PDELTDLFGSVEEDWTHETLYAYVDADHGYSHDSNIIHDLISIMTSFSKAERRLFLEF
                     LTGSPKLPIGGFKSLNPRMTVVRKHTENDLEPDHYLPSVMTCANYLKLPKYSNKDVLK
                     SRVLQAMKEGLGAFLLS"
     gene            <540476..>541192
                     /locus_tag="KLTH0D06050g"
                     /db_xref="GeneID:8295214"
     mRNA            <540476..>541192
                     /locus_tag="KLTH0D06050g"
                     /product="mRNA turnover protein MRT4"
                     /transcript_id="XM_002552938.1"
                     /db_xref="GeneID:8295214"
     CDS             540476..541192
                     /locus_tag="KLTH0D06050g"
                     /note="highly similar to uniprot|P33201 Saccharomyces
                     cerevisiae YKL009W MRT4 Protein involved in mRNA turnover
                     and ribosome assembly localizes to the nucleolus"
                     /codon_start=1
                     /product="mRNA turnover protein MRT4"
                     /protein_id="XP_002552984.1"
                     /db_xref="GeneID:8295214"
                     /db_xref="GOA:C5DGK4"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:C5DGK4"
                     /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTFRFVWVLH
                     LDDVRTPVLQEIRSAWVGSKLIMGKRKVLQKSLGEKREEEYKENIFALSKLCSGVTGL
                     LFTDEEPQVVQEYFKSYVRADYSRPKSKAPLTFEIPAGIIYSRGGQIPAEDDVPMVHS
                     LEPTLRNKFMIPTKIKAGKITIESPYLVCTEGETLDVRQALILKQFGVAAAEFRVKVA
                     AYYDNETSSVETVNINIESA"
     gene            complement(<541229..>541690)
                     /locus_tag="KLTH0D06072g"
                     /db_xref="GeneID:8295215"
     mRNA            complement(<541229..>541690)
                     /locus_tag="KLTH0D06072g"
                     /product="KLTH0D06072p"
                     /transcript_id="XM_002552939.1"
                     /db_xref="GeneID:8295215"
     CDS             complement(541229..541690)
                     /locus_tag="KLTH0D06072g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D06072p"
                     /protein_id="XP_002552985.1"
                     /db_xref="GeneID:8295215"
                     /db_xref="UniProtKB/TrEMBL:C5DGK5"
                     /translation="MDTALAQLILDDNEKLGTLIFALGETARHYFEHQLSSSAGTMSS
                     VRASTNSRCNIKVLFLNKLQYLFMYLTKLEGEGNGQELGLTNLIIYGLDEALELVDDK
                     LSIAQTRLANLIFNVAFKVRARHRVEVQFISSKDDVHDNLNRLEQYWQEVC"
     gene            <541858..>543066
                     /locus_tag="KLTH0D06094g"
                     /db_xref="GeneID:8295216"
     mRNA            <541858..>543066
                     /locus_tag="KLTH0D06094g"
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /transcript_id="XM_002552940.1"
                     /db_xref="GeneID:8295216"
     CDS             541858..543066
                     /locus_tag="KLTH0D06094g"
                     /note="similar to uniprot|P32902 Saccharomyces cerevisiae
                     YHL004W MRP4 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /protein_id="XP_002552986.1"
                     /db_xref="GeneID:8295216"
                     /db_xref="GOA:C5DGK6"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005706"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="UniProtKB/TrEMBL:C5DGK6"
                     /translation="MIPRFRVALYAQKRYLVFQNLKRGLASTGSLKEHDEQSSKIHKD
                     EAAHEPQDELSVLRQREYNNQVKELLKSFSKTATEDFKDFHGSVTGELSAKEQQLDEE
                     LTSFLKQFSQLNTVIEPKEDNGKRIAAPTYSRIKTFPFLIPSPEDKPYTNQELFLRQI
                     KHADGTAKLGAAMENVYYPHRDIFNPPAIEELSISKLLAAGVHLGQSTSLWRPSTQPY
                     IYGEYKGIHIIDLNKTLSNLKRAAKVVQGVAEKGGTILFLGTRDGQKRALQEAAKRTN
                     GFYVSTRWIPGTLTNPTEISSVWERHEIDFADTPTNRPLTSDEEAAIVKPDLLVVLNP
                     TENRNALNEAMQARVPTVGIIDTDSEPSLVTYPIPGNDDSLRSVNIILSVLAKAGEVG
                     LQSRLAKAAF"
     gene            complement(<543221..>544486)
                     /locus_tag="KLTH0D06116g"
                     /db_xref="GeneID:8295217"
     mRNA            complement(<543221..>544486)
                     /locus_tag="KLTH0D06116g"
                     /product="KLTH0D06116p"
                     /transcript_id="XM_002552941.1"
                     /db_xref="GeneID:8295217"
     CDS             complement(543221..544486)
                     /locus_tag="KLTH0D06116g"
                     /note="highly similar to uniprot|P38703 Saccharomyces
                     cerevisiae YHL003C LAG1 Ceramide synthase component
                     involved in synthesis of ceramide from C26(acyl)-coenzyme
                     A and dihydrosphingosine or phytosphingosine functionally
                     equivalent to Lac1p and highly similar to YKL008C
                     uniprot|P28496 Saccharomyces cerevisiae YKL008C LAC1
                     Ceramide synthase component involved in synthesis of
                     ceramide from C26(acyl)-coenzyme A and dihydrosphingosine
                     or phytosphingosine functionally equivalent to Lag1p"
                     /codon_start=1
                     /product="KLTH0D06116p"
                     /protein_id="XP_002552987.1"
                     /db_xref="GeneID:8295217"
                     /db_xref="GOA:C5DGK7"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:C5DGK7"
                     /translation="MSSHLQKPVVRTRRTSSVGAINLGDNKVPGLSTMKESEQSKTAA
                     LARMRALSEASKGDVDLLKKFYLTYREMSYRHTWLTPLVILLAVYGAYFLSGNRTASN
                     PLHPFVAISYQVGDSDMYGKGIGDLCFVFYYMVFFTFLREFLMECVLRPLASALGVTG
                     EHKTKRLMEQAYSIIYYGISGPFGLYIMYHTDLWLFRTAPMYATYPDLTNQYLYKVFY
                     LGQAAFWTQQACVLVLQLEKPRKDFKELVFHHIVTLALIWLSYVFHFTKMGLAVYITM
                     DVSDFFLSLSKTLNYLDSALTAPVFFVFVASWTYLRHYINLKILWSVLTEFRTVGDYT
                     LNFATQQYKCWISLPIVFVLISALQLVNLYWLFLVMRILYRLLFKGIQKDERSESESE
                     ETVQVDKHENDENEKTMEGNPDPALKKEN"
     gene            <544661..>546130
                     /locus_tag="KLTH0D06138g"
                     /db_xref="GeneID:8295218"
     mRNA            <544661..>546130
                     /locus_tag="KLTH0D06138g"
                     /product="KLTH0D06138p"
                     /transcript_id="XM_002552942.1"
                     /db_xref="GeneID:8295218"
     CDS             544661..546130
                     /locus_tag="KLTH0D06138g"
                     /note="similar to uniprot|P38753 Saccharomyces cerevisiae
                     YHL002W HSE1 Subunit of the endosomal Vps27p- Hse1p
                     complex required for sorting of ubiquitinated membrane
                     proteins into intralumenal vesicles prior to vacuolar
                     degradation as well as for recycling of Golgi proteins and
                     formation of lumenal membranes"
                     /codon_start=1
                     /product="KLTH0D06138p"
                     /protein_id="XP_002552988.1"
                     /db_xref="GeneID:8295218"
                     /db_xref="GOA:C5DGK8"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:C5DGK8"
                     /translation="MSSNQSLRDAILRATDGKLRVDNWQFIIEVCDLVREDPEDRGRF
                     ATDIVEERLKEDDANVVLRTLSLVVSLAENCGSRLQQAISSKGFTKVLYGLIENPKVH
                     LVVKREVAKVVEQLSDSFKNDSSLKSMQDLYVAISAQAPHLLVRERVPQKKEMSHETK
                     RNEEKELEEALKLSILEYEQSSSQKAAQNNDNKVANQKHIESSHHNESQTQNTVRKVR
                     ALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPVAEKTPEQ
                     LRQQKAHEDAVFSQISNVDKLHRRMAENANDLELTQDGEVNNLYSVVTPLRPQLTKMI
                     GDYAQKKEEYSSLRKVLADAEASYNRMLDRASQVYPTQSLPLERMGSGSYEQPVGLQH
                     THSRQASAVNPLSRQPQSGIPYVHAQSFLTGQPQPNQHQTHSLKLQQREQRQSPHQIP
                     ELYQQGPQNYQRQPQNTHPSETRPVHQVPYPMSNQATGI"
     gene            <546275..>547069
                     /locus_tag="KLTH0D06160g"
                     /db_xref="GeneID:8295219"
     mRNA            <546275..>547069
                     /locus_tag="KLTH0D06160g"
                     /product="KLTH0D06160p"
                     /transcript_id="XM_002552943.1"
                     /db_xref="GeneID:8295219"
     CDS             546275..547069
                     /locus_tag="KLTH0D06160g"
                     /note="similar to uniprot|P28495 Saccharomyces cerevisiae
                     YKL007W CAP1 Alpha subunit of the capping protein (CP)
                     heterodimer (Cap1p and Cap2p) which binds to the barbed
                     ends of actin filaments preventing further polymerization
                     localized predominantly to cortical actin patches"
                     /codon_start=1
                     /product="KLTH0D06160p"
                     /protein_id="XP_002552989.1"
                     /db_xref="GeneID:8295219"
                     /db_xref="GOA:C5DGK9"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /db_xref="UniProtKB/TrEMBL:C5DGK9"
                     /translation="MSSSFETIIESIISDAPSGEVQDVVKDLTTIAGDQAEEAIIEAM
                     THYNVKNLIPIEVKGKPVIISEYNKKGSKFFDPVRSILFSVDHLNRTGVDVEDCDQKH
                     TTEQRGLYEELDKYMSKNFTGNVAYAVYAKDDPDEVAIFIASTRYSPGNFWNGHWRSS
                     YTYNMNSQALKGTVDIDVHYFEDGNVSFKFSKDVEHNAASSAVVSIKNLENEVENEMS
                     ASFSNLNEKEFKLLRRRLPVTRSKINWGKGIGTYRLGKDSAENQLK"
     gene            complement(<547103..>547463)
                     /locus_tag="KLTH0D06182g"
                     /db_xref="GeneID:8295220"
     mRNA            complement(join(<547103..547360,547428..>547463))
                     /locus_tag="KLTH0D06182g"
                     /product="KLTH0D06182p"
                     /transcript_id="XM_002552944.1"
                     /db_xref="GeneID:8295220"
     CDS             complement(join(547103..547360,547428..547463))
                     /locus_tag="KLTH0D06182g"
                     /note="highly similar to uniprot|P43682 Saccharomyces
                     cerevisiae YKL006C-A SFT1 Intra-Golgi v-SNARE required for
                     transport of proteins between an early and a later Golgi
                     compartment"
                     /codon_start=1
                     /product="KLTH0D06182p"
                     /protein_id="XP_002552990.1"
                     /db_xref="GeneID:8295220"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5DGL0"
                     /translation="MSNSRYAQLEGNNDQRLDELANKLSTFRRVNQEIGDEARADSSV
                     MDQLQNQFSSLMVNVKNSSSRLTRSMNAGNNIWRMVGLALLLFFIMYALFKLF"
     gene            <548471..>549058
                     /locus_tag="KLTH0D06204g"
                     /db_xref="GeneID:8295221"
     mRNA            join(<548471..548599,548771..>549058)
                     /locus_tag="KLTH0D06204g"
                     /product="60S ribosomal protein L14"
                     /transcript_id="XM_002552945.1"
                     /db_xref="GeneID:8295221"
     CDS             join(548471..548599,548771..549058)
                     /locus_tag="KLTH0D06204g"
                     /note="highly similar to uniprot|P36105 Saccharomyces
                     cerevisiae YKL006W RPL14A and to uniprot|P38754
                     Saccharomyces cerevisiae YHL001W RPL14B Protein component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="XP_002552991.1"
                     /db_xref="GeneID:8295221"
                     /db_xref="GOA:C5DGL1"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:C5DGL1"
                     /translation="MSSESIVKNSQWRLVEVGRVVLIKKGPSAGKLAAIVEIIDQKRA
                     LIDGPETNVPRQSVNLGHVVLTPLTFALPRGAKTAVVAKKWTSAGVAEKWAASSWAKK
                     IAQRERRAALSDFERFQVMVLRKQRRYAVKKAVAKA"
     gene            complement(<549266..>550918)
                     /locus_tag="KLTH0D06226g"
                     /db_xref="GeneID:8295222"
     mRNA            complement(<549266..>550918)
                     /locus_tag="KLTH0D06226g"
                     /product="KLTH0D06226p"
                     /transcript_id="XM_002552946.1"
                     /db_xref="GeneID:8295222"
     CDS             complement(549266..550918)
                     /locus_tag="KLTH0D06226g"
                     /note="weakly similar to uniprot|P36106 Saccharomyces
                     cerevisiae YKL005C BYE1 Negative regulator of
                     transcription elongation contains a TFIIS-like domain and
                     a PHD finger multicopy suppressor of temperature-sensitive
                     ess1 mutations probably binds RNA polymerase II large
                     subunit"
                     /codon_start=1
                     /product="KLTH0D06226p"
                     /protein_id="XP_002552992.1"
                     /db_xref="GeneID:8295222"
                     /db_xref="GOA:C5DGL2"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR012921"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DGL2"
                     /translation="MLAEGVRRSSRRNKGTNKYLQDQRTAELEYVKARAKKQEVEAED
                     HGISDAVRCLVCGTTDENYDEDNDPYGDMIQCDKCNSWQHIKCMMDQEEANEVETYFC
                     SICSPSSYPNIRYSIDPQSVVTKKHFIKTSKSDDEIEDFQEEISDEDANEYLGKDSTR
                     PKKRRKLDSPKNITKAPTGDQGCRLRDSALKMFKDLFTKYVIPDTIQAHRFQLPPEFS
                     CEQYADSLAAELEEELHATNIAQEESKLNGMYKEKVRVLFSNLKDQKNIEMKALVVNK
                     ALPFKKLVQMSVNELVNPDLKSFKEKVGSEALTQLILEQPHKPRYFKTHKGEELIEDP
                     NDYEPEDIIFNKDILITNRGTSSERSQHESPDKKSVKETSLRTRRESDQIQNNSNLDG
                     DEHSWKCTVDYKELNCKFSGSVKFIASSQEISYTVQRDAIGDSAFVVEGRLSDEEAEK
                     YIRQMADSRAFLVYAIRPDDVSHEVEAFEHLVDFLSSRQRYGALVSKRQYVRHVYVIP
                     RTETLQSEVFNHLHLNEIGSKLEAQKCLLVVLILRLDMLDLK"
     gene            <551316..>552560
                     /locus_tag="KLTH0D06248g"
                     /db_xref="GeneID:8295223"
     mRNA            <551316..>552560
                     /locus_tag="KLTH0D06248g"
                     /product="KLTH0D06248p"
                     /transcript_id="XM_002552947.1"
                     /db_xref="GeneID:8295223"
     CDS             551316..552560
                     /locus_tag="KLTH0D06248g"
                     /note="similar to uniprot|P36107 Saccharomyces cerevisiae
                     YKL004W AUR1 Phosphatidylinositol:ceramide phosphoinositol
                     transferase (IPC synthase) required for sphingolipid
                     synthesis can mutate to confer aureobasidin A resistance"
                     /codon_start=1
                     /product="KLTH0D06248p"
                     /protein_id="XP_002552993.1"
                     /db_xref="GeneID:8295223"
                     /db_xref="GOA:C5DGL3"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5DGL3"
                     /translation="MSEIFKRLFMSHRPANSKVSQLETSLNPTITLKKLRSYTPSLGD
                     LCHYAFLGSVLLFVLIVYPAALILKLSVYVLFGVLFLLPATSQFFFNALPIFTWLALY
                     FTSSTFEAKHRPPITVQVLPAIETILYGDNLSDILAASLNKPLDIFAWLPYGIFHFGA
                     PFVVAIILFLCGPPTLLRGYAFAFGYMNLAGVIMQNLLPAAPPWYKIQYGLTPANYKM
                     KGSPGGLKRIDEYLGISVYTEGFSNSAVIFGALPSLHSGCATMEALFFSYVFPKLKPL
                     FIFYVCWLWWSTMYLTHHYFVDLMAGSVLSYTIFQYTKYFHLPLPEPSVYSRWSYADI
                     KKFSVWQADPLNGDGGDLENLAVPLAVDTDFELNVMENSEPPSIFDQDRSVSRSSATS
                     NTSADVQDDFVSAARPGKQRID"
     gene            complement(<552705..>553133)
                     /locus_tag="KLTH0D06270g"
                     /db_xref="GeneID:8295224"
     mRNA            complement(<552705..>553133)
                     /locus_tag="KLTH0D06270g"
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /transcript_id="XM_002552948.1"
                     /db_xref="GeneID:8295224"
     CDS             complement(552705..553133)
                     /locus_tag="KLTH0D06270g"
                     /note="highly similar to uniprot|P28778 Saccharomyces
                     cerevisiae YKL003C MRP17 Mitochondrial ribosomal protein
                     of the small subunit MRP17 exhibits genetic interactions
                     with PET122 encoding a COX3-specific translational
                     activator"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /protein_id="XP_002552994.1"
                     /db_xref="GeneID:8295224"
                     /db_xref="GOA:C5DGL4"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:C5DGL4"
                     /translation="MSSSFVEKKCNSIMLYELVSIVRVVNPLAANTEAKELATTIGKL
                     IIQNRGVVRRVLPVGNKLLPKIIKKDQEQHFQGYHFLMLFDSSAAVQSEILRTLKKDP
                     RVIRSSIVKVDTSKQLDVASSIERAAGYSSILEKVKKDAF"
     gene            <553292..>554037
                     /locus_tag="KLTH0D06292g"
                     /db_xref="GeneID:8295225"
     mRNA            join(<553292..553351,553408..>554037)
                     /locus_tag="KLTH0D06292g"
                     /product="KLTH0D06292p"
                     /transcript_id="XM_002552949.1"
                     /db_xref="GeneID:8295225"
     CDS             join(553292..553351,553408..554037)
                     /locus_tag="KLTH0D06292g"
                     /note="highly similar to uniprot|P36108 Saccharomyces
                     cerevisiae YKL002W DID4 Class E Vps protein of the
                     ESCRT-III complex required for sorting of integral
                     membrane proteins into lumenal vesicles of multivesicular
                     bodies and for delivery of newly synthesized vacuolar
                     enzymes to the vacuole involved in endocytosis"
                     /codon_start=1
                     /product="KLTH0D06292p"
                     /protein_id="XP_002552995.1"
                     /db_xref="GeneID:8295225"
                     /db_xref="GOA:C5DGL5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DGL5"
                     /translation="MALFEWVFGKSLTPQERLKKNQRALERTQRELERERRKLEQQEK
                     KLISDIKKSAKDGQVTAAKIQAKDLVRTRKHISKFSNMKTQLQAISLRIQAVRSSDQM
                     TSSMREATGLLASMNRSMNLPQLQRISAEFEKQSDLMDQRQEFMDEAIDDVMGDELEE
                     DDEADEIVNRVLDEIGVDLNVKLQSTPQDAVEAPENGSSERVAESLTSNGLGTANADD
                     ELQARLNSLKR"
     gene            complement(<554066..>554713)
                     /locus_tag="KLTH0D06314g"
                     /db_xref="GeneID:8295226"
     mRNA            complement(join(<554066..554549,554601..>554713))
                     /locus_tag="KLTH0D06314g"
                     /product="KLTH0D06314p"
                     /transcript_id="XM_002552950.1"
                     /db_xref="GeneID:8295226"
     CDS             complement(join(554066..554549,554601..554713))
                     /locus_tag="KLTH0D06314g"
                     /note="similar to uniprot|Q02196 Saccharomyces cerevisiae
                     YKL001C MET14 Adenylylsulfate kinase required for sulfate
                     assimilation and involved in methionine metabolism"
                     /codon_start=1
                     /product="KLTH0D06314p"
                     /protein_id="XP_002552996.1"
                     /db_xref="GeneID:8295226"
                     /db_xref="GOA:C5DGL6"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGL6"
                     /translation="MSTNITWHPNLTYEERSGLRKQNGATVWLTGLSASGKSTIACAL
                     EQLLLSENVAAYRLDGDNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCTISITS
                     FISPYRVDRDRARVLHKDSGLKFVEVFVDVPLDVAEQRDPKGLYKKAREGIIKDFTGV
                     SAPYEAPDAPELHLRTDKQTVEECAQQIYLYLKKESII"
     misc_feature    555337..555463
                     /note="Centromere Klth0D"
     gene            complement(<555635..>557710)
                     /locus_tag="KLTH0D06358g"
                     /db_xref="GeneID:8295228"
     mRNA            complement(<555635..>557710)
                     /locus_tag="KLTH0D06358g"
                     /product="KLTH0D06358p"
                     /transcript_id="XM_002552951.1"
                     /db_xref="GeneID:8295228"
     CDS             complement(555635..557710)
                     /locus_tag="KLTH0D06358g"
                     /note="highly similar to uniprot|P21576 Saccharomyces
                     cerevisiae YKR001C VPS1 GTPase required for vacuolar
                     protein sorting, functions in actin cytoskeleton
                     organization via its interaction with Sla1p"
                     /codon_start=1
                     /product="KLTH0D06358p"
                     /protein_id="XP_002552997.1"
                     /db_xref="GeneID:8295228"
                     /db_xref="GOA:C5DGL7"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGL7"
                     /translation="MDEALISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLVLQLINRRSSKNLSSKPDKNELLELENEHPTKGQS
                     EDNADEWGEFLHIPGKKFYNFDEIRQEIVNETDKTTGKNAGISSVPINLRIYSPHVLT
                     LTLVDLPGLTKVPVGDQPADIEKQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKL
                     AREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEVKKT
                     IRSALEDEKRYFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKNKIELTLK
                     KYQAELMNLGPETMDSPNSIVLSMITDFSKEYTGILDGEAKELSSQELSGGARISFVF
                     HEIYKNGVRALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIKRFEEPS
                     LRLVSLVFDELVRILKQIISQPKYARYPGLREAMSNYFVQFLKEAIIPTNTFVSDIIQ
                     AERTYINTAHPDLLKGSQAMAMIEEKLHPRQVSVDPKTGKPLPNQAPQPQTQQNEEKS
                     SFFGGFFSSKNKKKLVALESPPPVLKATGQMTERETMETEVIKLLIESYFNIVKRTIA
                     DVIPKAVMLKLIVKSKNDIQKMLLEKLYGNQDLADLTKENDITIQRRKECHKMTEILR
                     NASDIVSSV"
     gene            <558139..>559923
                     /locus_tag="KLTH0D06380g"
                     /db_xref="GeneID:8295229"
     mRNA            <558139..>559923
                     /locus_tag="KLTH0D06380g"
                     /product="KLTH0D06380p"
                     /transcript_id="XM_002552952.1"
                     /db_xref="GeneID:8295229"
     CDS             558139..559923
                     /locus_tag="KLTH0D06380g"
                     /note="similar to uniprot|P29468 Saccharomyces cerevisiae
                     YKR002W PAP1 Poly(A) polymerase one of three factors
                     required for mRNA 3'-end polyadenylation forms
                     multiprotein complex with polyadenylation factor I (PF I)
                     also required for mRNA nuclear export may also
                     polyadenylate rRNAs"
                     /codon_start=1
                     /product="KLTH0D06380p"
                     /protein_id="XP_002552998.1"
                     /db_xref="GeneID:8295229"
                     /db_xref="GOA:C5DGL8"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="UniProtKB/TrEMBL:C5DGL8"
                     /translation="MNQQKTYGVTGPISTAGPTAAENQLNDALIQELKKEKSFESEED
                     TKKRVEVLRILQNLAQEFVYQVSKKRNMSDGMAKDAGGKIFTYGSYRLGVHGPGSDID
                     TLVVVPKHVTREDFFTVFDQILRTRSELEEIAPVPDAFVPIIKIKFSGISIDLICARL
                     DIAQVPVNLTLADKNLLRNLDEKDLRALNGTRVTDEILQLVPKPTSFKIALRAIKLWA
                     QRRAVYANIFGFPGGVAWAMLVARICQLYPNACSAVILTRFFHILTKWNWPQPVLLKP
                     IEDGPLQVRVWNPRIYAQDRSHKMPVITPAYPSMCATHNISESTKKVILAELERGAQI
                     SSEIFSNKKTWSDLFQKHDFFYKYKFYLTVMASTSGSSEQHLKWSGLVESKLRLLVQK
                     LETLGGINLAHPFTKPFEASYVYDNEAQCKDIIDNYGTHKAQDILAQYTEVTDDNKDT
                     DGVKDKAQVHITTMYIGLDVALDGKKQVDIHVPCSDFFNLCRSFSEYDDTDMFSLMIK
                     YVKLYDLPDNVYVEGEERPVKHSKRKKLGKDSKKSKRPKSNSLKAEEPTSGTTNSEKN
                     NSQGPNKPVKHEPPMQTSPNPLAGSQVN"
     gene            <560246..>561547
                     /locus_tag="KLTH0D06402g"
                     /db_xref="GeneID:8295230"
     mRNA            <560246..>561547
                     /locus_tag="KLTH0D06402g"
                     /product="KLTH0D06402p"
                     /transcript_id="XM_002552953.1"
                     /db_xref="GeneID:8295230"
     CDS             560246..561547
                     /locus_tag="KLTH0D06402g"
                     /note="highly similar to uniprot|P38755 Saccharomyces
                     cerevisiae YHR001W OSH7 Member of an oxysterol-binding
                     protein family with seven members in S. cerevisiae family
                     members have overlapping redundant functions in sterol
                     metabolism and collectively perform a function essential
                     for viability"
                     /codon_start=1
                     /product="KLTH0D06402p"
                     /protein_id="XP_002552999.1"
                     /db_xref="GeneID:8295230"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:C5DGL9"
                     /translation="MPLNKLKTRSAAVPGEPSSATNASSRSLVDTDDIDENDESGQSI
                     LLGIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDILLEAHQEKDDLMRFVG
                     VVKWYLSGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAFYFSEQTSHHPPKSSYFY
                     MIPESNIRVDGTTVPKSKFLGNSTAAMMEGLTVLQFLDIQDSEGHPEKFTLTQPNMYA
                     RGILFGKMRIELGDHMVIKSSQHKVDIEFKTKGFISGTYDAIEGTIKDQAGNEYFEIS
                     GKWNDIIYIRDLQKKTPKTVLFDASKAAPLKPLVRPLEEQGNFESRKLWKKVTDALAA
                     RDHATATEEKFKIEDYQRTLAKKRAESGSPFLPKLFRPASRQSDDLEFYIYKDIPEGG
                     SHEDQIRSILEIAPVLPGQKFTEKFEVPGQQKHKVQKQNST"
     gene            complement(<561640..>562842)
                     /locus_tag="KLTH0D06424g"
                     /db_xref="GeneID:8295231"
     mRNA            complement(join(<561640..562556,562614..>562842))
                     /locus_tag="KLTH0D06424g"
                     /product="KLTH0D06424p"
                     /transcript_id="XM_002552954.1"
                     /db_xref="GeneID:8295231"
     CDS             complement(join(561640..562556,562614..562842))
                     /locus_tag="KLTH0D06424g"
                     /note="weakly similar to uniprot|Q02202 Saccharomyces
                     cerevisiae YKR004C ECM9 Non-essential protein of unknown
                     function"
                     /codon_start=1
                     /product="KLTH0D06424p"
                     /protein_id="XP_002553000.1"
                     /db_xref="GeneID:8295231"
                     /db_xref="UniProtKB/TrEMBL:C5DGM0"
                     /translation="MKNSNLSKRLYDCLTDDYNNKQIRLVVLPDYFREGDSDGIVCVS
                     DGNAIEIICFRTFYLQVYSEARKVLNDRQSSQAAANEERYYLATTVLLLITPEDHSNI
                     RRHEELLLNRLKDKNCSGLWRRDEIAGAFVRRELQFVTSCLTSSLARVNKSPSLWLLY
                     RKLYIITNSLFPTIEANYEMCFSKSAEAHSSNYYSWHTLRWMFDVGSKQLKARLAEAT
                     ETFCFKHPKDSSAWWSLAHVLVSSFDTQKNSIAQQNMLTANYSLPPLSELIFGCASST
                     EIESKVKKIVEYIDYAEVSEYPPFQCLEKLFQNLNQTGQKAYVEKWLSQVEVFERENF
                     EIGESSALLSDRQLRENVLIQRDFKTLVMKKRFVQRLLPHNTPKSTP"
     gene            complement(<563713..>564462)
                     /locus_tag="KLTH0D06446g"
                     /db_xref="GeneID:8295232"
     mRNA            complement(<563713..>564462)
                     /locus_tag="KLTH0D06446g"
                     /product="KLTH0D06446p"
                     /transcript_id="XM_002552955.1"
                     /db_xref="GeneID:8295232"
     CDS             complement(563713..564462)
                     /locus_tag="KLTH0D06446g"
                     /note="similar to uniprot|Q02204 Saccharomyces cerevisiae
                     YKR006C MRPL13 Mitochondrial ribosomal protein of the
                     large subunit not essential for mitochondrial translation"
                     /codon_start=1
                     /product="KLTH0D06446p"
                     /protein_id="XP_002553001.1"
                     /db_xref="GeneID:8295232"
                     /db_xref="GOA:C5DGM1"
                     /db_xref="InterPro:IPR018305"
                     /db_xref="UniProtKB/TrEMBL:C5DGM1"
                     /translation="MLSNRIASCSVKRGLHVSASSKDFMSWFRRKQTAKPAAPIKKTE
                     ELINEVESGVGGAEAPLNRLKLTDEFFIGKSNLDLDRRERQSRVNEVPFNKWMSSEKL
                     KSSGVLDSILLESYNSTNSEFRAIAIADEKLALPFTDLVFKFHFSKALQSATGTLIPD
                     YQITRLQTPIAFRNYLLKEVVSGKLAKFRESEPNAIELGQGHYSSDSIHVVEDVRFSE
                     RKKKLSKILSEVEFLEREAARQAVEKARQAA"
     gene            <564646..>565104
                     /locus_tag="KLTH0D06468g"
                     /db_xref="GeneID:8295233"
     mRNA            <564646..>565104
                     /locus_tag="KLTH0D06468g"
                     /product="KLTH0D06468p"
                     /transcript_id="XM_002552956.1"
                     /db_xref="GeneID:8295233"
     CDS             564646..565104
                     /locus_tag="KLTH0D06468g"
                     /note="some similarities with uniprot|Q02205 Saccharomyces
                     cerevisiae YKR007W MEH1"
                     /codon_start=1
                     /product="KLTH0D06468p"
                     /protein_id="XP_002553002.1"
                     /db_xref="GeneID:8295233"
                     /db_xref="GOA:C5DGM2"
                     /db_xref="InterPro:IPR028209"
                     /db_xref="UniProtKB/TrEMBL:C5DGM2"
                     /translation="MGVIISCCFRDRSSEDEPLIQDSQRGYGANANNDYDALQRKLEQ
                     EEQKLLVREQELTEIVNSTNDKLIDISMMSNSGIVVQSHDLDNILGAESEDEHGRLDG
                     SGIQEGLKELGPPKLQRHHRDAMKKLYAELFSGLDDQLMIDTKEDLIVTL"
     gene            <565317..>566975
                     /locus_tag="KLTH0D06490g"
                     /db_xref="GeneID:8295234"
     mRNA            <565317..>566975
                     /locus_tag="KLTH0D06490g"
                     /product="KLTH0D06490p"
                     /transcript_id="XM_002552957.1"
                     /db_xref="GeneID:8295234"
     CDS             565317..566975
                     /locus_tag="KLTH0D06490g"
                     /note="similar to uniprot|Q02206 Saccharomyces cerevisiae
                     YKR008W RSC4 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex found in close
                     proximity to nucleosomal DNA displaced from the surface of
                     nucleosomal DNA after chromatin remodeling"
                     /codon_start=1
                     /product="KLTH0D06490p"
                     /protein_id="XP_002553003.1"
                     /db_xref="GeneID:8295234"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:C5DGM3"
                     /translation="MAPKKRKAQDADPTVETTDLQRRYAAGKQPRTEEQLPSVDYHVP
                     LDPESELFTENDWFIPKFNLFISFTLDNLVESYRNVFKDFIKLPSRKFHPGYFYKIDQ
                     PISINEIKSRDYEYLNGHRTFLLDIELIRKNCYSYNDSDSLIVKNSMQVVNYVKYEVL
                     KAKNVTRNYLINAEVKKFLQDTLAKVFDATDKSVAEMMGKPSEGFDTSLRICEPFVEL
                     VSKDELPEYYEVIHRPSALKLVRNNLEMDYYSKIYDFYIDMILVFENALVFNDPETLI
                     YQDAEKLLRFFRKLMQERFFVSLKDASERGEVKLEYDKFEYKQYLANGGDGDAAEMED
                     EDVELEDYDFNHYEGLGNGYNRTLFSGDYLLGPSKMKLNEMNPKRNVMEAAEELPEAP
                     KYNIFNSLAEDAEKKNEEEVAPYTFIREISVTSSKSQYKQDTAPVQGALPPLNQKWVE
                     YVFNGECLTKKNNMFSLTLPPIQTSASITAHLNYLPGANYNASLTVDKEKTNPAPNAV
                     AEGNESPIKFEVRLLEGNNNLEFTCEDQDTGNTESFKLWIVVLP"
     gene            <567443..>567811
                     /locus_tag="KLTH0D06512g"
                     /db_xref="GeneID:8295235"
     mRNA            join(<567443..567451,567584..>567811)
                     /locus_tag="KLTH0D06512g"
                     /product="KLTH0D06512p"
                     /transcript_id="XM_002552958.1"
                     /db_xref="GeneID:8295235"
     CDS             join(567443..567451,567584..567811)
                     /locus_tag="KLTH0D06512g"
                     /note="similar to uniprot|P37299 Saccharomyces cerevisiae
                     YHR001W-A QCR10 8.5 kDa subunit of the ubiqunol-cytochrome
                     c oxidoreductase complex"
                     /codon_start=1
                     /product="KLTH0D06512p"
                     /protein_id="XP_002553004.1"
                     /db_xref="GeneID:8295235"
                     /db_xref="InterPro:IPR019182"
                     /db_xref="UniProtKB/TrEMBL:C5DGM4"
                     /translation="MVAYVSKLAAKTAPHFGQLKLRNLIDYIPNLAIWGGASLAGVFV
                     FTEGWPKFQDTIYKKIPIMGPHWQVEIPPEDSPQ"
     gene            complement(<568047..>570752)
                     /locus_tag="KLTH0D06534g"
                     /db_xref="GeneID:8295236"
     mRNA            complement(<568047..>570752)
                     /locus_tag="KLTH0D06534g"
                     /product="KLTH0D06534p"
                     /transcript_id="XM_002552959.1"
                     /db_xref="GeneID:8295236"
     CDS             complement(568047..570752)
                     /locus_tag="KLTH0D06534g"
                     /note="similar to uniprot|Q02207 Saccharomyces cerevisiae
                     YKR009C FOX2 Multifunctional enzyme of the peroxisomal
                     fatty acid beta-oxidation pathway has 3- hydroxyacyl-CoA
                     dehydrogenase and enoyl-CoA hydratase activities"
                     /codon_start=1
                     /product="KLTH0D06534p"
                     /protein_id="XP_002553005.1"
                     /db_xref="GeneID:8295236"
                     /db_xref="GOA:C5DGM5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5DGM5"
                     /translation="MGDNKLSFKGRVVIITGAGGGLGRIYALEFAKRGAKVVVNDLGG
                     SLGGEGQNSRAADVVVSEISEKYKTEAVANYDSVTENAQGIVQAALDNFGRVDVIINN
                     AGILRDSSFVKMSSSAFASVVDVHLNGAYRLTKAAWPYMKEQGFGRIVNTCSPAGLYG
                     NFGQANYSAAKMGLVGLSETLAKEGYKYNIRVNCIVPLARSRMTEKVVPPPILKQLSP
                     EKIAPLVVYLTHESTEVTNSIFELAAGFYSQIRWERSSGQIFNPDAESFTAEAILNKW
                     PSICDYRDKPFNKTQHPTQLSDYNALIAKARDLPQNEQGSQSIKSLKDKVVIVTGAGG
                     GLGKSHALNFAKYGARVVVNDIRDPDSVVLAIEKAYGRGRAIPDKHDIVKNPNEVVET
                     ALKAFGTVDILVNNAGVLRDRSFAKMTDEEWDIVLKVHLFSTFGLSKAVWPVFLKQKR
                     GCIINTTSTSGIYGNFGQANYAAAKAAVIGLSKTLALEGLKHNIKVNVVAPHAETAMT
                     KTIFSKKELGNHFDPSQVSPFFVLLASKELDAKAGKPVTGQLFEVGGGWCGQTRWQRS
                     KGVVSLQPTPEFLRDNWRKVVDFSQYAHPSSAQDSTMAILQSVALESKSASSLASKKD
                     GFRYSERDVILYNLGLGCSSTELNYCYENDPNFQVLPTFAVIPFMTSGNSIKLESLVD
                     DFNYAFLLHGEQYIRLNKFPVPTKGTLKTKAEPIQVDDKGGKAALVVGGYQTVIAETN
                     EPLFYNEASFFIRGAHVPEEKRLKGNRPKFAVQSFKAPSSKPDFEKIVSTDPNQAAIY
                     RLSGDLNPLHIDPNMAKLAKFPRPILHGLCTLGITGKALFEKFGQYKEFKVRFTNAVY
                     PGDRLKIQAWKQQDGVIVFQTVDLDQNYVVLDNAAMKVVGSQANL"
     gene            complement(<570972..>572342)
                     /locus_tag="KLTH0D06556g"
                     /db_xref="GeneID:8295237"
     mRNA            complement(<570972..>572342)
                     /locus_tag="KLTH0D06556g"
                     /product="KLTH0D06556p"
                     /transcript_id="XM_002552960.1"
                     /db_xref="GeneID:8295237"
     CDS             complement(570972..572342)
                     /locus_tag="KLTH0D06556g"
                     /note="similar to uniprot|P38153 Saccharomyces cerevisiae
                     YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway clathrin associated
                     protein medium chain"
                     /codon_start=1
                     /product="KLTH0D06556p"
                     /protein_id="XP_002553006.1"
                     /db_xref="GeneID:8295237"
                     /db_xref="GOA:C5DGM6"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DGM6"
                     /translation="MFLSFYITDLKNALVFQHLLSYDSPTFMSLWTKLQAMAPESPND
                     DSWFKVSIGRSLQVYRFKSKANKLIYWCLATHQSNPLEPAVFLEGFDNTLLQYFDKDQ
                     LTISKMVNNQDRIALLLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNR
                     ISQRNTSQVLNIGDPAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKT
                     GELTSVRGVLDGVVDFRSHLSGNPVIALNLRLRGHDLGMPALHQCCLDSYQGRPDQLR
                     FVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGLVSPDYRTELGDLGDEFEVNLNIAGSQ
                     HAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTGTLPVL
                     RGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNIKPFKGVKYIAKT
                     GDFHLR"
     gene            <572515..>574866
                     /locus_tag="KLTH0D06578g"
                     /db_xref="GeneID:8295238"
     mRNA            <572515..>574866
                     /locus_tag="KLTH0D06578g"
                     /product="KLTH0D06578p"
                     /transcript_id="XM_002552961.1"
                     /db_xref="GeneID:8295238"
     CDS             572515..574866
                     /locus_tag="KLTH0D06578g"
                     /note="some similarities with uniprot|P18480 Saccharomyces
                     cerevisiae YBR289W SNF5 Involved in global regulation of
                     transcription subunit of the chromatin remodeling Snf/Swi
                     complex"
                     /codon_start=1
                     /product="KLTH0D06578p"
                     /protein_id="XP_002553007.1"
                     /db_xref="GeneID:8295238"
                     /db_xref="GOA:C5DGM7"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:C5DGM7"
                     /translation="MNNLQTNPFANIGTTSFSLSQVPQHILQNLTPVQLQMIQQKHQQ
                     LLMERQALMQQQQQQQQQQQQQQQQQQQQPQHHQNQQHPSMSQRHQPGELPQHQRQHQ
                     HQQQQQQHHLHQQQQQHQLKQQQQQQQLQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQ
                     QLQQQQITANAGQSTALPQQLNLAQRAQILKAKQQQLDTNQQQAASTPTGVPALNLPP
                     QIAQLPPHVQQRVLNNLKQQAAAKNNPAAVAAITAAQQQLAGRMSNHQSPTPPSAQFP
                     QQPIPQTPGLPTPPVPQASVPLPKFQTIFQDPPERQMSSHSHWSDKIERGELDIKEPD
                     SNLLIYEQTLKRDRENGEQLIKERTGYEPFSKYGFSHKEYLTRLLQDLNYIKEVKAAR
                     MKSITATTQGLVSKSIWGDGYSGYGNGFSNTVTSVSTGQTGPDGRQSTHYNVGEIYQQ
                     AMYESHEELVPVRLEFDAERDNFSLRDVFVWNKNEKIIKIEELVTEMLRDYRFARNDQ
                     FFETVVQSIKEQINEFQPDPFLENEGDRFGGDDLRIKIQLDIVVGQNQLMDAFEWDIS
                     NPSNSPEEFAETLSQELELPGEFSTAIAHSIREQVHMYHKSLSLTCYQFDGSTVEDED
                     IRSRLLPLVTLNEVFRNSMNTKVFTPSLLKVSHAELERLDRDKDRDTRRKRRQGRFNR
                     RGVGPGTAVTLNDGSLPDLSDVPKTFRIPVPSTILPGGVDLGPSVNSYRTESSSEYMA
                     RPPEPALEQPNPCCRIIDHNPGQYLLVRIKLPSKTDGAISQGV"
     gene            <574893..>575855
                     /locus_tag="KLTH0D06600g"
                     /db_xref="GeneID:8295239"
     mRNA            <574893..>575855
                     /locus_tag="KLTH0D06600g"
                     /product="KLTH0D06600p"
                     /transcript_id="XM_002552962.1"
                     /db_xref="GeneID:8295239"
     CDS             574893..575855
                     /locus_tag="KLTH0D06600g"
                     /note="similar to uniprot|P38356 Saccharomyces cerevisiae
                     YBR290W BSD2 Heavy metal ion homeostasis protein
                     facilitates trafficking of Smf1p and Smf2p metal
                     transporters to the vacuole where they are degraded
                     controls metal ion transport prevents metal
                     hyperaccumulation functions in copper detoxification"
                     /codon_start=1
                     /product="KLTH0D06600p"
                     /protein_id="XP_002553008.1"
                     /db_xref="GeneID:8295239"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:C5DGM8"
                     /translation="MACKFRKRILSIVHCIQITKRSRYKHKAPACCKRSEHMAELNLG
                     AGVVGRSSDAIPESDSHGQDAPQGQRGFASTLQENIMRSFDSVGKKFNVLDRLFKKNN
                     GTTGLQFGANADGVFSNLTAKPDESGSVELQDRDKPPNYEEAAADMAPSYYGMDEDGI
                     GMYYNEICFEGLPVGNVVNLLWNIIVSVSFQFVGFLLTYILHTSHAAKQGSRFGLGLT
                     FLGYGYSMIPNDVTSKVGKSKSISKLKPLDPNEFDDMHLYSGSATKDEFESSLSHGID
                     EKKSGIPFLAILLFVSGFSIMFKSIYDYVKVKRKERRYLTQEQV"
     gene            complement(<575930..>576823)
                     /locus_tag="KLTH0D06622g"
                     /db_xref="GeneID:8295240"
     mRNA            complement(<575930..>576823)
                     /locus_tag="KLTH0D06622g"
                     /product="KLTH0D06622p"
                     /transcript_id="XM_002552963.1"
                     /db_xref="GeneID:8295240"
     CDS             complement(575930..576823)
                     /locus_tag="KLTH0D06622g"
                     /note="highly similar to uniprot|P38152 Saccharomyces
                     cerevisiae YBR291C CTP1 Mitochondrial inner membrane
                     citrate transporter member of the mitochondrial carrier
                     family"
                     /codon_start=1
                     /product="KLTH0D06622p"
                     /protein_id="XP_002553009.1"
                     /db_xref="GeneID:8295240"
                     /db_xref="GOA:C5DGM9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DGM9"
                     /translation="MSQKRQVDPLHSFLAGALAGAAEASITYPFEFAKTRLQLVDKSS
                     TASRNPLTLIYRTAKSQGVGALYVGCPAFIVGNTAKAGVRFLGFDAIKNVLRDPQTGE
                     LSGPRGIVAGLGAGLLESVVAVTPFEAIKTALIDDKQSANPKYHNNGRGMLRNYSNLV
                     YDQGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTMIQEYTNAPKDKPLSSGLTFVVG
                     AFSGIVTVYTTMPIDTVKTRMQSLNSSKYSSTLNCFSTVFREEGLKTFWKGATPRLGR
                     LILSGGIVFTIYEKVLIILGA"
     gene            <578225..>579274
                     /locus_tag="KLTH0D06644g"
                     /db_xref="GeneID:8295241"
     mRNA            <578225..>579274
                     /locus_tag="KLTH0D06644g"
                     /product="KLTH0D06644p"
                     /transcript_id="XM_002552964.1"
                     /db_xref="GeneID:8295241"
     CDS             578225..579274
                     /locus_tag="KLTH0D06644g"
                     /note="similar to uniprot|P38702 Saccharomyces cerevisiae
                     YHR002W LEU5 Mitochondrial carrier protein involved in the
                     accumulation of CoA in the mitochondrial matrix homolog of
                     human Graves disease protein does not encode an isozyme of
                     Leu4p as first hypothesized"
                     /codon_start=1
                     /product="KLTH0D06644p"
                     /protein_id="XP_002553010.1"
                     /db_xref="GeneID:8295241"
                     /db_xref="GOA:C5DGN0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002167"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DGN0"
                     /translation="MCNADNNNEIRASPEARMVDKYSAHYILRSGLAGGIAGSCAKTL
                     IAPLDRIKILFQTSNPHYLKYSGSMLGLVQAGFHINARDGIRGFYQGHSATLIRIFPY
                     AAIKFIAYEQIRNVMIPSKEYETHARRLASGSLAGLCSVFMTYPLDLIRVRLAYVTDH
                     RRIRMLPIIKQIYTERASESLTSKPFVPQWFAHWCNFYRGFTPTVLGMIPYAGVSFFA
                     HDLCGDILRSSVLAPYSVLHVSNEELSMRSKKQNNRPLKTWAELVAGGLAGMASQTAS
                     YPFEIIRRRLQVSVVSPTSIHEFQSIPDMIRVIYKERGWRGFFVGLSIGYIKVTPMVA
                     CSFFVYERMKWYLAI"
     gene            complement(<579343..>580686)
                     /locus_tag="KLTH0D06666g"
                     /db_xref="GeneID:8295242"
     mRNA            complement(<579343..>580686)
                     /locus_tag="KLTH0D06666g"
                     /product="KLTH0D06666p"
                     /transcript_id="XM_002552965.1"
                     /db_xref="GeneID:8295242"
     CDS             complement(579343..580686)
                     /locus_tag="KLTH0D06666g"
                     /note="similar to uniprot|P36101 Saccharomyces cerevisiae
                     YKL027W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D06666p"
                     /protein_id="XP_002553011.1"
                     /db_xref="GeneID:8295242"
                     /db_xref="GOA:C5DGN1"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DGN1"
                     /translation="MAQDSQWKLIAATAIFAAATTKFVDTLVQNYQTHGTILPKGEAT
                     ASVKPKGALIEEYNEDLIREQLARNYAFLGEEGMEALKGQNIVVVGAGGVGSWVVTML
                     VRSGVYKIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLEEIAPWCEIDAVHE
                     LWNKENAERLLFGEDGKEKPTFVIDCIDNIDTKVDLLEFVYRNEIPVISSMGAATKSD
                     PTRINVGDLTNTEEDPLARSVRRRLKQRGITKGIAVVFSAEKPDPRKASLLPLPEDEF
                     QKGKVDELSALKDFRVRILPVLGTMPGVFGLTIATWVLTKIAGYPMEPIEGKNRIKIY
                     DGIYQSLAGQMSRIGMPDQRVPIALKEIGYICEEVFRGKSPVSGFSTRLTLSKWDPEK
                     PVSLQNVVLLTKEEQKEHERRVLNGGERLEDCYSADVLELVAKRFKEEEYYSQFR"
     gene            complement(<580861..>582213)
                     /locus_tag="KLTH0D06688g"
                     /db_xref="GeneID:8295243"
     mRNA            complement(<580861..>582213)
                     /locus_tag="KLTH0D06688g"
                     /product="KLTH0D06688p"
                     /transcript_id="XM_002552966.1"
                     /db_xref="GeneID:8295243"
     CDS             complement(580861..582213)
                     /locus_tag="KLTH0D06688g"
                     /note="similar to uniprot|P36100 Saccharomyces cerevisiae
                     YKL028W TFA1 TFIIE large subunit involved in recruitment
                     of RNA polymerase II to the promoter activation of TFIIH
                     and promoter opening"
                     /codon_start=1
                     /product="KLTH0D06688p"
                     /protein_id="XP_002553012.1"
                     /db_xref="GeneID:8295243"
                     /db_xref="GOA:C5DGN2"
                     /db_xref="InterPro:IPR002853"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR017919"
                     /db_xref="InterPro:IPR024550"
                     /db_xref="UniProtKB/TrEMBL:C5DGN2"
                     /translation="MDRPIDDIVKNLLKFVVRCFYPGAYVLVLDAILFHSVLSEEDLA
                     HLLGIKRPELRGLLTKLLEDRMLAVHSQQEFHFNTRSIKRYYYYIKYPQAIDAIKWKV
                     HQIVSRLKDDLDKNSAPQGYMCPICQSKYSQLEAVSLLNYEKTQFLCSLCEEPLVEDD
                     SGKKSKEKQIKLNRLMDQVQPIIDYLKKIDDSRIEENTFESSLARLIPPQNNSVASYT
                     VNPRSKKSKMFTPGDNSNSALDNASSRRAGAKSQATLHVNITTASDEQARNEQEEKEM
                     EEKRKQNALPAWHEQSTVGKTALGKLDGDEDVADGAQIPNGNGPEHSDDPADTQATPV
                     AEDIPEPAPQLTQKEIEEREAERTLADYYAQLAKKQALEDEDDDGEDDEVDEGVEFED
                     VGSDNENEGTSPSENVTTSQEVASQVTESKAAEESSANNRKQTEEVDDDDMDAEFEDV
                     "
     gene            complement(<582430..>584265)
                     /locus_tag="KLTH0D06710g"
                     /db_xref="GeneID:8295244"
     mRNA            complement(<582430..>584265)
                     /locus_tag="KLTH0D06710g"
                     /product="KLTH0D06710p"
                     /transcript_id="XM_002552967.1"
                     /db_xref="GeneID:8295244"
     CDS             complement(582430..584265)
                     /locus_tag="KLTH0D06710g"
                     /note="weakly similar to uniprot|P53389 Saccharomyces
                     cerevisiae YNR055C HOL1 Putative ion transporter similar
                     to the major facilitator superfamily of transporters;
                     mutations in membrane-spanning domains permit nonselective
                     cation uptake"
                     /codon_start=1
                     /product="KLTH0D06710p"
                     /protein_id="XP_002553013.1"
                     /db_xref="GeneID:8295244"
                     /db_xref="GOA:C5DGN3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DGN3"
                     /translation="MTQFLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGD
                     DAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSIL
                     AAGSKGLALEFHRSLSDISYLVGGMMLALALGSIIASPCAVIFGKRIVYLVGIIIFFF
                     GSIGCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTLLLLG
                     GKNLVPLLASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRE
                     TAIARAADGARDVAISGYSAPKFQGEEDASLSKSLSPELLKSVTPTQSHRYLSRVRTK
                     IKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLI
                     MVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGI
                     YEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITF
                     TVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA
                     IPLYHYGKRARRWTDSKGLLDFSYVKKNHSRGSTGDRHMEDSYQS"
     gene            <585777..>587738
                     /locus_tag="KLTH0D06732g"
                     /db_xref="GeneID:8295245"
     mRNA            <585777..>587738
                     /locus_tag="KLTH0D06732g"
                     /product="KLTH0D06732p"
                     /transcript_id="XM_002552968.1"
                     /db_xref="GeneID:8295245"
     CDS             585777..587738
                     /locus_tag="KLTH0D06732g"
                     /note="similar to uniprot|P36013 Saccharomyces cerevisiae
                     YKL029C MAE1 Mitochondrial malic enzyme catalyzes the
                     oxidative decarboxylation of malate to pyruvate which is a
                     key intermediate in sugar metabolism and a precursor for
                     synthesis of several amino acids"
                     /codon_start=1
                     /product="KLTH0D06732p"
                     /protein_id="XP_002553014.1"
                     /db_xref="GeneID:8295245"
                     /db_xref="GOA:C5DGN4"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR015884"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DGN4"
                     /translation="MSARVESVIKTSIRIGRLARLYTSGSPMNLASTTRDNTFGNGAE
                     CGDPAHLKLEPVGSQAKAMLKDPVPKQTRLFVEGPIECPMEGFQLLNSPLFNKGSAFT
                     QEEREAFGLEGLLPPMVNTLDEQVERAYKQLCYLKTPLAKNDFMTSMRVQNKVLYFEL
                     VRRHIRELVPIIYTPTEGDAIAAYSHRFRKPEGVFLDITEPDSIERRLAAYGTSKDVD
                     YVVVSDSEGILGIGDQGIGGIRIAISKLALMTLCAGIHPGRVLPVCLDVGTNNKKLAR
                     DELYMGNRFSRIRGAQYDEFVDKFIKALKKRFPSAVLHFEDFGVTTARPLLDRYRGEL
                     ACFNDDIQGTGAVVMASLLAALKHTKRELADVKVLVYGAGSAGLGIADQIKNHMVTYG
                     LTVEEARSKIYLMDRRGLIMKSMESSSSPAQFLYAKPDEKWSGVNTSSLLEVVSKVKP
                     TCLIGCSTQAGAFNKAVVQEMHKHNPRPIIFPLSNPTRLHEAVPEDLMKWTNFEALVA
                     TGSPFPPVEGYRISENNNCFSFPGIGLGAVLSRATAITDTMISAAVDQLAALSPMTEN
                     DSKPGLLPPLEVINDTSSKVATAVILQALKEGTARIEEEDVPGSEEKVKVPRDFESCL
                     KWVTKQMWKPEYRPMVKVQHDPNVFTHQV"
     gene            complement(<588021..>590504)
                     /locus_tag="KLTH0D06754g"
                     /db_xref="GeneID:8295246"
     mRNA            complement(<588021..>590504)
                     /locus_tag="KLTH0D06754g"
                     /product="KLTH0D06754p"
                     /transcript_id="XM_002552969.1"
                     /db_xref="GeneID:8295246"
     CDS             complement(588021..590504)
                     /locus_tag="KLTH0D06754g"
                     /note="highly similar to uniprot|P40897 Saccharomyces
                     cerevisiae YJL212C OPT1 Plasma membrane transporter that
                     transports tetra- and pentapeptides and glutathione member
                     of the OPT family"
                     /codon_start=1
                     /product="KLTH0D06754p"
                     /protein_id="XP_002553015.1"
                     /db_xref="GeneID:8295246"
                     /db_xref="GOA:C5DGN5"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:C5DGN5"
                     /translation="MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQV
                     VEHGENSSDSSSLGQELSPGGSHVTYLSRGHLANEGAGAEGKTEQEIIEEEELTEQTV
                     WEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYP
                     SLSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSS
                     TAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTL
                     ISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVL
                     WGPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVL
                     FFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPL
                     FVPFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDC
                     PDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVG
                     LNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ
                     IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSP
                     GRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYT
                     LYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGN
                     NVYKNTYDHNYRKFYNLKKGEKFGYDKWW"
     gene            complement(<591149..>592378)
                     /locus_tag="KLTH0D06776g"
                     /db_xref="GeneID:8295247"
     mRNA            complement(<591149..>592378)
                     /locus_tag="KLTH0D06776g"
                     /product="KLTH0D06776p"
                     /transcript_id="XM_002552970.1"
                     /db_xref="GeneID:8295247"
     CDS             complement(591149..592378)
                     /locus_tag="KLTH0D06776g"
                     /note="similar to uniprot|P38757 Saccharomyces cerevisiae
                     YHR004C NEM1 Protein of the nuclear envelope required for
                     the spherical shape of the nucleus required for normal
                     sporulation"
                     /codon_start=1
                     /product="KLTH0D06776p"
                     /protein_id="XP_002553016.1"
                     /db_xref="GeneID:8295247"
                     /db_xref="GOA:C5DGN6"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DGN6"
                     /translation="MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQ
                     KRKRARWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEG
                     DSKSEASAGTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDK
                     GRRQPLQPQQQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLN
                     RRKRRTLVLDLDETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLF
                     LTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLS
                     VVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTD
                     IRNVLALKSGEHAFTNV"
     gene            complement(<594639..>594974)
                     /locus_tag="KLTH0D06798g"
                     /db_xref="GeneID:8295248"
     mRNA            complement(<594639..>594974)
                     /locus_tag="KLTH0D06798g"
                     /product="KLTH0D06798p"
                     /transcript_id="XM_002552971.1"
                     /db_xref="GeneID:8295248"
     CDS             complement(594639..594974)
                     /locus_tag="KLTH0D06798g"
                     /note="some similarities with uniprot|Q6Q5F4 Saccharomyces
                     cerevisiae YPR015C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D06798p"
                     /protein_id="XP_002553017.1"
                     /db_xref="GeneID:8295248"
                     /db_xref="GOA:C5DGN7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DGN7"
                     /translation="MQRQPASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAP
                     KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK
                     QLGLRRGST"
     gene            <596520..>597302
                     /locus_tag="KLTH0D06820g"
                     /db_xref="GeneID:8295249"
     mRNA            <596520..>597302
                     /locus_tag="KLTH0D06820g"
                     /product="KLTH0D06820p"
                     /transcript_id="XM_002552972.1"
                     /db_xref="GeneID:8295249"
     CDS             596520..597302
                     /locus_tag="KLTH0D06820g"
                     /note="some similarities with uniprot|Q04751 Saccharomyces
                     cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
                     involved in acetylation of the N-terminal residues of
                     histones H4 and H2A"
                     /codon_start=1
                     /product="KLTH0D06820p"
                     /protein_id="XP_002553018.1"
                     /db_xref="GeneID:8295249"
                     /db_xref="GOA:C5DGN8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DGN8"
                     /translation="MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQH
                     EERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYG
                     AGRQSWPARKRAEMETPGLVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFE
                     IHVSDIIRGQGLGTHLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGM
                     HVAAWSPQDRRAQVRRRTRAIAYDSSLVTRPAYYILFWPAAS"
     gene            <597659..>599179
                     /locus_tag="KLTH0D06842g"
                     /db_xref="GeneID:8295250"
     mRNA            <597659..>599179
                     /locus_tag="KLTH0D06842g"
                     /product="KLTH0D06842p"
                     /transcript_id="XM_002552973.1"
                     /db_xref="GeneID:8295250"
     CDS             597659..599179
                     /locus_tag="KLTH0D06842g"
                     /note="some similarities with uniprot|P54785 Saccharomyces
                     cerevisiae YMR070W MOT3 Nuclear transcription factor with
                     two Cys2-His2 zinc fingers involved in repression of a
                     subset of hypoxic genes by Rox1p repression of several
                     DAN/TIR genes during aerobic growth and repression of
                     ergosterol biosynthetic genes"
                     /codon_start=1
                     /product="KLTH0D06842p"
                     /protein_id="XP_002553019.1"
                     /db_xref="GeneID:8295250"
                     /db_xref="GOA:C5DGN9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DGN9"
                     /translation="MLSVHPYTSPADIDRDARRGSSQLDFRRRSSASSVASIGGAAAG
                     GGPAQSPTSALWAAAPAPAPAPPLVPPAAVSSTVHRQPQYSVAQMHSQAYAIRQKHAR
                     ASSTDSSGTPIPGPAAAVTTPGPASVPAPVTAAQQQPPPPPIGGPLYELMEYDTRYLP
                     YHYKSAYPMWGPAGPTAAAAGTAPGTAPGAPGAAYPAYQYPPPAWNSYQAPHHVWNGQ
                     PAASSGGYPHMQLQIPTQLPQQPQMTTSQQQQQQQQQQQQQPHQPQQPQQQYQFQQQP
                     QQPQQPSLHRQSISHRQSQGFSADQFPSALAATELPLSAYAPDPRSGAQLAGRPYVVA
                     AAPGPAAASAPFGLGAVGIGAGAGAGARGPAPYSGTGSDRGSFDDTGSSMAMLYRCSM
                     CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQELMEA
                     GDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIARVHDGEPGQ"
     gene            complement(<599324..>599905)
                     /locus_tag="KLTH0D06864g"
                     /db_xref="GeneID:8295251"
     mRNA            complement(join(<599324..599756,599835..>599905))
                     /locus_tag="KLTH0D06864g"
                     /product="KLTH0D06864p"
                     /transcript_id="XM_002552974.1"
                     /db_xref="GeneID:8295251"
     CDS             complement(join(599324..599756,599835..599905))
                     /locus_tag="KLTH0D06864g"
                     /note="highly similar to uniprot|Q04767 Saccharomyces
                     cerevisiae YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa
                     Integral membrane vesicle protein"
                     /codon_start=1
                     /product="KLTH0D06864p"
                     /protein_id="XP_002553020.1"
                     /db_xref="GeneID:8295251"
                     /db_xref="GOA:C5DGP0"
                     /db_xref="InterPro:IPR019365"
                     /db_xref="UniProtKB/TrEMBL:C5DGP0"
                     /translation="MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIA
                     NLFHVSAVIVFGIIAIVQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYV
                     GMAAVQWCSLAVMATSLIAVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHE
                     AVVREML"
     gene            <600181..>602175
                     /locus_tag="KLTH0D06886g"
                     /db_xref="GeneID:8295252"
     mRNA            <600181..>602175
                     /locus_tag="KLTH0D06886g"
                     /product="KLTH0D06886p"
                     /transcript_id="XM_002552975.1"
                     /db_xref="GeneID:8295252"
     CDS             600181..602175
                     /locus_tag="KLTH0D06886g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D06886p"
                     /protein_id="XP_002553021.1"
                     /db_xref="GeneID:8295252"
                     /db_xref="GOA:C5DGP1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017921"
                     /db_xref="UniProtKB/TrEMBL:C5DGP1"
                     /translation="MSDSASESGRSLAEEESEDELIMSAFDASFEKIGRGFPRISFPS
                     IWGAKSAGPGTKDEVEGDFGRWSRRFQMNTFLNDLQKGLSFSNALTRLQTVKAITEEA
                     ISNAINSSDTGHGDNSASREDGDADKPEVPAGVVPAAKPKNVPAYNDMVIPQGKGPQV
                     LDEHLLKLTELPSDQNNDEATLRQRIQHIRSLDLGPAKTAAMMQRLMMGKFVDELNRP
                     SPTPTLEAPLTRDPSEAEKAPTYHNTGALGCAHYQRNCKLQCHQCLGWYTCRFCHDES
                     PEISGSSHPHSFQRAETRQVMCMRCNHVQAPQKDCENCDEEFAMYFCPECKLYDNDET
                     KDIYHCAKCGICRLGLGLGLDFFHCDGCQACLSIELQGNHKCIERATMSSCPICGDFM
                     FTSVKPVVYMSPCGHAIHQHCFDEYTKHSYKCPSCQVSILNMEAQFRVLDKEIEEQPL
                     PAPYCDWICYVSCNDCKAKSTCKYHILGLRCGNCMSYNTSQLKLVKPEEAATHDNAAE
                     FDTITQSNSSFDSLNVMRQELLRGQFQREEVSPLITVEKGGMLSNIEQYMNGYFHDDT
                     QGASEGASADHGDFSSQNLFNTAGFFKNNNRNENQSGDATVGSSSMARAPSLTERLRQ
                     FINDAPPQLSISDAFQKFIQGSHQGLSSGDEDDCSSQASA"
     gene            <603521..>604666
                     /locus_tag="KLTH0D06908g"
                     /db_xref="GeneID:8295253"
     mRNA            <603521..>604666
                     /locus_tag="KLTH0D06908g"
                     /product="KLTH0D06908p"
                     /transcript_id="XM_002552976.1"
                     /db_xref="GeneID:8295253"
     CDS             603521..604666
                     /locus_tag="KLTH0D06908g"
                     /note="some similarities with uniprot|P33417 Saccharomyces
                     cerevisiae YKL032C IXR1 Protein that binds DNA containing
                     intrastrand cross-links formed by cisplatin contains two
                     HMG (high mobility group box) domains which confer the
                     ability to bend cisplatin-modified DNA mediates aerobic
                     transcriptional repression of COX5b"
                     /codon_start=1
                     /product="KLTH0D06908p"
                     /protein_id="XP_002553022.1"
                     /db_xref="GeneID:8295253"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:C5DGP2"
                     /translation="MNVPNVGTGISPPPKGSSNHGSIPNTNNSLQDQLLPYPDLDPTA
                     HQQPSQQVSSKLQQLGPQIHHIPQQQPVHQGVQTNAGHPDIPVQADIYGQALQAHLQT
                     PQQQHHQQQHQQQQQQQQQQQQQQFSDAMFNSFLTQIGQRQVANVLNTFNAGAHSMNA
                     AMNSAMVTQPAQRFFHAAMNTPSMMEMTHPAMMQPTPQFQLQVPPPIAKKMSASQSRI
                     EKRKMLKKQGPKRPSSAYFLFSMAVREDLVREYPDAKVPELSKLASAKWKEMSDEDKK
                     PYHVKFKENWEKYRIARKEYESSLPPKRPSGPFIQFTQEVRPQIIRENPQKDLIEITK
                     LIGEKWRSLSPVDKRTYTDTYKRKLKEWEEQYPEEASPTTPKDVLGE"
     gene            complement(<604805..>605419)
                     /locus_tag="KLTH0D06930g"
                     /db_xref="GeneID:8295254"
     mRNA            complement(<604805..>605419)
                     /locus_tag="KLTH0D06930g"
                     /product="KLTH0D06930p"
                     /transcript_id="XM_002552977.1"
                     /db_xref="GeneID:8295254"
     CDS             complement(604805..605419)
                     /locus_tag="KLTH0D06930g"
                     /note="weakly similar to uniprot|Q04772 Saccharomyces
                     cerevisiae YMR073C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D06930p"
                     /protein_id="XP_002553023.1"
                     /db_xref="GeneID:8295254"
                     /db_xref="GOA:C5DGP3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5DGP3"
                     /translation="MVESESEGQGFQGSFRKPSPFKAQPPAINPRTTSRLMRPPAGGD
                     FRVPTQAGCSTLGAGGYRNKVVLKPGHSALDWSELSVKKGSQGLLITGIAKLLADPEI
                     QQLNSPQALMALQHNVPTFKIYPPIKVTKAQLQKHNTAEDCWCVLNQRVYCVSSYLDF
                     HPGGAEILLRTAAGKDATALFNKYHRWVNYERLLETCLVGVYVP"
     gene            <608167..>609231
                     /locus_tag="KLTH0D06974g"
                     /db_xref="GeneID:8295255"
     mRNA            <608167..>609231
                     /locus_tag="KLTH0D06974g"
                     /product="KLTH0D06974p"
                     /transcript_id="XM_002552978.1"
                     /db_xref="GeneID:8295255"
     CDS             608167..609231
                     /locus_tag="KLTH0D06974g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D06974p"
                     /protein_id="XP_002553024.1"
                     /db_xref="GeneID:8295255"
                     /db_xref="UniProtKB/TrEMBL:C5DGP4"
                     /translation="MCSNEECRAILPKKERELLLKAAKVEKTRDDGTTVVGFPRVKCD
                     GMMLIDDSREDLYNQHRKPGFCNSCKATHSMSWYNDNVYKGKRICHNCNTYQCYTQAR
                     CQNEACSLIHHSKHLTEIKLNYRRETGKNAGIEAVLKCIKCQGPVAIDKTKTIRDRKV
                     PYKPGACLTCDRRSERKWKRIPWDKVSSQRMCGKCEARYRKTATRCLNTGCSHIHTIG
                     EVAKMENMGKIKAHLPDGTIVLGHPCVKCGCTTYKDTSMKLSCRKKAEAGQMCYSCKS
                     QIKGVAELVAWDKQNPERLCRACFWRYHTYKAHCDSAECSLVPNKEGLDALKKKGPIE
                     VCEETPVKKVYHAPCPKCKG"
     gene            complement(<609406..>611460)
                     /locus_tag="KLTH0D06996g"
                     /db_xref="GeneID:8295256"
     mRNA            complement(<609406..>611460)
                     /locus_tag="KLTH0D06996g"
                     /product="KLTH0D06996p"
                     /transcript_id="XM_002552979.1"
                     /db_xref="GeneID:8295256"
     CDS             complement(609406..611460)
                     /locus_tag="KLTH0D06996g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D06996p"
                     /protein_id="XP_002553025.1"
                     /db_xref="GeneID:8295256"
                     /db_xref="GOA:C5DGP5"
                     /db_xref="InterPro:IPR000269"
                     /db_xref="InterPro:IPR015798"
                     /db_xref="InterPro:IPR015801"
                     /db_xref="InterPro:IPR016182"
                     /db_xref="UniProtKB/TrEMBL:C5DGP5"
                     /translation="MHIFDPISDAEIRTTARLLKDLNGDAKVHFVQIDRLDPPKKQAL
                     RYLSVERHGGAPLPRIPRRTYAYYYLNDRMPLYKALCNVSDGRVIANQATPEGTVGPL
                     LPEDVEAVEAAILAHPAVQAEIAKLKLDALSYNHSALGPLGYSVVCEPWMYGTDSPHD
                     KIPLIQAYMYLKLDHPEANHYSIPLKFSPVFEYLTHAFVRIDYLPSGADESLVHNTLP
                     HTVLPTVEYHPELLEDVPPRDGLKPLIVSQPEGASFTVDGSKITWQDWEFRVATNVRE
                     GLAIYDVHFKGRSLFYRASLEEMTVPYGDSRAPFHRKQAFDLGDCGFGNSANSLALGC
                     HCLGVIKYLDTRRSDSEGNPVLIPSTVCMHEQDYGILYLHKNYRNGKTVTTRRREFVV
                     QTIATVANYEYILNFVFDQAGAITVQVRATGILSTMPNDDNNVTDFGTIVGPGVTAAY
                     HQHLLSFRFDTRIDGDKNTVVYDDYVPMEENTAMNPYNVGFRQVRSYMDKSGYIDQSP
                     FTNRTYKVINENSINPVTMKPVGYKFEMPAKQMILASKNSYNVKRAHYATKQFWVSKY
                     HDDQLYAAGEFTNQSQGDTGLSKWADGTESVRNTDTVVWATLALTHPPVTEQFPVMTS
                     DFMQFLVTPASFFTKNPALDVPLANNNFNKSVYYEDAQKAAGLATGESQSSSASCCKS
                     NI"
     gene            complement(<611733..>612215)
                     /locus_tag="KLTH0D07018g"
                     /db_xref="GeneID:8295257"
     mRNA            complement(join(<611733..612048,612118..>612215))
                     /locus_tag="KLTH0D07018g"
                     /product="KLTH0D07018p"
                     /transcript_id="XM_002552980.1"
                     /db_xref="GeneID:8295257"
     CDS             complement(join(611733..612048,612118..612215))
                     /locus_tag="KLTH0D07018g"
                     /note="some similarities with uniprot|Q04773 Saccharomyces
                     cerevisiae YMR074C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D07018p"
                     /protein_id="XP_002553026.1"
                     /db_xref="GeneID:8295257"
                     /db_xref="GOA:C5DGP6"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="UniProtKB/TrEMBL:C5DGP6"
                     /translation="MDPELQALREARLAELKNHANPAAAAAPGRPQKSAADADAVAAL
                     LQPQALERLSRVALVRPERARAVEAYLQQLAARGQLSRKVSEPEIVDILNGVARDEQR
                     RSTTRIIFDRRDARDASIVTPNGAVTSDDDDDFFD"
     gene            <612872..>614896
                     /locus_tag="KLTH0D07040g"
                     /db_xref="GeneID:8295258"
     mRNA            <612872..>614896
                     /locus_tag="KLTH0D07040g"
                     /product="KLTH0D07040p"
                     /transcript_id="XM_002552981.1"
                     /db_xref="GeneID:8295258"
     CDS             612872..614896
                     /locus_tag="KLTH0D07040g"
                     /note="similar to uniprot|Q04779 Saccharomyces cerevisiae
                     YMR075W RCO1 Nuclear protein of unknown function"
                     /codon_start=1
                     /product="KLTH0D07040p"
                     /protein_id="XP_002553027.1"
                     /db_xref="GeneID:8295258"
                     /db_xref="GOA:C5DGP7"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DGP7"
                     /translation="MSDPARHPPERSGSPGEPATRARRTISLNVDYNLKKRRIIPSED
                     ARPRKNRPVGRPPGRPPGRPAGSKTASSTPSSTPSSSAASSLSPQDENHRAPQSVIQH
                     DATGAVQFHEPESVDPVNGMTGLPLSAGPPEKVKKESLWSYRKGAGASASASTNASVN
                     AATPAPSESSASVSAPASASASADVETPASSEDAYRARLQTQESEQRTRPSSLRAIAT
                     PKDIYRTKRQYRKRSAEPRARHFPTHTKIKASTTKENKLFGQNSITNQKALAPPLASS
                     AEAAVENDDFCASCRQPGIFLCCDTCPKSFHFACCNPPLDPDNLPEGDWSCAECQFRI
                     RCPNKAAAHRLEKDYLAQLERSKGITLFGKLLFRLEFTNPKQYLPPHPIRDAFADVRT
                     GSHGEYADNSMREPLNEKQIFGSGYGQSLTKMDQYNPELHVDPESGELLVCFKCRKSK
                     MGTLDHPEDERLITRCDYCNTPWHLDCVPHVPRASFKNLGSKWMCPLHADSSIPHQER
                     RLARHQRHFTPANRYRVPNDGDIDVQLDEISVPVSKDALKEDKINKELAILQLPESSI
                     KIDFVDKIYRAKSALMDKHFRQQQALIDNTMHSKPSLLSDARPLLYFSLQDNSQLRKL
                     WDFKELCRVATKELEVPELDSAEISELQTLRKLLESKSKEEVMEFLGIKL"
     gene            complement(<615021..>618899)
                     /locus_tag="KLTH0D07062g"
                     /db_xref="GeneID:8295259"
     mRNA            complement(<615021..>618899)
                     /locus_tag="KLTH0D07062g"
                     /product="KLTH0D07062p"
                     /transcript_id="XM_002552982.1"
                     /db_xref="GeneID:8295259"
     CDS             complement(615021..618899)
                     /locus_tag="KLTH0D07062g"
                     /note="similar to uniprot|Q04264 Saccharomyces cerevisiae
                     YMR076C PDS5 Protein required for establishment and
                     maintenance of sister chromatid condensation and cohesion
                     colocalizes with cohesin on chromosomes in an
                     interdependent manner may function as a protein-protein
                     interaction scaffold"
                     /codon_start=1
                     /product="KLTH0D07062p"
                     /protein_id="XP_002553028.1"
                     /db_xref="GeneID:8295259"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DGP8"
                     /translation="MLTRLVSDALHVIKLNRPEQAGNTADYSLMVGSKSRLESDFSII
                     STIKNNIPTQQLLIRLERLHEELSNLKQESVDLRSLERYRADLIDRKILRNKDHGVRA
                     FAACCLSDILRLYAPDAPYTDKELTEIFRLFLAQLKLLQEPENGYLTQQTYLINNLLE
                     YRSIVILTDLPSSSQLVEELFNIFYSPTNSTIQGNMFTAIGGILGEVISECDSLPMSA
                     LKMVFNKFLSHKRAESLDGINYKKDPGFEISLIICQTYSNRLGRHFIKFYSEIMYEVL
                     GESDIHEKGIASSAYKTLVKIGNLTSELWKYAPELVGSVTGLLYQLLCSDNELFRESA
                     TKCVSKMLGTHSLINFAVAHSDTYKIWLSKMADISPHVRQAWVSEIPSILMSRSDLSD
                     DISKGLAKALIDSDHTVRLSAIQTFHEVPVKRLWECLPNAAVFAGLVHLTRETRRDLR
                     DECIDAVARIYTESIESIPKTNENKEIWGVVETIPSACFNLYYINDLEINMKVDLLTF
                     EKFLPLGLSNEEFVQRLLTLLQGFNEKAFSSFYAFNRRQDQMSTVLWKFIEFCEETNS
                     QSPAASLSDTKLIKTVEWISSGFPSHLNVEQILLAFRELNDRRLYRLIKVAVAETSKH
                     LTVRNAVSELFKRLEEPELFRKKNIKIESRFTRDNFSTVFRVLIYRAAPIIFNISNLP
                     SFLNTSDSSNEDEKALKRQLIDNISIIKPGIFKDQVKNLVTIITEGETTGPGNTLSLA
                     EAMRTVYKISKDKREHLDIEENTFFFQKLEDYAKEGNPLEAKYAIKLLGLAPNAAEYL
                     SEVATAILPLDLKSKHFASNVLVLAEITKMQPQLLEKDSTEIVGLLIKDVLLSNDVVG
                     DEDDQQAWFSDEDIYTGKADALSAKVFSLKLFANKIKVMAPDAHADEMTHAFTERTLK
                     LFFYLVASGGELVSESNTDNYPTPANYQNKLRCCAGLHILKITKIASLSRFIKPQDIS
                     KLMNLVEDESLEVRSSFIGRLKDFLGDGSISIKFLPLVFFTAYEPDQALRTSTKMWIN
                     YTLSKENFRKGTFFERALPRLIHFIAHHPDVAEGLRLRETAFLTGLTTAIDYLVFYAD
                     SVLKASNLALLYYLAGRVRQYRDAVTEEDNEGEDEDEDEETDQTSHNSSSNIYIISEL
                     AQLVLGEFKEHHEWTLSSYPGKLNLPSDLFEPFESIDEARKNTFETYLRTEDTRSLRK
                     VIAAKVSRLYRRTNVHKPLVQKRKNPESSSRPRKRAQASVHSDAELEGESEDDSYVPS
                     RSRRGAVGETRKSSRPKKAVDYADDESEED"
     gene            complement(<619124..>621115)
                     /locus_tag="KLTH0D07084g"
                     /db_xref="GeneID:8295260"
     mRNA            complement(<619124..>621115)
                     /locus_tag="KLTH0D07084g"
                     /product="KLTH0D07084p"
                     /transcript_id="XM_002552983.1"
                     /db_xref="GeneID:8295260"
     CDS             complement(619124..621115)
                     /locus_tag="KLTH0D07084g"
                     /note="some similarities with uniprot|P38750 Saccharomyces
                     cerevisiae YHL008C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D07084p"
                     /protein_id="XP_002553029.1"
                     /db_xref="GeneID:8295260"
                     /db_xref="GOA:C5DGP9"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR024002"
                     /db_xref="UniProtKB/TrEMBL:C5DGP9"
                     /translation="MSEDEYYISPHETALAVVATAMKKARLTLTTLALNSLAGGVLFS
                     TGGLLYTSWHGSNQAILENDPGVLNFLGAFTFSIGLFYVVINGTDLFNSNILFFSVAA
                     LRGAVSIYDLLISWTVSWIGNFTGTLFVVYVMCHLSGTTSSADLVSFTHQMVAKKDSS
                     SFIQTFIKGIAGNFYVSLAIYLQLMAKPLHVKYLMMTLPIFTLVAAGFTHVVAEMFLL
                     MVGMFNGAELSIGTFVWKHMVAVTLGNIIGGSAFALVIPYYLHLVVVEQDRKRLALPS
                     YEARDEQPEINMDSRVVRVPTQEAEKVEEEAEENEEMTSEEKANLELASSDSSAEDRK
                     AAPPVEYRPRLSSTSLSRTYSNLRRLNTNKSYSSVRSVKSLPHRTPTGVFPVKGMASP
                     VRTNSGIPPQKREESQGLGRFSRPLSRRSSQTSSLRLSKTLGSSRRNSISVLQRPGGA
                     FAHRSKSLPHIGLVGERTHFGTNDVLEEKMGTKLERALTRITSRVSREGRNSPGFGLP
                     STTQDIFPTSTGLGLHESDATASFSMDDHSSSSMLDGLPANGRRSRTPSIQKTSIQDL
                     YLKPSTSDNLSGAINETSGSKSPPTQPQGKNSPSDGTSQKSTSSRSIPTIRRPSSIYV
                     PDAVDQRNSVYNAGYKNTLLRNHMTPDNDYDEEQSIKDA"
     gene            complement(<621467..>624595)
                     /locus_tag="KLTH0D07106g"
                     /db_xref="GeneID:8295261"
     mRNA            complement(<621467..>624595)
                     /locus_tag="KLTH0D07106g"
                     /product="KLTH0D07106p"
                     /transcript_id="XM_002552984.1"
                     /db_xref="GeneID:8295261"
     CDS             complement(621467..624595)
                     /locus_tag="KLTH0D07106g"
                     /note="similar to uniprot|P36097 Saccharomyces cerevisiae
                     YKL033W Protein of unknown function localized to the
                     cytoplasm."
                     /codon_start=1
                     /product="KLTH0D07106p"
                     /protein_id="XP_002553030.1"
                     /db_xref="GeneID:8295261"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ0"
                     /translation="MASRESVAFQRVQPHCVNLSRQSFLPRDVFNPNSVVLLEGLRSL
                     EEELKQLENEGVSLSPKFADYVFVPIASLLRQDSLGSSQTEALLQVIGHLVSLCWSSA
                     GSFNKALAQQLFALVTFLISNDKDNTCLLTKTPSFQLTGCIVLRKLFKAFAIQKASGS
                     FDHFADPQNLPSLGHSVTILLDILGGNDNEIDLQLAAIEALHVLYQETLNDGEIISFI
                     VPGNVSAFSKLLLKPGLTVNPRVVCSTLRLFAVIICIVYSDFDLHVVEHSPSDLNELL
                     EEAEKPFETNIAINEVDFKNRNLHRDIKWLRATSAQINRALKGVLPKLVKRDNGSINL
                     ALCEFISALMKHCRASLNNCQKLFFSVALELHYVPGELVQTLEGTRTLKLMVDNKVTR
                     ISNAIQFEDIKALQTIQYGLQTLYSYQCLDFEMVDGLVFSLKSCVSDFLEQKNLRFTE
                     GKLKEQGGMVIVGQDFLTLTETSQPLLPKISTALEETLSQLLHTLGTCYSRDHIQGTV
                     SELLTFDGSESGFGKAVSLWMSANLLKAASEVLPDAHDITDEFMTFENDERKVADLPL
                     EPIETCYAILESSVALIDEVNQNSAALHHDSEFQVVVGLKSIQIMSETLGEEFRTELI
                     DILFPVVDCLASPSSAIRHFAQTTTLSIAKSFYGGSIHDLLLDNIDYLVDAISVRLNN
                     CMTKRVPTLLMVLCRVGGYNLIKSFKDVLEIIFRLLDFYHGYEDLCCEFFQLFEVIVT
                     EMRHTYLSSTDVSPRLKNEHSVSSSFKPWGMQNILQVLDILDKTGEKGIHEEDFDDLD
                     SNQDDPGTFQEFFDKRVHEVDSDDEDEDIQPTEGQSTSSGHASDKWFSPIPRDSYRLL
                     LQIVGYGDRLLTHPSRQLKVQILQLMSRVFPMLATQHDMLLPQVSKSWDIIVQLSLDP
                     DFAIAKVACECLRELIHCSGDFVTKRFVDLWGAQKAHSPLLGIAAPKGVAPTLSSKKW
                     LTSPKQFPPITREALVSLSEMLLEGIVQTELFTSEVQIQEMVYCCLLVLPKEHVQSRS
                     LLLGDIVSLLSL"
     gene            complement(<624863..>626494)
                     /locus_tag="KLTH0D07128g"
                     /db_xref="GeneID:8295262"
     mRNA            complement(<624863..>626494)
                     /locus_tag="KLTH0D07128g"
                     /product="KLTH0D07128p"
                     /transcript_id="XM_002552985.1"
                     /db_xref="GeneID:8295262"
     CDS             complement(624863..626494)
                     /locus_tag="KLTH0D07128g"
                     /note="similar to uniprot|P32487 Saccharomyces cerevisiae
                     YNL268W Lysine permease; one of three amino acid permeases
                     (Alp1p, Can1p, Lyp1p) responsible for uptake of cationic
                     amino acids"
                     /codon_start=1
                     /product="KLTH0D07128p"
                     /protein_id="XP_002553031.1"
                     /db_xref="GeneID:8295262"
                     /db_xref="GOA:C5DGQ1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ1"
                     /translation="MSLKNDQEVEVIGIATSQSLSSDTQDAGALNRGHVRENLNRSLT
                     PRHINMISIAGVIGTGLYLGTGKALANGGPASLLINYGIIGLVVYLIMLCLGEMSTFM
                     PISGSFCSYAKKFGSGSLAFTLMCNYWFNDAVSVASDLTALQLILDYWKNPNSHFPYW
                     AASLIFWFALLLLNVVHVRVYGEAEYWLALLKVIAIIMFFIISIIVNAGHNSDHAYIG
                     FKNWGVGDAPFVNGFKGFASLFVSSSFAFGGTESITLTAGEAVNPVRNTPKIIKTVFW
                     RILIFYVFTAFFIGMNVPYNYPNLSEKSVMTSPFTIVFQMVGSRGAGSFMNAVILTSV
                     ISAGNHALFAGSRVLFNIGLEGYFFPSFITKTNRYQVPYVAVLITWAAGGLCFGSSFI
                     GAGTLWTWLQNIVGVSNQLAWLCISVISIRFRRGLARQGKTHELQFVNWTYPYGPYFL
                     VVFVTFIIFVQGWSSFAPWSVSDFFSYYIELIVFVALYAFWWLWKRDSFVKSDEMDFV
                     TDKYVSPEEEVLLNERLDNLKGWKKVRQVVDEYFV"
     gene            <627115..>628737
                     /locus_tag="KLTH0D07150g"
                     /db_xref="GeneID:8295263"
     mRNA            <627115..>628737
                     /locus_tag="KLTH0D07150g"
                     /product="KLTH0D07150p"
                     /transcript_id="XM_002552986.1"
                     /db_xref="GeneID:8295263"
     CDS             627115..628737
                     /locus_tag="KLTH0D07150g"
                     /note="similar to uniprot|P38748 Saccharomyces cerevisiae
                     YHL010C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D07150p"
                     /protein_id="XP_002553032.1"
                     /db_xref="GeneID:8295263"
                     /db_xref="GOA:C5DGQ2"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ2"
                     /translation="MSIVLGSAQVFIRPKKPCMSFRYRLVIELDVLNEAKKAHEFWIR
                     DEQETTTESTTVRSDLEDSATEDWRHEDVKIGIMNAMSQRDNFIEAEFSSPGIVRLFK
                     IGEEKPDAGTAGDSVLRIPGDDTMISVLFVPSYLSARDLLHSFLGDAVTSRVSHFRII
                     RSNKDAGYSFILLMKFRDPESAALFKEQYNGRNFNQMDPETCHVIRIKEVVFQERLFP
                     KPQSAGSQFLMNDPFTGHKETGDVELPTCPVCLERLDSEVTGLATIPCQHTFHCQCLN
                     KWKDSRCPVCRYSGLKVTKSSLLRQGVRCSTCGANENLWICLICGNVGCGRYNFKHAV
                     QHFKDTAHFFSMDVATQRVWDYAGDNYVHRLVQNEVDGKLVEVGSSSSRDSSGKRDKE
                     YHLEYVQVLLSQLESQREYYESKLRQLEINEEELKSVHSLQQQIQELKLQAVVTRSKS
                     EHKVNEMRKQLEEERLLSRALQKNLDHLSNTIGDLQKQQEQSVIENQELKEQVTDLMF
                     FLESQEKLKDADESVKQGTLVMKPKKNSRKKK"
     gene            <629258..>630220
                     /locus_tag="KLTH0D07172g"
                     /db_xref="GeneID:8295264"
     mRNA            <629258..>630220
                     /locus_tag="KLTH0D07172g"
                     /product="KLTH0D07172p"
                     /transcript_id="XM_002552987.1"
                     /db_xref="GeneID:8295264"
     CDS             629258..630220
                     /locus_tag="KLTH0D07172g"
                     /note="highly similar to uniprot|P38689 Saccharomyces
                     cerevisiae YHL011C PRS3
                     5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase
                     involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="KLTH0D07172p"
                     /protein_id="XP_002553033.1"
                     /db_xref="GeneID:8295264"
                     /db_xref="GOA:C5DGQ3"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ3"
                     /translation="MATNSIKLLAPDVHRGLAELVAKRLGLKLTDTKLKRDPTGEVSF
                     SIGESVRDQDIFIITQIGSGVVNDRVLELLVMINACKTASARRITSVLPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVVTMDLHASQIQGFFDVPVDNLYAEPSVVRYIRE
                     HINFNEAIIISPDAGGAKRAAALADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLAKAAEVLLDNRAKGVIAIVTHGVLSGKAIENINNSKLDRVVCTNT
                     VPFEEKMKLCPKLDVIDVSAVLAESIRRLHNGESISYLFKHSPL"
     gene            complement(<630316..>630987)
                     /locus_tag="KLTH0D07194g"
                     /db_xref="GeneID:8295265"
     mRNA            complement(<630316..>630987)
                     /locus_tag="KLTH0D07194g"
                     /product="KLTH0D07194p"
                     /transcript_id="XM_002552988.1"
                     /db_xref="GeneID:8295265"
     CDS             complement(630316..630987)
                     /locus_tag="KLTH0D07194g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D07194p"
                     /protein_id="XP_002553034.1"
                     /db_xref="GeneID:8295265"
                     /db_xref="GOA:C5DGQ4"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ4"
                     /translation="MDGLLINTEDIYTLVTNEILTEYGKGPLTWDLKVQLQGLPGPEA
                     CRKVLDHFQLPVTPQEFDRKNIELQCKMWPKCSFLPGALDLIRYLHSKNIPIALCTSS
                     AKHKFEGKTSHLKHGFELFDAIVTGDDPRIPPGRGKPFPDIWLVGLKELNNKFKANIQ
                     PEECLIFEDGVPGVTAAKAAGGYVVWIPHPDAYDVLGDTDAILDGKGELISSLVHLDK
                     AKFGL"
     gene            complement(<631219..>633462)
                     /locus_tag="KLTH0D07216g"
                     /db_xref="GeneID:8295266"
     mRNA            complement(<631219..>633462)
                     /locus_tag="KLTH0D07216g"
                     /product="KLTH0D07216p"
                     /transcript_id="XM_002552989.1"
                     /db_xref="GeneID:8295266"
     CDS             complement(631219..633462)
                     /locus_tag="KLTH0D07216g"
                     /note="similar to uniprot|P36096 Saccharomyces cerevisiae
                     YKL034W TUL1 Transmembrane Ubiquitin Ligase"
                     /codon_start=1
                     /product="KLTH0D07216p"
                     /protein_id="XP_002553035.1"
                     /db_xref="GeneID:8295266"
                     /db_xref="GOA:C5DGQ5"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ5"
                     /translation="MEIDGNTILFIFVILYFLYSSPSGDGVTSQYEYNQLQTLRAQYN
                     DEHSQFANMTLSENFRNITGLKLSYEDVLKSPGINATYPIAGKDYNHWSSNQGHMILP
                     ESVITEIREDVWSGKEGVFPPNITSTLHGLIKLDSNKDYQKVPMPVPEYYEPPHDFSQ
                     NFNDPYVDDGTLSNGQHNVTFNEGQVVIEIKAADTALAYSDARRPSFFNSQSDRWRML
                     HVNLHFSDFHDEEKHSINSRAVYDIKRGRILAISESAKFHSLFAFPHYMSLKEDDKLV
                     FDEVKLLVEEYWNASNFVDTRTMNYLQESYAVANYKCEFLAYFQLSPWSAYSPEQLKV
                     IDDELTWPLGRRANLSSLPPINISSGIVYSPDCGINLRVSSVSGPRYELHVRKMRDTL
                     LFGIVLLASQIYLLLIQMQHTNTPSMVNKISYWCFSLMNSVDGSLAIIFFFMTSAIPE
                     LYLPLVICSFACLILASVFEMRYLISIYASQANEQNVSFTTLLRRNTGSEERNAPTVI
                     PDEATISSHMYRRYILMMFLSMVLILSVATWSRRIRTPFECVAFFVLNSYWVPQIARN
                     AIKGNEPRRRRASPGESQAPRQNKMPLLWSFVIGTSIIRFLPVAYVFTVPSNIFYHHR
                     DIRYVVIVALWILFQIVILYSQDIMGARWFLPKYTIPEGYSYHKGISSADLLEHGSSP
                     NYSIDCAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVC
                     RAPLPPL"
     gene            complement(<633807..>635306)
                     /locus_tag="KLTH0D07238g"
                     /db_xref="GeneID:8295267"
     mRNA            complement(<633807..>635306)
                     /locus_tag="KLTH0D07238g"
                     /product="KLTH0D07238p"
                     /transcript_id="XM_002552990.1"
                     /db_xref="GeneID:8295267"
     CDS             complement(633807..635306)
                     /locus_tag="KLTH0D07238g"
                     /note="highly similar to uniprot|P32861 Saccharomyces
                     cerevisiae YKL035W UGP1 UDP-glucose pyrophosphorylase or
                     UTP-glucose-1-phosphate uridylyltransferase EC:2.7.7.9"
                     /codon_start=1
                     /product="KLTH0D07238p"
                     /protein_id="XP_002553036.1"
                     /db_xref="GeneID:8295267"
                     /db_xref="GOA:C5DGQ6"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ6"
                     /translation="MMQAKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSVKDEDT
                     RSKFEGELDSFFSLFRRYLVEKASGSTLEWDKIKSPNPEEVVDFSVIEQQPENVSNLS
                     KLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNS
                     FNTDADTAHLIKKYSANRIRIRSFNQSKFPRVYKDSMLPVPSSYNDELDSWYPPGHGD
                     LFESLHASGELDALIAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTR
                     ADVKGGTLISYDGQVRLLEVAQVPKEHVDEFKNIRKFKNFNTNNLWINLKAVKKLVES
                     SSLEMEIIPNQKTINRGGHEINVLQLETACGAAIRHFQGAHGVVVPRSRFLPVKTCSD
                     LLLVKSDLFCLEHGALKLDPSRFGPNPLIKLGSHFKKVSGFHARIPHIPKIVELDHLT
                     ITGNVFLGKGVTLKGTVIIVCSEGQRIDIPNGSVLENVVITGNLQILEH"
     gene            complement(<635598..>638537)
                     /locus_tag="KLTH0D07260g"
                     /db_xref="GeneID:8295268"
     mRNA            complement(<635598..>638537)
                     /locus_tag="KLTH0D07260g"
                     /product="KLTH0D07260p"
                     /transcript_id="XM_002552991.1"
                     /db_xref="GeneID:8295268"
     CDS             complement(635598..638537)
                     /locus_tag="KLTH0D07260g"
                     /note="some similarities with uniprot|P32862 Saccharomyces
                     cerevisiae YKL038W RGT1 Glucose-responsive transcription
                     factor that regulates expression of several glucose
                     transporter (HXT) genes in response to glucose binds to
                     promoters and acts both as a transcriptional activator and
                     repressor"
                     /codon_start=1
                     /product="KLTH0D07260p"
                     /protein_id="XP_002553037.1"
                     /db_xref="GeneID:8295268"
                     /db_xref="GOA:C5DGQ7"
                     /db_xref="InterPro:IPR001138"
                     /translation="MSASRRESEPKEAETSPEAGGAASDRRRSKTSRACDQCREKKTR
                     CDFSDERPICSACQRMGKTCTFERVPMKRGPTKGYTRNSEPPEGFDTSRRGSRKRSSS
                     DVFKGDAGRPRADPVSLPPLAQYLPQSGSQPRLQPLLAPGAQPQQQFWKVPYYEYQHQ
                     RRGSIDSLGSDVSNRNGSEQLAYLPSNASSGSQFYPASQAQYASQLPSDVEGANPEDC
                     RGSLSLPAIQKFQQPPSGYYLQYPYSQFSMLPQQQQQQQQQNAQQSYFTSQYVPPAAP
                     PGAEHFKEFDEGFHSRKGSDVSVAVSPSSPVQVTRTQQAGLNSESRDTNTATAVSPKP
                     LPKPSKPQMQTERSSSKSDGNHNGPRKQKRKNSNRNKPGSQSSIESIASSSHASIIYG
                     KIPDKQLIDIYFEFIHPNFPVIPINKETLTDDLLLVNTQPISPVHELNTYILHWFRNS
                     LELLVRVALKKPSGSGQAYSDGAVDILDSQATFINALNECFQRIVDIHPGLRENEKLL
                     SLKTKFIYLATFSILNYILAFVGYDNSFVLGMSVTIYNECKLYRYLMYDELPSNDTEA
                     SENEDEAGAGDAHASGTPERGKSAKHDLGHQVLFKRLYVLLVVFDSLQSCAFGVPKLI
                     SVPLAELTEETFKFSTGKWCVERDPQRFETIRQSLVLGQVLSWLSISRKSVRRNSLQA
                     APQDASWKDEKSDSVSSSLFAKFLVQKHEMMEDFLLLAPLENSSHLLTFDLLSKSSTA
                     ICGLISSMHRLLALLMKINPTNSVDPNNRPPLRQGDFVHTDTEIQSESSNPPAATAAP
                     DSCDADKFDVYRKLLGLNGGQERHVAQGTISPFVISIVVEIRNVLELVKHLPTSIIGV
                     VVNLLPNGEGENYQKRSHRLVMSLSNAMNELVQITSLISLLKPFKMFDHTLRSNRPSA
                     KVSTKLLRQKFAPESVKTPSSQPPSSSPGPNSDGSNNTSLSQNTVMHAILDAAWDLMD
                     GEELGWL"
     gene            639477..639548
                     /locus_tag="KLTH0D07282r"
                     /db_xref="GeneID:8295269"
     tRNA            639477..639548
                     /locus_tag="KLTH0D07282r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT) cove score=75.85"
                     /db_xref="GeneID:8295269"
     gene            <639765..>640724
                     /locus_tag="KLTH0D07304g"
                     /db_xref="GeneID:8295270"
     mRNA            <639765..>640724
                     /locus_tag="KLTH0D07304g"
                     /product="KLTH0D07304p"
                     /transcript_id="XM_002552992.1"
                     /db_xref="GeneID:8295270"
     CDS             639765..640724
                     /locus_tag="KLTH0D07304g"
                     /note="similar to uniprot|P38747 Saccharomyces cerevisiae
                     YHL013C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D07304p"
                     /protein_id="XP_002553038.1"
                     /db_xref="GeneID:8295270"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ8"
                     /translation="MDTEEAILARHRAEKKDLQNKIAGMKKQATKSKRKQVNSRCEEL
                     EHDLLQRQEKELQTFRNEGSSDKQASNEPLQESSDDEITPEKLLAQLELGVSAQNSPS
                     VDADKQQTAPQPKKRRNRQKERLAKRDAEMARIREAAAQEAAVQPNLKQIEQDALDQL
                     CDVKGVKQFDIKPDGHCLFASILDQVWLRHPTDAQYFIPSGYDGPHLPRDLDVRALRS
                     LSSNYIRQYRDDFVPYLFDEATMSIKDVDDYTKTMEETAQWGGEVELLALAKVLKCCI
                     SVMMSGRATHMINEQEVANPELKLVYYKHSFALGEHYNSLHDS"
     gene            <640849..>642096
                     /locus_tag="KLTH0D07326g"
                     /db_xref="GeneID:8295271"
     mRNA            <640849..>642096
                     /locus_tag="KLTH0D07326g"
                     /product="KLTH0D07326p"
                     /transcript_id="XM_002552993.1"
                     /db_xref="GeneID:8295271"
     CDS             640849..642096
                     /locus_tag="KLTH0D07326g"
                     /note="similar to uniprot|P38746 Saccharomyces cerevisiae
                     YHL014C YLF2 Protein of unknown function, has weak
                     similarity to E. coli GTP-binding protein gtp1"
                     /codon_start=1
                     /product="KLTH0D07326p"
                     /protein_id="XP_002553039.1"
                     /db_xref="GeneID:8295271"
                     /db_xref="GOA:C5DGQ9"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGQ9"
                     /translation="MFLATTQRFYSAAKGPVRLGRPSNNLTSGIVGLANVGKSTFFQA
                     ITNSKLGNPANYPFATIEPEEAKVVVPSEQLDHLQKLYASSKKVPAVLTIYDIAGLTR
                     GASKGEGLGNKFLNDIRHVDGIFQVVRGFADPEITHIEGTVSPIRDLSIVQDELVLKD
                     LEFLEGIREKLDRKISKAAKSSGEFKYMSAELELLNALEDHMYEGKKIAHFKDDWTPE
                     EVSILNKHNFLTAKPTIVLLNVSPKNFLLQQNKYLNDVNDWMENYSPGDQVLLFSAEF
                     ETKFNEFMADNDVEGLDLYCKLQSGGEVDHKETCLPRLIHEMRKALGLISFYTCGPLE
                     ARQWTIREGTLAPQAAGVIHTDLEKTFISANITKFSDLAFMAPPLKESQLKAQALVKR
                     GGKQYEMEDGDVVLFKAAGAASR"
     gene            complement(642151..642248)
                     /gene="SNR69"
                     /locus_tag="KLTH0D07348r"
                     /db_xref="GeneID:8295272"
     ncRNA           complement(642151..642248)
                     /ncRNA_class="snoRNA"
                     /gene="SNR69"
                     /locus_tag="KLTH0D07348r"
                     /product="snR69"
                     /note="C/D snoRNA monocistronic SNR69"
                     /transcript_id="XR_002432184.1"
                     /db_xref="GeneID:8295272"
     gene            complement(<642839..>643195)
                     /locus_tag="KLTH0D07370g"
                     /db_xref="GeneID:8295753"
     mRNA            complement(<642839..>643195)
                     /locus_tag="KLTH0D07370g"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_002552994.1"
                     /db_xref="GeneID:8295753"
     CDS             complement(642839..643195)
                     /locus_tag="KLTH0D07370g"
                     /note="similar to uniprot|P38701 Saccharomyces cerevisiae
                     YHL015W RPS20"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_002553040.1"
                     /db_xref="GeneID:8295753"
                     /db_xref="GOA:C5DGR0"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:C5DGR0"
                     /translation="MSDFQKEKGEQQEQPQIHKIRITLTSTKVKQLENVSANIIKNAE
                     NYKLVKKGPVRIPTKVLKITTRKAPNGEGSKTWDTYEMRIHKRYIDLQAPAQIVKRIT
                     QITIEPGVDVEVTVAA"
     gene            <643756..>645102
                     /locus_tag="KLTH0D07392g"
                     /db_xref="GeneID:8295273"
     mRNA            <643756..>645102
                     /locus_tag="KLTH0D07392g"
                     /product="KLTH0D07392p"
                     /transcript_id="XM_002552995.1"
                     /db_xref="GeneID:8295273"
     CDS             643756..645102
                     /locus_tag="KLTH0D07392g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D07392p"
                     /protein_id="XP_002553041.1"
                     /db_xref="GeneID:8295273"
                     /db_xref="InterPro:IPR012469"
                     /db_xref="UniProtKB/TrEMBL:C5DGR1"
                     /translation="MTIEAVEYLKSIKSVRDTTSQVFNFAVSNGGGHYFDLDLGQMPR
                     VADFLCEIVKRDYGTEYASIPPHGRWQHLNHGHPGRVEGLIAQWRDSGVDEVEVARKL
                     VDLLVFSVLVDAGAGNSWKFTVPGSSTSVGRSEGLAVASYYLFVEGSLSDDRDDPYKV
                     TGRALSNFDAELFSRGFQVSEANPLAGAPGRVSLIQRLGAALLARPDIFGAEARPGAL
                     VDYLYAKSTVTSDAAGATSPTIDLQDVWDALMQGLTSIWPAGRTVVNGEPLGDAWRLD
                     TKAAASSDHTPAGVPSDIVTFHKLTQWLCYSLLVPLERYGYKFRISNKSLQTGLPEYR
                     NGGLFYDFGVLKLKSDALKGGLAFSAQLRDAGHDASDTIPTFEPHQGAIVEWRCLTVG
                     LLDSLLPLVNKKLEYELGLPQLIEAGSWKAGREIAAKLRPATGGPPIELYSDGTVF"
     gene            <645479..>647713
                     /locus_tag="KLTH0D07414g"
                     /db_xref="GeneID:8295274"
     mRNA            <645479..>647713
                     /locus_tag="KLTH0D07414g"
                     /product="KLTH0D07414p"
                     /transcript_id="XM_002552996.1"
                     /db_xref="GeneID:8295274"
     CDS             645479..647713
                     /locus_tag="KLTH0D07414g"
                     /note="similar to uniprot|P33413 Saccharomyces cerevisiae
                     YHL016C DUR3 Plasma membrane urea transporter expression
                     is highly sensitive to nitrogen catabolite repression and
                     induced by allophanate the last intermediate of the
                     allantoin degradative pathway"
                     /codon_start=1
                     /product="KLTH0D07414p"
                     /protein_id="XP_002553042.1"
                     /db_xref="GeneID:8295274"
                     /db_xref="GOA:C5DGR2"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR019900"
                     /db_xref="UniProtKB/TrEMBL:C5DGR2"
                     /translation="MPSSLEGSPSIETFKQEMALIESPLPQGAGYAVVVGLGFVFAFG
                     MILTTYMLKRYQKEIITAEEFATAGRTVKTGLIAAAVVSSWTWAATLLQSTAMVYKVG
                     ISGGYYYGAGACFQIIAFAALAIKAKQRAPNAHTFLEIIYARYGKVAHICYLFYALAT
                     NILVTAMLLTGGSAVVNDLTGMNTVAACFLLPLGVIVYTLFGGIKATFLTDYVHTIVI
                     IVIILTFAFTVYATGDKLGSPGKVYDLVRAAAQAHPIEGNAGGEYLTMRSKSGGIFFV
                     INLVGNFGTVFLDNGYWNKAISASPAASLPGYVLGGVSWFAIPTLISTAMGLACVALE
                     SNPSFPTYPQRLTSDQVSAGLVLPSAAVTILGKGGAVAALLMVFMAVTSAMSAELIAV
                     SSIFTYDIYRTYINPNATGKKLIFSSHAACIIFGFSMAGFAVGLYYAGVSMGYLYELM
                     GIIISAAVLPACLTLFWKQQNLAAVVISPILGTGLAIMAWLVCAKSQFNEITIDSTFA
                     DDPMLTGNVVALLSPMVFIPILTYAFKPQKFNWDLLQVITRADETEEIEAAEGQTEGE
                     NGQVSVRGDTSDSGNSIEANDREKLAAVKSVTSAAQEVPETQIDAMKREEAERLEVAG
                     KWGTYLCIFFALALLVVWPMPMYGSKYIFSKKFFRGWVVVLIIWLFLSGFCVCIYPLW
                     EGREGIYTTCRGIYWDLTGQTYKLREWQNSHPEKLHVVQSQISARAHASRRSLDGNID
                     DIVN"
     gene            complement(<647819..>649285)
                     /locus_tag="KLTH0D07436g"
                     /db_xref="GeneID:8295275"
     mRNA            complement(<647819..>649285)
                     /locus_tag="KLTH0D07436g"
                     /product="KLTH0D07436p"
                     /transcript_id="XM_002552997.1"
                     /db_xref="GeneID:8295275"
     CDS             complement(647819..649285)
                     /locus_tag="KLTH0D07436g"
                     /note="similar to uniprot|P32857 Saccharomyces cerevisiae
                     YKL039W PTM1 Putative membrane protein"
                     /codon_start=1
                     /product="KLTH0D07436p"
                     /protein_id="XP_002553043.1"
                     /db_xref="GeneID:8295275"
                     /db_xref="GOA:C5DGR3"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="UniProtKB/TrEMBL:C5DGR3"
                     /translation="MIAQGPFLVLAILANFAFGNRESLDGYRQVCSGMYSKEDWGGKV
                     DPFISFNLKEISGDEGVSVAVLDFQDYEHLGIKSGERTFYICSDTAIEKGLCTEEHKN
                     EYLFEEMIFDSETGENKTLAASIQTFYQTESGLHNPKYFVKSTGYYCVITHTENSNAD
                     FDAVVNFRNAFGQLPAAEINNLPLYGLLAIFYVVAMALYSFAFWKHKNEILPVQKYLL
                     AFFAFLTVEQIFIWAYYDIKNEKGNTAGTKVYMVFVSILSAGKTSFSFFLLLVIALGY
                     GVVYPKLNKKLMRRCQIFAGLNFSFSVAYMIQNYLTNPESVTLLPLITLVPAAITILG
                     FYFWILKSMTETLRYLQEQRQVVKLKMYRRLLSTIYFSLFVLFAGIVVTSFVFIGMNS
                     IEMVEQHWRTRFIVDFWPSLVYYFVFITVAFIWRPTDTSYMLACSQQLPTDPENVADF
                     DLDDLQSLEEPSNHIDDDLNFSDDEDHQQGRNSPRQNK"
     gene            <649564..>650310
                     /locus_tag="KLTH0D07458g"
                     /db_xref="GeneID:8295276"
     mRNA            <649564..>650310
                     /locus_tag="KLTH0D07458g"
                     /product="KLTH0D07458p"
                     /transcript_id="XM_002552998.1"
                     /db_xref="GeneID:8295276"
     CDS             649564..650310
                     /locus_tag="KLTH0D07458g"
                     /note="similar to uniprot|P32860 Saccharomyces cerevisiae
                     YKL040C"
                     /codon_start=1
                     /product="KLTH0D07458p"
                     /protein_id="XP_002553044.1"
                     /db_xref="GeneID:8295276"
                     /db_xref="GOA:C5DGR4"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:C5DGR4"
                     /translation="MFVARRIQTVKKSLGCGSQFLHIKSVSTPNENALKFISTDGELL
                     QERGKPSVEIKNTDESLIKHSPLASRLFTQCPGVEALMIGDDFITVNKDEMVHWNQIT
                     PSVIDLLTQYLASGREAVTPEFFSVQEQGVGYDVNVPKFEYNEDEQEISDMIDELIQT
                     RIRPAIMDDGGDIQYRGYDPQTGTVYLKLQGACKSCSSSEVTLKHGIESMLKHYIEEV
                     ENVVQILDPEEQVALKEFEKLEKKLESTAA"
     gene            complement(<650375..>650704)
                     /locus_tag="KLTH0D07480g"
                     /db_xref="GeneID:8295277"
     mRNA            complement(<650375..>650704)
                     /locus_tag="KLTH0D07480g"
                     /product="KLTH0D07480p"
                     /transcript_id="XM_002552999.1"
                     /db_xref="GeneID:8295277"
     CDS             complement(650375..650704)
                     /locus_tag="KLTH0D07480g"
                     /note="similar to uniprot|P38744 Saccharomyces cerevisiae
                     YHL018W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D07480p"
                     /protein_id="XP_002553045.1"
                     /db_xref="GeneID:8295277"
                     /db_xref="GOA:C5DGR5"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:C5DGR5"
                     /translation="MYNKVKRVAAFPLSTAEISKHLVKHPKWSYDGLRISRDVAFKDF
                     ETTWSFLGQLAMRSHLWGHHPTITTTYNKVNLRLTTHDVNGVSDIDIKLMERIEGYIA
                     GHGEASA"
     gene            <650799..>652313
                     /locus_tag="KLTH0D07502g"
                     /db_xref="GeneID:8295278"
     mRNA            <650799..>652313
                     /locus_tag="KLTH0D07502g"
                     /product="KLTH0D07502p"
                     /transcript_id="XM_002553000.1"
                     /db_xref="GeneID:8295278"
     CDS             650799..652313
                     /locus_tag="KLTH0D07502g"
                     /note="similar to uniprot|P38700 Saccharomyces cerevisiae
                     YHL019C APM2 homologous to the medium chain of mammalian
                     clathrin-associated protein complex Similar to clathrin
                     coat proteins"
                     /codon_start=1
                     /product="KLTH0D07502p"
                     /protein_id="XP_002553046.1"
                     /db_xref="GeneID:8295278"
                     /db_xref="GOA:C5DGR6"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR027200"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DGR6"
                     /translation="MSSCVFILDEQLNPLILRNLKSIAHPEWYALYFKRVHPQSRGPV
                     IYSKGIIYIYILRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGI
                     IDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEIL
                     QSKENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYL
                     MDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLKDKDLFLGSSKFHQCVSLESL
                     SSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQKKHRLHLSVTIQPHF
                     KAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIKGG
                     HGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEGKGQ
                     FQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV"
     gene            complement(<652426..>653796)
                     /locus_tag="KLTH0D07524g"
                     /db_xref="GeneID:8295279"
     mRNA            complement(<652426..>653796)
                     /locus_tag="KLTH0D07524g"
                     /product="KLTH0D07524p"
                     /transcript_id="XM_002553001.1"
                     /db_xref="GeneID:8295279"
     CDS             complement(652426..653796)
                     /locus_tag="KLTH0D07524g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D07524p"
                     /protein_id="XP_002553047.1"
                     /db_xref="GeneID:8295279"
                     /db_xref="UniProtKB/TrEMBL:C5DGR7"
                     /translation="MAWRLRLNGLGKRLSSNWSRLSEIYAKAGDKVPDKLPLLKNEAN
                     HKIRCGVILQSLKSQRQSAFLSALLSDVYSNDQYWHDQFSQRYSKRGPKLIRYGASLE
                     VHRLDNSSTLYTLPSPWLQKHDIELLEMDEVSPANDGCHIYLGLGKALPAMVWTTLSI
                     SDTDSESPMGTREVNCKKALAGMRKLIQSKSNVTEYLKDLESSNFLYITQLLESQLCD
                     KNHIMERLKHAVIKNIYETDTSISKYSQHLTEKKTIDGEIDNWAYKAHSALQSQLKPR
                     LKQFVHGQLSVYKLHTYSESQLELKLREMCDLSRTSDLTEKINHIRGRLNLPLSSPPV
                     WDMNRLHQRANAMHKVINKFIYQQFFKFQLPLILCSVLGVLSGQFSAYSMGSLAALGL
                     VLGVNRTMHQWSAILQRFQTEVLEEKRLEIEVARGEIQTESNIKAENESRILRSKVEI
                     LEKLSK"
     gene            <653992..>655125
                     /locus_tag="KLTH0D07546g"
                     /db_xref="GeneID:8295280"
     mRNA            <653992..>655125
                     /locus_tag="KLTH0D07546g"
                     /product="KLTH0D07546p"
                     /transcript_id="XM_002553002.1"
                     /db_xref="GeneID:8295280"
     CDS             653992..655125
                     /locus_tag="KLTH0D07546g"
                     /note="some similarities with uniprot|P21957 Saccharomyces
                     cerevisiae YHL020C OPI1 Transcriptional regulator of a
                     variety of genes phosphorylation by protein kinase A
                     stimulates Opi1p function in negative regulation of
                     phospholipid biosynthetic genes"
                     /codon_start=1
                     /product="KLTH0D07546p"
                     /protein_id="XP_002553048.1"
                     /db_xref="GeneID:8295280"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="UniProtKB/TrEMBL:C5DGR8"
                     /translation="MGNVNAKTEYKEEGIPQDIALAVEALRDLRNSHGRGQRDTLLDK
                     VRSNTLINNAVRVYEQSKNQYPKFRKGAEIVERKALIPMVKRLEETSNKWKNRSKRSH
                     EEEEDEEEGSQSDEDYCEQDEYDEESDNFMDRATAVNDEVLLVDERLCRKRTSKRQKI
                     SNAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANYQLSNRVGFLQNLVFKEQQLR
                     RGRLRGHDIDSDEEEEFYDASDSIDEQSNVVKMEIVRTVKKVYTLISKFTGNSLPEPA
                     RTQVRESLLKLPMNWTSTMNSENLARYTNSKGVSPNGKVLILAKESLGMVHNVMNVVD
                     STLGKAEEWVKQKQEIKELLKEQFLDSRLREKVKKQMSEEKEI"
     gene            complement(<655143..>655811)
                     /locus_tag="KLTH0D07568g"
                     /db_xref="GeneID:8295281"
     mRNA            complement(<655143..>655811)
                     /locus_tag="KLTH0D07568g"
                     /product="KLTH0D07568p"
                     /transcript_id="XM_002553003.1"
                     /db_xref="GeneID:8295281"
     CDS             complement(655143..655811)
                     /locus_tag="KLTH0D07568g"
                     /note="similar to uniprot|P36095 Saccharomyces cerevisiae
                     YKL041W VPS24 involved in secretion"
                     /codon_start=1
                     /product="KLTH0D07568p"
                     /protein_id="XP_002553049.1"
                     /db_xref="GeneID:8295281"
                     /db_xref="GOA:C5DGR9"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DGR9"
                     /translation="MDYLKKAIWGPDPKEQHRKIRTLVRRNGRSLDKSLRELNALQSK
                     TQALIKRSAKQNDTRSVRIYARELYQINKQYKRMYTSKAQLQSVGMKIDEAFRMQSLQ
                     ENMALSAGLMREINSLVRLPYLQSSMMELEKELVKSGLISEMIDDTMEMATEDEDMEE
                     EAEREVKKIVDQYTSSKLDELDDIPADELPGKEEEIVPDDKIDDEADNMLNEMRERLK
                     ALQN"
     gene            656927..656998
                     /locus_tag="KLTH0D07612r"
                     /db_xref="GeneID:8295282"
     tRNA            656927..656998
                     /locus_tag="KLTH0D07612r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=64.23"
                     /db_xref="GeneID:8295282"
     gene            <657085..>660924
                     /locus_tag="KLTH0D07590g"
                     /db_xref="GeneID:8295284"
     mRNA            <657085..>660924
                     /locus_tag="KLTH0D07590g"
                     /product="KLTH0D07590p"
                     /transcript_id="XM_002553004.1"
                     /db_xref="GeneID:8295284"
     CDS             657085..660924
                     /locus_tag="KLTH0D07590g"
                     /note="similar to uniprot|Q03690 Saccharomyces cerevisiae
                     YMR012W"
                     /codon_start=1
                     /product="KLTH0D07590p"
                     /protein_id="XP_002553050.1"
                     /db_xref="GeneID:8295284"
                     /db_xref="GOA:C5DGS0"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="InterPro:IPR028275"
                     /db_xref="UniProtKB/TrEMBL:C5DGS0"
                     /translation="MRSARLLPLGFQDHNFKELTKFKSCKKFTFFESSSKSSTKSRNL
                     TEYLTTMDAQATDAVTVSVRLPHQKQEVQLNLVKSSSVQVVADILQFSPSSRCLTNLE
                     LFQKSQKLTGDEILKNLSNSDSLKLDVKFKPYTARDALRHVTLVRDTIGFTSETQDGI
                     SDFAISTGSQISSMPLRPIKSSPPLKGANGESSAFEISEEEKKDLQQTVRDSLSKRQT
                     VNEILKAKSGIITPCLRSLALSAYNPVPPFYRTKGHLLYLHVITLENEAFHVTATSSG
                     FYVNKSTSTKFDPSPRSEGEVPKVSLLDLFSTHSKKFKDHLSKLEKKVSSLDSVFTAR
                     PSTTFLGKPWLVSTTPSGAGHHSRLQLSEADFNTERNFNDEFQAIKDMTSSDFQSIVD
                     TEKLTAKVYQEFTETAVKDAMSIFYDDLVPMNPEAPSREHIYLKNNIFYAFVGDVNGN
                     YTKVGGDAAAFAASNQDLQAVKLLHRVSLSEIHYLLCVIIDFAGRRVLAQTPVPGLLS
                     AMGSVNKKNPETDEIITEDLVSDVNVVYGLDEATGEVLFDEEFDEALESFSKVFHLKN
                     HEAGSAKIKFSSNSKGIVGSDKRKYVLDLANSHPLDSQFARKYYDNVPESQRYPHRQT
                     LVRNELVDKWWASKLEGSDLTFEKAFDEKLFAFNPDAYIREGVEDPLVEEVSSYLTNE
                     VLPSFAKDYAIGNLTAPYDGDHLTDSMHKNGINMRYLGKLIELAENELKDQVVQHQSK
                     TSEVAASNEEHKKWEKDYLIKIEKLIKERQAKINKLVQEGKDIPEDLKGNLKLDEKDI
                     RKPTKGKAAIVNKDQLTCLIKVSQLEIAARSLKHVLREYTKDLPIPVLPSVVVYFFNL
                     LFGSSFNETPEVEIVDSFYAGKSFSFAKLSRQGLLKEICNQAQRRFIYTLPNDVVEEF
                     CSGAFPLIRAISKKFGIQFLNKEYFFTQEQFEKFLQSQDKKTKSKIEVPKATFSVNDL
                     VLIPIVKDGDYRSLTGDNFWNQGAAILNEKEADGLVLLSQALTIKEEVNGVIHHSVAE
                     SYMAMSTIYHTLKRIPEALTYCRKACAIYERTCGVDSFEVLRCLTNLAILEISNKCPS
                     NGALVLQRIMNTLDALCVAIHPAVINAYTMLQQASLASKEPKLAIEVMKKLSETILQI
                     EDGERTIAYGYNQSRLGDLYATLNDLNGSLKAITEAREVFQRELGLNDETTAQCNQWV
                     TSIEALMESQLQQRKLTQQQSTVNSSGTAANRKQKPSKKQEEPNPELANKSVDELLSF
                     IEGTKPKNSKGKKKNKK"
     gene            complement(<661066..>662568)
                     /locus_tag="KLTH0D07634g"
                     /db_xref="GeneID:8295283"
     mRNA            complement(<661066..>662568)
                     /locus_tag="KLTH0D07634g"
                     /product="KLTH0D07634p"
                     /transcript_id="XM_002553005.1"
                     /db_xref="GeneID:8295283"
     CDS             complement(661066..662568)
                     /locus_tag="KLTH0D07634g"
                     /note="weakly similar to uniprot|P20048 Saccharomyces
                     cerevisiae YMR013C SEC59 Membrane protein that catalyzes
                     the CTP-mediated phosphorylation of dolichol the terminal
                     step in dolichyl monophosphate (Dol-P) biosynthesis
                     required for viability normal rates of lipid intermediate
                     synthesis and protein N-glycosylation"
                     /codon_start=1
                     /product="KLTH0D07634p"
                     /protein_id="XP_002553051.1"
                     /db_xref="GeneID:8295283"
                     /db_xref="GOA:C5DGS1"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR026566"
                     /db_xref="UniProtKB/TrEMBL:C5DGS1"
                     /translation="MEKQSAQDRERIQKLNEGYSPIHAFLKPEKVIQLMMLGSTIHLV
                     VAKFLQNEAGAKLQNSLLVTSVAIFVGFWVSYRTRVANNGTWGSPLQPIATFVPDFNV
                     VYLMYLPTLFSLIFAREVTIVNLVMSFNCTDLPVAMKLPVQAIFVLLNDEYQQNRTKN
                     LKAIFINWVFASLIERIGQLRSFDRVDSNLFSICLTNVLFLLNRSSLHFQILHNVLKG
                     FMVAISVNYLLSFITRKLNQYLRSVILLTSFIVVFPLTILCSFEVEGQNPAGWLFRYI
                     LSDSTRVKIIVGWLGCLLLLVPNIMIFQSKFSLDTSRKLWHFIILVLVVPPLHQDPEF
                     VKIALAGTIVLFLSVEYLRYLKLAPFGEFFDSKLRSFADFRDDRGPIIISYIYLIIGI
                     ATPILINGSLVGVISLGVGDSLASIVGYRWGRHRWPGTSKTLEGTLAFITATSSCSLA
                     LKNFNNSFQDLSNAKLIMTCILSGILEGNSVLNDNILVPAFMLIVREGLK"
     gene            662816..662900
                     /gene="SNR78"
                     /locus_tag="KLTH0D07656r"
                     /db_xref="GeneID:8295285"
     ncRNA           662816..662900
                     /ncRNA_class="snoRNA"
                     /gene="SNR78"
                     /locus_tag="KLTH0D07656r"
                     /product="snR78"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR78"
                     /transcript_id="XR_002432185.1"
                     /db_xref="GeneID:8295285"
     gene            663012..663093
                     /gene="SNR77"
                     /locus_tag="KLTH0D07678r"
                     /db_xref="GeneID:8295760"
     ncRNA           663012..663093
                     /ncRNA_class="snoRNA"
                     /gene="SNR77"
                     /locus_tag="KLTH0D07678r"
                     /product="snR77"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR77"
                     /transcript_id="XR_002432186.1"
                     /db_xref="GeneID:8295760"
     gene            663288..663389
                     /gene="SNR76"
                     /locus_tag="KLTH0D07700r"
                     /db_xref="GeneID:8295759"
     ncRNA           663288..663389
                     /ncRNA_class="snoRNA"
                     /gene="SNR76"
                     /locus_tag="KLTH0D07700r"
                     /product="snR76"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR76"
                     /transcript_id="XR_002432187.1"
                     /db_xref="GeneID:8295759"
     gene            663504..663592
                     /gene="SNR75"
                     /locus_tag="KLTH0D07722r"
                     /db_xref="GeneID:8295758"
     ncRNA           663504..663592
                     /ncRNA_class="snoRNA"
                     /gene="SNR75"
                     /locus_tag="KLTH0D07722r"
                     /product="snR75"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR75"
                     /transcript_id="XR_002432188.1"
                     /db_xref="GeneID:8295758"
     gene            663703..663781
                     /gene="SNR74"
                     /locus_tag="KLTH0D07744r"
                     /db_xref="GeneID:8295757"
     ncRNA           663703..663781
                     /ncRNA_class="snoRNA"
                     /gene="SNR74"
                     /locus_tag="KLTH0D07744r"
                     /product="snR74"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR74"
                     /transcript_id="XR_002432189.1"
                     /db_xref="GeneID:8295757"
     gene            663855..663962
                     /gene="SNR73"
                     /locus_tag="KLTH0D07766r"
                     /db_xref="GeneID:8295756"
     ncRNA           663855..663962
                     /ncRNA_class="snoRNA"
                     /gene="SNR73"
                     /locus_tag="KLTH0D07766r"
                     /product="snR73"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR73"
                     /transcript_id="XR_002432190.1"
                     /db_xref="GeneID:8295756"
     gene            664085..664167
                     /gene="SNR72"
                     /locus_tag="KLTH0D07788r"
                     /db_xref="GeneID:8295755"
     ncRNA           664085..664167
                     /ncRNA_class="snoRNA"
                     /gene="SNR72"
                     /locus_tag="KLTH0D07788r"
                     /product="snR72"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR72"
                     /transcript_id="XR_002432191.1"
                     /db_xref="GeneID:8295755"
     gene            <664551..>666038
                     /locus_tag="KLTH0D07810g"
                     /db_xref="GeneID:8295754"
     mRNA            <664551..>666038
                     /locus_tag="KLTH0D07810g"
                     /product="KLTH0D07810p"
                     /transcript_id="XM_002553006.1"
                     /db_xref="GeneID:8295754"
     CDS             664551..666038
                     /locus_tag="KLTH0D07810g"
                     /note="similar to uniprot|Q04347 Saccharomyces cerevisiae
                     YMR014W BUD22 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="KLTH0D07810p"
                     /protein_id="XP_002553052.1"
                     /db_xref="GeneID:8295754"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="UniProtKB/TrEMBL:C5DGS2"
                     /translation="MPKENLIFKLDRLEYQYHHLNGSLDGFTPRLANTAKTFNAKGKK
                     TSKRIGKLLSASNLEDVEKDLNSLRQEIIEKKSYHLENKLTSLLERTLQQKYTALKKK
                     ANDKHKADLETLKELDEKYTLSGFCKLISKSRTCKLLIAHVLPTKILKEEPPTWFQEN
                     EYLEIFKDKGNDYNPGKVWNEVVLPTKGCEKLLSQSTNDKKIKELLAGFENAMDLFMN
                     LKRERSLGSKKEDAQLSTKSENSESIDNTTSGEQSEQDFDSSGSEDGIDHDEEDVDEE
                     EILKQYEGMLVASDEEEDESVPYSLDPNVNYNEVTDEEPSDLEESMGSDLADSSEDEE
                     PLKKRQKTSRESKNTKHDKATAKLPELMTGYFSGGSENELSEDEVAAQQSSNKPLRKN
                     RRGQRARQKIWEKKFGKNAKHVQKQMEAERSERERKKVEYEQRVVKRAAKTQQRESAV
                     DQKRIDAAARAQRVENTPIHPSWEAKKLAEEKQKGAKFQGKKIVF"
     gene            complement(<666271..>667869)
                     /locus_tag="KLTH0D07832g"
                     /db_xref="GeneID:8295286"
     mRNA            complement(<666271..>667869)
                     /locus_tag="KLTH0D07832g"
                     /product="KLTH0D07832p"
                     /transcript_id="XM_002553007.1"
                     /db_xref="GeneID:8295286"
     CDS             complement(666271..667869)
                     /locus_tag="KLTH0D07832g"
                     /note="highly similar to uniprot|P54781 Saccharomyces
                     cerevisiae YMR015C ERG5 C-22 sterol desaturase a
                     cytochrome P450 enzyme that catalyzes the formation of the
                     C-22(23) double bond in the sterol side chain in
                     ergosterol biosynthesis may be a target of azole
                     antifungal drugs"
                     /codon_start=1
                     /product="KLTH0D07832p"
                     /protein_id="XP_002553053.1"
                     /db_xref="GeneID:8295286"
                     /db_xref="GOA:C5DGS3"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:C5DGS3"
                     /translation="MDSVVESYAGDQALMSVQNSTISAGGLQGVVQTLQAISYWKLFF
                     TVVCVGLVWDQISYQTKKGSIAGPRWKFWPVIGPFLESLDPKFEEYKAKWDSGPLSCV
                     SIFHKFVVIASTRDLARKILQGHKYVKPCLVDVAVKILRPSNWVFLDGKAHSDYRKSL
                     NGLFTKSSLAKYLPSQEQVMDKYLEKFVTFSAENDFKPQVFFHEMREIMCALSLKAFC
                     GSYITESQIRKVADDYYLVTAALELVNFPIILPYTKTWYGQKTADMTMKIFEKCAQMA
                     KDHIAAGGKPTCVMDAWCQLMHDAKTKNDEDSRLLHREFSNREISEAIFTFLFASQDA
                     SSSLACWLFQIVADRPDVMEKIREEQLRVRDNDPNKPLSLELIEEMKYTYMVVKETLR
                     YRPPVIMVPYVVKEKFPIAPNYTAPKGAMIIPTLYPALHDPEVYEDPEEFIPERWVEG
                     SPANEAKRNWLVFGSGSHVCLGQTYVMLTFTALIGKFAMFTDWKHEVTPLSEKIKVFA
                     TIFPKDDLHLSFRKRDPLTGKIEV"
     gene            complement(<668300..>669376)
                     /locus_tag="KLTH0D07854g"
                     /db_xref="GeneID:8295287"
     mRNA            complement(<668300..>669376)
                     /locus_tag="KLTH0D07854g"
                     /product="KLTH0D07854p"
                     /transcript_id="XM_002553008.1"
                     /db_xref="GeneID:8295287"
     CDS             complement(668300..669376)
                     /locus_tag="KLTH0D07854g"
                     /note="weakly similar to uniprot|P36094 Saccharomyces
                     cerevisiae YKL042W SPC42 Central plaque component of
                     spindle pole body (SPB) involved in SPB duplication may
                     facilitate attachment of the SPB to the nuclear membrane"
                     /codon_start=1
                     /product="KLTH0D07854p"
                     /protein_id="XP_002553054.1"
                     /db_xref="GeneID:8295287"
                     /db_xref="GOA:C5DGS4"
                     /db_xref="InterPro:IPR021611"
                     /translation="MSPHTEGPLFAVLKNSRARPRPRESRLRRRVHKQMNISPTPKRY
                     NSRGYEFPRSNDEAFHPFNREPPMVPSERILPEEYRVNSQMINKLIKQNKDLTQQLDR
                     KQDEIDRLNVLVGSLRGKLIKYTELNKKLEQAAAGARQSSPDDVLQVNRTRPREPPAG
                     GTRLDDRLSDLYSKLETLTELVVGSAAADRGARDHVHVPSAGATRTPSSGASVSHRPL
                     QPGAASEDDILTQESAELKGLEDQIDLLKRKLLIKRENELRKLSLNKELLDLMEKLDV
                     SRPAGPVPSSSTPPHCDQCHKAAYQTAAANGGHGVPAGAGSGAGAGASMPSPRNPPYM
                     SMAQVLETPTPAHRSSHKPNDTLW"
     gene            complement(<669644..>671941)
                     /locus_tag="KLTH0D07876g"
                     /db_xref="GeneID:8295288"
     mRNA            complement(<669644..>671941)
                     /locus_tag="KLTH0D07876g"
                     /product="KLTH0D07876p"
                     /transcript_id="XM_002553009.1"
                     /db_xref="GeneID:8295288"
     CDS             complement(669644..671941)
                     /locus_tag="KLTH0D07876g"
                     /note="some similarities with uniprot|P53438 Saccharomyces
                     cerevisiae YMR016C SOK2 Protein that can when
                     overexpressed suppress mutants of cAMP-dependent protein
                     kinase displays homologies to several transcription
                     factors"
                     /codon_start=1
                     /product="KLTH0D07876p"
                     /protein_id="XP_002553055.1"
                     /db_xref="GeneID:8295288"
                     /db_xref="GOA:C5DGS5"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:C5DGS5"
                     /translation="MSNEQIHNAYSQQPPQQQQQQQQPQQQPQHGAGGAAGGQGAGQL
                     HAHSQAHMVQHSPSQAPSHAHTASAAQGNPYMNQEHWQYQYAPQMHGFYTQTGGGSGS
                     AGGAAGGAAASHQTAAHQSPSDHVSYAYSHYPAASAAADPQQQPQQQQQQQQQQQPYA
                     SYASSAGYGYYPYAAQTAAVGDEQQQAYASYYRQAQLAQVQAQAQAQAQAQAQAQAQA
                     QAQAQAQAQAQAQAAQAQASQLGYQYPGFLGSGRPGAAASHDELSGSSAAGGSAGAGA
                     VSPVAYYGEELGGKARRAVSSRGRELGAGSLDGSALLGLAAAGALDPTTGMPGAMPGA
                     MPTGIHTGMAGGMATGLGAAARTSAAAAAAGARPRVTTTMWEDEHTLCYQVEANGVSV
                     VRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVKVGSMHLKGVWIPFDRALAM
                     AQREKIVDLLFPLFVRDIQSIIQQGASTVLAGPAAAAASAGPVQAPTRSMGGMSSGGA
                     GAGGGSAYYADAYQPLAGYGHYQPIDYGYAARPVMHAVSGLGSVGSAGLGSSGLGSAG
                     SVGSVSGGVPSSSAIATHGGPLSAAAGHTAASAGHGLGHGHGPGSGVGVGVGPVDGSA
                     SNAGPGSDNGPGVGVGVGVGVGVGVGSGSGSGAVHGTSPGSGSTAASGVGADLGSHSG
                     GDRAPGSAAPGATSSGDATGASVMGVSHGYPSQAGASSMDSLAKPVASHSTDSSEQTP
                     VGHGAPDQVKPEALDSNDANAAHDE"
     gene            <672516..>674534
                     /locus_tag="KLTH0D07898g"
                     /db_xref="GeneID:8295289"
     mRNA            <672516..>674534
                     /locus_tag="KLTH0D07898g"
                     /product="KLTH0D07898p"
                     /transcript_id="XM_002553010.1"
                     /db_xref="GeneID:8295289"
     CDS             672516..674534
                     /locus_tag="KLTH0D07898g"
                     /note="weakly similar to uniprot|P50104 Saccharomyces
                     cerevisiae YMR019W STB4 Protein that binds Sin3p in a
                     two-hybrid assay"
                     /codon_start=1
                     /product="KLTH0D07898p"
                     /protein_id="XP_002553056.1"
                     /db_xref="GeneID:8295289"
                     /db_xref="GOA:C5DGS6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DGS6"
                     /translation="MCLDHHQQDDNARVATLQQDTGRPRIRVRKACGTCKRRKVKCNG
                     QQPCAGCAKHGSVCHYKVEPVTRPASAALKAGAPGPAGTLPALSQVPAPSDFATGPAP
                     ASPWQRFSPGKYRFHRRHQNLVPYYLGQALISSLPPALVQKYALRAPRLQFYGWNMSG
                     GHYLKQGSTFGAPQGTVWRWDLAVELQRQILEKCASFFFQHVNRFVSIVHEQAFWQQF
                     RGGFLDGSDGKNGSSDLFEAILNLIAAIALRFSYSGAGASVCEALTAAEVTWLDLHLT
                     RHGRHLEETLFERAYAVTTRLSFEWESFELIQAWLLAAVYLRTCHRQVSCWQALSRAV
                     QMCNGMSLYLNRFPEKHTAYDECRARNCYWACFVLDRLISFQMGRFPELAGPGPDMGS
                     PDTAVDTWFSAESVALYKLAAIVTTCQRRYGQELTAAETQELGARLDEWHGDCEEVLA
                     DPGLCARQVLLTYLDVRIALEIRGLFQLLDVGSDTVRHALPLDAVTLVDLASRVLDQF
                     EAIVESGLFFRPWWLNLSLLFTCSVICLTLVQGGLQLARAQALLSRSFHIWHFIEGAR
                     PPNPPGMARECLWCLKMLNHMFCQRLTTSAEQLESIIGVDPGDDSVNQNKFRQFGKVD
                     MNRANDDGAALLQSGSDTISPADDSNNLVAHLQWFDQWLDVDNLQTMF"
     gene            complement(<674563..>676083)
                     /locus_tag="KLTH0D07920g"
                     /db_xref="GeneID:8295290"
     mRNA            complement(<674563..>676083)
                     /locus_tag="KLTH0D07920g"
                     /product="KLTH0D07920p"
                     /transcript_id="XM_002553011.1"
                     /db_xref="GeneID:8295290"
     CDS             complement(674563..676083)
                     /locus_tag="KLTH0D07920g"
                     /note="highly similar to uniprot|P20457 Saccharomyces
                     cerevisiae YKL045W PRI2 Subunit of DNA primase which is
                     required for DNA synthesis and double-strand break repair"
                     /codon_start=1
                     /product="KLTH0D07920p"
                     /protein_id="XP_002553057.1"
                     /db_xref="GeneID:8295290"
                     /db_xref="GOA:C5DGS7"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="UniProtKB/TrEMBL:C5DGS7"
                     /translation="MFRQSKRRVANRRNFGDQVSRTPGKFILNGITSEEEKQLYQSLY
                     ESKLSFYEVPPKGEITLEQFELWAIDRLKVLLEIESCVQRNKTAKEIEIIVKPLLQKL
                     LPFTTEDLQDRKKDYYSHFILRLCFCRSKELREKFIRSETMLLKLRFNMMTSRDQAKF
                     VQTLNLPFLQFISDEEKEQLSTQLYQTISSSLQFQLNLTDETARRQYFEQEKFIKLPF
                     ESVIELVGARQVFIKKGYAYLPQFQQLNHIANEFANMLSLALTKTYQTIPRLNEDDRL
                     LPILHHLSTGYTITNFQQHDQFGQASQGEINAKSVYSSAIQENFPLCAKNLMSGLKEN
                     HHLRYQGRQQLSFFLKGIGMDVDEALQFWSDAFTSGGQMTQEKFNKEYRYNFRHNYGL
                     EGNRINYKPWDCRTILSRPRPSRGEYHGCPYRDWNVDKLTLELSQGMSLNPSQVTSVL
                     DSVQRTEYTIACTKVFEMTHGGSANTEINDQSHIAHPNLYYERSRQLQKKAGAAIK"
     gene            <676761..>678263
                     /locus_tag="KLTH0D07942g"
                     /db_xref="GeneID:8295291"
     mRNA            <676761..>678263
                     /locus_tag="KLTH0D07942g"
                     /product="KLTH0D07942p"
                     /transcript_id="XM_002553012.1"
                     /db_xref="GeneID:8295291"
     CDS             676761..678263
                     /locus_tag="KLTH0D07942g"
                     /note="similar to uniprot|P50264 Saccharomyces cerevisiae
                     YMR020W FMS1 Polyamine oxidase converts spermine to
                     spermidine which is required for the essential
                     hypusination modification of translation factor eIF-5A
                     also involved in pantothenic acid biosynthesis"
                     /codon_start=1
                     /product="KLTH0D07942p"
                     /protein_id="XP_002553058.1"
                     /db_xref="GeneID:8295291"
                     /db_xref="GOA:C5DGS8"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="UniProtKB/TrEMBL:C5DGS8"
                     /translation="MIENQVVIIGAGIAGLKAASELYKRGFKSCTILEARDRIGGRLH
                     TVTGYQNRRYDLGASWHHDTLVNGLFLEELNLPEDQRASFVFDDDSMVVFDAEKGRVD
                     QDPEMVLEILLEELVKYSQLHFFEDLSAQDLNYFQMVVKYLYERRGLLTNDQIRFLPQ
                     VARFMELWHGIDWKSQSSKCLEIAHQGRNALVLNYDKIVRRIASEIPESWLQLSTEVK
                     EVRNDGKNVLVTIDKGETISCKYVIVTVPQSILAHSLQPEPRVGKIEFIPPLNVNIQD
                     AFKKTHYGALGKVVFEFDDCCWSTERSRILSLGKSSSNLSQRVREARDLSLLVEELDA
                     NTKYQFERGDSWNFPLLFVNMVKHTGIPSFVMLMANPLTKYIESMNDKGKIFEFFTPV
                     LENLLKTLGCAEPIVKDFENKLVKSNKKAPILKNIVTTNWTRDDYALGAYSACEPGDD
                     PMDLVLALTENQTSLVRFAGEHTIMDGAGCVYGAWQSGKREADFIADKLA"
     gene            complement(<678368..>679543)
                     /locus_tag="KLTH0D07964g"
                     /db_xref="GeneID:8295292"
     mRNA            complement(<678368..>679543)
                     /locus_tag="KLTH0D07964g"
                     /product="KLTH0D07964p"
                     /transcript_id="XM_002553013.1"
                     /db_xref="GeneID:8295292"
     CDS             complement(678368..679543)
                     /locus_tag="KLTH0D07964g"
                     /note="similar to uniprot|P35192 Saccharomyces cerevisiae
                     YMR021C MAC1 Copper-sensing transcription factor involved
                     in regulation of genes required for high affinity copper
                     transport"
                     /codon_start=1
                     /product="KLTH0D07964p"
                     /protein_id="XP_002553059.1"
                     /db_xref="GeneID:8295292"
                     /db_xref="GOA:C5DGS9"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:C5DGS9"
                     /translation="MIIYDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTV
                     RKVILVDASSQVNSGLHEEGDGGSPSCCSSAGARSCSKMNKQPILFLRTMSMQKALLV
                     DGALKIMIEDNDPNFQGRYKFVSEKDYLLNHLDTSQKGCAMSAESITRAGSSEAQSLE
                     RFLSEGMSPASSSNKQELSEIKFEGHHETLVYPVQNIPREAGNASPEIANNSMVELFT
                     HKGVYLSTQCNCADGNCLCVNCLIHRKEEELEKYIQQSGVPLSTIGNGRITFPEEQSP
                     NNTFICRSPAEDCTAQECLLHPEEIIPLNQIFLYGLVNVPLRRKHVIKFRHKLIPSKF
                     WWHLLKEELPSMPQDQWSKFELLSWFEHIIKSFDSEIPNEPSGDGVNLHSMGLMMNA"
     gene            <679875..>680372
                     /locus_tag="KLTH0D07986g"
                     /db_xref="GeneID:8295293"
     mRNA            <679875..>680372
                     /locus_tag="KLTH0D07986g"
                     /product="KLTH0D07986p"
                     /transcript_id="XM_002553014.1"
                     /db_xref="GeneID:8295293"
     CDS             679875..680372
                     /locus_tag="KLTH0D07986g"
                     /note="highly similar to uniprot|Q02159 Saccharomyces
                     cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
                     involved in the ER-associated protein degradation pathway
                     requires Cue1p for recruitment to the ER membrane proposed
                     to be involved in chromatin assembly"
                     /codon_start=1
                     /product="KLTH0D07986p"
                     /protein_id="XP_002553060.1"
                     /db_xref="GeneID:8295293"
                     /db_xref="GOA:C5DGT0"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5DGT0"
                     /translation="MSKTAQKRLFKELQQLLKDSPEGIVAGPRSEDNLFLWDCLISGP
                     PDSPYQGGVFNATLEFPKDYPLSPPKLLFTPSILHPNIYPNGEVCISILHSPGDDPNM
                     YELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWRDSREEFEKQVKRSIL
                     KSLGF"
     gene            <680735..>682081
                     /locus_tag="KLTH0D08008g"
                     /db_xref="GeneID:8295294"
     mRNA            <680735..>682081
                     /locus_tag="KLTH0D08008g"
                     /product="KLTH0D08008p"
                     /transcript_id="XM_002553015.1"
                     /db_xref="GeneID:8295294"
     CDS             680735..682081
                     /locus_tag="KLTH0D08008g"
                     /note="highly similar to uniprot|P36091 Saccharomyces
                     cerevisiae YKL046C DCW1 Mannosidase GPI-anchored membrane
                     protein required for cell wall biosynthesis homologous to
                     Dfg5p"
                     /codon_start=1
                     /product="KLTH0D08008p"
                     /protein_id="XP_002553061.1"
                     /db_xref="GeneID:8295294"
                     /db_xref="GOA:C5DGT1"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:C5DGT1"
                     /translation="MRLLLATFLTALLSFRSSQALDFDVDNEGSIKNATALVAGGLLD
                     YYTGQQYGQTIGMFSNPYYWWEAGGAWGSILDFWWYTQNDTYNAMLEEALLYQAGENH
                     DYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNPPETEPQWLYLAQAVFNTMALRWDD
                     ESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAARLARYTGNNTYVDWAEKVFDWMKG
                     IGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLLMSGCAYLYNYTGSETWHTRTF
                     EFLNSSDIFFNNSILYERTCQEANTCNTDQRSFKAYFSRFLGLTAQLVPAARNQIMDW
                     IRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQMAALEIMQNVLCLDRPAPY
                     TAATGGSSVGNGAAGTETSATNLSPLDITTGSRAAAGIITAVIGLSIVACTVWLVL"
     gene            complement(<682139..>683698)
                     /locus_tag="KLTH0D08030g"
                     /db_xref="GeneID:8295295"
     mRNA            complement(<682139..>683698)
                     /locus_tag="KLTH0D08030g"
                     /product="KLTH0D08030p"
                     /transcript_id="XM_002553016.1"
                     /db_xref="GeneID:8295295"
     CDS             complement(682139..683698)
                     /locus_tag="KLTH0D08030g"
                     /note="similar to uniprot|P36090 Saccharomyces cerevisiae
                     YKL047W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D08030p"
                     /protein_id="XP_002553062.1"
                     /db_xref="GeneID:8295295"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="InterPro:IPR028115"
                     /db_xref="UniProtKB/TrEMBL:C5DGT2"
                     /translation="MRQFTRTLDMRYNPKPYDFEIQEPSHKVPLCCIFLCQFDVKKGN
                     TLIWSKKSTETSDISLGNIEFKCIPSGIHELEKDVVSFVIPKGENLVEVYYGVSCFQQ
                     NGQSLSRNVSHVDRGKVQMFSLGVIVDASFRYKGVSKSKFYDWKPNQFISATEYIDDL
                     QELLSHWLKRQNLGQDFSLFENYFEANRFKADSAMLSSPILQHSWQNAGKFTTNSLLQ
                     EKHPHMLESLSQWLEYLGPLMFPLWKACITRQRVLIITGNGVSFEKTNSLVYCLSILS
                     LIPRIISDKLKDSPLQPLYCIGISDIDDLERHVAASMSTNDETYEITGFIACTGDEIL
                     ESRSELYDVCLKIHGRDALPEITTSNGDYLKATPHELELYEKLVSNSLGYQLSQNEKE
                     KVFRLVEPTTWSQYLIDGFYWWATAGYMRPSFHEPEDKVIADLDRDNLEIVISLVGYF
                     HEKTLLLYNSLKQVVEASTEDTVVVSPIFLATVGLDCFSSGDYAFLNKVCQKWFDREL
                     LVRNVDCTLLC"
     gene            <683787..>684128
                     /locus_tag="KLTH0D08052g"
                     /db_xref="GeneID:8295296"
     mRNA            <683787..>684128
                     /locus_tag="KLTH0D08052g"
                     /product="KLTH0D08052p"
                     /transcript_id="XM_002553017.1"
                     /db_xref="GeneID:8295296"
     CDS             683787..684128
                     /locus_tag="KLTH0D08052g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D08052p"
                     /protein_id="XP_002553063.1"
                     /db_xref="GeneID:8295296"
                     /db_xref="GOA:C5DGT3"
                     /db_xref="InterPro:IPR020491"
                     /translation="MTWKAGMKERVLRQHIEGCIDQVQEYVDLESAQAISSFESKAVD
                     HFRCLDGLKAQYNTREDKISEFKRLQSEYATKVDGLEKSIEHFEKLSEEIEEFLVELE
                     VKTKLASKRQS"
     gene            complement(<684208..>685701)
                     /locus_tag="KLTH0D08074g"
                     /db_xref="GeneID:8295297"
     mRNA            complement(<684208..>685701)
                     /locus_tag="KLTH0D08074g"
                     /product="KLTH0D08074p"
                     /transcript_id="XM_002553018.1"
                     /db_xref="GeneID:8295297"
     CDS             complement(684208..685701)
                     /locus_tag="KLTH0D08074g"
                     /note="similar to uniprot|P32559 Saccharomyces cerevisiae
                     YMR023C"
                     /codon_start=1
                     /product="KLTH0D08074p"
                     /protein_id="XP_002553064.1"
                     /db_xref="GeneID:8295297"
                     /db_xref="GOA:C5DGT4"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGT4"
                     /translation="MQRGLYASYRLYSSVPATAFHPTIYALSTSPGQRSAIAVVRVTG
                     SHCKHIYYQLTGAQSPPVPRRCSLRNLYHAAGAKKNLLDSSLVLFFENPKSFTGEDML
                     ELHLHGGRAVIKSVLGAIQSLGDQKKGLDIRYAQPGEFSQRAFQNGRMDLTQAEGVAD
                     LIDAETETQRRSALQSFRGQNKALFDGWRSQIVSGIAQLTAIIDFGEDAEIEDTQAIL
                     DSVRRNMMNLDKEIKLFVLKIRRSSILQNGVKVALLGSPNAGKSSLLNCITNDDTSIV
                     SDTPGTTRDAIDVPIDVDGYKVVLCDTAGIRSESEDQIEIQGIKRAKAKGSESDLVIL
                     VIDPTKTPLVTEDLQRFVKEQIPHNQVIIAVNKTDLVDTKGLKNVRQEVYQIFNGDFP
                     IKSVSCTNFEGIENLVKELSHVFQGLSGTSHDSDPLIVSNRTEEILTKDVMFGLQEFL
                     SFPGTEDVVMACENLAYAAEGIGKITGASVGVEEVLGVVFSRFCVGK"
     gene            complement(685802..685874)
                     /locus_tag="KLTH0D08096r"
                     /db_xref="GeneID:8295298"
     tRNA            complement(685802..685874)
                     /locus_tag="KLTH0D08096r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8295298"
     gene            <686143..>687060
                     /locus_tag="KLTH0D08118g"
                     /db_xref="GeneID:8295299"
     mRNA            <686143..>687060
                     /locus_tag="KLTH0D08118g"
                     /product="KLTH0D08118p"
                     /transcript_id="XM_002553019.1"
                     /db_xref="GeneID:8295299"
     CDS             686143..687060
                     /locus_tag="KLTH0D08118g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D08118p"
                     /protein_id="XP_002553065.1"
                     /db_xref="GeneID:8295299"
                     /db_xref="UniProtKB/TrEMBL:C5DGT5"
                     /translation="MKLTSFLNACLVIALPVRICSATALEAQDAQLRQTEILNSWNAT
                     TTKCQDRTVPLIDKALSYKFSVDSLERGVSSALSTLRASLQGKDEFCALDIVRVATEQ
                     MRWMSLSDVDFSTKISFAAQFSQVKTIYYSVPMLRQLHRCVSYAVASTADSVQWKGFI
                     GEAAKAWYRLISNSASGRDLSQAVELVQNSSKLQKILAKARDEWVLAAPLCERHQDVH
                     TNHINLENAASRVAAFHGPKPGDAPSLLASKDEEDNHTVQGGSVTHAGSMTHVPVNSN
                     ESSGVVLRKISSWSVMGAVVVVLSGVALF"
     gene            <687366..>688490
                     /locus_tag="KLTH0D08140g"
                     /db_xref="GeneID:8295300"
     mRNA            <687366..>688490
                     /locus_tag="KLTH0D08140g"
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /transcript_id="XM_002553020.1"
                     /db_xref="GeneID:8295300"
     CDS             687366..688490
                     /locus_tag="KLTH0D08140g"
                     /note="similar to uniprot|P36516 Saccharomyces cerevisiae
                     YMR024W MRPL3 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /protein_id="XP_002553066.1"
                     /db_xref="GeneID:8295300"
                     /db_xref="GOA:C5DGT6"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:C5DGT6"
                     /translation="MSQQLLLSGRLARSLHVVARSKRVWLRGFPAPQRSIHLSPRQRQ
                     QQVKLETPELNKYREYYKRLQAAVNDVPEELASKSPSLVTLHRRLNLPESFQLSTLAR
                     CLTCRSSRLPSDLNVPSSGAAFTSSVPTSNFYDNHGLNIFGKNLLTYHVTRQTMAKYP
                     RLPTVVLNAAVDAYISQSVLASVGRSWGIELENSSVLDRYLREEPIQVSLGKLRFFNN
                     ALKREDGVELITSHNFSEDAAYALAVRSVIGALWAYTHETDPTFAFRFIDDHILSRKL
                     DVTRIFQFEQPARELAVLCRRENLSPPVSKLLAESGRLSKAPVFIVGVFSGAEKLGEG
                     FGSSLKEAKARAATDALMKWYCYEPVQGQAPVIDPGAVIV"
     gene            <688657..>689418
                     /locus_tag="KLTH0D08162g"
                     /db_xref="GeneID:8295301"
     mRNA            <688657..>689418
                     /locus_tag="KLTH0D08162g"
                     /product="KLTH0D08162p"
                     /transcript_id="XM_002553021.1"
                     /db_xref="GeneID:8295301"
     CDS             688657..689418
                     /locus_tag="KLTH0D08162g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D08162p"
                     /protein_id="XP_002553067.1"
                     /db_xref="GeneID:8295301"
                     /db_xref="UniProtKB/TrEMBL:C5DGT7"
                     /translation="MDVNLGLGVIVDANHLKETLLATGGYPTQPLCLLLFGGISGSRV
                     DLQRSLELPLIRSEKEDRLVFSETALRDRVHLVESVEPELRLLGVLFITNDLGDVEAI
                     IDELRRLAKGLQYFFTYDTCGTRLTLKCYRSRGQARMEEVPFQLSSSDSVLAAVEALS
                     PNVGKQYDQDEFEEQTSFNRKLLERVEAMIEYMEGGRVSDQALREMFLLTSLLKKGST
                     QDIEEALLHKEVELQSLDVICSQWETAQSIRGFIK"
     gene            complement(<689421..>690575)
                     /locus_tag="KLTH0D08184g"
                     /db_xref="GeneID:8295302"
     mRNA            complement(<689421..>690575)
                     /locus_tag="KLTH0D08184g"
                     /product="KLTH0D08184p"
                     /transcript_id="XM_002553022.1"
                     /db_xref="GeneID:8295302"
     CDS             complement(689421..690575)
                     /locus_tag="KLTH0D08184g"
                     /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
                     YMR026C PEX12 RING-finger peroxisomal membrane peroxin
                     that plays an essential role in peroxisome biogenesis and
                     peroxisomal matrix protein import forms translocation
                     subcomplex with Pex2p and Pex10p"
                     /codon_start=1
                     /product="KLTH0D08184p"
                     /protein_id="XP_002553068.1"
                     /db_xref="GeneID:8295302"
                     /db_xref="GOA:C5DGT8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:C5DGT8"
                     /translation="MDFYSNLPAASSSIASSIFPTLFEVLSADEIDELLTPSVRYIVA
                     NLVARNPNKLTIRFSNWFDEWFVLAAKLTLESYYLKTWDATFIEVFYGLKRINASDAV
                     LLRTLQSNPPVEIPMRLTRFQRRAVLCEKVLAPYVALKLDLLHSKLLARSLLQHPPAQ
                     EMGQRVRESLRTLYLRFYPLLKKLLFVLNLAVKLYFLSGRTGSTSLLDLILNIQYTRL
                     SKYDYSRNDRSSTAPGQAVRSRPQRLNRSALLFLCRASFSKIKNLLKLSVSQMLPAFI
                     FLLRVFQWWSSQDLSGEIQRRLNNIDKDIPPPPGRFEKNTEGTCRICNGPIRNPAVIG
                     TGYVFCYPCILDYLPQHEGKCPVTGSQLLGCQYDKDSGHWSIKGVRKLLL"
     gene            complement(690773..690844)
                     /locus_tag="KLTH0D08206r"
                     /db_xref="GeneID:8295303"
     tRNA            complement(690773..690844)
                     /locus_tag="KLTH0D08206r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (CTG) cove score=70.60"
                     /db_xref="GeneID:8295303"
     gene            complement(<693583..>694662)
                     /locus_tag="KLTH0D08250g"
                     /db_xref="GeneID:8295305"
     mRNA            complement(<693583..>694662)
                     /locus_tag="KLTH0D08250g"
                     /product="KLTH0D08250p"
                     /transcript_id="XM_002553023.1"
                     /db_xref="GeneID:8295305"
     CDS             complement(693583..694662)
                     /locus_tag="KLTH0D08250g"
                     /note="highly similar to uniprot|P14540 Saccharomyces
                     cerevisiae YKL060C FBA1 Fructose 1 6-bisphosphate aldolase
                     required for glycolysis and gluconeogenesis"
                     /codon_start=1
                     /product="KLTH0D08250p"
                     /protein_id="XP_002553069.1"
                     /db_xref="GeneID:8295305"
                     /db_xref="GOA:C5DGT9"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DGT9"
                     /translation="MGAQDVLTRKTGVIVGDDVRALFDYAKEHKFAIPAINVTSSSTA
                     VAALEAARDNGSPIILQTSNGGAAYFAGKGISNDGQNAAIRGSIAAAHYIRSIAPAYG
                     IPVVLHSDHCAKKLLPWFDGMLEADEAYFKLHGEPLFSSHMIDLSEESDDENIASCVK
                     YFTRMAKMGQWLEMEIGITGGEEDGVNNEHVSREDLYTKPETVFAVHKALAPISPNFS
                     IAAAFGNVHGVYAPGNVQLRPEILGDFQKYAHGQVKTEEKPLYLVFHGGSGSSNEDFK
                     TAIGHGVVKVNLDTDCQFAYLKGIRDYVLKNKDYLMTPVGNPEGADKPNKKKYDPRVW
                     VREGEKTMSERITEALGVFNTQKQL"
     gene            complement(<695296..>696987)
                     /locus_tag="KLTH0D08272g"
                     /db_xref="GeneID:8295306"
     mRNA            complement(<695296..>696987)
                     /locus_tag="KLTH0D08272g"
                     /product="KLTH0D08272p"
                     /transcript_id="XM_002553024.1"
                     /db_xref="GeneID:8295306"
     CDS             complement(695296..696987)
                     /locus_tag="KLTH0D08272g"
                     /note="highly similar to uniprot|P06169 Saccharomyces
                     cerevisiae YLR044C PDC1 Major of three pyruvate
                     decarboxylase isozymes key enzyme in alcoholic
                     fermentation decarboxylates pyruvate to acetaldehyde
                     subject to glucose-ethanol- and autoregulation involved in
                     amino acid catabolism and to YLR134W uniprot|P16467
                     Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
                     pyruvate decarboxylase, key enzyme in alcoholic
                     fermentation, decarboxylates pyruvate to acetaldehyde,
                     regulation is glucose- and ethanol-dependent, repressed by
                     thiamine, involved in amino acid catabolism"
                     /codon_start=1
                     /product="KLTH0D08272p"
                     /protein_id="XP_002553070.1"
                     /db_xref="GeneID:8295306"
                     /db_xref="GOA:C5DGU0"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DGU0"
                     /translation="MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMR
                     WAGNTNELNAAYAADGYARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVP
                     SLASQAKQQLLHHTLGDGDFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQ
                     RPVYLGLPANIVNQMVDRRLLDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILA
                     DACCSRHDAKKEAWQLTDATQFPCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAV
                     EAADLILSLGALLSDFNTGSFSYSYGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLI
                     QRIPAAIQHYSPRPVPTRPARNAPTPRDTPLTQEWLWTQIGEFLREGDVVVTETGTSA
                     FGINQTRFPNNTYGISQVLWGSIGFTTGATLGAAMAAEELDKNKRVILFIGDGSLQLT
                     VQEISSMVRWGLRPYLFVPNNDGYTIEKLIHGPTAQYNEIQNWHHLRLLPTFGATDYE
                     AVRVATTGEWDALTNDPAFNRNSRIRLVEVMLEVMDAPSSLVRQAQLTAATNAQN"
     gene            <697828..>699273
                     /locus_tag="KLTH0D08294g"
                     /db_xref="GeneID:8295307"
     mRNA            <697828..>699273
                     /locus_tag="KLTH0D08294g"
                     /product="KLTH0D08294p"
                     /transcript_id="XM_002553025.1"
                     /db_xref="GeneID:8295307"
     CDS             697828..699273
                     /locus_tag="KLTH0D08294g"
                     /note="similar to uniprot|Q04371 Saccharomyces cerevisiae
                     YMR027W High level expression reduced Ty3 Transposition"
                     /codon_start=1
                     /product="KLTH0D08294p"
                     /protein_id="XP_002553071.1"
                     /db_xref="GeneID:8295307"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="UniProtKB/TrEMBL:C5DGU1"
                     /translation="MLSPPYFAPSSTCQHHGFLAVMSLPQTFKNNDKGTFGQFTATSR
                     WPTIISNAIDDLQAELDTLEGGSQHFHDGQKIQQSLVELRKEVETDQAIRPFTAGEIK
                     TADVPGSFNEHIASVAQTWHTGGWLFCEVYLYRRINVLFRSYASWREFDIFNRVKQST
                     FQSSMVGVVELAVRYQKLQSQLESADSEAIELLFKEFVEISLWGNATDLSLLTNATLE
                     DIKSLQGEQARKASESKILINDTAKAWKQLQSSEHKRVDFVLDNSGFEVYADLMLALF
                     LLDTGIVKECIFHAKDIPYMVSDCMIKDFELLLRDMESPDFFDLKQLQHDEQPGRESL
                     AFLVKTLRDHIQSGCISFVQDSFWTTDLDYTHIDPSETKYHGAEIHKSLLDSALVIFK
                     GDLNYRKLTGDRKWPRTTKWETAIGSLASNGLKTLSLRTCKADVVVGLPSGVDEKLCS
                     EWESSNKKGEPGSWWSSSGKYAVICFCDGQN"
     gene            complement(<699342..>700532)
                     /locus_tag="KLTH0D08316g"
                     /db_xref="GeneID:8295308"
     mRNA            complement(<699342..>700532)
                     /locus_tag="KLTH0D08316g"
                     /product="KLTH0D08316p"
                     /transcript_id="XM_002553026.1"
                     /db_xref="GeneID:8295308"
     CDS             complement(699342..700532)
                     /locus_tag="KLTH0D08316g"
                     /note="similar to uniprot|P35728 Saccharomyces cerevisiae
                     YKL059C MPE1 Essential conserved subunit of CPF (cleavage
                     and polyadenylation factor) plays a role in 3' end
                     formation of mRNA via the specific cleavage and
                     polyadenylation of pre-mRNA contains a putative
                     RNA-binding zinc knuckle motif"
                     /codon_start=1
                     /product="KLTH0D08316p"
                     /protein_id="XP_002553072.1"
                     /db_xref="GeneID:8295308"
                     /db_xref="GOA:C5DGU2"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014891"
                     /db_xref="UniProtKB/TrEMBL:C5DGU2"
                     /translation="MSSTIFYKFRSQKGTSRILFDGTGITVFDLKREIIQENRLGDGT
                     DFQLRLYNPDTGEELEDDSYVIPRSSNVEVRRSPAIKVSGLNGRTSLGNATRYITGKP
                     RVMKATSHASPAVSAALNTKGMSEEDAIASMFANQENQWQQTQQEMSSATPIFHKTGA
                     AAGQDEGPPPPGYMCYRCGGKDHWIKNCPTNSDPNFEGKRIRRTTGIPKKFLKSVEID
                     PSTMTPEEMAQRKIMVTDDGSFVVQVADQHSWEDYQRKQQSRVMNHADAIWAKDHFAN
                     LSEDLKCPITGGLLKAPVKTSKCCNKTFSRQALEDLLVEHDFVCPGCGAEETLLDTLV
                     VDEEKEKQVEAFLSENSVKRKDADADGRDAKKPKLAMPVPPFGMPFPMFPMPFLPNMN
                     PTKQ"
     gene            <700660..>701007
                     /locus_tag="KLTH0D08338g"
                     /db_xref="GeneID:8295309"
     mRNA            <700660..>701007
                     /locus_tag="KLTH0D08338g"
                     /product="KLTH0D08338p"
                     /transcript_id="XM_002553027.1"
                     /db_xref="GeneID:8295309"
     CDS             700660..701007
                     /locus_tag="KLTH0D08338g"
                     /note="highly similar to uniprot|P32774 Saccharomyces
                     cerevisiae YKL058W TOA2 Transcription factor IIA small
                     chain"
                     /codon_start=1
                     /product="KLTH0D08338p"
                     /protein_id="XP_002553073.1"
                     /db_xref="GeneID:8295309"
                     /db_xref="GOA:C5DGU3"
                     /db_xref="InterPro:IPR003194"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR015871"
                     /db_xref="InterPro:IPR015872"
                     /db_xref="UniProtKB/TrEMBL:C5DGU3"
                     /translation="MSASGYYELYRRSTVGATLVDALDTLISDGRIEASLAMRVLDTF
                     DRVVAETLKDKTQSKLTFKGHLDTYRFCDDVWTFIIKDCNVKLDQTEDIQGNTVVVDK
                     LRIVACNSKKTGE"
     gene            <701141..>702229
                     /locus_tag="KLTH0D08360g"
                     /db_xref="GeneID:8295310"
     mRNA            <701141..>702229
                     /locus_tag="KLTH0D08360g"
                     /product="KLTH0D08360p"
                     /transcript_id="XM_002553028.1"
                     /db_xref="GeneID:8295310"
     CDS             701141..702229
                     /locus_tag="KLTH0D08360g"
                     /note="similar to uniprot|Q04372 Saccharomyces cerevisiae
                     YMR028W TAP42 Protein that physically associates with the
                     protein phosphatase 2A and the SIT4 protein phosphatase
                     catalytic subunits"
                     /codon_start=1
                     /product="KLTH0D08360p"
                     /protein_id="XP_002553074.1"
                     /db_xref="GeneID:8295310"
                     /db_xref="GOA:C5DGU4"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="UniProtKB/TrEMBL:C5DGU4"
                     /translation="MSSVKDVFQQLVSQVDSQIDSSPLRQDSKEFQERLTEIIGAFLE
                     LKSTVFSKLALFSDNETLEDLSTASMPLLAIDFYLGKLVSRKQAAQLQDTRDRNVLKL
                     KFLRKAVQLYMQFLMSLRNYELLDKATELKLDHLEDADEPKLESLYVQPSSDKDLSGA
                     QLKRQQKIEAYQQSKQLEAQIKALELKSSSDSNNDEDLRDLQKYQLIQTAYKALNEIE
                     QNLYEIELLSNFITSPPPSKCIKGVTQEDSDSSRTAYTDRVESLNQPLVSKTGKVLRN
                     FTLVNKKSQIKDKVFGYGQYAPTMSVEEFLEKELQSGRVLQGGEQDEPQPNEDDEEWQ
                     DRETYKAREWDAFKEANPKGSGNTLNRG"
     gene            complement(<702287..>705355)
                     /locus_tag="KLTH0D08382g"
                     /db_xref="GeneID:8295311"
     mRNA            complement(<702287..>705355)
                     /locus_tag="KLTH0D08382g"
                     /product="KLTH0D08382p"
                     /transcript_id="XM_002553029.1"
                     /db_xref="GeneID:8295311"
     CDS             complement(702287..705355)
                     /locus_tag="KLTH0D08382g"
                     /note="similar to uniprot|P35729 Saccharomyces cerevisiae
                     YKL057C NUP120 Subunit of the Nup84p subcomplex of the
                     nuclear pore complex (NPC) required for even distribution
                     of NPCs around the nuclear envelope involved in
                     establishment of a normal nucleocytoplasmic concentration
                     gradient of the GTPase Gsp1p"
                     /codon_start=1
                     /product="KLTH0D08382p"
                     /protein_id="XP_002553075.1"
                     /db_xref="GeneID:8295311"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021717"
                     /db_xref="UniProtKB/TrEMBL:C5DGU5"
                     /translation="MASVSYFSKVDANLQDFKSEKGNGSVVNLSLNSSSPAVDLRNTF
                     SDYSNTIRLLNDEYICYQFSHEYSVLSLYSLSAAIAGKTIVIQLPEHMLNMYHTFTIR
                     EIDGELVLELILRDGLYLVLYFPLNCILDGAAETPENWFTVLNPYDFTVRRPLYAYSV
                     SASSTIIFLEDGGLLGLTKSKNERGEHEVTPVLFNDNSYLQSLTKMFFLRRNPSQNFN
                     VASCIVYRDRYLLTLTQNCKLRVWDLKHQTAVFEKDLAVNEKHQNKVYETIGQFMSLY
                     EDKLAIFLPFDNGIFQLWDLRLDAQGHIALNPGPTYSSNLSSSSIWSLVDMKLTKPLD
                     SNCFSGYMNLVVLWRSNSVTKLQVLNLISEDLQQHQWLEAVNQSLMDLRADLSLLTNG
                     DTDRALMNLKSHYTPALYKRAQSTLSESGILLSPESPYNHEYLLNLESVLKDLKKRND
                     EPSSLTLYHGEIIMVNSLSLYSHALYKTNSRLESIFYNLNEEQSSKDDLGDYLRTIEG
                     FASTLSSQVLFEVSEAFLDMVTSSFPSEIPIKDKLTEIYTRHLDGNFHMANLRKLFEE
                     LSRLDVIKILNIFIDNHLQKEGNEEPLIDSIIPNKLVNVALLESTHQAILVQNNLVLK
                     ALLIFAFMDFDYSIFQPQIKTLLSLHYKQCLWISLYQLDKDLLASEVFARTSKFGNGY
                     KIKTYSDWSMSSTIVLNEIYSMPVSPNPLFIESFDKFVMSGTKSPKLCNSYLRVVQQR
                     FYIHSNVAHEFMLGLSYFMCGMYDLSFEFLQKHPYPETLPLEFPDRLYMPLQKDGHLW
                     RDVIGSFKLPYKHSAYYFNLSKLFSVANSFEYALKCVKKSIKLSSEQREAEEPLNFKK
                     AQLVQYLKTLIVFSNYEEILDVLRCSFETLPGDVRAAYYKQILTSLQHREAFFAKLLT
                     LCRDSSGAFLPVDDYKILDEILLEEVSKTSWETYKRLYSFRLINDHDRAAAEILYHYV
                     IHGESVDIKKKCLLLIINILSSFNSDGDRWILAGGNPVTLRDVRMELNAL"
     gene            complement(<705772..>707580)
                     /locus_tag="KLTH0D08404g"
                     /db_xref="GeneID:8295312"
     mRNA            complement(<705772..>707580)
                     /locus_tag="KLTH0D08404g"
                     /product="KLTH0D08404p"
                     /transcript_id="XM_002553030.1"
                     /db_xref="GeneID:8295312"
     CDS             complement(705772..707580)
                     /locus_tag="KLTH0D08404g"
                     /note="some similarities with uniprot|Q05040 Saccharomyces
                     cerevisiae YMR029C FAR8 Protein involved in G1 cell cycle
                     arrest in response to pheromone in a pathway different
                     from the Far1p-dependent pathway interacts with Far3p
                     Far7p Far9p Far10p and Far11p"
                     /codon_start=1
                     /product="KLTH0D08404p"
                     /protein_id="XP_002553076.1"
                     /db_xref="GeneID:8295312"
                     /db_xref="InterPro:IPR013258"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DGU6"
                     /translation="MEGSVGMNPIPTSPMYTLPGVMHYLQTEFTRNERDRIGWELERS
                     EMKTRIAQLEGENRTLRYELAKQKSSSDTADQSGLTSDLAIQEPLLLKSKLAVQENVK
                     EIIYLLRSPNVTEQLHELGDSADVVHGLEAMNLNLPLNQHQHQQLQRQQQAKSQTQRQ
                     SQHQRQPPQQDYDNVSTQSIRQAPVESFTPDVGLQARSIGSQSEHVSGVLDGNTSDQN
                     SEVDTIVPDDSATTRPRASSLFSSKSGSIAPNHVLRCKRLRYHLAGLEKLIISHHNLL
                     SYARDGLMKHWLIEPNLNCNDKLTKSFHGLAPIVLGLYWLDNQTFFTVDNFGLKVWLT
                     TESAPHLSLDVFGGSSDVSFSDIGSIDFKNGWLVLTCLDVVHIWEVVVTGKAINIGSR
                     HKVEGTGKVVDSILGMTEKSLILFKEDPYELVIYTFGGDILQRISLQEAVSKQTDSAD
                     TSNDGCKKLLLNKQSSKLLIQLGRFVAVYSFDRKKIVLSKQLTMTPTSAIFRSPKDYV
                     IFAYDDGLIEMRNINNFQDVVKTYNHYDEEAEYEDEDDTKANASNTTEKEVMSEVRQT
                     TSKGVIIDMTEIDSAAVIVSGGDDGIIRLERMEECG"
     gene            complement(<707761..>708264)
                     /locus_tag="KLTH0D08426g"
                     /db_xref="GeneID:8295313"
     mRNA            complement(<707761..>708264)
                     /locus_tag="KLTH0D08426g"
                     /product="KLTH0D08426p"
                     /transcript_id="XM_002553031.1"
                     /db_xref="GeneID:8295313"
     CDS             complement(707761..708264)
                     /locus_tag="KLTH0D08426g"
                     /note="highly similar to uniprot|P35691 Saccharomyces
                     cerevisiae YKL056C RBF18 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D08426p"
                     /protein_id="XP_002553077.1"
                     /db_xref="GeneID:8295313"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018103"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:C5DGU7"
                     /translation="MIIYKDIISGDELLSDAYDVKLVDGVIYEADCDMVKVGGDNIDI
                     GANPSTEGGDDDVEDGSEVVNNVVHSFRLQQTAFDKKSFLTYIKGYMKSIKNKLQETN
                     PDEVATFEKGAMVYVKKVVGSFKDWEFFTGESMDPDGMLVLLNYREDGTTPFVAIWKH
                     GVSEEKI"
     gene            complement(<708475..>709272)
                     /locus_tag="KLTH0D08448g"
                     /db_xref="GeneID:8295314"
     mRNA            complement(<708475..>709272)
                     /locus_tag="KLTH0D08448g"
                     /product="KLTH0D08448p"
                     /transcript_id="XM_002553032.1"
                     /db_xref="GeneID:8295314"
     CDS             complement(708475..709272)
                     /locus_tag="KLTH0D08448g"
                     /note="similar to uniprot|P35731 Saccharomyces cerevisiae
                     YKL055C OAR1 Mitochondrial 3-oxoacyl-[acyl-
                     carrier-protein] reductase may comprise a type II
                     mitochondrial fatty acid synthase along with Mct1p"
                     /codon_start=1
                     /product="KLTH0D08448p"
                     /protein_id="XP_002553078.1"
                     /db_xref="GeneID:8295314"
                     /db_xref="GOA:C5DGU8"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DGU8"
                     /translation="MPRTPVALITGATRGIGRAIVDKLSAEGLSCLMVGSRKESFGPM
                     TADLPVICRELQWHRGLVVDLAQWPQWTQQGRFDGFHFSSVPGARAYRCSDGAWPLLD
                     LPPSSELALLVNCAGVTQASPALRCDASEIQRITNINYLSAVSLCNMAAKRMLRSRKH
                     LSRPPCIVNISSILGDPATSALPGTALYSASKAALAQFSRTLSAELARAGIRVHCLSP
                     SLVAQTDMVQTLEEDAKVRLESTFSQFPAQSPQQIASQVWKLYDSDT"
     gene            complement(<709655..>711856)
                     /locus_tag="KLTH0D08470g"
                     /db_xref="GeneID:8295315"
     mRNA            complement(<709655..>711856)
                     /locus_tag="KLTH0D08470g"
                     /product="KLTH0D08470p"
                     /transcript_id="XM_002553033.1"
                     /db_xref="GeneID:8295315"
     CDS             complement(709655..711856)
                     /locus_tag="KLTH0D08470g"
                     /note="some similarities with uniprot|P35732 Saccharomyces
                     cerevisiae YKL054C DEF1 RNAPII degradation factor forms a
                     complex with Rad26p in chromatin enables ubiquitination
                     and proteolysis of RNAPII"
                     /codon_start=1
                     /product="KLTH0D08470p"
                     /protein_id="XP_002553079.1"
                     /db_xref="GeneID:8295315"
                     /db_xref="GOA:C5DGU9"
                     /db_xref="InterPro:IPR003892"
                     /translation="MSTQSRKSNSSKQPHSTHKKLDPELKFKLETLTELFPDWTNDDL
                     IDLVQEYEDLETIIDKITSGAATKWDEVKKPSKKERQREQQQQQQQQQQAQLAAQQAT
                     QPSSQSHHNNHTHISPSHDGDHSHSAQTSHNHHQSKSSKFSSRERDSSSRSHKKSSNN
                     AAASGPNGSGNARRERASGASRVPATSAASAASANASAVQPDHLKTAVSAAKTASSTS
                     WAAMASDKKAAKQSAQAKKAEEQQQEQQSPQQAQHESTAPSPQQEAEPQSQSQSKSQP
                     QSDNKSAESVSSTSTPATEDLEKPKKMTWAAIVKPKTKPSVKKSEPLEELEDLKREAA
                     QISTEEPEAAEKVIEQVIEQVEQTPEEVVEQVEVTVVPEEVSQESEEASAQQEETAEP
                     AAPVVPAEPEAASSEEKAAPAQPEQGTYSPVAQQQQPQQQQQPQQQQQAQQQQQQPTA
                     YSEDKQSQAQQAQSQQAQSFYQAQPQQYGSQTPQQTPQTLQQQNAAAAAAAAQQQYYM
                     YQNQFPGYSYPGMFDSQSYPAGYGQQYAPQSQNGSQPQTASTQQSQSGQYGVPPGYAS
                     TGRDLGAASPMAAQVQLQQQQQQQPYGGSFMPYYHFYQQSFPYGQPQYGMAGQYPYQV
                     PKAYNYMNQYQPQQGGQTPSSQSQQGEEAQQSAQQGQATASQGQAQGSGSQGQAQTNA
                     QQQAQLQQYYQFQQQQQQQQAAAAAAAAQQGGVPYGYSGYDFSSQATRGFY"
     gene            complement(<712735..>713001)
                     /locus_tag="KLTH0D08492g"
                     /db_xref="GeneID:8295316"
     mRNA            complement(<712735..>713001)
                     /locus_tag="KLTH0D08492g"
                     /product="KLTH0D08492p"
                     /transcript_id="XM_002553034.1"
                     /db_xref="GeneID:8295316"
     CDS             complement(712735..713001)
                     /locus_tag="KLTH0D08492g"
                     /note="highly similar to uniprot|O60200 Saccharomyces
                     cerevisiae YKL053C-A MDM35 Mitochondrial Distribution and
                     Morphology"
                     /codon_start=1
                     /product="KLTH0D08492p"
                     /protein_id="XP_002553080.1"
                     /db_xref="GeneID:8295316"
                     /db_xref="InterPro:IPR007918"
                     /db_xref="UniProtKB/TrEMBL:C5DGV0"
                     /translation="MGNAMSASFAPECTDLKQEYDNCFNQWYSEKFLKGLSMENECSK
                     QWYAYTTCVEAALVKQGIKPALDEARKEAPFEKGGESADSDASK"
     gene            complement(<713189..>713944)
                     /locus_tag="KLTH0D08514g"
                     /db_xref="GeneID:8295317"
     mRNA            complement(<713189..>713944)
                     /locus_tag="KLTH0D08514g"
                     /product="KLTH0D08514p"
                     /transcript_id="XM_002553035.1"
                     /db_xref="GeneID:8295317"
     CDS             complement(713189..713944)
                     /locus_tag="KLTH0D08514g"
                     /note="weakly similar to uniprot|P35734 Saccharomyces
                     cerevisiae YKL052C ASK1 Component of the DASH complex that
                     binds to microtubules and kinetochores and is essential
                     for chromosome segregation phosphorylated during the cell
                     cycle by cyclin-dependent kinases"
                     /codon_start=1
                     /product="KLTH0D08514p"
                     /protein_id="XP_002553081.1"
                     /db_xref="GeneID:8295317"
                     /db_xref="GOA:C5DGV1"
                     /db_xref="InterPro:IPR013964"
                     /db_xref="UniProtKB/TrEMBL:C5DGV1"
                     /translation="MAEESLERLDQEITLHLQQIDSNLSYCFSKITQDVIPHVTKYGA
                     VCDKAMDSSNWLKVMFQHAGNLQIDSVTGPQQQQQQQAPEAAENGSLQTLFPEKSRLS
                     PASSSILAPPTAAPHQRPAAGLPVPDLNVTTTTTGKVLQLPDSSDDELGDAADRDPTD
                     RSTTAHSRNDPDGSTLQRQRRKRKLSLLLQQQFGSSSSSVAPSPAQIKRRASSTIDSS
                     PMRKDLASHADSTKQQGVQPGTVIYFPTRDETS"
     gene            <714887..>715843
                     /locus_tag="KLTH0D08536g"
                     /db_xref="GeneID:8295318"
     mRNA            <714887..>715843
                     /locus_tag="KLTH0D08536g"
                     /product="KLTH0D08536p"
                     /transcript_id="XM_002553036.1"
                     /db_xref="GeneID:8295318"
     CDS             714887..715843
                     /locus_tag="KLTH0D08536g"
                     /note="similar to uniprot|P35735 Saccharomyces cerevisiae
                     YKL051W"
                     /codon_start=1
                     /product="KLTH0D08536p"
                     /protein_id="XP_002553082.1"
                     /db_xref="GeneID:8295318"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="UniProtKB/TrEMBL:C5DGV2"
                     /translation="MSLFKKPGNWFFIVPWVAFIPWWGMLVAMLACWAGQGHPIYWFM
                     HTSQFPVYISDIGATNLRPLFISCAGWQGLGYCVSLACEYFQRSGRWPFQRRALSHES
                     VADRGSTSASQDSIKSSYGDMLRSARFLMPPYYTRHERNCIFASFVLGAMGEVCLLMC
                     SIFSTAHYHRVHITMVGLFCAFMFLSVCCNVAEYFMMGRHYAQLHPLASPEDKLQETS
                     WNHWVGYKFNKYTISAIAKVVWLASALAWAIAFGAIDDGSKSACFEWLLAFWFGLLFI
                     IISVDFYLGGRYKYSKYFHQVTSFQGYYKYDRLLPTPRYDTL"
     gene            complement(<715949..>718741)
                     /locus_tag="KLTH0D08558g"
                     /db_xref="GeneID:8295319"
     mRNA            complement(<715949..>718741)
                     /locus_tag="KLTH0D08558g"
                     /product="KLTH0D08558p"
                     /transcript_id="XM_002553037.1"
                     /db_xref="GeneID:8295319"
     CDS             complement(715949..718741)
                     /locus_tag="KLTH0D08558g"
                     /note="similar to uniprot|Q05050 Saccharomyces cerevisiae
                     YMR031C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="KLTH0D08558p"
                     /protein_id="XP_002553083.1"
                     /db_xref="GeneID:8295319"
                     /db_xref="GOA:C5DGV3"
                     /db_xref="InterPro:IPR024527"
                     /translation="MSLISAAADVNDASSTTSAGSVRSSAVYRKDGKPLSQEALYRAQ
                     QKYGVFQSPARQTGSGLKDSKMASDVAANLANNNRTTIEAYKRVLDSNASRAATAVSS
                     RSRSSSVTSNATVVTTSSKSTNAAVKALSSKPVEQPVAPKKSNMNMSKILVGAEAAAE
                     KRIGIRMKPEKIVYVPSKESGKAAERSMSLTPEIMDKLKTKGDYEAEAEVEADPKKYA
                     SKAAFAVRDFDPNEATEKELLEREKKKQAYFGMLTSPQVLSLARANAQVKLDQIDKAA
                     PGSLYKNEEFNKLAVALAQKNSTKRSEHHGKINMGGGLWLTQADVQNIAQGLITPVLD
                     EVDSRALQQRAIDEDIKQRKIDFKEQNAAWIELQRNKLSNDKMYSRETRMRHKRETEG
                     LHARTERKFQDLCASKDSEVAEMEKALQNAKDSYAALQKQMEEDLEKERLRVEAEVAA
                     LKKEQEEDLKAARVEQEQELKPYVDDVKAAEAEHERLTAERDSLNKEIEELRASIESH
                     KVRIEELDNEISDSAAKHEEEEGKREELTKHKEEFDQEVSEKFTVIAQAAKEKAQKSS
                     EEARLKQLEVDAMINERQSELNSTELELKKEKLSLLEAMRNVTELKGEDKLDENRVKA
                     LIGMTSEEFIAENNKSVNVSDDKFEPFNEHTASTKSIKHEEGVLGEGGAKTNSDELPV
                     KDSAEKSSEHLNSTAEKSIEPAKASSPYPAKPSMVDAVLPKDFKPEVKPKAKPAHKTP
                     QQGAAAGGEPASAKSGVKRSPSLKQKFMGIIKGDTKSQSKPAAAATPVHPPATVKKAA
                     PKKAAASSEADTPAKVSPAKDTAKTEIQKIAQGGPAPAPEPEHKTAPAVDNATTKSVS
                     TLQKPTNSGIDKSEIHKIAQGGPAPTSGHSNHTRTSVYENGDNSDDEDELPDSSEAGE
                     NGIGADKKGSLFKEVF"
     gene            <719409..>721211
                     /locus_tag="KLTH0D08580g"
                     /db_xref="GeneID:8295320"
     mRNA            <719409..>721211
                     /locus_tag="KLTH0D08580g"
                     /product="KLTH0D08580p"
                     /transcript_id="XM_002553038.1"
                     /db_xref="GeneID:8295320"
     CDS             719409..721211
                     /locus_tag="KLTH0D08580g"
                     /note="similar to uniprot|Q05080 Saccharomyces cerevisiae
                     YMR032W HOF1 Bud neck-localized SH3 domain- containing
                     protein required for cytokinesis"
                     /codon_start=1
                     /product="KLTH0D08580p"
                     /protein_id="XP_002553084.1"
                     /db_xref="GeneID:8295320"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DGV4"
                     /translation="MSHSYNYQLSFWDEQDTGTRILLEHVSQGLESCEGLIDFFEERS
                     KLEKDYARRLSAITAKFNSNIQSQPDYGKLGLSVKSLHSSQERLSQSHSKQAVAIYRD
                     GFSELKLFVQDLQARYKTISLKTRNLCNDKITKKQLCDVLQGKLEKASTELRDCQLNQ
                     DNYLGKRDSSQNDRHIQKWRSIVDELQMKLDVLKQEYKNSTKHWLHEWSRLSLELQEL
                     ERSRIQFIKVKLQEFSKQCSDAAVEEQISMDNLTQQLTKFTADQDISSFAYNHGTGRI
                     RGNFVHAASADSPRTSSTSSKHVQNVRQLSSQLQRSRLSGYYEEQAADVPHPEVEKQK
                     PEPTKLDRLEPPETAAEVYTSSESSNESSNPTEFTSNVRHRASVESMSTSISSLAHSI
                     GDSQRFAKSWNSQNRRKSKTRSQLLESSQSSNLNEGSRTSSMETTRFHASSGPRTTQR
                     RKSMVASDSSSNPFKEALEAMKRGSSGYDDVEDERPSNSTSSQKKHLIPFQHSRSSTN
                     ETCTKRVMDKDHYVELPLFSSKGEEVLRYAKALYTFMEPNEQQIVNFHVGDYLLLTEQ
                     LDQDWFIGEVLDSQNVDPEYRYGIIPRNYIEILP"
     gene            complement(<721268..>721804)
                     /locus_tag="KLTH0D08602g"
                     /db_xref="GeneID:8295321"
     mRNA            complement(<721268..>721804)
                     /locus_tag="KLTH0D08602g"
                     /product="KLTH0D08602p"
                     /transcript_id="XM_002553039.1"
                     /db_xref="GeneID:8295321"
     CDS             complement(721268..721804)
                     /locus_tag="KLTH0D08602g"
                     /note="highly similar to uniprot|P36012 Saccharomyces
                     cerevisiae YKL049C CSE4 Centromere protein that resembles
                     histones required for proper kinetochore function homolog
                     of human CENP-A"
                     /codon_start=1
                     /product="KLTH0D08602p"
                     /protein_id="XP_002553085.1"
                     /db_xref="GeneID:8295321"
                     /db_xref="GOA:C5DGV5"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DGV5"
                     /translation="MNASIASQTGGRSLSNTNRLSRDINERAISLLQKNRQHRELLQR
                     RGEDRRRYVPSEEPSQIDISAPAVTQIRRRKASTKRYRPSDTALQEIRKYQRSTDLLI
                     SKMPFARLVKEVTDQFTTEEQQLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRI
                     TIMRKDMQLARRIRGQFI"
     gene            <722066..>723364
                     /locus_tag="KLTH0D08624g"
                     /db_xref="GeneID:8295322"
     mRNA            <722066..>723364
                     /locus_tag="KLTH0D08624g"
                     /product="KLTH0D08624p"
                     /transcript_id="XM_002553040.1"
                     /db_xref="GeneID:8295322"
     CDS             722066..723364
                     /locus_tag="KLTH0D08624g"
                     /note="similar to uniprot|Q05123 Saccharomyces cerevisiae
                     YMR033W ARP9 Actin-related protein"
                     /codon_start=1
                     /product="KLTH0D08624p"
                     /protein_id="XP_002553086.1"
                     /db_xref="GeneID:8295322"
                     /db_xref="GOA:C5DGV6"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027665"
                     /db_xref="UniProtKB/TrEMBL:C5DGV6"
                     /translation="MREETFYPPQLEIPTVVYKTPEGLYTSKSDSGNVKVNPLVDGQI
                     VDLDGFLFFVKLIYKSYLAQRSRNGASPEVFDMELSNIPMLMLSHSSWTHHQLETIAQ
                     FVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHLAVKV
                     EHGGSQIDQELAKLLPQWTPEQIEDLKKSSIFEVLSEDAKKSSSLNFKHGEDEGALDV
                     AALVTSDRDTREILEEREKNKDKHNVENSEQENNVFVDRHGKQIIVGKQRFKGCESLV
                     AEISKTVGRVLSQIDDFHKLRAMWENILVVGGTTSISGFKEALLQKLVEDHLIGEPAH
                     EKDIREREHSAQNSVKKKAKIANSFLNSVDYVQIPTAISLAKYPEYFPEWKKHGYAEV
                     PFLGAQIVAKQAFGHTNESFYVTREKYEKKGPSIVWDVAF"
     gene            complement(<723457..>724752)
                     /locus_tag="KLTH0D08646g"
                     /db_xref="GeneID:8295323"
     mRNA            complement(<723457..>724752)
                     /locus_tag="KLTH0D08646g"
                     /product="KLTH0D08646p"
                     /transcript_id="XM_002553041.1"
                     /db_xref="GeneID:8295323"
     CDS             complement(723457..724752)
                     /locus_tag="KLTH0D08646g"
                     /note="similar to uniprot|Q05131 Saccharomyces cerevisiae
                     YMR034C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D08646p"
                     /protein_id="XP_002553087.1"
                     /db_xref="GeneID:8295323"
                     /db_xref="InterPro:IPR016833"
                     /db_xref="UniProtKB/TrEMBL:C5DGV7"
                     /translation="MREALKTRLALFKILYTNRVTQFLISQWFFITLAVFIVLAHFFP
                     NFARHGGTIRAEYTIGYGAVAAIFLQSGLSMKTQKLCYNLGNWRAHLSVLTISFLVTS
                     SIMFGLCSGIKKANDPAIDDWVLMGLIVTATCPTTVASNVVMTKKAGGNDLLCLCEVF
                     IGNVLGAFVTPALVQMFTSSSLFAFGNPASGSSVSHLYADVMKQIGLSVFVPLFVGQV
                     LQNIFPEQVSWCLSTFKLGKVGSFCLLLIMWSSFSTAFHQRAFESVSHACIIFVVFFN
                     IAIYLFFTGICYLWARPWFLPLLFPTEPTQDSSKAYKTFYKILSPFYCTKKNAIAVMF
                     CGAAKTAALGVSLVTSQYGSDSPHLGKLLVPLVLYQSEQVITANFLVSFFKKWAADEN
                     NAVIETAQASNDIESGATSSAKKSCNIDRETLASSSAMK"
     gene            <725208..>725738
                     /locus_tag="KLTH0D08668g"
                     /db_xref="GeneID:8295324"
     mRNA            <725208..>725738
                     /locus_tag="KLTH0D08668g"
                     /product="KLTH0D08668p"
                     /transcript_id="XM_002553042.1"
                     /db_xref="GeneID:8295324"
     CDS             725208..725738
                     /locus_tag="KLTH0D08668g"
                     /note="similar to uniprot|P46972 Saccharomyces cerevisiae
                     YMR035W IMP2 mitochondrial peptidase"
                     /codon_start=1
                     /product="KLTH0D08668p"
                     /protein_id="XP_002553088.1"
                     /db_xref="GeneID:8295324"
                     /db_xref="GOA:C5DGV8"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:C5DGV8"
                     /translation="MSFIKSSGRFANSLLIGITWIPVALAFNENVCYIAKIQGSSMMP
                     TLNPSKTEPTDWVLLWKWGMKNVNNIKHNDVVLIKAPSNPRKVFCKRVKGKEFDSVQT
                     RYPYPREIAHIPRSHIWVEGDNAFHSIDSNNFGPVSTGLVLGKAIAVIWPPSRWNTDL
                     NTSLGREDIRVNGFGF"
     gene            complement(<725899..>727617)
                     /locus_tag="KLTH0D08690g"
                     /db_xref="GeneID:8295325"
     mRNA            complement(<725899..>727617)
                     /locus_tag="KLTH0D08690g"
                     /product="KLTH0D08690p"
                     /transcript_id="XM_002553043.1"
                     /db_xref="GeneID:8295325"
     CDS             complement(725899..727617)
                     /locus_tag="KLTH0D08690g"
                     /note="some similarities with uniprot|P23748 Saccharomyces
                     cerevisiae YMR036C MIH1 Protein tyrosine phosphatase
                     involved in cell cycle control regulates the
                     phosphorylation state of Cdc28p homolog of S. pombe cdc25"
                     /codon_start=1
                     /product="KLTH0D08690p"
                     /protein_id="XP_002553089.1"
                     /db_xref="GeneID:8295325"
                     /db_xref="GOA:C5DGV9"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DGV9"
                     /translation="MSDPKIFVRKAKRTTLQEGGNFLKNINLLVGINRRKSGKSRAAR
                     GGDAPGLNHPQSNLQQNETEKTTFAADSVFGAQVLHISSENSSTSCEEDDEEKGEGEG
                     ESCNSPVVRQPFFPILDSPSEDVFEHSMRLKPQRAPAPFLARIGNERANSASLAAIKN
                     SDGFNLRSRPLKRQPSGVKKEHATSQVAKGQLRRIHSMYASQKEVSKGLEVPKMRSLE
                     EPEAECDIECPAYESKLERSGIPHYFDNKTDDNLPRISVETLVNIMDGDVKKQYDTVH
                     IVDCRFEYEYQGGHIGDAINISSQTSLESVFIHNRKNYCKSHLPSLVIFHCEFSSYRG
                     PIMASHLRNCDRMLNYDNYPKLHYPDILIVEGGYKSFFEKYSHRCFPRRYIEMGSQDH
                     IDKCESEMEKFRRNSKRVATKSNSLHSLNKGNVTSRASTPFRSEFASRNQSCFSDYKK
                     HDRPGLSHYTTKSNLSFRYEAPPKLTLSQFSMNSGSGSPSSVSSSAASSRALLLDELQ
                     DDLESSDFDNISFEENEHPHTYCGGTDPVLALNSPKASLLSSIFQEEEVDSRYPSKQL
                     ANATTK"
     gene            complement(<728072..>729886)
                     /locus_tag="KLTH0D08712g"
                     /db_xref="GeneID:8295326"
     mRNA            complement(<728072..>729886)
                     /locus_tag="KLTH0D08712g"
                     /product="KLTH0D08712p"
                     /transcript_id="XM_002553044.1"
                     /db_xref="GeneID:8295326"
     CDS             complement(728072..729886)
                     /locus_tag="KLTH0D08712g"
                     /note="similar to uniprot|P32801 Saccharomyces cerevisiae
                     YKL048C ELM1 Serine/threonine protein kinase that
                     regulates cellular morphogenesis septin behavior and
                     cytokinesis required for the regulation of other kinases
                     forms part of the bud neck ring"
                     /codon_start=1
                     /product="KLTH0D08712p"
                     /protein_id="XP_002553090.1"
                     /db_xref="GeneID:8295326"
                     /db_xref="GOA:C5DGW0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DGW0"
                     /translation="MNEFEVEVSKSSNTQLPTLIDSKGYAEGGDQVLAQSGFTDKYAV
                     SYHQIIEQERALLDKRLRPVVKNTVHSDSKRKVGEYTLVRRIGKGQFGDVYMANTADG
                     GYVAIKCVPKRPRKSQQYSMNQVLRQIRRQQSQGRRSLSSDEAILEMNVNKIRWEIFV
                     ASGFNHKNILGVIECLDSRDSKDIWIVLPFASLGELKWKRSSKPETLEQWDLTLRHKT
                     SVTEFSEYVLRSLTAGLLYLWDQGCIHRDIKPSNILIDGSTGNIVLSDFGSSLLSPKK
                     LLLEEPAMQKAYSEEVKKIVGTPAFIAPELCNFEENDSSLDGFKIDLWSLGVTIFCLL
                     ENRLPFWGENEFDTFQKIANNELPLSGDWLHDLVVSKLLRKDPTHRLSIKQLDSLLRN
                     PKKESGMKKLVSRLRKISMKKKKGAKVPEASAGKAAIAVPSNVETSDVEFSDIESNIS
                     SAASLSDEPVQVPGFMDCRPPTDNGSPSVTASELSSRATPLELSPQQPSPLPVTPKHT
                     THDTSPSPIKIDTPLKNLIRAENTPEKAPSLSPMPVIKPQAQVSQQASRLASKGTLDF
                     TKYLQSPSKVPKDCAPVGSTKASNSIEDIKRYLNFAES"
     gene            complement(<730214..>732247)
                     /locus_tag="KLTH0D08734g"
                     /db_xref="GeneID:8295327"
     mRNA            complement(<730214..>732247)
                     /locus_tag="KLTH0D08734g"
                     /product="KLTH0D08734p"
                     /transcript_id="XM_002553045.1"
                     /db_xref="GeneID:8295327"
     CDS             complement(730214..732247)
                     /locus_tag="KLTH0D08734g"
                     /note="similar to uniprot|P33749 Saccharomyces cerevisiae
                     YKL062W MSN4 Transcriptional activator related to Msn2p
                     activated in stress conditions which results in
                     translocation from the cytoplasm to the nucleus binds DNA
                     at stress response elements of responsive genes inducing
                     gene expression"
                     /codon_start=1
                     /product="KLTH0D08734p"
                     /protein_id="XP_002553091.1"
                     /db_xref="GeneID:8295327"
                     /db_xref="GOA:C5DGW1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DGW1"
                     /translation="MSPLEPASARVTCHTALIKHSSSGLSHTPNTANPGRAPLHTRTT
                     PFTQQHLHLDRAQTAGLQHAPMTAHQQQQYASQEELHTYSSNSLDIRNGFAARERGTP
                     SAEPARPLHKQPSPTAVGELLALLDDQGTLVAAATPPHLDSRGFLTGEQMNEPAVELI
                     SEPGHALTGLPTEQISSSRPGPHAGPRTSLPTQVHTAEHERPSSGSRSRSSASARDSA
                     TILFDEALAALSPPEELQHLHTPQHLQPEQPCIDPNLLSNSNSYVDSGLQLDDSNVLE
                     AFADQDESHSVLDEFTFSRRPSEPASRAFAPDLPARGSISYATDFWNLPSSGSKSGSE
                     RPAERLAGDSRLPASSGFRPTHKPHRSFAGVLPSSLGAARPPSVGVRSESLKPSGTST
                     SPFKIENELTQLLSDYNLSYSHQKATKFRTGSFNALTISRKSSLSEPQHRVQKQRAST
                     SLVDGNNHDLISKLYDDMATPRPRLTNLSWENAIMSDDEEDEEDELAQPLKALGNSHA
                     DGAAGYNFNSNDILQQLESEAEPSNSKFIPPNLLVNDSNQAADNNAIDMTNLSSGSAG
                     SNTLNPLQLSLTASTSPSSYNSNSNAKQRKATSFSKPSRNSKSSSPIEEDEKPFKCQE
                     CTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKHGDF"
     gene            <733064..>733627
                     /locus_tag="KLTH0D08756g"
                     /db_xref="GeneID:8295328"
     mRNA            <733064..>733627
                     /locus_tag="KLTH0D08756g"
                     /product="KLTH0D08756p"
                     /transcript_id="XM_002553046.1"
                     /db_xref="GeneID:8295328"
     CDS             733064..733627
                     /locus_tag="KLTH0D08756g"
                     /note="similar to uniprot|P35725 Saccharomyces cerevisiae
                     YKL063C"
                     /codon_start=1
                     /product="KLTH0D08756p"
                     /protein_id="XP_002553092.1"
                     /db_xref="GeneID:8295328"
                     /db_xref="UniProtKB/TrEMBL:C5DGW2"
                     /translation="MQGGVRRKNDLLPRYRGQAHSKKQSFLTTPMKKVAVYVMLLIMM
                     YLAIKTVFVDPQNAETKLEIESAVGRAGAGGDALEAQMDAADLQTNPKVSKERFNNEV
                     VMQQETKNLENEKDFQKQKVPTKNTKQEVGNDVKAVKPQFENKEQPPVDEQARRINEK
                     APYKKTDKKSDKAVAEGGAAAAAANAL"
     gene            complement(<733758..>734492)
                     /locus_tag="KLTH0D08778g"
                     /db_xref="GeneID:8295329"
     mRNA            complement(<733758..>734492)
                     /locus_tag="KLTH0D08778g"
                     /product="KLTH0D08778p"
                     /transcript_id="XM_002553047.1"
                     /db_xref="GeneID:8295329"
     CDS             complement(733758..734492)
                     /locus_tag="KLTH0D08778g"
                     /note="similar to uniprot|P40202 Saccharomyces cerevisiae
                     YMR038C CCS1 Copper chaperone for superoxide dismutase
                     Sod1p involved in oxidative stress protection
                     Met-X-Cys-X2-Cys motif within the N-terminal portion is
                     involved in insertion of copper into Sod1p under
                     conditions of copper deprivation"
                     /codon_start=1
                     /product="KLTH0D08778p"
                     /protein_id="XP_002553093.1"
                     /db_xref="GeneID:8295329"
                     /db_xref="GOA:C5DGW3"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="UniProtKB/TrEMBL:C5DGW3"
                     /translation="MTSPTSEDSFEATYAVDMHCNGCVEDIKSCLAGIPNLSLDFHVP
                     KKLLAVKGTAAPSVIISTLQKCGRDAIIRGTGKPNSAAVSILETFEPVADSDTPVRGL
                     ARIVGVSDTKTWVDITLNGLPQPGKYYASVRECGDISKGAQSTGGPVYKFDEPIDCSS
                     PSDLGKNLYSGQAFLSAPLRVWELVGRSFMVTSDPQHRAGHGYEICGVLARSAGVWEN
                     DKQVCACSGKSVWQERKDALEHNIQH"
     gene            complement(<734724..>737456)
                     /locus_tag="KLTH0D08800g"
                     /db_xref="GeneID:8295330"
     mRNA            complement(<734724..>737456)
                     /locus_tag="KLTH0D08800g"
                     /product="KLTH0D08800p"
                     /transcript_id="XM_002553048.1"
                     /db_xref="GeneID:8295330"
     CDS             complement(734724..737456)
                     /locus_tag="KLTH0D08800g"
                     /note="similar to uniprot|P35724 Saccharomyces cerevisiae
                     YKL064W"
                     /codon_start=1
                     /product="KLTH0D08800p"
                     /protein_id="XP_002553094.1"
                     /db_xref="GeneID:8295330"
                     /db_xref="GOA:C5DGW4"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:C5DGW4"
                     /translation="MSDPRELESAPLLGQSKARKAKSKKSGSKKRKRKSAFKGSAASA
                     VVEPQNLHVEDSKHHEFNSNDFDKTDSWGILHEGSEEDSGAATRNTSSSDVALASHFP
                     HSYFDHRPSIAVMEAINSSGTLKRGRRPSTARAHGSGTGAQVTKGMLPQMSPRDAERW
                     ARCAKDSHAQGASVARSQGSDVVIDVDELMNHVTRNNHLSQSSAQSPSTLSPRHSSGG
                     YNSQPSSRRTSNSSSLKDVCLPMDDEDSEGPKLWPDISVLEEYSKEETERLRRQAVED
                     AENFHFQYDDEEDYEDNNNNDGVLFSKPIVTNIDVPELGNTRINEAEHMKTGRLRPKK
                     ITPWHLRRKGSIIPGFSGQTDAKNVKLVSQTSRKGQDDFLVGSNIQYPPHIVSNNPEH
                     FRFTYFREDLDSTIHSPTISGLLQPGQKFEELFVSSIYAGSNHEATPSETKSSTPVQQ
                     TPLQRLSTRQSGSIEIDDVPPFWLDVSNPSEEEMKVLSKAFGIHPLTTEDIFLGEVRE
                     KVELFKDYYLVCFRSFDIVAERHTRKKKQQQDSSSSINDHENTKKWLPKFLRSRRRSS
                     TNKTVSSSDPSYRSKVRKEIEENEKYKRKSGDRRRPRGGELEPLNVYIIVFRTGVLTF
                     HFAPTPHPINVRRRARLLKDYLNVTADWIAYALIDDITDAFAPMIEIIEDEVHDIEEY
                     ILKMNQSDDSSSDDDSSDEETFERGYSSIDRYPKRGSVVNENASLSSLSRSSRSSTST
                     FDANIIGWKRKGDMLRRIGECRKRVMSIIRLLGSKADVIKGFAKRCNEHWEVAPRSEI
                     GMYLGDIQDHIVTMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMNDVLGKITILG
                     TVVLPMNIITGLWGMNVLVPGQNTDSLTWFTCITTSMLVFAYIAYVYTKRRFGF"
     gene            complement(<737718..>738518)
                     /locus_tag="KLTH0D08822g"
                     /db_xref="GeneID:8295331"
     mRNA            complement(<737718..>738518)
                     /locus_tag="KLTH0D08822g"
                     /product="KLTH0D08822p"
                     /transcript_id="XM_002553049.1"
                     /db_xref="GeneID:8295331"
     CDS             complement(737718..738518)
                     /locus_tag="KLTH0D08822g"
                     /note="some similarities with uniprot|P54000 Saccharomyces
                     cerevisiae YMR039C SUB1 Suppressor of TFIIB mutations
                     transcriptional coactivator"
                     /codon_start=1
                     /product="KLTH0D08822p"
                     /protein_id="XP_002553095.1"
                     /db_xref="GeneID:8295331"
                     /db_xref="GOA:C5DGW5"
                     /db_xref="InterPro:IPR003173"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="UniProtKB/TrEMBL:C5DGW5"
                     /translation="MSYYNRYRGQRKFAGNGETGAAIDEPDAIFELGNNKRVTVRQFR
                     NINLIDIREYYADSASGEMKPGKKGISLTEELYDELLKHRQNIDDALRRFGSKRPRTK
                     TVNVLSDSEDEPQSMRVAPPQRSKPTRSEQSKPARRDRRTAAPAPPQSQPDEKRRKRD
                     AREAGARLVMPGGQPSNPRLDDLHTSRTNVSNPRLDDLHTPPASASNPRLDDHLPRLP
                     SVPKPDNDSDLDSSDEDFALALESEFQRDENSARANDHEDEGEISEES"
     gene            <738727..>739749
                     /locus_tag="KLTH0D08844g"
                     /db_xref="GeneID:8295332"
     mRNA            <738727..>739749
                     /locus_tag="KLTH0D08844g"
                     /product="KLTH0D08844p"
                     /transcript_id="XM_002553050.1"
                     /db_xref="GeneID:8295332"
     CDS             738727..739749
                     /locus_tag="KLTH0D08844g"
                     /note="similar to uniprot|Q04212 Saccharomyces cerevisiae
                     YMR041C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D08844p"
                     /protein_id="XP_002553096.1"
                     /db_xref="GeneID:8295332"
                     /db_xref="GOA:C5DGW6"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DGW6"
                     /translation="MDSLKPIGPTQGLVRGLGVENLPKLILGGATLNTQYNDDPASLP
                     VVDMIRFAMQFGVRAIDTSPYYGDSEVLYGAALESLKEELPRENYFICTKVGRIRLEE
                     FDYSRSHIHFSVLRSCERLKTKYLDVVFLHDVEFVETEQVLEALQELRKLRDEGVILN
                     FGISGYPVDFLLNIALKCKTHPQIGALDVVLSYANLNLQNRTLHEYAPRFREEAGVKV
                     VENGSILSMSLLRSQETKAFHPCSAELRKLSNEAAQYAASQGEDLASLATRYAFSEWA
                     DKGPTVLGVSSVAELRVALESYTIVADNQGKLSEKDARLANEIQSQIFGAHMNETWSS
                     GIDHEE"
     gene            complement(<739836..>740459)
                     /locus_tag="KLTH0D08866g"
                     /db_xref="GeneID:8295333"
     mRNA            complement(<739836..>740459)
                     /locus_tag="KLTH0D08866g"
                     /product="KLTH0D08866p"
                     /transcript_id="XM_002553051.1"
                     /db_xref="GeneID:8295333"
     CDS             complement(739836..740459)
                     /locus_tag="KLTH0D08866g"
                     /note="similar to uniprot|P35723 Saccharomyces cerevisiae
                     YKL065C YET1 Endoplasmic reticulum transmembrane protein
                     homolog of human BAP31 protein"
                     /codon_start=1
                     /product="KLTH0D08866p"
                     /protein_id="XP_002553097.1"
                     /db_xref="GeneID:8295333"
                     /db_xref="GOA:C5DGW7"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:C5DGW7"
                     /translation="MSVYLSVLFGALTLEMACLFVLVLPLHYKIRKGLVSTYDRFMSY
                     TQVKTVIWITAGLVGLLFVDSWKRAQVSVFLHHHQGVGGPSANPDGAGAITPVQALAS
                     RAYNQRNTYISGFILYFCFCIPTVISVVRRLVKYETLLRDKDSQHEGQNEAETKAEAE
                     VAKLKKELSEKKASIKALAKQKANLEAHFDSSAEAQKNADPKLKKDN"
     gene            complement(740937..741051)
                     /locus_tag="KLTH0D08888r"
                     /db_xref="GeneID:8295334"
     tRNA            complement(join(740937..740980,741014..741051))
                     /locus_tag="KLTH0D08888r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8295334"
     gene            <741531..>742505
                     /locus_tag="KLTH0D08910g"
                     /db_xref="GeneID:8295335"
     mRNA            <741531..>742505
                     /locus_tag="KLTH0D08910g"
                     /product="KLTH0D08910p"
                     /transcript_id="XM_002553052.1"
                     /db_xref="GeneID:8295335"
     CDS             741531..742505
                     /locus_tag="KLTH0D08910g"
                     /note="some similarities with uniprot|P50947 Saccharomyces
                     cerevisiae YNL097C"
                     /codon_start=1
                     /product="KLTH0D08910p"
                     /protein_id="XP_002553098.1"
                     /db_xref="GeneID:8295335"
                     /db_xref="GOA:C5DGW8"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:C5DGW8"
                     /translation="MAAPANLYPGLNDISDVLEEMPLEVTRYLTLLREIDAKCVHTVP
                     ELNSTIGEFLGARGSKNDGVEPLARMNGLFQDLMPSLEEKMHVSALAYEALNRLTARL
                     ELAYEVAIKNNEIPPKLRLGNDNHPAMHLHHELMAKIDSKSGSKSSQALKSESRREAM
                     AARRTAGAPPSVPAGHATGNGGGAGGAGAGGAGAGGFAAGAAASGSAAAATAAGAAQT
                     TDGRKRRTMAGPTGTASGAMGATAGSASADSKKRKRKTASREDYSQRPKTNEYGEALY
                     CYCNQVAYGEMVGCDGDNCILEWFHLPCIGLETLPKGKWYCDDCKRAL"
     gene            <742772..>743762
                     /locus_tag="KLTH0D08932g"
                     /db_xref="GeneID:8295336"
     mRNA            join(<742772..742786,742899..>743762)
                     /locus_tag="KLTH0D08932g"
                     /product="KLTH0D08932p"
                     /transcript_id="XM_002553053.1"
                     /db_xref="GeneID:8295336"
     CDS             join(742772..742786,742899..743762)
                     /locus_tag="KLTH0D08932g"
                     /note="similar to uniprot|P01120 Saccharomyces cerevisiae
                     YNL098C RAS2 GTP-binding protein that regulates the
                     nitrogen starvation response, sporulation, and filamentous
                     growth; farnesylation and palmitoylation required for
                     activity and localization to plasma membrane; homolog of
                     mammalian Ras proto-oncogenes"
                     /codon_start=1
                     /product="KLTH0D08932p"
                     /protein_id="XP_002553099.1"
                     /db_xref="GeneID:8295336"
                     /db_xref="GOA:C5DGW9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGW9"
                     /translation="MSLNKNNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIE
                     DSYRKQVVVDGKVSILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFEELMT
                     YYQQILRVKDADYVPVFLVGNKSDLEDERQVAYEEGVSLAKQFNAPFLETSAKQAINV
                     EESFYGLVRLVRDEGAVYNPAHGEQLGQKFQQQQARNQSMGAGAGLGVGASDGLDNGG
                     HASDPNMLSADAQGGQAADARTSGVAASGKAGELKSGKAPGAAGKVKSPAGRVEQRAD
                     NTSGKKQKSGGCCIVC"
     gene            complement(<743851..>744231)
                     /locus_tag="KLTH0D08954g"
                     /db_xref="GeneID:8295337"
     mRNA            complement(<743851..>744231)
                     /locus_tag="KLTH0D08954g"
                     /product="KLTH0D08954p"
                     /transcript_id="XM_002553054.1"
                     /db_xref="GeneID:8295337"
     CDS             complement(743851..744231)
                     /locus_tag="KLTH0D08954g"
                     /note="similar to uniprot|P46964 Saccharomyces cerevisiae
                     YOR103C OST2 Epsilon subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="KLTH0D08954p"
                     /protein_id="XP_002553100.1"
                     /db_xref="GeneID:8295337"
                     /db_xref="GOA:C5DGX0"
                     /db_xref="InterPro:IPR003038"
                     /db_xref="UniProtKB/TrEMBL:C5DGX0"
                     /translation="MVPKTTPKKADVASSASKFSDTISASYKAYCKQVSGDRQLQLID
                     TFCAFLVAVGVIQFLFVCAAKDSFPLNAFLAGFSACVGQFVLLVSLRMQVVNSFMGIS
                     PQRAFGEFVLASLVLHFLCLHFVN"
     gene            <744374..>744991
                     /locus_tag="KLTH0D08976g"
                     /db_xref="GeneID:8295338"
     mRNA            <744374..>744991
                     /locus_tag="KLTH0D08976g"
                     /product="KLTH0D08976p"
                     /transcript_id="XM_002553055.1"
                     /db_xref="GeneID:8295338"
     CDS             744374..744991
                     /locus_tag="KLTH0D08976g"
                     /note="highly similar to uniprot|P50946 Saccharomyces
                     cerevisiae YNL099C OCA1 Putative protein tyrosine
                     phosphatase required for cell cycle arrest in response to
                     oxidative damage of DNA"
                     /codon_start=1
                     /product="KLTH0D08976p"
                     /protein_id="XP_002553101.1"
                     /db_xref="GeneID:8295338"
                     /db_xref="GOA:C5DGX1"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DGX1"
                     /translation="MEPDYEEDDDHVYINEETELGRENVVISHAPRARIVPPLNFCPV
                     ERYLYRSGQPSTVNFPFLLDLKLKTIIWLANEEPQDALLEFCDAHAIQLQFATINPDG
                     GEDDNPWDGLTEHSIISALRTIVNVESYPLLVCCGMGRHRTGTVIGCLRRIMGWNLAS
                     VSEEYRRFTGSRGGRILVELLIEAFDTQLVEIDRAKAPQWLLTAV"
     gene            <745108..>745761
                     /locus_tag="KLTH0D08998g"
                     /db_xref="GeneID:8295339"
     mRNA            <745108..>745761
                     /locus_tag="KLTH0D08998g"
                     /product="KLTH0D08998p"
                     /transcript_id="XM_002553056.1"
                     /db_xref="GeneID:8295339"
     CDS             745108..745761
                     /locus_tag="KLTH0D08998g"
                     /note="weakly similar to uniprot|Q12057 Saccharomyces
                     cerevisiae YOR104W PIN2 Protein that induces appearance of
                     [PIN ] prion when overproduced"
                     /codon_start=1
                     /product="KLTH0D08998p"
                     /protein_id="XP_002553102.1"
                     /db_xref="GeneID:8295339"
                     /db_xref="UniProtKB/TrEMBL:C5DGX2"
                     /translation="MSQICYKRLATRGFVSGAKDTAESFKSWDSCMDNRACKIIAIVG
                     IVIASIVAVWIVGSLLRCFKYGASGICEFCCWCCGAGRRRGVQRPIAQPHSQPGVGGG
                     PPMVVYQPVTAPQDAYYRGNSFYDERSSVKELEQDFDLEAQRPENKRRAAGAHRISGG
                     REAVPLVYDEDPREDHELSVYHPRLTTNVAPQGYTTQTPYPKDEQQSYSKTYRHGNY"
     gene            complement(<745849..>746571)
                     /locus_tag="KLTH0D09020g"
                     /db_xref="GeneID:8295340"
     mRNA            complement(<745849..>746571)
                     /locus_tag="KLTH0D09020g"
                     /product="KLTH0D09020p"
                     /transcript_id="XM_002553057.1"
                     /db_xref="GeneID:8295340"
     CDS             complement(745849..746571)
                     /locus_tag="KLTH0D09020g"
                     /note="similar to uniprot|P50945 Saccharomyces cerevisiae
                     YNL100W"
                     /codon_start=1
                     /product="KLTH0D09020p"
                     /protein_id="XP_002553103.1"
                     /db_xref="GeneID:8295340"
                     /db_xref="GOA:C5DGX3"
                     /db_xref="InterPro:IPR019166"
                     /translation="MSRNFYADEGAFVGSSKGPLLPDILHTEDVSTKTLPTGNQIYDS
                     KALDSWFSGIRKYVTHKYYIYKTELDTQKSAAANEWKSVQDYVSQHVLTDDYEKQELL
                     VPSSALALGAFFTGRVLSNRRNWGFDSPLNTTKAGILTRNPSALGRVLTSIPSRVLLP
                     WVLTGTVLSQLTPVTWNNSVKALEQDVLPADLVARYHEIWNQLLVDGVQKTSASVHRN
                     VDASLQQGIGEVRRYLVKKLDL"
     gene            complement(<746802..>748958)
                     /locus_tag="KLTH0D09042g"
                     /db_xref="GeneID:8295341"
     mRNA            complement(<746802..>748958)
                     /locus_tag="KLTH0D09042g"
                     /product="KLTH0D09042p"
                     /transcript_id="XM_002553058.1"
                     /db_xref="GeneID:8295341"
     CDS             complement(746802..748958)
                     /locus_tag="KLTH0D09042g"
                     /note="similar to uniprot|P50944 Saccharomyces cerevisiae
                     YNL101W AVT4 Vacuolar transporter exports large neutral
                     amino acids from the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="KLTH0D09042p"
                     /protein_id="XP_002553104.1"
                     /db_xref="GeneID:8295341"
                     /db_xref="GOA:C5DGX4"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DGX4"
                     /translation="MKPKTKKSDGIDSLSSNISIPQQQDRRRHSILLLSESVASRRSS
                     YTRALRDSKWRKSGTFSKSPQLGRSVDSRIFIDRASPSFKTPKQQHQEEILNSVRTNY
                     LNDYMSRKASQTSLSLKGQNESSDTEQGPELLDRDPNLESQGGHITRELYRMTSPAAF
                     GKAVKKTRSADDLTLEEQHSASNASALNVPGGFRREFILQKHNKGKTIDTALSSESET
                     LHSSSVSGESVPDSSEKVPFLTRNFLEFLYVYGHFAGESFEDEFYTDQESEEQAVDET
                     SPLLARAEAGTGKKILVPKSAKGTTSTTKAFLLMIKSFVGTGVLFLPGAFSNGGLFFS
                     LAMLVFFGIYSYWCYYILTKSKIATKVSSFGDIGLTLYGPWMKFIILFSLVMTQLGFS
                     GAYVVFTAKNLLAFVENVFYWPGVTIVHLLALQLVVFIPLSFIRNIAKLSFSSLVANF
                     LVMGGIVIVIGFTAKHLFFDLNCKPAEGIVTGFNSQSWTLFVGTAIFAFEGIGLIIPI
                     QSSMKHPEKFPLVMALVIITATVLFVSVATLGYLSYGAETQTVILLNLPQDSILVNLI
                     QFFYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKIQYKPNSGKLDWRIK
                     WLKNFVRSLIVSSVVIAAYFGANHLDAFVAIVGSLACIPLVYIYPPMLHLRSCSKPRF
                     AGEKSVWRKWPILLDYVLVVFGAIGMVYTSYQSIFG"
     gene            complement(<749322..>753683)
                     /locus_tag="KLTH0D09064g"
                     /db_xref="GeneID:8295342"
     mRNA            complement(<749322..>753683)
                     /locus_tag="KLTH0D09064g"
                     /product="KLTH0D09064p"
                     /transcript_id="XM_002553059.1"
                     /db_xref="GeneID:8295342"
     CDS             complement(749322..753683)
                     /locus_tag="KLTH0D09064g"
                     /note="similar to uniprot|P13382 Saccharomyces cerevisiae
                     YNL102W POL1 Catalytic subunit of the DNA polymerase
                     alpha-primase complex required for the initiation of DNA
                     replication during mitotic DNA synthesis and premeiotic
                     DNA synthesis"
                     /codon_start=1
                     /product="KLTH0D09064p"
                     /protein_id="XP_002553105.1"
                     /db_xref="GeneID:8295342"
                     /db_xref="GOA:C5DGX5"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015088"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR024647"
                     /db_xref="InterPro:IPR029702"
                     /db_xref="UniProtKB/TrEMBL:C5DGX5"
                     /translation="MSAKNRIELLKKLQHARQNKSSKSLYEEDETDDKVYDLIDEEEF
                     RSMKRQELLRDDFVVDDDGLGYVDRGVDEWDDRNRDQNYSSEEDDKPRERAAKGSKKI
                     KNDGKGVKSSSGASIGDIIAAQHTKNAKVLSKAPKKFSLDEFDDILQEFDGNEASTAV
                     GGLFGAKSHRVVPKLENNIKREANAAATPPTIKRMKIDEQSFSTPQGGANTSPLAGTK
                     TKANLLDDRDLQAMIDDVQSSPTITKERSADIVKSGGQSSEEDSDEEITFRRRTIRSA
                     AASQRSNVDIRSSVQSSPFVTAPPTPSGSSKLKEENPKSLSFIGKRYSRSDVISDNAS
                     SFKFYWLDFAEVDSTLLLFGKISTRENKLISAMIQILNLSRELFFLPREGKTASDVHG
                     EIIPLLMEKYGLENIRAKPEIKKYAFELPGIPHESEYLKVLLPYRTPKNRNVTIPSDL
                     EGDTFHHVFGGNTNIFESFVVQKKVMGPCWLEINNGDFSALSNASHCDIEVQVSQPSS
                     IEPTSDKHVPNLNCASLAVQTIMSSKENKQEIVSITLSQYKNLAQDLPIPEDLAPNDT
                     ITLVRPPVGSSFPTGLTHLAKKNLTGNLRLFNNEKALLSCFCAMMKSSDPDVIIGHRL
                     ENVALDTILYRCFELKIPTFSCLGRRARKSWPDKFGKNPSMNQFYNRDILSGRLLCDI
                     SNEMGQSLTPKCQSWDLPEMYQVTCQKEQRALEINYQNPQYQNDVNSMIMALQENVSN
                     ALISAEIAFRIQILSLTKQLTVLAGNAWCQTLGGTRAGRNEYILLHEFERNNYIVPDK
                     ETKSMRNQRQQRAREEAGLDGGDEVQVSSKKAKYQGGLVFEPEKGLHKNYVLVMDFNS
                     LYPSIIQEYNICFTTVERDPSNIDELPNVPSSEMAQGVLPRLLASLVQKRREVKKLLK
                     TEPDPHKRTQCDIRQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQ
                     LAESLALTVVYGDTDSVMIDTGSDSYMEAIKIGENFKKLVNERYRLLEIDTDNVFRKL
                     LLHAKKKYAALTVVFDKSGAEKTLLEVKGLDMRRREYCPLSKEVSTHVLETILSDKEP
                     ETALQDVYEYLEDIREKVENNTIRVDKYKINTRLSKDPKAYPGGKNMPAVQAALRMRE
                     AGRVVKAGSVITFVITKQEGVEDDSSLSPAERARVLNEVMVKNNNLRPDPQFYLEKQI
                     FAPVERLLERIESFDIVRLSESLGLDSRRFINRAGANGELNGSSSGSLQPLESSISDE
                     ERFKDVAALTFQCSGCQQRFPFGGIVASKRYQMSYSGLQCSSCQHTFAPLQMSAQLES
                     AIRSHISMYYAGYLACDDPTCGNNTRQVSVFGKRCLNENCMGVMRYRYTDKQLYNQLL
                     YFESLFDVDKNKKDAVKPLYKPDHPDAPEAKIPTSQLLALGEQNRELFQVMSSVVQKY
                     LANCARRFVDMDAIFAV"
     gene            <753982..>754779
                     /locus_tag="KLTH0D09086g"
                     /db_xref="GeneID:8295343"
     mRNA            <753982..>754779
                     /locus_tag="KLTH0D09086g"
                     /product="KLTH0D09086p"
                     /transcript_id="XM_002553060.1"
                     /db_xref="GeneID:8295343"
     CDS             753982..754779
                     /locus_tag="KLTH0D09086g"
                     /note="similar to uniprot|Q12241 Saccharomyces cerevisiae
                     YOR106W VAM3 Syntaxin-related protein required for
                     vacuolar assembly PEP12 homolog"
                     /codon_start=1
                     /product="KLTH0D09086p"
                     /protein_id="XP_002553106.1"
                     /db_xref="GeneID:8295343"
                     /db_xref="GOA:C5DGX6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5DGX6"
                     /translation="MSFLDAISRPGTKAHRSNGTLDELLSELIHSINELQKKNGLLGT
                     KRDSQELRYSVEMELVPQCETLRDRIEQVVSGDYSNGKLATDFASLKGELIRSKRQFS
                     ELKSKFPLRKAQRPSSNSVVSQNSGYVSMPVAIAEETTPLLQDQGSRDRQQQLQQQEQ
                     PSVSQDELNFHTLIQQERSEEISRIHTAVQEVNAIFHQLGSLVREQGEDVDNIDSNIS
                     GLAGNLHRANEQLGKADQSQRKKNRCGIITLVIIVVIVLVVILAALS"
     gene            complement(<754873..>757002)
                     /locus_tag="KLTH0D09108g"
                     /db_xref="GeneID:8295344"
     mRNA            complement(<754873..>757002)
                     /locus_tag="KLTH0D09108g"
                     /product="KLTH0D09108p"
                     /transcript_id="XM_002553061.1"
                     /db_xref="GeneID:8295344"
     CDS             complement(754873..757002)
                     /locus_tag="KLTH0D09108g"
                     /note="some similarities with uniprot|P32389 Saccharomyces
                     cerevisiae YNL103W MET4 Lecine-zipper transcriptional
                     activator responsible for the regulation of the sulfur
                     amino acid pathway requires different combinations of the
                     auxiliary factors Cbf1p Met28p Met31p and Met32p"
                     /codon_start=1
                     /product="KLTH0D09108p"
                     /protein_id="XP_002553107.1"
                     /db_xref="GeneID:8295344"
                     /db_xref="UniProtKB/TrEMBL:C5DGX7"
                     /translation="MQNGRSCGHCHVIQGHVSKCHTTTKIRDHVPTRCITGDGYSVSR
                     DGARARPFLASGPGNCGCAPAPVTCERLTRATSFFFTILISVWGLALQTLQSTSDRLH
                     CSSALCRCSPPTASLLCSRVLPMSFDKNDGLHNLFGEDSDAFKASDGPLNFHSNDANV
                     TPNILLEQLAYVDNFMPDFENDMASFGAPAHGEAHAGGLGLDDRLAAELSAFADETFI
                     FPDEEKPDNPNGSQDSRQGSSADTLAPGLPGSASTAASPSASASATHPVANRSSRFLS
                     QRRNNFLASQHDNSRQRFSSRRAFDIANRSPSDDHGGFTNVDITDGPAQPFAQPGAPY
                     SNSPLSNLVSDSNSQTAELFTNSSATPLLTPQDPLRRQSQAPPFQNSYSEIHMPDYSS
                     IPTRTLLALLPKVKVPSGAWNSLRAVGFDQDQIDAIAAIIAHHQMHKNSNPSISNSAS
                     QVVSQSVPPVTDENAASFLLQFLSHDNQQPQQRQQRQQQQHQPQQQHQTQNHQQPLPR
                     NEGILSSHQAPMRNAEASITPRSIEHEKATESFFNTFFNADSVRPDVQSSASESRPRL
                     SSSASRSDRSVPSDKEASKSDYEKTTSRKPSVDRREMDFASSLHAADEKRPTGSKTQH
                     PKRKMKEQEMEGSIQELSELALGLQHRIHTLEMENRLLKNLVMERGELKGVEQAESVR
                     RELMKKIKDDKKEENKMSDNFVEKSEF"
     gene            <758342..>759427
                     /locus_tag="KLTH0D09130g"
                     /db_xref="GeneID:8295345"
     mRNA            <758342..>759427
                     /locus_tag="KLTH0D09130g"
                     /product="KLTH0D09130p"
                     /transcript_id="XM_002553062.1"
                     /db_xref="GeneID:8295345"
     CDS             758342..759427
                     /locus_tag="KLTH0D09130g"
                     /note="some similarities with uniprot|Q99188 Saccharomyces
                     cerevisiae YOR107W RGS2 Negative regulator of
                     glucose-induced cAMP signaling directly activates the
                     GTPase activity of the heterotrimeric G protein alpha
                     subunit Gpa2p"
                     /codon_start=1
                     /product="KLTH0D09130p"
                     /protein_id="XP_002553108.1"
                     /db_xref="GeneID:8295345"
                     /db_xref="GOA:C5DGX8"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:C5DGX8"
                     /translation="MNTSGAPTLEQALEMARAQPRNASRARSRDSPAQAFSFAAFRDF
                     LRKSHCDENLDFILATDAFVGADAALTEADFPLKPWTDNVYSQFIRRDSPRECNLPQG
                     IRECFDRCHATQSAPDRAYIRSARQHVITLLRDAFTRFLDRQRRCSSSNCSRCGSRTA
                     AVMAASAAASAAASLAASASSSATATAPGTPSVLSPGLAAAKLSRNSYISDYAVDDDD
                     EDEDGTDGADAGQSYNIRDLRDLRDLRDLDTEGSAAATITRTQNSASTAFSAFSAASA
                     ASAASALSATVHPPLGSITTTTGTHLSDRPAYPPSSMPSTPSSSFSTTSSAGFNSLKL
                     KHTGKKLVNKFKFRRSSSGSSGSSFNP"
     gene            <760328..>762154
                     /locus_tag="KLTH0D09152g"
                     /db_xref="GeneID:8295346"
     mRNA            <760328..>762154
                     /locus_tag="KLTH0D09152g"
                     /product="KLTH0D09152p"
                     /transcript_id="XM_002553063.1"
                     /db_xref="GeneID:8295346"
     CDS             760328..762154
                     /locus_tag="KLTH0D09152g"
                     /note="highly similar to uniprot|P06208 Saccharomyces
                     cerevisiae YNL104C LEU4 Alpha-isopropylmalate synthase
                     (2-isopropylmalate synthase) the main isozyme responsible
                     for the first step in the leucine biosynthesis pathway"
                     /codon_start=1
                     /product="KLTH0D09152p"
                     /protein_id="XP_002553109.1"
                     /db_xref="GeneID:8295346"
                     /db_xref="GOA:C5DGX9"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DGX9"
                     /translation="MFRRTAVNLAQSAGKAIPPVKLAYKYMLKDPSKKYKPFKAVTLP
                     NRKWPDNRITKAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVEIGFKEIEVSFPSA
                     SQTDFDFTRYAVENAPEDVSIQCLVQSREHLIKRTVESLSGAKRATVHCYLATSDMFR
                     DIVFNMSQEEAIKKAVEATKLVRKLTKDDPAQQATRWSYQFSPETFSDTPPEFALEIC
                     EAVKAAWEPTEENPIIFNLPATVEVATPNNYADQIEYFSTHISEREKVCISTHAHNDR
                     GCGVAASELGVMAGADRVEGCLFGNGERTGNVDLVTVALNMYTQGVSPELDLSDLNSV
                     VEVVERCNKIPISPRAPYGGDLVVCAFSGSHQDAIKKGFALQEKRRANGDEEWKIPYL
                     PLDPKDIGRDYEAVIRVNSQSGKGGAAWVILRSLGLDLPRNLQIEFSTTVQNRADSLG
                     RELKSQEITELFKEVYNYSGNIGKVTLLEYDVTKIDAERRSLTGQVSINGGVYDIQGS
                     GNGPISSLVDAMSNLFNVKFGVANYTEHSLGSGSSTQAASFIHLVYRRDSDNERTFKW
                     GVGVSEDVGEASTKAILSAINSIVQSGDVSLPDAPSKASASA"
     gene            <762443..>765796
                     /locus_tag="KLTH0D09174g"
                     /db_xref="GeneID:8295347"
     mRNA            <762443..>765796
                     /locus_tag="KLTH0D09174g"
                     /product="KLTH0D09174p"
                     /transcript_id="XM_002553064.1"
                     /db_xref="GeneID:8295347"
     CDS             762443..765796
                     /locus_tag="KLTH0D09174g"
                     /note="similar to uniprot|Q12271 YOR109w Saccharomyces
                     cerevisiae INP53 Phosphatidylinositol 4,5-bisphosphate
                     5-phosphatase"
                     /codon_start=1
                     /product="KLTH0D09174p"
                     /protein_id="XP_002553110.1"
                     /db_xref="GeneID:8295347"
                     /db_xref="GOA:C5DGY0"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DGY0"
                     /translation="MQILVQRGAERKVALVSTAYALVFKAVNDGQNSTKPLCAIELTP
                     KSQIGSSYQKMSSHEVHGFIGLIELEGFIFICTITGKTKVAQPIPGETVNKIYAVDFF
                     CLNDSQWDFVELDSNGYPVTSEDDYRGEQSPSYPGHPCHELRKLLSNGSFYYSSNFDL
                     TSILQKRGMGAHSLSFDNYQEEYMWNSFLMKEVITFRNRLDDLGRQVLDDEGFLTTVI
                     RGFAETFVTYIKQLKVSLTVISKQSWKRAGTRYNARGVDDEGNVANFVETELLMFSKE
                     YCYAFTQIRGSIPIFWEQDTALINPKVQITRSVEATQPVFDDHFTRLIDKYGPVHVVN
                     LLSTKSSEVELSARYKQHVARSKLHTLNKDIFFTDFDFHKETSQEGFAAAARIKPLIT
                     QSLLESGYFSYDVRERKVLSEQHGIFRTNCLDCLDRTNLIQQFISRYAFALFLNDFHL
                     MSTARGTAFTDSDLFIKHNTLWADHGDQISQIYTGTNALKSSFSRKGKMSFAGVLSDA
                     TKSVSRMYINNFMDKNKQANIDTLLGRLSHQQAVSLYDPINEYVTTQLTKSSDQFTSS
                     SSINIFVGTYNVNGLTRRVDISKWLFPIGDKFKPDVVVLGMQEIIELSAGSILNADYS
                     KSPFWQNIVNECLNQYNDKYLLLRAEQMSSLLILFFVKSDKINNVKQVEGSSKKTGLG
                     GMTGNKGAVSIRFDYGSTSFCFVNAHLAAGVSNVDERRHDYESITKGICFTRSRQISH
                     HDAIFWLGDLNYRLSLPNEEVRREISDQKDNFPESLLMHDQLTQEINAGVVFKDFKEP
                     TVKFPPTYKYDHGTNNYDTSEKARTPSWTDRIVYKGNNLRPLAYSDSQLIASDHKPVY
                     AAYRAQVNFVDETVKMDLTKKLYMQYKESHPEEYNNTTVALVDIDYEKKNGHGAKSSS
                     TQLFAESDISLVDLDENRADVGSITRSSSISSSSEMSSLNSGTLNPVRKEAPSRSTTS
                     LGRARVPPPPPPAPRQNSMASQFSSASNLQAKAEPVNAETTSTASVVAPPPPPARKTT
                     FPPGYSSSILTPKNASAAGSKLTSPEPSVSSAPVPDASSTQNSKTDEHAAVSEAPINK
                     PSRIPPPRPAKKPTLDNLNMDSWKPLTPK"
     gene            complement(<765986..>766552)
                     /locus_tag="KLTH0D09196g"
                     /db_xref="GeneID:8295348"
     mRNA            complement(<765986..>766552)
                     /locus_tag="KLTH0D09196g"
                     /product="KLTH0D09196p"
                     /transcript_id="XM_002553065.1"
                     /db_xref="GeneID:8295348"
     CDS             complement(765986..766552)
                     /locus_tag="KLTH0D09196g"
                     /note="similar to uniprot|P53930 YNL107W Saccharomyces
                     cerevisiae YAF9 Subunit of both the NuA4 histone H4
                     acetyltransferase complex and the SWR1 complex may
                     function to antagonize silencing near telomeres interacts
                     directly with Swc4p"
                     /codon_start=1
                     /product="KLTH0D09196p"
                     /protein_id="XP_002553111.1"
                     /db_xref="GeneID:8295348"
                     /db_xref="GOA:C5DGY1"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:C5DGY1"
                     /translation="MGEVKPPNAPVEHSHMWTIFVRGPNGEDLSDIIKSVVFKLHETY
                     PNPTRAVEAPPFELTETGWGEFEINIKIHFIESANEKPISFYHHLRLHEYQNQNSNGV
                     KLENGGNSPEVESVFYDEIVFNEPNEEFFKVLIAKPGYLLPSNKSEKAVFSKQLEQEE
                     IDRISDGAKKVDEEIEKLKEELTQMIQT"
     gene            <766792..>768109
                     /locus_tag="KLTH0D09218g"
                     /db_xref="GeneID:8295349"
     mRNA            join(<766792..766821,766859..>768109)
                     /locus_tag="KLTH0D09218g"
                     /product="KLTH0D09218p"
                     /transcript_id="XM_002553066.1"
                     /db_xref="GeneID:8295349"
     CDS             join(766792..766821,766859..768109)
                     /locus_tag="KLTH0D09218g"
                     /note="similar to uniprot|Q6B220 Saccharomyces cerevisiae
                     YOR110W"
                     /codon_start=1
                     /product="KLTH0D09218p"
                     /protein_id="XP_002553112.1"
                     /db_xref="GeneID:8295349"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DGY2"
                     /translation="MAIKTIYIARELLKLTHYFQHGYRSNWLPKGPYPPPPTGVNSDV
                     PLAEHGVKQAKELAHYIMSIENQPEMIFSSPFYRCLQTSEPIADLLDLPINMERGIGE
                     WYKPDRDVIPEPASFEVLNNFFPGKLNPDWESTVIPSGKGETEQDIFNRCKEFWPKFA
                     AKLEAAFPNVETILLVSHAATKIALGMNLLGFDNCRDPIDSDGAIIRSGSCSLDKFEL
                     VQSELEDLEDVPFPARRWRLTMNGNTEFLSKGEEMHWDFQYGFEAGSDADIKARQALA
                     EKEALQAKASDAGVPLEKDARASNVDTEAFEHVYFSVDVPGDNFKKRGEIEPNATMQY
                     SGLETEAPLVRVGEKLYEGKWKKLVGTELALPDAAVMKTRTSEDGDDAVSESETFDST
                     STDKNQTPEDAGDPNGERIYRITDRLVLENVRPM"
     gene            <768379..>769134
                     /locus_tag="KLTH0D09240g"
                     /db_xref="GeneID:8295350"
     mRNA            <768379..>769134
                     /locus_tag="KLTH0D09240g"
                     /product="KLTH0D09240p"
                     /transcript_id="XM_002553067.1"
                     /db_xref="GeneID:8295350"
     CDS             768379..769134
                     /locus_tag="KLTH0D09240g"
                     /note="similar to uniprot|Q99210 Saccharomyces cerevisiae
                     YOR111W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D09240p"
                     /protein_id="XP_002553113.1"
                     /db_xref="GeneID:8295350"
                     /db_xref="GOA:C5DGY3"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:C5DGY3"
                     /translation="MTLSMTFLSRFRSLRKIPLRCSLHQRCSMMSRVIKEISEKFEIV
                     LASSSPRRYEIVTQVMGFADVKLMKPSFAEDHDKSLYAGNPTGYVHDTSKSKALGIIE
                     DLKHTEETHASKPKLVICADTVVIDSDENIHEKPQRPELQLGNLLRFRESDGPVKVIT
                     SVTLIKWESPQDFTFTQFEEVSEVHFDSDFPLPILYDYVDSGDALDVAGGFKVQSFGG
                     AMIKKINGDFFNVVGLPLNKTFKELYKAAFPLE"
     gene            <769384..>770055
                     /locus_tag="KLTH0D09262g"
                     /db_xref="GeneID:8295351"
     mRNA            <769384..>770055
                     /locus_tag="KLTH0D09262g"
                     /product="KLTH0D09262p"
                     /transcript_id="XM_002553068.1"
                     /db_xref="GeneID:8295351"
     CDS             769384..770055
                     /locus_tag="KLTH0D09262g"
                     /note="similar to uniprot|P53927 Saccharomyces cerevisiae
                     YNL110C NOP15 Constituent of 66S pre-ribosomal particles
                     involved in 60S ribosomal subunit biogenesis localizes to
                     both nucleolus and cytoplasm"
                     /codon_start=1
                     /product="KLTH0D09262p"
                     /protein_id="XP_002553114.1"
                     /db_xref="GeneID:8295351"
                     /db_xref="GOA:C5DGY4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DGY4"
                     /translation="MAKSTTKQATPILEAEPVREEQLELGNSSSNESEIEGLSEDDEA
                     GSGEEQGSSGSRASSGVHTVKKLDAKKRESQQEGGKGSKKGRSKAEELSGIIYVSRLP
                     KGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDALVAQETMHNYLL
                     MNHLLQVVALPKGKKIEKLFHYKKRAFSETSVTKSSEELKQRAIDKHAQRAARLQDKG
                     IEFKW"
     gene            <770560..>770931
                     /locus_tag="KLTH0D09284g"
                     /db_xref="GeneID:8295352"
     mRNA            <770560..>770931
                     /locus_tag="KLTH0D09284g"
                     /product="KLTH0D09284p"
                     /transcript_id="XM_002553069.1"
                     /db_xref="GeneID:8295352"
     CDS             770560..770931
                     /locus_tag="KLTH0D09284g"
                     /note="similar to uniprot|P40312 Saccharomyces cerevisiae
                     YNL111C CYB5 Cytochrome b5 involved in the sterol and
                     lipid biosynthesis pathways required for sterol C5-6 and
                     fatty acid desaturation"
                     /codon_start=1
                     /product="KLTH0D09284p"
                     /protein_id="XP_002553115.1"
                     /db_xref="GeneID:8295352"
                     /db_xref="GOA:C5DGY5"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5DGY5"
                     /translation="MAKLYSYKEIAEHNTENDLWMIIDGKVYDCTKFMDEHPGGEEVL
                     LDLGGQDATGPFADIGHSDDAVKMLEDLYVGDVDKDSEPIAVVKGDPASTTTGGEGNG
                     VMILAIAAVALAVVYFYLNQK"
     gene            <771018..>773357
                     /locus_tag="KLTH0D09306g"
                     /db_xref="GeneID:8295353"
     mRNA            <771018..>773357
                     /locus_tag="KLTH0D09306g"
                     /product="KLTH0D09306p"
                     /transcript_id="XM_002553070.1"
                     /db_xref="GeneID:8295353"
     CDS             771018..773357
                     /locus_tag="KLTH0D09306g"
                     /note="similar to uniprot|Q12453 Saccharomyces cerevisiae
                     YOR112W"
                     /codon_start=1
                     /product="KLTH0D09306p"
                     /protein_id="XP_002553116.1"
                     /db_xref="GeneID:8295353"
                     /db_xref="GOA:C5DGY6"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C5DGY6"
                     /translation="MWKQEWRSEPPSWQVLSISRSGPCVFSQNTRKNTELHHTCKITT
                     SDPRALPMNFLFKSISGFQFPYSLESTPSVTTPIWEATNGHRKSDSLPVTVFSFQKQR
                     NGALDAMIANAVHYAKVLKLPGILRVVDVLDTNQNTAYVVTERAHILDTKGLSQHALS
                     LGTLQVAETLELLHAQAKVVLGTLSRGTVFVNERGEWRLFGLELCSKISDLSHMKQNV
                     SSYLSFVAGSGLEVQISPSSAADAVLLSKFIQSIYSHPPSEWKPLLVGLEQGRLTLSQ
                     FLARSKNTQPFQSPLIAMYQDLREFHIKDPQGKVVAMSDLQRNIMDDPTVLRGSTPGF
                     VEGHLIPEISQCIASILGAQKTQALTATSANVITFVASIMELTCSDDPVTDSASVFAH
                     YVKPLIFESFKSPDRQLRFLLLVYFANYLEKLTNNEVSDRIFPHFVQGLADSDATMRI
                     ETLKKIPDVTPLITERQLNNDLLRHLAKTQVDADVEIRTWTILTISGLSKKLSPSNNR
                     SGILATAFTKSLKDPHVKPKLAALYGLETSLELFDVTTIANKILTVIAPGLLDSNGQV
                     RRKAKNLFRLYLSKLEGETDQIPADDSEEVEVDFDASLRKENGQVIQQFMSNLKLSTP
                     PIMSQPQTHDLAENTGDDEWAQNNDEWAQNNDEWDDDEGWEGDLVDDIDAGLSKPTQE
                     TKGGHQAKVHIGQVKIQKSWNKDIENDDWDSWDQPADLSTKAASKTSKPPTSKVTAKR
                     TIIKASRQKKDQKPNPIAEKAEVFEGFENDGDDGWGDDW"
     gene            complement(<773449..>775823)
                     /locus_tag="KLTH0D09328g"
                     /db_xref="GeneID:8295354"
     mRNA            complement(join(<773449..773837,774557..>775823))
                     /locus_tag="KLTH0D09328g"
                     /product="KLTH0D09328p"
                     /transcript_id="XM_002553071.1"
                     /db_xref="GeneID:8295354"
     CDS             complement(join(773449..773837,774557..775823))
                     /locus_tag="KLTH0D09328g"
                     /note="similar to uniprot|P24783 Saccharomyces cerevisiae
                     YNL112W DBP2 Essential ATP-dependent RNA helicase of the
                     DEAD-box protein family involved in nonsense-mediated mRNA
                     decay and rRNA processing"
                     /codon_start=1
                     /product="KLTH0D09328p"
                     /protein_id="XP_002553117.1"
                     /db_xref="GeneID:8295354"
                     /db_xref="GOA:C5DGY7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DGY7"
                     /translation="MTYGSRDNQFNRDNYGSRGGDFRGGRPSDRNSYGRDSYGGGRGG
                     FSRPPPSQPMELVAPDWDQELPNLPKFEKNFYVEHESVRNRSDAEVEEFRKANEMSIL
                     GKDIPKPITTFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSG
                     KTLSYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCV
                     YGGVPRGHQIRELTRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFE
                     PQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIV
                     EVVSDMEKRDRLLKHLETASEDKDSKILIFASTKRTCDEITRYLRQDGWPALAIHGDK
                     AQNERDWVLQEFRTGNSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIGRTG
                     RAGATGTAISFFTEANKGMGAQLISIMREANQQIPPELMKYDRRQYGGHPRYGRGGYG
                     GGRGGRGGYGRGGRGGGRGYGGGRGGGFQKPRDSGWGNRNINY"
     gene            complement(<776115..>776555)
                     /locus_tag="KLTH0D09350g"
                     /db_xref="GeneID:8295355"
     mRNA            complement(<776115..>776555)
                     /locus_tag="KLTH0D09350g"
                     /product="KLTH0D09350p"
                     /transcript_id="XM_002553072.1"
                     /db_xref="GeneID:8295355"
     CDS             complement(776115..776555)
                     /locus_tag="KLTH0D09350g"
                     /note="some similarities with uniprot|P28000 Saccharomyces
                     cerevisiae YNL113W RPC19 RNA polymerase subunit common to
                     RNA polymerases I and III"
                     /codon_start=1
                     /product="KLTH0D09350p"
                     /protein_id="XP_002553118.1"
                     /db_xref="GeneID:8295355"
                     /db_xref="GOA:C5DGY8"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:C5DGY8"
                     /translation="MANGDVKEPDAQVNTEEIVHAGESVQNGAEDVDMVADEQEEAEE
                     DADKEKIRLLSSATSEDGTCASFQISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSE
                     TLLNLRIQTYGKFTAVEVLQKGLQDLMDLCDAVEDKFTQRIREM"
     gene            complement(<776870..>777832)
                     /locus_tag="KLTH0D09372g"
                     /db_xref="GeneID:8295356"
     mRNA            complement(<776870..>777832)
                     /locus_tag="KLTH0D09372g"
                     /product="KLTH0D09372p"
                     /transcript_id="XM_002553073.1"
                     /db_xref="GeneID:8295356"
     CDS             complement(776870..777832)
                     /locus_tag="KLTH0D09372g"
                     /note="similar to uniprot|P00812 Saccharomyces cerevisiae
                     YPL111W CAR1 Arginase responsible for arginine degradation
                     expression responds to both induction by arginine and
                     nitrogen catabolite repression disruption enhances freeze
                     tolerance"
                     /codon_start=1
                     /product="KLTH0D09372p"
                     /protein_id="XP_002553119.1"
                     /db_xref="GeneID:8295356"
                     /db_xref="GOA:C5DGY9"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:C5DGY9"
                     /translation="MLTEPSFDLYPNKKAGLVLANFSGGQGKSGVEDGPKYMLRQGLR
                     QDLQELGWTTSIEEPLASDDYEKRKETDTSDVWGIVKRPQLVGEATKQIYESAKKVLE
                     RGEMPVTIGGDHSVAIGSIAAVFEKHPDACVLWIDAHADINTPSTTDSGNLHGCPVSF
                     LMGLDSENTPPSLQWVPKCVKPNKIAYIGLRDVDAGEKRILRENHIPAFSMYHVDRFG
                     LNHVIEMALQAINPDGDCPIHLSYDVDAMDPLFVPATGTPVRGGLTLREGLFVAERVA
                     ETGKLVALDVVEVNPTLAVHDMHVLDTVSAGCAVARCALGETLL"
     gene            779021..779092
                     /locus_tag="KLTH0D09394r"
                     /db_xref="GeneID:8295357"
     tRNA            779021..779092
                     /locus_tag="KLTH0D09394r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT) cove score=75.85"
                     /db_xref="GeneID:8295357"
     gene            <779251..>780438
                     /locus_tag="KLTH0D09416g"
                     /db_xref="GeneID:8295358"
     mRNA            <779251..>780438
                     /locus_tag="KLTH0D09416g"
                     /product="KLTH0D09416p"
                     /transcript_id="XM_002553074.1"
                     /db_xref="GeneID:8295358"
     CDS             779251..780438
                     /locus_tag="KLTH0D09416g"
                     /note="similar to uniprot|Q6B2A9 Saccharomyces cerevisiae
                     YPL112C PEX25 Peripheral peroxisomal membrane peroxin
                     required for the regulation of peroxisome size and
                     maintenance recruits GTPase Rho1p to peroxisomes induced
                     by oleate interacts with homologous protein Pex27p"
                     /codon_start=1
                     /product="KLTH0D09416p"
                     /protein_id="XP_002553120.1"
                     /db_xref="GeneID:8295358"
                     /db_xref="GOA:C5DGZ0"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:C5DGZ0"
                     /translation="MESQLYEGFHSSQRLVDEFNMLQDNQPISFTEKDSSDEESTAEE
                     SQELQEVKHSHAVHHSAVVVRNIDVLNHIFGTLGGKDRLAKILKYVLDLVKLFVSRSR
                     IGITRWDPQVLEHYSKVLAQLNLRLLLRHPATIAKIMVVAGLRNFEAKASLVSSNLSL
                     FRQILRFGGTPFRVAALWSKINLTTHQIAAARAKPASAADSHTLAVINKLWLNEASLG
                     DFIDLYYGVMDELMLLHKFKVWHHPGLYTWVAKHESLSWYYDIMLGLKKNWCSLQQLN
                     RAQLELSIQEQVKKRALELSSRLQGKTASPIKQQLLQDLQTGQEHNDQFSKRIRDIER
                     QRRVVILDLVRLSFDFLADTTDVFNLKTPPGTYAVLSLASGLTGLVKLWGNAKRELSE
                     SVV"
     gene            <780671..>781825
                     /locus_tag="KLTH0D09438g"
                     /db_xref="GeneID:8295359"
     mRNA            <780671..>781825
                     /locus_tag="KLTH0D09438g"
                     /product="KLTH0D09438p"
                     /transcript_id="XM_002553075.1"
                     /db_xref="GeneID:8295359"
     CDS             780671..781825
                     /locus_tag="KLTH0D09438g"
                     /note="similar to uniprot|Q02961 Saccharomyces cerevisiae
                     YPL113C Putative dehydrogenase"
                     /codon_start=1
                     /product="KLTH0D09438p"
                     /protein_id="XP_002553121.1"
                     /db_xref="GeneID:8295359"
                     /db_xref="GOA:C5DGZ1"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DGZ1"
                     /translation="MAKKPGVLIPFKNRVEVDDSLPEWKRLEEHVDFIKYKITTKEDF
                     KVALARSNVECLWITEDLFTYLGSPAEFYDDYSSSLKLIAVPWVGTDFLDGPKLKREK
                     GIVVCNIGPSAASNVGELALFLALSCFRMTSFFEHCFRFVHRGQPGQCAEYVGGKKHA
                     LTASSATGGEHHYPFPEKFTREQAQVVDLSKNYTIAGKTIASPNGKTALILGFGYIGQ
                     SIGKKLCYGLDMKIQYFKRSGPVSKDILGYPAKYCSTLEDPETWVSADLIVLALPGHS
                     STQNVINAKTLSMCKDQVRIVNVGRGSCIDEDALFQALESGKVASAGLDVFKNESTKV
                     DERFFDRWDVTLLPHIGSTVSDMVGRQTLVTLQNVEDVLVKNGRGLYPCN"
     gene            complement(<781892..>782566)
                     /locus_tag="KLTH0D09482g"
                     /db_xref="GeneID:8295360"
     mRNA            complement(<781892..>782566)
                     /locus_tag="KLTH0D09482g"
                     /product="KLTH0D09482p"
                     /transcript_id="XM_002553076.1"
                     /db_xref="GeneID:8295360"
     CDS             complement(781892..782566)
                     /locus_tag="KLTH0D09482g"
                     /note="weakly similar to uniprot|P32773 Saccharomyces
                     cerevisiae YOR194C TOA1 Transcription factor IIA large
                     chain"
                     /codon_start=1
                     /product="KLTH0D09482p"
                     /protein_id="XP_002553122.1"
                     /db_xref="GeneID:8295360"
                     /db_xref="GOA:C5DGZ2"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:C5DGZ2"
                     /translation="MSNQEGARAYETIVENVVNEVREDFESAGIDEQTLQDLKLVWQT
                     KLSESRVAKFMWDPEDEGALGTSLNNSNIAPSLLDSQGLAIPALSSGEDKAQQSQSQQ
                     QQAQQQPLMTQSKHEEQPKQEIELSMEDPDGEIAEQLKLQAKQAKKSALLDTDEINSD
                     LDDSEDDYLNSSGEDEGQDENIVLCLYEKVLRVKNKWKCNLKDGLATINHKDYAFQRA
                     QGETEW"
     gene            <783223..>785379
                     /locus_tag="KLTH0D09504g"
                     /db_xref="GeneID:8295361"
     mRNA            <783223..>785379
                     /locus_tag="KLTH0D09504g"
                     /product="KLTH0D09504p"
                     /transcript_id="XM_002553077.1"
                     /db_xref="GeneID:8295361"
     CDS             783223..785379
                     /locus_tag="KLTH0D09504g"
                     /note="weakly similar to uniprot|Q08581 Saccharomyces
                     cerevisiae YOR195W SLK19 Kinetochore-associated protein
                     required for normal segregation of chromosomes in meiosis
                     and mitosis component of the FEAR regulatory network which
                     promotes Cdc14p release from the nucleolus during anaphase
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0D09504p"
                     /protein_id="XP_002553123.1"
                     /db_xref="GeneID:8295361"
                     /db_xref="InterPro:IPR012347"
                     /db_xref="InterPro:IPR024312"
                     /db_xref="UniProtKB/TrEMBL:C5DGZ3"
                     /translation="MGDSNIGSFSTPLKNGISRSVELRVPNSERPYPKGVDSPGKPAN
                     DDRALRIQKNNENASQLRSSPWKRAKLDKFSSRSHPVSSPAVIEMLDRNVSGPHGSLR
                     DSQALEIQDEISEAISSAVREVSGSDSSNHDNQHRTSLINDLLSPRRDGTPDHIPDAD
                     LANLGKLTPPKNYMHNTESSIIQNLQSCFRDELGKFEQYLKAKNEQADEYRRRTVDCF
                     EKIKQLEEALDEQKLTYSSLLGEYEMLRASQSVRDDQWQTQNREIEKLSTEKTSLEER
                     VSRLKLRLSEARNEMKMINQNSQILQEKFQTQIQQNERLQNQVSELEDSENQLRVHIE
                     NTTNSKKRVEEEIERTRAELALLTEGKFKTQSENEDLKLSVSKAQTLLAEKTKFIEEL
                     QANLRASHDTKQKSTIELEQRINDLTLEKNELVRELEDMSTLRSKIEESENEIQSVKT
                     ELDRTQVALQHLKEEHSELREHCRSLEAELKTSHQKLETANDQLAIKSAEVVELGHDV
                     KELRQGKSHLEDSLKLRDASISEWNSKYEEKCAENNKLSIEIESFQFKNGNLETEHLV
                     ELEQLHQQMTSLQETLKSNSERIKELTEENSSLKDQLEVRELPQPQQGPLVDPEQVEE
                     LHAKIQSLEQQLREKEAEAGKRLQLLAEDLYIQYSSKHEQKVKMLKKGYESKYQDKLE
                     RLGLENSGLKDELMQLNDTLKAEREEKHNLVKLLNK"
     gene            <785720..>788815
                     /locus_tag="KLTH0D09526g"
                     /db_xref="GeneID:8295362"
     mRNA            <785720..>788815
                     /locus_tag="KLTH0D09526g"
                     /product="KLTH0D09526p"
                     /transcript_id="XM_002553078.1"
                     /db_xref="GeneID:8295362"
     CDS             785720..788815
                     /locus_tag="KLTH0D09526g"
                     /note="similar to uniprot|P32873 Saccharomyces cerevisiae
                     YPL115C BEM3 Rho GTPase activating protein (RhoGAP)
                     involved in control of the cytoskeleton organization
                     targets the essential Rho-GTPase Cdc42p which controls
                     establishment and maintenance of cell polarity including
                     bud-site assembly"
                     /codon_start=1
                     /product="KLTH0D09526p"
                     /protein_id="XP_002553124.1"
                     /db_xref="GeneID:8295362"
                     /db_xref="GOA:C5DGZ4"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DGZ4"
                     /translation="MGSDDDSAGSITLQLLSKYNYHTSERDRSLENKEKNNEPSRKPS
                     YDALYKENTTLKLQLEEYESEIASLKRFIDVLKNNRNTFKESHQQLEVEDKLKEPILP
                     PRSAERRRNAKNLSLPVTKEAKSQAEKSPGLLSPAGIITSRSFNGTPTLTDNTLNHDR
                     DQSFSLNELDKIRRSSSSYSNVIAASPATSVAYTTSRISPSRSNKHSLKDEDSASSVP
                     ERSASLLNSSKAVISVSDHYHSPLRIGSGGNQEDNQESSSKKSYPKSPIPNLLASHEG
                     KADISPASKKSLNNFAEMLDSSFGEDEEQTPHENPQEIEVASANQERESISRLLGSPV
                     ALKKPHQSHENSPVLHSFEVVSSSAPEEKPSSSTIGSSASTQIVSAYDPQSPRSINAK
                     SIPHLGKSNSQPIVQSPRKKTTPTVTDSHSIISDIPLFVQPGELGTIRIDVVSTLHRD
                     NEMFAGDHHILFSVIDRTSGKEIFKFAKTIDRVYELDVYLKCHMDTIMLPPLPEKAMF
                     ETTTPLRVDYRREKLNDYFSCLFAQQNLLPDIALKLAKFISTDTVMNPIIGDYIKEGI
                     LMMRKSKAIGSTNSWRLRYAVVDGVNLSLLDRGQVSEIIKLSQAAIELQANLPDDRYG
                     TKNGFILNVHKKGGLSSGTRYFFCCESPRERESWVSSLAEFVESSVVFSGSINSKSES
                     SSMIDHSSTGNEASSDAPVSYIGPIANLQSPVSHSPTQAPDTTAQEDERESKRIRMRS
                     FFPFKRATAAQTSSEPELPLNGDSSQLPLLQPNETSISRSLQAMDLGPEIVSNTVFGS
                     ELRSCVSISSQLYQGKYVIPSVVYRCLEYLYRNHGVEEEGIFRISGSSLLIKSLQEQF
                     DKDRDIDLCNYNKSVTSDDPNKSNFGTGLVDVNTVTGLLKLFLRKMPHVIFGDSMLPV
                     FKSALDAKWGSGYQVALEYRRLVNSDKISKESYSLMFVLFELLVKINQKNQINKMNLR
                     NLCIVFSPTLNIPVSVLQPFIVDFDCIFKNEEPINDSQREQVDIDAPSAVLKEINSYF
                     A"
     gene            complement(<788915..>790030)
                     /locus_tag="KLTH0D09548g"
                     /db_xref="GeneID:8295363"
     mRNA            complement(<788915..>790030)
                     /locus_tag="KLTH0D09548g"
                     /product="KLTH0D09548p"
                     /transcript_id="XM_002553079.1"
                     /db_xref="GeneID:8295363"
     CDS             complement(788915..790030)
                     /locus_tag="KLTH0D09548g"
                     /note="highly similar to uniprot|P32875 Saccharomyces
                     cerevisiae YOR196C"
                     /codon_start=1
                     /product="KLTH0D09548p"
                     /protein_id="XP_002553125.1"
                     /db_xref="GeneID:8295363"
                     /db_xref="GOA:C5DGZ5"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /translation="MLSRFKCSRLQLQKRAISVTKATTTTASQPKRRRTTTFSDALNK
                     GPSFEDFVSGKAAKFTLDPLQQARSNIEEAKRLPRWLKVPIPKGTNYHKLKKDVRELK
                     LSTVCEEAKCPNISECWGGGDSSKATATIMLLGDTCTRGCRFCSVKTNRAPSKPDPAE
                     PENTAEAISRWGLGYVVLTTVDRDDLADGGAHHLAETVCRIKQKAPKTLVETLSGDFR
                     GDLEMVKVMAQSGLDVYAHNLETVKDLTPHVRDRRATYEQSLSVLNQAKKTVPTLITK
                     TSLMLGLGETDEQVLQTLQDLRAIGCDVVTFGQYMRPTKRHMKVVEYVKPEKFDYWRD
                     KALELGFLYCASGPLVRSSYKAGEAFIENVLRKRANN"
     gene            complement(<790606..>790833)
                     /locus_tag="KLTH0D09570g"
                     /db_xref="GeneID:8295364"
     mRNA            complement(<790606..>790833)
                     /locus_tag="KLTH0D09570g"
                     /product="KLTH0D09570p"
                     /transcript_id="XM_002553080.1"
                     /db_xref="GeneID:8295364"
     CDS             complement(790606..790833)
                     /locus_tag="KLTH0D09570g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D09570p"
                     /protein_id="XP_002553126.1"
                     /db_xref="GeneID:8295364"
                     /db_xref="UniProtKB/TrEMBL:C5DGZ6"
                     /translation="MGKAASNTSHAIQAGNKAVIISPWQHKVIEILPLNKFGGQCSFN
                     GVMNGEVSLNDRYLHQVAVVENGEFVCLRDE"
     gene            complement(<792708..>794825)
                     /locus_tag="KLTH0D09592g"
                     /db_xref="GeneID:8295365"
     mRNA            complement(<792708..>794825)
                     /locus_tag="KLTH0D09592g"
                     /product="KLTH0D09592p"
                     /transcript_id="XM_002553081.1"
                     /db_xref="GeneID:8295365"
     CDS             complement(792708..794825)
                     /locus_tag="KLTH0D09592g"
                     /note="similar to uniprot|Q02959 Saccharomyces cerevisiae
                     YPL116W HOS3 Trichostatin A-insensitive homodimeric
                     histone deacetylase (HDAC)"
                     /codon_start=1
                     /product="KLTH0D09592p"
                     /protein_id="XP_002553127.1"
                     /db_xref="GeneID:8295365"
                     /db_xref="GOA:C5DET4"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:C5DET4"
                     /translation="MSKEVDPLLKFEHQFQSFVRNNPNVASAAHSASQIPESAKAVVV
                     LSPLSLQHQFPRYWVSKSYKKTIVERPERLLACSMGIGAAITMYPALFTLKSSHKRKT
                     SLLSDHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGDIYLSRQTISALEG
                     SIGALETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAA
                     DTYGVTHAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGY
                     FSLHDINSFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKY
                     RTLFAKADEYFRTAKQNMRALGKPFKGLVVISAGFDASEYEQPSMQRHAVNVPTFFYN
                     LFTKDALKLAQMHSHGKLLSVLEGGYSDGAISSGVFAHLIGLQNQNWINEWGSAQVVK
                     EIVRGCKPQWKPYKTKRARDVIRIWAEEVIKLGRAMIPEFEQVLFEPELVEPKAETSK
                     RITRSRRAPAAASIAVVKTPPTLPRSETPTPNDKRYIQKLETADVETVPFVEQDLPSD
                     NEDEDDEDYVYDEELNKTFNRTVEDITIDDISRHLETLEIEPEALDDAPPRTASSSGT
                     RASSRNADSEAAAAAAAGAPQERRPLSSSSGGYKIPSGSTTRHLRNTRASRLMNFDDS
                     DISMISHVSPTKGRSTRSGQTKW"
     gene            <795668..>796975
                     /locus_tag="KLTH0D09614g"
                     /db_xref="GeneID:8295366"
     mRNA            <795668..>796975
                     /locus_tag="KLTH0D09614g"
                     /product="KLTH0D09614p"
                     /transcript_id="XM_002553082.1"
                     /db_xref="GeneID:8295366"
     CDS             795668..796975
                     /locus_tag="KLTH0D09614g"
                     /note="highly similar to uniprot|Q08601 Saccharomyces
                     cerevisiae YOR197W MCA1 Putative cysteine protease similar
                     to mammalian caspases"
                     /codon_start=1
                     /product="KLTH0D09614p"
                     /protein_id="XP_002553128.1"
                     /db_xref="GeneID:8295366"
                     /db_xref="GOA:C5DET5"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /db_xref="UniProtKB/TrEMBL:C5DET5"
                     /translation="MFPGAGRQSYANQQQQNMQQGVYSRPQGPPPGQGQQFHPPPQQY
                     SRPGAPPPSFQGQQGYQDQQGHQGSQGFQRPPQPPPQGQYRNDIQANHAQPGFVNGPD
                     MYQQPQNLHAPPQQAQVAGSGSNNEFSYQYSQCTGKRKALLIGINYFGTQSELRGCIN
                     DVRNIHDFLTTRYGYKSEDIVVLTDDQTQMAGVPLRQNILRAMQWLVSNAQPNDSLFF
                     HYSGHGGQTKDLDGDEEDGMDDVIYPVDHETQGHIIDDEIHDIMVKPLQPGVRLTALF
                     DSCHSGTVLDLPYTYSTKGVIKEPNLWKDVGQDGLQAAMAYATGNTSRMLTSLNSMFK
                     SATRKATGSSASQQIKQTKFSPADIIMLSGSKDNQTSADAVENGQASGAMSHAFVKVM
                     TTQPQQTYLSLLQNMRAELSGKYSQKPQLSSSHPINVNLQFLL"
     gene            complement(<797064..>798479)
                     /locus_tag="KLTH0D09636g"
                     /db_xref="GeneID:8295367"
     mRNA            complement(<797064..>798479)
                     /locus_tag="KLTH0D09636g"
                     /product="KLTH0D09636p"
                     /transcript_id="XM_002553083.1"
                     /db_xref="GeneID:8295367"
     CDS             complement(797064..798479)
                     /locus_tag="KLTH0D09636g"
                     /note="similar to uniprot|P38934 Saccharomyces cerevisiae
                     YOR198C BFR1 Component of mRNP complexes associated with
                     polyribosomes implicated in secretion and nuclear
                     segregation multicopy suppressor of BFA (Brefeldin A)
                     sensitivity"
                     /codon_start=1
                     /product="KLTH0D09636p"
                     /protein_id="XP_002553129.1"
                     /db_xref="GeneID:8295367"
                     /db_xref="UniProtKB/TrEMBL:C5DET6"
                     /translation="MSSTTTVKKQGFVKRPDVGARDKKLDVLKSQLKKIDTEIASLRK
                     QIDQQQVASGAQDQRSQLQNELRGIIKTQSDLKSRRQAIHDQVKALDAELKRKKTQIG
                     AKVGGKSQYQSVDDIEARKRAIDADISSGELSLVEEKLLVKELQSLNKLARDLQAIEP
                     IRKSMEDDKSRIAALKQELNELNPKEVSGKFETTQKKLNDLQSKNQTLYDKRQTLFNK
                     RSALYKKRDEVYAQISQIRSDFDNEFKAFKHKLEKERLKREEEQKLSKLLEEKDAVVG
                     KLQEKLTHARQPAFTYEIGAIENVLCVLDPSYVKPAKHTLEVPADSNVAKAPVRKVEA
                     DDLVPIVKEKEEFFAMGTKSKKNKKKQGSSSQSPASSGKFSLEPTMIATLAELDVTVP
                     LNKEEVPKTIEQLRAKHEDFTARQDEQTEKNIAEAEAKLKELDLEYAKKEENVRKELE
                     EKRAKEQEQEQEQGQTEQEEK"
     gene            <799938..>800768
                     /locus_tag="KLTH0D09658g"
                     /db_xref="GeneID:8295368"
     mRNA            <799938..>800768
                     /locus_tag="KLTH0D09658g"
                     /product="KLTH0D09658p"
                     /transcript_id="XM_002553084.1"
                     /db_xref="GeneID:8295368"
     CDS             799938..800768
                     /locus_tag="KLTH0D09658g"
                     /note="similar to uniprot|P15496 Saccharomyces cerevisiae
                     YPL117C IDI1 Isopentenyl diphosphate:dimethylallyl
                     diphosphate isomerase (IPP isomerase) catalyzes an
                     essential activation step in the isoprenoid biosynthetic
                     pathway required for viability"
                     /codon_start=1
                     /product="KLTH0D09658p"
                     /protein_id="XP_002553130.1"
                     /db_xref="GeneID:8295368"
                     /db_xref="GOA:C5DET7"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:C5DET7"
                     /translation="MSSYSELVKGLDASHILSQFQDVIPLQKRPNTHSSSSSAEDNGD
                     VVFEGHDEEQIRLMCENCIVVDWSDRAVGAGTKKLCHLMTNIELGLLHRAFSVFLFNE
                     QGQLLLQQRATEKITFPDLWTNTCCSHPLCVDDELGLTGTLDDKVAGAQTAAVRKLEQ
                     ELGIPMTETVAKTDFHFLNRIHYKAPSNGPWGEHEIDYIFFCQLRAGQSLTVEPNPNE
                     VRDYKWVTAEQLKSMFQDPQFKFTPWFKLICESYLFQWWDQLSDLSQVENDSQIHRML
                     "
     gene            complement(<800841..>802022)
                     /locus_tag="KLTH0D09680g"
                     /db_xref="GeneID:8295369"
     mRNA            complement(<800841..>802022)
                     /locus_tag="KLTH0D09680g"
                     /product="KLTH0D09680p"
                     /transcript_id="XM_002553085.1"
                     /db_xref="GeneID:8295369"
     CDS             complement(800841..802022)
                     /locus_tag="KLTH0D09680g"
                     /note="similar to uniprot|P25270 Saccharomyces cerevisiae
                     YOR201C MRM1 Ribose methyltransferase that modifies a
                     functionally critical conserved nucleotide in
                     mitochondrial 21S rRNA"
                     /codon_start=1
                     /product="KLTH0D09680p"
                     /protein_id="XP_002553131.1"
                     /db_xref="GeneID:8295369"
                     /db_xref="GOA:C5DET8"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5DET8"
                     /translation="MFKPRPNTILRRSLAQAIRPAVKVPNASHQGSGPSNIDKNLPHE
                     RRTKAWEKAGEDKDSWFRRKYAHVHAKAGNPNRQKGRAKQNVEEASVQHDQHKSKFRN
                     RSVTGSLRPNPLMEYVHGTNSVISVLQADKRDYYSRILYHASVTDEIRSLAKKRGAQL
                     EMTDKHRLNILTNYAVHNNVVLETKPLQLPEISQVGSCDPEGSTFAYDELFFDEASER
                     RTSFIQKENKKFPLGLYLDEVSDPHNMGAIIRSAYFLGVDFMIMSRRNCAPLSPTVSK
                     TSSGATELLPIFTVDKPLDFFSKSQKEGWTFVSAGVSKQNKFAKNKKIEAQDLHGMLK
                     ELPVILVVGNEGEGVRTNLQMRSDFLVEIPQGRGAAGTRSVDSLNVSVATAILLNSIL
                     N"
     gene            <802180..>802863
                     /locus_tag="KLTH0D09702g"
                     /db_xref="GeneID:8295370"
     mRNA            <802180..>802863
                     /locus_tag="KLTH0D09702g"
                     /product="KLTH0D09702p"
                     /transcript_id="XM_002553086.1"
                     /db_xref="GeneID:8295370"
     CDS             802180..802863
                     /locus_tag="KLTH0D09702g"
                     /note="highly similar to uniprot|P06633 Saccharomyces
                     cerevisiae YOR202W HIS3 Imidazoleglycerol-phosphate
                     dehydratase catalyzes the sixth step in histidine
                     biosynthesis mutations cause histidine auxotrophy and
                     sensitivity to Cu Co and Ni salts transcription is
                     regulated by general amino acid control via Gcn4p"
                     /codon_start=1
                     /product="KLTH0D09702p"
                     /protein_id="XP_002553132.1"
                     /db_xref="GeneID:8295370"
                     /db_xref="GOA:C5DET9"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DET9"
                     /translation="MNGTSNQGKTERRSFVSRNTNETKIQIALSINGGHVEIKDSILP
                     KKAADIASQATSSQIIDIHTGVGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTED
                     CGIALGEAFKEAVGAVRGVKRFGHGYAPLDEALSRAVVDLSNRPYAVVDLGLKREKIG
                     DLSTEMIPHFLESFAEAARITLHVDCIRGFNDHHRSESAFKALAIALRESLSSNGTND
                     VPSTKGVLM"
     gene            complement(<802972..>804027)
                     /locus_tag="KLTH0D09724g"
                     /db_xref="GeneID:8295371"
     mRNA            complement(<802972..>804027)
                     /locus_tag="KLTH0D09724g"
                     /product="KLTH0D09724p"
                     /transcript_id="XM_002553087.1"
                     /db_xref="GeneID:8295371"
     CDS             complement(802972..804027)
                     /locus_tag="KLTH0D09724g"
                     /note="similar to uniprot|Q02950 Saccharomyces cerevisiae
                     YPL118W MRP51 Mitochondrial ribosomal protein of the large
                     subunit MRP51"
                     /codon_start=1
                     /product="KLTH0D09724p"
                     /protein_id="XP_002553133.1"
                     /db_xref="GeneID:8295371"
                     /db_xref="InterPro:IPR016712"
                     /db_xref="UniProtKB/TrEMBL:C5DEU0"
                     /translation="MSSNLSHLLRNSRIAQVPKSKKPLTSAAPKYAPTHQIIETRPST
                     LHRQEWGLKAAVPSKIKTKYIVFNDLDTLERLTTFEPNGGSQWNRIRFQELGVAPKYN
                     PGKANPLFEANASSKTQLVPLSALLNVNTSTPKPEVRRRLAEIKDLRSTFKKWLLEHD
                     PEALLNKSFSAKDMTDSAVEFLAEKTDLNVNLASASLRKVVGTGGLTYNLHGRLRNSP
                     NGVVSRTVVPGRFLNVEGNDRLAAIGGFVANAGSSSVTTSQMDYRMGDFVRQLQFPFA
                     VNHATVQDNGKVVLRANVISGMSSKARIQMNSRYYQQRPPRKVMRTASAEESTKHAEE
                     LLNILTNFDSGKSKKLR"
     gene            <805863..>807728
                     /locus_tag="KLTH0D09746g"
                     /db_xref="GeneID:8295372"
     mRNA            <805863..>807728
                     /locus_tag="KLTH0D09746g"
                     /product="KLTH0D09746p"
                     /transcript_id="XM_002553088.1"
                     /db_xref="GeneID:8295372"
     CDS             805863..807728
                     /locus_tag="KLTH0D09746g"
                     /note="similar to uniprot|P06634 Saccharomyces cerevisiae
                     YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA
                     helicase required for translation initiation of all yeast
                     mRNAs mutations in human DEAD-box DBY are a frequent cause
                     of male infertility"
                     /codon_start=1
                     /product="KLTH0D09746p"
                     /protein_id="XP_002553134.1"
                     /db_xref="GeneID:8295372"
                     /db_xref="GOA:C5DEU1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEU1"
                     /translation="MSDLANKMENMNLGEDSKGASSYVPPHMRGKRGGNRAPSSFQSG
                     GDGDGASYFGGRGGSRDNRGSSFFSGGGRGGSRGFGGRSEGRGSIRGVGRWVNGKHVP
                     SDKDEQLELQLFGTPEDPGFQSSGINFDHYDDIPVEASGNDVPEPITEFTSPPLDQLL
                     LDNIIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSESFANGPAP
                     VPEQASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGADIGSQI
                     KELNRGCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHIVEGC
                     DMPSVDERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVEDMD
                     KKSALLDLLAASDDGLTLIFVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALA
                     AFRSGKASLLVATAVAARGLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVATA
                     FLNRGNKNVVKEMVDLLTEAKQEVPEFLKQLARESSGSRGGARGGGFSSRGNSTRDYR
                     RVGGGAPSYGGSSRGGSSMGGGRGGSSWGSSWGNSGSSWGNTGSTGNSSASNSWW"
     gene            808766..808837
                     /locus_tag="KLTH0D09768r"
                     /db_xref="GeneID:8295373"
     tRNA            808766..808837
                     /locus_tag="KLTH0D09768r"
                     /product="tRNA-Cys"
                     /note="tRNA-Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:8295373"
     gene            complement(<808930..>810450)
                     /locus_tag="KLTH0D09790g"
                     /db_xref="GeneID:8295374"
     mRNA            complement(<808930..>810450)
                     /locus_tag="KLTH0D09790g"
                     /product="KLTH0D09790p"
                     /transcript_id="XM_002553089.1"
                     /db_xref="GeneID:8295374"
     CDS             complement(808930..810450)
                     /locus_tag="KLTH0D09790g"
                     /note="similar to uniprot|P87331 Saccharomyces cerevisiae
                     YPL122C"
                     /codon_start=1
                     /product="KLTH0D09790p"
                     /protein_id="XP_002553135.1"
                     /db_xref="GeneID:8295374"
                     /db_xref="GOA:C5DEU2"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="UniProtKB/TrEMBL:C5DEU2"
                     /translation="MSSTLFKATVTEYLQELPAQVHSRLYSSPATCLAIYRLLPKLAK
                     FFIMSLVFNETDASLRDLDRWVKSGGKYQFNEAIKSMKSLHLLIEGNSGQPFMINLNP
                     IFRSSFRNALTGGEVNNSFGNVVEDENETVHTSILDQYAANKWETILHFMVGTPLTQT
                     PSRNVLSLLQHSKLMEESSSGELQITNEGFQFLLQDANAQIWALLLQYLRLAETLQMD
                     PVDVLNFIFMLGALELGKAYSDTNLSDTQKIMLQDMRDYGLVFQKASNTHKFYPTRLT
                     AMLTSDTSSIRSASGAMNSVLSQGTSSSKEEAAAVAETDEETAQVGGTTQNIPDGAVI
                     LETNFKLYSYSNSPLQIAVLSLFVHLKSRFSNMVTGQITRESIRRALHNGITADQIIA
                     YMETHAHPQMRRLAEQTLDKKMELDPNCNEGLQILPPTVVDQIKLWQLELDRIISYDG
                     YLFTDFENFQEYNMLSSYAKDIGVLLWSDDKKKRFFVSQEGNSQVIDYAKRKLKKK"
     gene            <810820..>814254
                     /locus_tag="KLTH0D09812g"
                     /db_xref="GeneID:8295375"
     mRNA            <810820..>814254
                     /locus_tag="KLTH0D09812g"
                     /product="KLTH0D09812p"
                     /transcript_id="XM_002553090.1"
                     /db_xref="GeneID:8295375"
     CDS             810820..814254
                     /locus_tag="KLTH0D09812g"
                     /note="highly similar to uniprot|P22276 Saccharomyces
                     cerevisiae YOR207C RET1 Second-largest subunit of RNA
                     polymerase III which is responsible for the transcription
                     of tRNA and 5S RNA genes and other low molecular weight
                     RNAs"
                     /codon_start=1
                     /product="KLTH0D09812p"
                     /protein_id="XP_002553136.1"
                     /db_xref="GeneID:8295375"
                     /db_xref="GOA:C5DEU3"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:C5DEU3"
                     /translation="MSTAAVATPHDHFEKDSAFEQLLKPVYKGKKLTDEINTAEDKWN
                     LLPAFLKVKGLVKQHLDSFNYFVDVDLKKIIKANQLILSDVDPEFYLKYVDIRVGHRS
                     TSSSKDYIVPPHECRLRDMTYSAPVYVDIEYTRGRNIIMHRDVEIGRMPIMLRSNKCI
                     LNGASEKDMAKINECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASV
                     TSSTHERKSKTYVITKNDKIYLKHNSIAEEVPIVLVLKACGIVSDLEIMQLVCGNDSS
                     YQDIFAVNFEEVAKMKIYTQQQALEYIGSKVKTVRRQKLSTLQEGIEAIATTVIAHLT
                     VEALDFREKALYIAVMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKK
                     FNNDFKANIDKVLKKPNRAMEYDALLSINVHSNNISSGLNRAISTGNWSLKRFKMERA
                     GVTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPEGEACGL
                     VKNLALMTHITTDDEEEPIKKLCFLLGVECINVVDSDSLHLNYCVYLNGTIVGVIRFP
                     TKFVSHFRNLRRSGKVSEFISIYTNSHQKAVHIATDGGRICRPLIIVNEGKSLVTAQH
                     LRQLLDGHLQFDDFLKLGLVEYLDVNEENDSFIALYERDLEPRITHLEIEPFTVLGAV
                     AGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIE
                     LIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKLTTVLKRYPN
                     HTQDMVGGMRVDESGEPIWQHKPLGPDGLGEVGMKVESGQIYVNKSVPTNASDSVLTQ
                     SQAQYRETPVVYRAPEPSHIDQVMMSVSENDQALIKVLLRQNRRPELGDKFSSRHGQK
                     GVCGIIVNHEDLPFNDQGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGT
                     CFGGSKLENMSQILVNHGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKM
                     HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVD
                     VCNKCGLMGYSGWCTSCKGAENVIKMTIPYAAKLLFQELLSMNIAPRLKLEDVFEQ"
     gene            complement(<814355..>815002)
                     /locus_tag="KLTH0D09834g"
                     /db_xref="GeneID:8295376"
     mRNA            complement(<814355..>815002)
                     /locus_tag="KLTH0D09834g"
                     /product="KLTH0D09834p"
                     /transcript_id="XM_002553091.1"
                     /db_xref="GeneID:8295376"
     CDS             complement(814355..815002)
                     /locus_tag="KLTH0D09834g"
                     /note="similar to uniprot|P32489 Saccharomyces cerevisiae
                     YPL121C MEI5 Meiosis specific protein involved in
                     DMC1-dependent meiotic recombination forms heterodimer
                     with Sae3p proposed to be an assembly factor for Dmc1p"
                     /codon_start=1
                     /product="KLTH0D09834p"
                     /protein_id="XP_002553137.1"
                     /db_xref="GeneID:8295376"
                     /db_xref="InterPro:IPR018468"
                     /db_xref="UniProtKB/TrEMBL:C5DEU4"
                     /translation="MAITNASLTIHRKPFKTPFVSSVKRGGSLGSKTLPSKEIIHPNR
                     QASKEERIVNEQLNKVRRENTTLQNSLKILRKYERELEVLELIDKWRSICQAGMAFLL
                     NSTLLKVNKMGGYEELIRKEVEAEKRKLEYQFAGRLQDEVDEVLESEEFKALPELEQQ
                     WLRRDLQQKVDSNEQLQQEEIKKLDLKLTESSNKQMTMRELANRLKVDYALVFEE"
     gene            complement(<815253..>817409)
                     /locus_tag="KLTH0D09856g"
                     /db_xref="GeneID:8295377"
     mRNA            complement(<815253..>817409)
                     /locus_tag="KLTH0D09856g"
                     /product="KLTH0D09856p"
                     /transcript_id="XM_002553092.1"
                     /db_xref="GeneID:8295377"
     CDS             complement(815253..817409)
                     /locus_tag="KLTH0D09856g"
                     /note="similar to uniprot|P39744 Saccharomyces cerevisiae
                     YOR206W NOC2 Protein that forms a nucleolar complex with
                     Mak21p that binds to 90S and 66S pre- ribosomes as well as
                     a nuclear complex with Noc3p that binds to 66S
                     pre-ribosomes both complexes mediate intranuclear
                     transport of ribosomal precursors"
                     /codon_start=1
                     /product="KLTH0D09856p"
                     /protein_id="XP_002553138.1"
                     /db_xref="GeneID:8295377"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="UniProtKB/TrEMBL:C5DEU5"
                     /translation="MGKVSKSTKKFQTKHLKHTLDHRRKQKHHNKKIQGRRGNKSEEE
                     KRNAALTKEEQKLRDSSKEEVFKDMSVEDFFAGGFDVPKNKGPKAVKAKAPKAENDSE
                     DSSSEDEDGMSENMANLADKDPEFYKYLQENDKDLLDFKPSNPLDNISDDEGEDDEDE
                     EQTTEAAPGKQDKSNDTVEVDLKLVRKWKKDLNSAFSVKLIRNIVSSFKAAVNANKEE
                     LVDEYKYAVVDEKAFQELMFLALKDMPAAIQKAHPYHVSKGARTLSNNSNVNKIASAL
                     KSHAGSMITLLHDITNTETAALVLHSLDQVFPYFLSHRRILKEIIKSVVEIGATTRDL
                     DTQITAFAFLNNSSREFRKSILDTVLRTTYSSFVKSCRKTNIRTMPLINFQKNSSAEL
                     FGIDEVLGYQVGFEYIRQLAIHLRNSINASTKQTANSNPADAYKIVYNWQFCHSLDFW
                     SRVLSSQCHPDKEGGKESQLRQLIYPLVQVTIGVIRLIPTAQFFPLRFYLIKSLIRLS
                     QNTGVFIPIYPLLSEILTSTAFTKVPKKKSTLPTFDFEHNIKCNQGYLGTKVYQDGLG
                     EKFVELLCEFYVLYCKNVSFPELVTPAVIALRRYIKTSKNFKFNKQVSNVLEKLKQNS
                     EFILNKRSEIDFGPTNRSEVARFLADLPWNKTPLGSYVQVHREVKEEKARILRESLAE
                     EEENHVKSTSDDEGANALEEDEEDEEDAEMSDASRE"
     gene            <817653..>819260
                     /locus_tag="KLTH0D09878g"
                     /db_xref="GeneID:8295378"
     mRNA            <817653..>819260
                     /locus_tag="KLTH0D09878g"
                     /product="KLTH0D09878p"
                     /transcript_id="XM_002553093.1"
                     /db_xref="GeneID:8295378"
     CDS             817653..819260
                     /locus_tag="KLTH0D09878g"
                     /note="similar to uniprot|Q08622 Saccharomyces cerevisiae
                     YOR205C FMP38 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0D09878p"
                     /protein_id="XP_002553139.1"
                     /db_xref="GeneID:8295378"
                     /db_xref="GOA:C5DEU6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLPVSRLCVRSSLRKLVFVRFVSCTSCGVTLQNNNVRGTGFYTP
                     PKAQIERKRPVIEDLKYLLFSQDLQSLKSELSAEERPKKNKPLICKRCNDALHHNTFS
                     KEDFRRYSMQEVYRHVPAGADIYHVVPLTDFPLQLNSAVLKDSRYNSALLLSKGDQVT
                     PDKSLLQRKAPQFFKDMLRLKMNYNSNKSIAFSASKGWNIQSVYSVLRSNSFLIGCPN
                     SGKSTLVNALLKKFPSLKPSEGNNASEAEIVRGAGVSNIPNMTRDLQSYNIGSKVIND
                     LPGYSTNYGSPGPEDALDAKVLEKIQKTHLFKKTKLVKQRYTSLKGTDAGRCYTVSGI
                     FYLVPPPDTINQVVNYIPGNERQYRNIDKALSVVNSEHACPEKGPLRQYVGVQKAMES
                     KDNYVRHVLPPFQGSIEVVLKEIGYFQLKTTGKYKFLGLHEVWVPKGVDVCIREPIAR
                     LIDEGYEGYLSSEGKKKAIPEKREVFSATYPMSFEETDTLQKMKEMFLERTKNDVLAR
                     KFISSNPLKIIGTAQKEAPNLYWYYKW"
     gene            <819367..>820740
                     /locus_tag="KLTH0D09900g"
                     /db_xref="GeneID:8295379"
     mRNA            <819367..>820740
                     /locus_tag="KLTH0D09900g"
                     /product="KLTH0D09900p"
                     /transcript_id="XM_002553094.1"
                     /db_xref="GeneID:8295379"
     CDS             819367..820740
                     /locus_tag="KLTH0D09900g"
                     /note="similar to uniprot|Q02948 Saccharomyces cerevisiae
                     YPL120W VPS30 Protein required for sorting and delivery of
                     soluble hydrolases to the vacuole"
                     /codon_start=1
                     /product="KLTH0D09900p"
                     /protein_id="XP_002553140.1"
                     /db_xref="GeneID:8295379"
                     /db_xref="GOA:C5DEU7"
                     /db_xref="InterPro:IPR007243"
                     /db_xref="UniProtKB/TrEMBL:C5DEU7"
                     /translation="MGDDEVLKCQNCQVPLEIDSSLIDLSLAQRSLLMNTATEPSVPT
                     GIIPPDRLRRLGSVKKGGSLNLQPSVLNSLDSYVFLGGESSTLQQTRWDGESGDEADD
                     SATTKTLSSRVGTLTNIFNVLSSKSNIDYPVCQDCCDLLIQKLKGEYEEALKERDTYS
                     EFLYRLKKQRELESYATSKPHMVSESGGVDTKKEQEELLNELIELEKTEAELDSTIED
                     LESELQAKNDQEIAELEVMNSRDLEKLEFMSELQSLKNQYESTLNNLDKLRKTNVYNE
                     TFRISHDGPFGTINGMRLGGLDDKPIPWQEINGALGQVILLLATICARLKFKLNGYVL
                     RPMGSFSKIEKLDPKDQEWHSYDAFSDGSFKLGRFFHKETSFDRAMVSILEVISQITS
                     RLSMERSSDSEEIELPYNMHGDKINGMAVKLCGNKPGLEWTTACKFVLTNCKWLLAFS
                     SSMINDF"
     gene            <820901..>823504
                     /locus_tag="KLTH0D09922g"
                     /db_xref="GeneID:8295380"
     mRNA            <820901..>823504
                     /locus_tag="KLTH0D09922g"
                     /product="KLTH0D09922p"
                     /transcript_id="XM_002553095.1"
                     /db_xref="GeneID:8295380"
     CDS             820901..823504
                     /locus_tag="KLTH0D09922g"
                     /note="highly similar to uniprot|P21524 Saccharomyces
                     cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
                     reductase (RNR) and to YIL066C uniprot|P21672
                     Saccharomyces cerevisiae YIL066C RNR3 Ribonucleotide-
                     diphosphate reductase (RNR), large subunit; the RNR
                     complex catalyzes the rate-limiting step in dNTP synthesis
                     and is regulated by DNA replication and DNA damage
                     checkpoint pathways via localization of the small
                     subunits"
                     /codon_start=1
                     /product="KLTH0D09922p"
                     /protein_id="XP_002553141.1"
                     /db_xref="GeneID:8295380"
                     /db_xref="GOA:C5DEU8"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:C5DEU8"
                     /translation="MTVKTVVSDRNGEANKLTSQALAQSLKQLAGGLQIEDADFDAVS
                     RRILDAVPPSATHSSVVQFGGEVLAAMSTTHPDFANLAARWEISELHKKLQGLSFTEN
                     LALLQKLRSSSKAPTVKRHKTSTSHNDKNLISAAFYEMALRYQTTLDAAIQPDRDFDF
                     SYFGWKTLSKSYLIKRKNEETHETPQFLFMRVALAIHGPRGDIDAVLETYDLMSRKFF
                     IHASPTLFNAGTVNQYLSSCFLVAMIEDSIDGIYRTLHKTAMISKASGGVGVHVSNVR
                     GTGAYISGSNGTSNGLVPMLRVFNNTARYVDQGGNKRPGAFCIYLEPWHSDVLDFLQL
                     RKNQGKEELRARDLFLALWIPDLFMERVEQNGSWCLFSPDEAPGLQECFGEEFKKLYE
                     TYEKTLAPAKKMPAQKLWSEILQSQVETGGPFMLYKDSCNNKSNQKNLGTIKSSNLCC
                     EIVQYSSPSETAVCNLASVALPSFVKLQREQAIFDFESLHKIVKVLTKNLDSVIDICD
                     YPVEDAKFSNEKNRPIAIGVQGLADALMILRIPFHSESARVLNKQIFETIYHAAVETS
                     IERSKKLGPYPSFDNSPVSRGEFQFDLWGLNDDNYEFLFSDWKEMREKVKQHGIRNSL
                     LVGPMPTASTSQILGFTESFEPMTSNIYTRRVLSGEFTVINKYMVDDFCRLGIWNEKL
                     KNRIIEQNGSIQGIEGIPSNLKELYRTVWEIPQRVMIDLSADRGPFIDQSQSLNLFLR
                     EPTMGKLTSMHFYGWKKGLKTGMYYLRTQAASGAIKFTINQENTLRGAVSIRKGLEVK
                     QLSVFGHYPSSCKPHLHIKVAKDKRHEMSNSSDTSDKFRGDDDHFGIHNSQQLACSND
                     RTDANCESCSG"
     gene            <823988..>825292
                     /locus_tag="KLTH0D09944g"
                     /db_xref="GeneID:8295381"
     mRNA            <823988..>825292
                     /locus_tag="KLTH0D09944g"
                     /product="KLTH0D09944p"
                     /transcript_id="XM_002553096.1"
                     /db_xref="GeneID:8295381"
     CDS             823988..825292
                     /locus_tag="KLTH0D09944g"
                     /note="similar to uniprot|Q02933 Saccharomyces cerevisiae
                     YPL123C RNY1 RNAse member of the T(2) family of
                     endoribonucleases"
                     /codon_start=1
                     /product="KLTH0D09944p"
                     /protein_id="XP_002553142.1"
                     /db_xref="GeneID:8295381"
                     /db_xref="GOA:C5DEU9"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:C5DEU9"
                     /translation="MRIPIEALSLESLGLFSKLEHNNFKEKFPSCPSDLPLSCSNHTV
                     INDSCCFEYPGGIMLQTQFWDYVPPRNMDSGRWNSDLEKHLGPNTSFTNHGLWPDNCD
                     GRYEQFCDSSRQIDDVYHLLTSEEFNKEGMEIQGKELLEQMGKLWKSNTGDDESLWIH
                     EFNKHATCIKTLQPSCYARWDGNEEAISEDHEKQAVFDYYRIAMKLYGELDTFQTLEK
                     HGIVPSVGKSYSRKQISEALNSDFKGKDVFFKCDRNKALNEIWYYHLLQGSLLGEQFE
                     PIDSLRPRSNCPEEGIKFYPKGHRPHNGGRPGGGNRGQRGIIRVSGYNGFIIRNGHWM
                     TTGTPANFDLIKAPFGNYYLKSRTGYCGSDNKHEGVLVCNKGISSASQFDYDETKGFL
                     GLSGSFAWHANEYPRGRRQAQIYTGSPEDSKYPLKLKFVKLH"
     gene            complement(<825335..>825985)
                     /locus_tag="KLTH0D09966g"
                     /db_xref="GeneID:8295382"
     mRNA            complement(<825335..>825985)
                     /locus_tag="KLTH0D09966g"
                     /product="KLTH0D09966p"
                     /transcript_id="XM_002553097.1"
                     /db_xref="GeneID:8295382"
     CDS             complement(825335..825985)
                     /locus_tag="KLTH0D09966g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D09966p"
                     /protein_id="XP_002553143.1"
                     /db_xref="GeneID:8295382"
                     /db_xref="UniProtKB/TrEMBL:C5DEV0"
                     /translation="MSQPGLSAFLSNPETDDTLQNIRREYLASKKNLQNLLVTSPTRA
                     RTRPLQQIPTPPINGSKERADDDKLRQQLREGLQPDRFMNRPPQVPIPTAARSDIENL
                     RSMLYSQQRVIDELTRGLDAQVIRNSALENRVSMLERYITRLESQGNSRSPEPQLVDE
                     GISRRLRQQYTPLYTDDENTRVLLNSGAVDRPDRQISNFDDSTTKLLQIARDTSRW"
     gene            <827667..>830237
                     /locus_tag="KLTH0D09988g"
                     /db_xref="GeneID:8295383"
     mRNA            <827667..>830237
                     /locus_tag="KLTH0D09988g"
                     /product="KLTH0D09988p"
                     /transcript_id="XM_002553098.1"
                     /db_xref="GeneID:8295383"
     CDS             827667..830237
                     /locus_tag="KLTH0D09988g"
                     /note="similar to uniprot|P29461 Saccharomyces cerevisiae
                     YOR208W PTP2 Phosphotyrosine-specific protein phosphatase
                     involved in the inactivation of mitogen- activated protein
                     kinase (MAPK) during osmolarity sensing dephosporylates
                     Hog1p MAPK and regulates its localization localized to the
                     nucleus"
                     /codon_start=1
                     /product="KLTH0D09988p"
                     /protein_id="XP_002553144.1"
                     /db_xref="GeneID:8295383"
                     /db_xref="GOA:C5DEV1"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DEV1"
                     /translation="MSQAHLGMRHSGTAVHLGSPKNQAFMNTAATCVDLTKGQYYAAH
                     VQPCESLGDARQLENALFIDLSQCGTQLPLPNCKQVHLKFPSTLLRRPKFQFSQLVQT
                     LDHETQRVLEEEVPRRSTYVFYDEGSSLQSCSFNTSHILAKIVPYLYQQQRDIRLFFL
                     QGGAAQPQEKPAHQHPPFARPPHPTSTRSSSGIRKAAPSKHNMNLKITIPSRNLRTDN
                     SNYMFIQSFKKDSVHYSPDSLQKYFTFHMPSKIESDDQTLPAWLKSFSKDGNKNLLRI
                     LTSFEHLEKLEVQRLERCLQSFKDEQGSQTGRDARPPVANDNSSRSQRPRVEKLYSFR
                     EMQKQFQPNRHDYDSDNDSYHQSEEAKLKMDISEELNDGENKKMLLKLKKAKEDFNPY
                     SSDTKDSEECSDVAREAGTNEDDEEVAETPMDDYLLTRGIQSFTKNRYSNILPYEHSR
                     VKLEPSPIWAENKNDQFANTGAPGPKSPAGCTVRRRRNSYFSQDCSNDRDAEQACPPR
                     QENSRSSLMPPSMSLESRSSAASPHKSASESESFNDYFNANYLKIPQINPDYNYIATQ
                     APLPSTLDDFWKVVIANNVKVIISLNSDDELSLRKWDVYWNSSTLKKFDVRVNKTYEN
                     VAGVEGCILRVFDVRRHISYEASSAEGPKNSGSANTVKSESNDSSAQGFEGNENSKNS
                     SDSKFSPSYTVCQLQYTKWLDSCGIVMSDVLKLHRIKTYLSSDAEGFIKSVQDGKVYE
                     AIMKSDNEVPKNISAFDQKKNEVSAPVLVHCSAGCGRTGVFITLDYLLNVLEHPTDRS
                     NRIDVWNMSQDLIYIIVNELRKQRISMVQNLTQYITCYEGILEYFGLRKSAGRDATVY
                     "
     gene            complement(<830376..>833480)
                     /locus_tag="KLTH0D10010g"
                     /db_xref="GeneID:8295384"
     mRNA            complement(<830376..>833480)
                     /locus_tag="KLTH0D10010g"
                     /product="KLTH0D10010p"
                     /transcript_id="XM_002553099.1"
                     /db_xref="GeneID:8295384"
     CDS             complement(830376..833480)
                     /locus_tag="KLTH0D10010g"
                     /note="similar to uniprot|Q02932 Saccharomyces cerevisiae
                     YPL125W KAP120 Karyopherin with a role in the assembly or
                     export of 60S ribosomal subunits"
                     /codon_start=1
                     /product="KLTH0D10010p"
                     /protein_id="XP_002553145.1"
                     /db_xref="GeneID:8295384"
                     /db_xref="GOA:C5DEV2"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DEV2"
                     /translation="MGDGSLALTELDLVQVLGQASDPRHAGSQAQRFAEQQLKLWETQ
                     KGFHFLLQSVYLNLSCPLDVRWLAIIQFKNGVEKYWRSTRINAIGKDEKASIRARLFD
                     LIDENNNQLGIQNSQAAARIARLDFPGDWPTLFEDLEHLLGTEAIWQDNVRMFNLLLI
                     MNQMIKTLATARIGRCRPAMQSKSPLVFPLLVRTYLKAFNEWTSAASVDEESLSQIQV
                     SYLALKVLRRLVTEGCETPHRNVSIAEFLQISINHFELLMTHFDNYKGFDNFEKFVRC
                     YGKLYYSLICASPSNFILLPCSLQVLTAFTKLLIERAPDVYRENAEVDGNFWEQIAIR
                     SFLILKRLINFIHKKGAVTIKAKNDKYEVDVAVKRITSEFLNENLIKKWVDLLMDWYL
                     KLRKSDLEDWSLDPEEWINEQLATSYEYQIRPCAENFFQDLINSFPDLLVPYLLNKIQ
                     TEASSLNNSVEDLLKKDAIFASFQLSATSISEAVDFDTLLVNVFLPEALNPQQLPEFS
                     KIVKRRVALVINEWSTIKCSEESKQACYKFFYKILTEEEDKVVRLTAIQSLRTLVDDW
                     NFDKNSFQPYLDDFVVVLLKRTLPSVSLTETRLYVLNTLSDIIVQTKPLVSRNLLVEI
                     LQVVPELWELSMNDSSESILANALLRLLRRAIDSLGKNSPATWQISLPITLAACDPSS
                     PQYSLLYEDGFELWQSLLQNYSPSEQALDETFFKLVPFLKNAVQNQTEILPTLLEIVK
                     SYALVLPESQFLNNECFFFAFSHLSGYLLKLRDDSFDIVLSILDILTLARDPDNDRLL
                     LEFLLETGMLPSIFNALFREDQISLFQAGQLLQTIARIAYFDPGSIIQLLERYRSALP
                     TSERNSLLPLEERKALSVETPLENVINKLVTIWILCFKDFFDPRVRKIHILGLSSMLR
                     TQYPAVISEIASIVSLWVEFLEETNETTNGDCEKYYINDPAYGESQDDSEEHILTCEH
                     QRLQKLVSERDPAHNVSLKEHITYTLQYLETEMGPQFQTLLSSVDEALIQDLRLFLSI
                     PAQK"
     gene            complement(<833709..>834998)
                     /locus_tag="KLTH0D10032g"
                     /db_xref="GeneID:8295385"
     mRNA            complement(<833709..>834998)
                     /locus_tag="KLTH0D10032g"
                     /product="KLTH0D10032p"
                     /transcript_id="XM_002553100.1"
                     /db_xref="GeneID:8295385"
     CDS             complement(833709..834998)
                     /locus_tag="KLTH0D10032g"
                     /note="highly similar to uniprot|P39683 Saccharomyces
                     cerevisiae YOR209C NPT1 Nicotinate
                     phosphoribosyltransferase"
                     /codon_start=1
                     /product="KLTH0D10032p"
                     /protein_id="XP_002553146.1"
                     /db_xref="GeneID:8295385"
                     /db_xref="GOA:C5DEV3"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:C5DEV3"
                     /translation="MTGPVIKSLLDTDMYKLTMYAAVLQNMPDAEVIYKYTNRSSHMT
                     FNKEAIEWLEQEVRVLGDLKFGKDEIEYLKTAIPYLPDEFLKYISNGQPKICPSDQIS
                     LSTEPADAPERYHIKIQVKGLWRDTILYEIPLLSLISEAYFKFVDTDWTYENQEERAY
                     QKAKKLIENDINFSEFGSRRRRSLEAQDLVLKGIIKAVEETGEKGRKCFAGTSNVLFA
                     KKYGVKPVGTVAHEWMMGVASVTKDYVNANKLAMDYWIKTFGPENAGLALTDTFGTDN
                     FLKTFIPPYSDYYAGVRQDSGDPVQYAKKIAHHYFDVLKYPRFSKLICFSDSLNPEKA
                     IQYSQAAHDCGLKATFGIGTNFTNDFHSSEDSVKVSEPLNIVIKLLEVNGNPAIKISD
                     NMGKNMGDPRTVRRVKEELGYIERTWAGDNEAHRWAS"
     gene            complement(<835206..>837818)
                     /locus_tag="KLTH0D10054g"
                     /db_xref="GeneID:8295386"
     mRNA            complement(<835206..>837818)
                     /locus_tag="KLTH0D10054g"
                     /product="KLTH0D10054p"
                     /transcript_id="XM_002553101.1"
                     /db_xref="GeneID:8295386"
     CDS             complement(835206..837818)
                     /locus_tag="KLTH0D10054g"
                     /note="similar to uniprot|Q02931 YPL126W Saccharomyces
                     cerevisiae NAN1 U3 snoRNP protein component of the small
                     (ribosomal) subunit (SSU) processosome containing U3"
                     /codon_start=1
                     /product="KLTH0D10054p"
                     /protein_id="XP_002553147.1"
                     /db_xref="GeneID:8295386"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DEV4"
                     /translation="MGQSVVHQKYKLSVVSGGKLVLPRASNRSCCNKSVTLLTRDETC
                     VVVPFNNQIKVYSLETSQCVKTLKFANNAVLSRLFLGADAASICDLALGDLTLAEGGT
                     ADGAHSDDTFDFSVITSVGDVVVLNYKGKLADEPKVIQLGTLQPNEQVVKLFRFGGRV
                     SVLTSEAETSATYTYRIYSYDNSERKLSERKRFEHVLLSAWSSNDKFLCLLAKGQNSK
                     KVLYLEDIHDQIDSKTLPLPSIASASASSNAHFATVMALDHQGSQLAVGYASGVINVI
                     NLTDQSTRLLKWHIDSVLSLCFTSDGTYLLSGGWEKVLSFWQLSTNLQQFLPRLNGVV
                     VDCNILHDKFYSLGLQFADNQSNSDYQLLLLNSTDLKSRIAISGPLCVFQTAVRDVVY
                     PVSAVSSKASASSADLQKANKKQQRKLLKRRRQDFSSVFEIQPSTKHLYFPHTSAVQI
                     FDFYKNEQIHYQYLASGLNNSMGKVRSELNLKDPVIADVKFTKDGNWMISYEVEYPPE
                     GLLSSNDFSHVLKFWRMSASGEWELQTKVLSPHGLKTPITSILVAPRSVNNSLGCLTS
                     DNNGGLKYWSFDEVLNNWALSKVAVPSVNHFSNSVELAWSLDGSLIFHAFDDKVTVIE
                     FAAFKKFYEDSAKALNEFTMDSAIQSIMLVNDSNLIVATQTSLNSINLLLGVVESSFD
                     LYPFVNGVYKNGHASRLISCDEKNGRVALVVNHKTLDAEGRPTLNYASHVLVFNSDLS
                     QKLGAFEHDEYISCIRWNFDTDFIFLDTKNRLGVVSTTTSPEMLDEVDKEGALDQLAS
                     NEFEIELQKLTRAQKAQGLEPETDEKEEALLDFINGDKSGKLINMNSFTSMFENIENV
                     QMDTLFDRVMKVIT"
     gene            <838105..>838317
                     /locus_tag="KLTH0D10076g"
                     /db_xref="GeneID:8295387"
     mRNA            <838105..>838317
                     /locus_tag="KLTH0D10076g"
                     /product="KLTH0D10076p"
                     /transcript_id="XM_002553102.1"
                     /db_xref="GeneID:8295387"
     CDS             838105..838317
                     /locus_tag="KLTH0D10076g"
                     /note="highly similar to uniprot|P22139 Saccharomyces
                     cerevisiae YOR210W RPB10 RNA polymerase subunit ABC10-beta
                     common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="KLTH0D10076p"
                     /protein_id="XP_002553148.1"
                     /db_xref="GeneID:8295387"
                     /db_xref="GOA:C5DEV5"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:C5DEV5"
                     /translation="MIVPVRCFSCGKVVGDKWEAYLNMLQEDELDEGTALSRLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLEKRD"
     gene            complement(<838429..>841023)
                     /locus_tag="KLTH0D10098g"
                     /db_xref="GeneID:8295388"
     mRNA            complement(<838429..>841023)
                     /locus_tag="KLTH0D10098g"
                     /product="KLTH0D10098p"
                     /transcript_id="XM_002553103.1"
                     /db_xref="GeneID:8295388"
     CDS             complement(838429..841023)
                     /locus_tag="KLTH0D10098g"
                     /note="similar to uniprot|P32266 YOR211C Saccharomyces
                     cerevisiae MGM1 Mitochondrial GTPase related to dynamin
                     present in a complex containing Ugo1p and Fzo1p"
                     /codon_start=1
                     /product="KLTH0D10098p"
                     /protein_id="XP_002553149.1"
                     /db_xref="GeneID:8295388"
                     /db_xref="GOA:C5DEV6"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEV6"
                     /translation="MLQLTGRAVPITRQAIVRQAIFRRGYYSPLRRVHPTSYYHSFVR
                     PSRFLYVSHEAIHQLSHKRNASFFPKMIARVIRVPAYIGGGAAAVSSYLAYKLEEATH
                     FSHNKLAQLKELAQTMKERFGDTFGRQGPDGDNGGEGTEGEEALATGALLASLDNNDA
                     EAKRANEEDDDDDDEEEDNTESEILNLTKQMIEIRSILNKVDSSSANLTLPSIVVIGS
                     QSSGKSSVLESIVGKEFLPKGSNMVTRRPIELTLVNTASSNETTADFPSLRAYNIKDF
                     NEVKRILMELNMAVPSTEAVSADPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPYELK
                     SKIRQVCETYLAEPNIILAISAADVDLANSSALRASKVADPKGTRTIGVITKLDLVEP
                     ARAREILNSKKYPLKMGYVGVITKSPGSQSRLFDSGSKSGLFKRNTNKEVELEQTRSF
                     ERNYFRENKSVFTNCQVSTKRLREKLIKILEVSMSNALEPTSRVIQQELDDTSYLFKV
                     EFNDRQLTPKSYLLNNVDILKLAIKEFQEKFNRYELKSILKADLDQRVLDLLASRYWK
                     DENLQELSSKKSEKDESSALYWHKKLELSSSSLTKIGVGRVSTTLVTNAILRELENIL
                     DMTQLKNHDLIKELVNNTAVNVLNTKYYATADQVENCIKPFKYEIDLEERDWSVAVDH
                     STKLMREELRQCNERLQAIKNTVGSRKLQQVTTYLQQDSARQETLGFSALLLERGREA
                     AFLEKRSQLLSFRLKTLKNRCHSTADKDICPEVFLNAVSDKLTSTAVLFLNVELLSDF
                     FYNFPIELDRKLTALSDEQVEMFAKEDPRIARHIELQKRKELLTLALERIDSILVFKK
                     SYKNVSQP"
     gene            <841691..>842379
                     /locus_tag="KLTH0D10120g"
                     /db_xref="GeneID:8295389"
     mRNA            join(<841691..841859,841922..>842379)
                     /locus_tag="KLTH0D10120g"
                     /product="KLTH0D10120p"
                     /transcript_id="XM_002553104.1"
                     /db_xref="GeneID:8295389"
     CDS             join(841691..841859,841922..842379)
                     /locus_tag="KLTH0D10120g"
                     /note="similar to uniprot|P53551 Saccharomyces cerevisiae
                     YPL127C HHO1 Histone H1, a linker histone required for
                     nucleosome packaging at sites"
                     /codon_start=1
                     /product="KLTH0D10120p"
                     /protein_id="XP_002553150.1"
                     /db_xref="GeneID:8295389"
                     /db_xref="GOA:C5DEV7"
                     /db_xref="InterPro:IPR005818"
                     /db_xref="InterPro:IPR005819"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5DEV7"
                     /translation="MPSRVETKAKQTRLNSAVSAVKQKDTNKPSVKNAKPANKKVVKP
                     SVKPKSPLPTYKDMIIEGIATLGERNGSSRQALKKYISAKYPVGEGFENRFNLAIRRG
                     IDSGDFSQPKGSSGPLKAVKKGPAKSEHVITPKPEVKDEIPKRRRSATKVKDNVTGVS
                     PSKEKRRGSATTVPKAKPQVSKNTKKAVSTKTPIAKPAKTAASRIKAA"
     gene            <843374..>844915
                     /locus_tag="KLTH0D10164g"
                     /db_xref="GeneID:8295390"
     mRNA            <843374..>844915
                     /locus_tag="KLTH0D10164g"
                     /product="KLTH0D10164p"
                     /transcript_id="XM_002553105.1"
                     /db_xref="GeneID:8295390"
     CDS             843374..844915
                     /locus_tag="KLTH0D10164g"
                     /note="some similarities with uniprot|Q02457 YPL128C
                     Saccharomyces cerevisiae TBF1 TTAGGG repeat binding
                     factor"
                     /codon_start=1
                     /product="KLTH0D10164p"
                     /protein_id="XP_002553151.1"
                     /db_xref="GeneID:8295390"
                     /db_xref="GOA:C5DEV8"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR013867"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5DEV8"
                     /translation="MSEALPAKDTDPLKSDDIKTGKVIAELPPRTQLNINSIGLLDNV
                     STQLLKLLMTSSIETLIGFTSAQSDGYQSEVFEMLFALFKQVKKVYTSAPLLVVQDIA
                     PGLWLEDEKCPYILKNQENLVLAAIRKANIVTYLLSIMGRLQYGFLFLDESFIEIFCP
                     VAGDLPFEAERALTTSLGRLLKPQAVLYLNLKTHAYISAIEPYRDNAEALSRVREEIL
                     DRIFAKNMEQFILAKRRMRSSKLSPSEEDFVKRCVHRREKLQSQDSLDLLVAEYDWLE
                     FFKEIFFYLQRNISVLVWGKKGCDFASPGSDVSASDINADQPMSSLNNGSAESSRASS
                     EPPVGKPLSSSSSLRPSPAPLRDAASAKKLKQKRLWNKEEEGALIEALKVHGPAWSKI
                     LELHGAGGSLSESLKNRTQVQLKDKARNWKMYFLKGGLPVPDYLAKVTGDLERDEKSK
                     QRFKNKTKKQAPTKTIGNVEKPHEPTQDLRKVANMSIVAQAGRSEFPIEEANASEMDP
                     QLQAT"
     gene            <845352..>846617
                     /locus_tag="KLTH0D10186g"
                     /db_xref="GeneID:8295391"
     mRNA            <845352..>846617
                     /locus_tag="KLTH0D10186g"
                     /product="KLTH0D10186p"
                     /transcript_id="XM_002553106.1"
                     /db_xref="GeneID:8295391"
     CDS             845352..846617
                     /locus_tag="KLTH0D10186g"
                     /note="similar to uniprot|P18851 YOR212W Saccharomyces
                     cerevisiae STE4 G protein beta subunit"
                     /codon_start=1
                     /product="KLTH0D10186p"
                     /protein_id="XP_002553152.1"
                     /db_xref="GeneID:8295391"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016346"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DEV9"
                     /translation="MIVKNGTSYEHSHHNQALPLAVDVENSVKDQIALARSDTRQLQD
                     LITRVKAKVRDANLAQMSKNVPSLRGGSVNLASHLTLNGHNNKISDFAWSSDSQSILS
                     ASQDGFMIIWDAALGFKKNAIPLDSQWVLTCAINASGNLVASAGLTNNCTIYRISQEN
                     RIQQQIVSIFKGHTCYVSQVEFFGGNEVITASGDMTCALWDIPKAKRVAEFSDHLGDV
                     LALALPPPKTQPEKTVFASGGSDGYVYIWDTRMRTAGQSFFVSESDVSTLKFFNNGNA
                     ILTGTDDGIARMFDLRSDCVIAAYSLSQGLSQRTNSPGKQHSEFSLEYGLSPGKNSFT
                     RATRSANSTYLDNQGIVSLDFSGSGRLIHACYTDYGCVIWDTLKAEIVGKLEGHSSRI
                     SGVKTSPDGMAVCTGSWDATLKLWSPEYM"
     gene            complement(<846664..>847398)
                     /locus_tag="KLTH0D10208g"
                     /db_xref="GeneID:8295392"
     mRNA            complement(join(<846664..847317,847390..>847398))
                     /locus_tag="KLTH0D10208g"
                     /product="KLTH0D10208p"
                     /transcript_id="XM_002553107.1"
                     /db_xref="GeneID:8295392"
     CDS             complement(join(846664..847317,847390..847398))
                     /locus_tag="KLTH0D10208g"
                     /note="weakly similar to uniprot|Q99314 Saccharomyces
                     cerevisiae YOR213C SAS5 Subunit of the SAS complex (Sas2p,
                     Sas4p, Sas5p), which acetylates free histones and
                     nucleosomes and regulates transcriptional silencing;
                     stimulates Sas2p HAT activity"
                     /codon_start=1
                     /product="KLTH0D10208p"
                     /protein_id="XP_002553153.1"
                     /db_xref="GeneID:8295392"
                     /db_xref="GOA:C5DEW0"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:C5DEW0"
                     /translation="MSILYVNRTVRIKTTQNIISEKSPVEGLPLRQWQVNVLILGPNG
                     DESPAYIFEKCIYRLHPTFRNPIRTKIEAPFALEEKGWGEFTFSISCFFLRGAGEVEF
                     LHELTFQDEVYYLDFNIKVPCHVPELRRVLELTGPVPEAVAPADLTYKTDMEKWIQKL
                     LASDEELATNVVNKIMHHPAVAREVERKPLDECFVVDLRQLPESLLWDIGDYILNEPP
                     VK"
     gene            complement(<847624..>848460)
                     /locus_tag="KLTH0D10230g"
                     /db_xref="GeneID:8295393"
     mRNA            complement(join(<847624..848367,848452..>848460))
                     /locus_tag="KLTH0D10230g"
                     /product="KLTH0D10230p"
                     /transcript_id="XM_002553108.1"
                     /db_xref="GeneID:8295393"
     CDS             complement(join(847624..848367,848452..848460))
                     /locus_tag="KLTH0D10230g"
                     /note="highly similar to uniprot|P35189 Saccharomyces
                     cerevisiae YPL129W TAF14 Subunit (30 kDa) of TFIID TFIIF
                     and SWI/SNF complexes involved in RNA polymerase II
                     transcription initiation and in chromatin modification
                     contains a YEATS domain"
                     /codon_start=1
                     /product="KLTH0D10230p"
                     /protein_id="XP_002553154.1"
                     /db_xref="GeneID:8295393"
                     /db_xref="GOA:C5DEW1"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:C5DEW1"
                     /translation="MVASVKRTVRIKTQQAILPDVPPPVENFPMRHWSIEIFVLDEQG
                     NEVPATIFDKVVYHLHPTFANPTRTFTEPPFKIEEQGWGGFELLISGHLLEKGGERKL
                     THDLHFMKEVYEVDHVIQVPTNKPLLKAELQKTGPVEETVASTAGTPTASGVGEKRKA
                     ISNGESKSKKAKTGTGSAVKGSVDLEKLAFGLTKLNEDDLVGVVQMVTDNRTPDMNIT
                     NNIEEGEFIIDLYSLPEGLLKSLWEYVKKNTD"
     gene            complement(<848849..>849412)
                     /locus_tag="KLTH0D10252g"
                     /db_xref="GeneID:8295394"
     mRNA            complement(<848849..>849412)
                     /locus_tag="KLTH0D10252g"
                     /product="KLTH0D10252p"
                     /transcript_id="XM_002553109.1"
                     /db_xref="GeneID:8295394"
     CDS             complement(848849..849412)
                     /locus_tag="KLTH0D10252g"
                     /note="similar to uniprot|Q12032 YOR215C Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10252p"
                     /protein_id="XP_002553155.1"
                     /db_xref="GeneID:8295394"
                     /db_xref="GOA:C5DEW2"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /translation="MLTRRITLGISRNLSRGALINARFASSQSYLDSVANLKKDLKKA
                     MIAKDDLRKTTIRGLLSGIKNKEIDAQGKDLDEFALHDLYSKLITQRKDSIEEFLKNN
                     RSDLVEREESEIEIIKNYLGQLPVASEAEIDAKVSNLLTELKQSNPSLQLKDAFKKVD
                     WKAAPSDWRASASMIKASIVRQFKTKS"
     gene            complement(<849747..>851162)
                     /locus_tag="KLTH0D10274g"
                     /db_xref="GeneID:8295395"
     mRNA            complement(<849747..>851162)
                     /locus_tag="KLTH0D10274g"
                     /product="KLTH0D10274p"
                     /transcript_id="XM_002553110.1"
                     /db_xref="GeneID:8295395"
     CDS             complement(849747..851162)
                     /locus_tag="KLTH0D10274g"
                     /note="similar to uniprot|Q12234 YOR216C Saccharomyces
                     cerevisiae RUD3 Golgi matrix protein that is involved in
                     the structural organization of the cis-Golgi"
                     /codon_start=1
                     /product="KLTH0D10274p"
                     /protein_id="XP_002553156.1"
                     /db_xref="GeneID:8295395"
                     /db_xref="GOA:C5DEW3"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR019459"
                     /db_xref="UniProtKB/TrEMBL:C5DEW3"
                     /translation="MAKNKKKASKPKPEKMEPAKTDCEAPESEPATSHQEPAPENAIE
                     LTDNDKTGDDEAGLRKEVERLQNEVSNLRQQLEKQTKHGSKDEKDEKDEKDEKDENSE
                     KTNKEVKDEEELTTKLAKIQEERDQFENQYNSLLSRLSSMKSVFNKMRESQEELESCQ
                     EQLREYESQNLSLRNKLENSNREHEELQNTVVTLNQEVSGLNDECESLSQELSEAVEK
                     SSKFEEDLKTLSSHNANERHTWETKFKELELLLSNMKQDMESLKEEREDLKQRLEKSE
                     RLKETSEANLAELERQLELQQQAGEETISEKAKRIQTLEAQIQEYRIKNEKIELERVN
                     LLSQVEGMREAVEQKEALQQECKERLLQIGKLRHEAIILNEHLTKALAMLKKSSDSET
                     VDKELISNLLISFVAIPRADPKKFEVLELISSFLNWDDDKKQQAGLIYAANGQRSNTN
                     GSRTQNFVSLWTEFLEKESVN"
     gene            <851319..>853913
                     /locus_tag="KLTH0D10296g"
                     /db_xref="GeneID:8295396"
     mRNA            <851319..>853913
                     /locus_tag="KLTH0D10296g"
                     /product="KLTH0D10296p"
                     /transcript_id="XM_002553111.1"
                     /db_xref="GeneID:8295396"
     CDS             851319..853913
                     /locus_tag="KLTH0D10296g"
                     /note="similar to uniprot|P38630 Saccharomyces cerevisiae
                     YOR217W RFC1 Subunit of heteropentameric Replication
                     factor C (RF-C) which is a DNA binding protein and ATPase
                     that acts as a clamp loader of the proliferating cell
                     nuclear antigen (PCNA) processivity factor for DNA
                     polymerases delta and epsilon"
                     /codon_start=1
                     /product="KLTH0D10296p"
                     /protein_id="XP_002553157.1"
                     /db_xref="GeneID:8295396"
                     /db_xref="GOA:C5DEW4"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012178"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEW4"
                     /translation="MVGIDEFFKGQHTGKQPSKARATGTSRKRKEQPVNSASNPINLE
                     DSEDEHTLEAKKPSNQLKAGVSVEIVDEEPQPRKRQRATAPAPKAKASSPKKSPKSKI
                     QSAEAGTAEALLSQIPSVDLDAVHVKETAQFDFRSNGNAGDSSQAAAEEANFPEGAPN
                     CLLGLTIVFTGQLPTIERGVAEAIAKRYGARVTKSISSKTSVVVLGDEAGPKKLEKIK
                     QLKIKAIDEDGFKQLVAGMPEEGGDGSAAEKARQKLKQQEEKAQKDAAEMIKVEEEQR
                     EKARRVQSKANTADKREPVREEDKLWTVKYAPTSLQHICGNKTSVNKLKTWLSNWRTY
                     QKQGFKNAGRDGFGVFRAAMVYGPPGIGKTTAAHLAAKELGYDILERNASDVRSKSLL
                     NAGVKNALDNTSVVGFFKSKHDGDVNQKNFVIIMDEVDGMSGGDRGGVGQMAQFCRKS
                     SMPMILICNERNSPKMRPFDRVCLDIQFRRPDPTSIKARLMTVAVREKFQLDPNIIDK
                     LVEATRGDIRQLINLLSTISTTTKKIGHENAQEIAKAWEKNIALKPFDIAHKLFDGRI
                     YSDVGSKSFPLYKKIELYFDDFDFAPLMIQENYLQTRPSVLKPGQSHLAAVADAAESI
                     SQGDLVERKIRSSEQLWSLLPFHAIMSSVRPASKVAGQMAGRINFTSWLGQNSKMGKY
                     YRLLQEIQYHTRLSTSTDKLGLRMDYMPTMKKRLLDPLVERGNDAVPEVIQTMDDYYL
                     SKEDWDSIMEFMIGSDKTDLQIKKIPTAVKSGFTRKYNSMVHPVAIYKTGSTTAVGAK
                     PAATPDFEDIVDADDNVPPADEDEESKEDTDFKKDKLIKQGKPKVASKRAGSTAKKSA
                     AAKKRKTK"
     gene            complement(<853996..>856611)
                     /locus_tag="KLTH0D10318g"
                     /db_xref="GeneID:8295397"
     mRNA            complement(<853996..>856611)
                     /locus_tag="KLTH0D10318g"
                     /product="KLTH0D10318p"
                     /transcript_id="XM_002553112.1"
                     /db_xref="GeneID:8295397"
     CDS             complement(853996..856611)
                     /locus_tag="KLTH0D10318g"
                     /note="similar to uniprot|P33894 Saccharomyces cerevisiae
                     YOR219C STE13 Dipeptidyl aminopeptidase Golgi integral
                     membrane protein that cleaves on the carboxyl side of
                     repeating -X-Ala- sequences required for maturation of
                     alpha factor transcription is induced by a- factor"
                     /codon_start=1
                     /product="KLTH0D10318p"
                     /protein_id="XP_002553158.1"
                     /db_xref="GeneID:8295397"
                     /db_xref="GOA:C5DEW5"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DEW5"
                     /translation="MEPSYKKRHPSLYLLKSNSSAQFMPAQEFELQPKGEAPGTAGKL
                     PRDEEAQVTDGADFLSRVPFRDFQNRIRVRKSAVIFLALIISWLTVGFSVLRFKDSNL
                     SLSKPASPSGRTFSIENVLNGEFSYYDTYFKFIRPGVLHQPQDNDPGLYLKIENKNGI
                     PKYVAKQLVDVEFYKELGRTSFTYGDVEYQVSDFDVSHRLDKAILATDLEKKFRHSST
                     AYYWLKDIPTNTYRPISPFPEDGKLYKLSFARFSPHRNFVYFVYNNDLYVQSATNSQG
                     FRRLTADGSEDVKNGRPDWVYEEEVLASDQAVWWAPDDSQIVFAKFNDSEVLTESVPT
                     YINEQAYDDVQQIKYPKPGTPNPRVQLFSYKMSEGVTYSIPFGGETGGRILYAAQWLD
                     NNHFMFKDTDRASQAMFVKIYESNARKVSTVRIINATAYSGWIEKVKDVQPIPPSEIH
                     GRSELSYVDVQVDESGYPHLFHFKSVFASTGTQLTFGDWEVTGKGIVGYDQDADSVFF
                     LSNRLSRFSQHLFMVPLREDSTKAAHGLQDPRDRDSFYEFELSVSCRFGVKRYLGPDE
                     PMSDAGVLTSLLLNDQSRAITQLTSNAGMLEALKKYDLPKSSFSSTQLDDDVQIDYKE
                     TVPYDFDPRKKHPLLIHVYGGPGSQTVDHKFAISLEESLASSANAIVLSIEPRGTGGR
                     GWPYRSWAKNKIGYWEPRDIISVVKDYVNKHSDSIDPDHVAIWGWSYGGFVTLKTLEL
                     DQGQIFKYGVAVAPVTNWKYYNSIYTERYLGLFENNEKAYEDTSLIKDVQNFSSVKRF
                     LLIHGSADDNVHVKNTMQLLDNFNLNNVKNYDLSIFPDSEHSIVFHNANRVVYERIFN
                     WIKNAFEGKLDNLSW"
     gene            complement(<856900..>857787)
                     /locus_tag="KLTH0D10340g"
                     /db_xref="GeneID:8295398"
     mRNA            complement(<856900..>857787)
                     /locus_tag="KLTH0D10340g"
                     /product="60S ribosomal protein L5"
                     /transcript_id="XM_002553113.1"
                     /db_xref="GeneID:8295398"
     CDS             complement(856900..857787)
                     /locus_tag="KLTH0D10340g"
                     /note="highly similar to uniprot|P26321 Saccharomyces
                     cerevisiae YPL131W RPL5 component of the large (60S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L5"
                     /protein_id="XP_002553159.1"
                     /db_xref="GeneID:8295398"
                     /db_xref="GOA:C5DEW6"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:C5DEW6"
                     /translation="MAFQKEIKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKY
                     SSPKYRLVVRFTNKDIICQIVSSTITGDVVLVAAYSHELPRYGITHGLTNWAAAYATG
                     LLVARRALQKLGLDETYPGVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVF
                     GALKGASDGGLYVPHSESRFPGWDFEAEELDADMLRTYIFGGHVSQYMEELADDDEER
                     FKELFKGYLADDIDADAVEDIYLEAHEKIREDPSFKPTEKKFTKEQYAAESKKYRQTK
                     LSKEERRARVAAKIAALAQ"
     gene            complement(<858224..>858952)
                     /locus_tag="KLTH0D10362g"
                     /db_xref="GeneID:8295399"
     mRNA            complement(<858224..>858952)
                     /locus_tag="KLTH0D10362g"
                     /product="KLTH0D10362p"
                     /transcript_id="XM_002553114.1"
                     /db_xref="GeneID:8295399"
     CDS             complement(858224..858952)
                     /locus_tag="KLTH0D10362g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0D10362p"
                     /protein_id="XP_002553160.1"
                     /db_xref="GeneID:8295399"
                     /db_xref="UniProtKB/TrEMBL:C5DEW7"
                     /translation="MCPCARSKPLDALCTNPAQRTPSTDTPLPQPPVAAARAPWPPEM
                     RLWRAACVPERPCCYATPLRTTHYGILGAALRCWERKRQRKRNERARRADGDSAGGNL
                     PPRKTACTARSAQRARQAQRRAVRCPAIVACVLGFVGENASLSCAATCCSFGATTAPG
                     AEAFPDDCPFGVWLPQRRTRYRLARGEKEEVIEAVGEERRLWAQRSVAMGETHRREAP
                     ARRVRRERRMERAARQSGRGARGR"
     gene            <859289..>859933
                     /locus_tag="KLTH0D10384g"
                     /db_xref="GeneID:8295400"
     mRNA            <859289..>859933
                     /locus_tag="KLTH0D10384g"
                     /product="KLTH0D10384p"
                     /transcript_id="XM_002553115.1"
                     /db_xref="GeneID:8295400"
     CDS             859289..859933
                     /locus_tag="KLTH0D10384g"
                     /note="weakly similar to uniprot|Q12044 Saccharomyces
                     cerevisiae YOR220W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10384p"
                     /protein_id="XP_002553161.1"
                     /db_xref="GeneID:8295400"
                     /db_xref="UniProtKB/TrEMBL:C5DEW8"
                     /translation="MLHTTPKTQILITDVPAQDFACGWPQQLQSQLFDREFPQLKHSC
                     LYYTPLAFLHRVVLIFDQEPATLQVHEFLTRALAGKPVKIFLTESLLAKPRAKSFDAA
                     PDHVPDFDVEPRAKPQLSLDTHSSPANSPSLSPDRSDPHSPTALKSLEDGKVHLYQEP
                     LPAADAPGDDASPRGETKLLYKPRLSLDTRSSGASHSSFSVPMSPSITLNEFPQ"
     gene            complement(<860078..>860842)
                     /locus_tag="KLTH0D10406g"
                     /db_xref="GeneID:8295401"
     mRNA            complement(<860078..>860842)
                     /locus_tag="KLTH0D10406g"
                     /product="KLTH0D10406p"
                     /transcript_id="XM_002553116.1"
                     /db_xref="GeneID:8295401"
     CDS             complement(860078..860842)
                     /locus_tag="KLTH0D10406g"
                     /note="similar to uniprot|P19516 YPL132W Saccharomyces
                     cerevisiae COX11 Mitochondrial membrane protein required
                     for assembly of active cytochrome c oxidase"
                     /codon_start=1
                     /product="KLTH0D10406p"
                     /protein_id="XP_002553162.1"
                     /db_xref="GeneID:8295401"
                     /db_xref="GOA:C5DEW9"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:C5DEW9"
                     /translation="MLHKLLFRAASRSIPARRLFSAGPMCLKNQSQIDISKLTQKEIQ
                     QLRSLKFQRDRQFKDRTAAYYFTSIAVLFLGLAYAAVPLYRAICARTGFGGIPITDKR
                     KFTDDKLIPVESGKRIRVSFTSEVSQILPWKFVPEQREVHVLPGETALAFYKARNTSD
                     KDIIGMATYSITPGDAAPYFNKIQCFCFEEQRLAAGEEIDMPVFFFIDPDFATDPRMR
                     NIDDIVLHYTFFRAHYANGGAVSESANPQVMDSGSS"
     gene            <861135..>862196
                     /locus_tag="KLTH0D10428g"
                     /db_xref="GeneID:8295402"
     mRNA            <861135..>862196
                     /locus_tag="KLTH0D10428g"
                     /product="KLTH0D10428p"
                     /transcript_id="XM_002553117.1"
                     /db_xref="GeneID:8295402"
     CDS             861135..862196
                     /locus_tag="KLTH0D10428g"
                     /note="similar to uniprot|P19541 Saccharomyces cerevisiae
                     YPL133C RDS2 Regulator of drug sensitivity Transcriptional
                     regulator"
                     /codon_start=1
                     /product="KLTH0D10428p"
                     /protein_id="XP_002553163.1"
                     /db_xref="GeneID:8295402"
                     /db_xref="GOA:C5DEX0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DEX0"
                     /translation="MNESSQKKRKKVSKACLYCRRSHMICDEQRPCSRCLRRDIGHLC
                     RDEDSRLPMDVEVDPERIQPTLASLDKQHPALQQPPKNVAYSGLLSQQPTFVSEHVGS
                     EFLSLNEFMNMLEEPIILEPPAVTHSAPRNPEDQPTLKENFFLTAADPSAEMTPEDRL
                     KSVINAKLEAGLLRPYNYAQGYARLQTYMDKHMDFLSKQRILKPLSIIRPEFRAIARS
                     LKDVDLILVEESFERMLLSYDRVFTSMSMPACLWRRTGEIYRGNKEFASLVDCKVDDL
                     RDGKLAIYELMTEESAVNFWEKYGSIAFDKAQKAVLTSCNLRARDGGRQRSCCFSFTI
                     RRDRYNIPICIVGNFIPTS"
     gene            complement(<862180..>863160)
                     /locus_tag="KLTH0D10450g"
                     /db_xref="GeneID:8295403"
     mRNA            complement(<862180..>863160)
                     /locus_tag="KLTH0D10450g"
                     /product="KLTH0D10450p"
                     /transcript_id="XM_002553118.1"
                     /db_xref="GeneID:8295403"
     CDS             complement(862180..863160)
                     /locus_tag="KLTH0D10450g"
                     /note="weakly similar to uniprot|Q12283 Saccharomyces
                     cerevisiae YOR221C MCT1 Predicted malonyl-CoA:ACP
                     transferase putative component of a type-II mitochondrial
                     fatty acid synthase that produces intermediates for
                     phospholipid remodeling"
                     /codon_start=1
                     /product="KLTH0D10450p"
                     /protein_id="XP_002553164.1"
                     /db_xref="GeneID:8295403"
                     /db_xref="GOA:C5DEX1"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C5DEX1"
                     /translation="MKVITFPGQGTPVALNVFRSYLAEGSSAFRAVFRDSGRIGVTRT
                     IEQRPADPVSIAACSFLLFDLYRRSRKNNAEELLFLGHSLGELGCLGAGNRLFGLSET
                     MKIASLRNKLMINAAGGNKYELWAISAPRSQNLECELQPLLRVTDVNLANVNSRMQCV
                     VTVPQGYTTDSKGTPQWAAELALQVPRCRIQRLENPYHIPFHNKNILQGIEEPLLDHM
                     WQKLKSQGLHTKRELEHPIISNLNGKRITDVDKALESFAKSSCNVVNFVACCDTLNSL
                     GVSKAVHIGPGEVIGKLMHRNCKLEKSQEWNTVEDITKELGDVQDSNSLE"
     gene            <863427..>864317
                     /locus_tag="KLTH0D10472g"
                     /db_xref="GeneID:8295404"
     mRNA            <863427..>864317
                     /locus_tag="KLTH0D10472g"
                     /product="KLTH0D10472p"
                     /transcript_id="XM_002553119.1"
                     /db_xref="GeneID:8295404"
     CDS             863427..864317
                     /locus_tag="KLTH0D10472g"
                     /note="similar to uniprot|Q99297 Saccharomyces cerevisiae
                     YOR222W ODC2 Mitochondrial inner membrane transporter
                     exports 2-oxoadipate and 2-oxoglutarate from the
                     mitochondrial matrix to the cytosol for use in lysine and
                     glutamate biosynthesis and in lysine catabolism"
                     /codon_start=1
                     /product="KLTH0D10472p"
                     /protein_id="XP_002553165.1"
                     /db_xref="GeneID:8295404"
                     /db_xref="GOA:C5DEX2"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DEX2"
                     /translation="MTDARPLPFIYQFAAGAVAGISEILVMYPLDVVKTRMQLQVAGG
                     VGPQYNGVVNCLKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFG
                     VEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSKYNGPVDVVKRIIAQEGVL
                     AMYNGLESTLWRHGVWNAGYFGIIFQVRSLLPQAQSKSQQTGNDLIAGTIGGTIGSLM
                     STPFDVVKSRVQNTAVVAGQARKYNWSWPSIFTIYREEGFSALYKGFVPKVLRLGPGG
                     GILLVVFTGMMDFFRTVHYK"
     gene            <864837..>865595
                     /locus_tag="KLTH0D10494g"
                     /db_xref="GeneID:8295405"
     mRNA            <864837..>865595
                     /locus_tag="KLTH0D10494g"
                     /product="KLTH0D10494p"
                     /transcript_id="XM_002553120.1"
                     /db_xref="GeneID:8295405"
     CDS             864837..865595
                     /locus_tag="KLTH0D10494g"
                     /note="similar to uniprot|Q12015 Saccharomyces cerevisiae
                     YOR223W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10494p"
                     /protein_id="XP_002553166.1"
                     /db_xref="GeneID:8295405"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:C5DEX3"
                     /translation="MSGSELDGSPSQDRVVVVRFSDEQMEDLPLNVNNVSLSDVNTSW
                     LRRMCRQLRGRSLSNRKLRFIRSGRFLNASTDLQLQRYFESTNDKFYVHCIVGQELTP
                     QELANEDSVDETQQNTEGTTTQAIGFDRLRAVGFSDEEIELLRQRFRSTYGDLEELSR
                     DNGEGQDIRQLEEHWMETGANDENDQLGAVGIANYKHNKDLLIGLVVGCVLGVFSFLL
                     MKQEGLFNKRQKLAMVGGLLINMGFGAMLGFSRD"
     gene            complement(<865650..>866273)
                     /locus_tag="KLTH0D10516g"
                     /db_xref="GeneID:8295406"
     mRNA            complement(<865650..>866273)
                     /locus_tag="KLTH0D10516g"
                     /product="KLTH0D10516p"
                     /transcript_id="XM_002553121.1"
                     /db_xref="GeneID:8295406"
     CDS             complement(865650..866273)
                     /locus_tag="KLTH0D10516g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D10516p"
                     /protein_id="XP_002553167.1"
                     /db_xref="GeneID:8295406"
                     /db_xref="InterPro:IPR019560"
                     /db_xref="UniProtKB/TrEMBL:C5DEX4"
                     /translation="MSAPTKSPSSEYAETHLPDSTDSSVRYAAYASRLRTIALASHRY
                     VAYTSDIGESFRPVFSPLLVKLGYGVSWAYILGDVSYTAWVAKLQKEGRYREGLKPWD
                     PVPPVDPNMVEKGTLEKLPDWKMVGLERMIFQSVASMGLPAFTIHSTVKYSGKWFNKA
                     FPKNAALRTWGPIGLGLSVVPALPYIFDKPIERLLEQVFHPEHDKQE"
     gene            complement(<866502..>866936)
                     /locus_tag="KLTH0D10538g"
                     /db_xref="GeneID:8295407"
     mRNA            complement(<866502..>866936)
                     /locus_tag="KLTH0D10538g"
                     /product="KLTH0D10538p"
                     /transcript_id="XM_002553122.1"
                     /db_xref="GeneID:8295407"
     CDS             complement(866502..866936)
                     /locus_tag="KLTH0D10538g"
                     /note="highly similar to uniprot|P20436 Saccharomyces
                     cerevisiae YOR224C RPB8 RNA polymerase subunit ABC14.5,
                     common to RNA polymerases I, II, and III"
                     /codon_start=1
                     /product="KLTH0D10538p"
                     /protein_id="XP_002553168.1"
                     /db_xref="GeneID:8295407"
                     /db_xref="GOA:C5DEX5"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DEX5"
                     /translation="MSTTLFDDIFQVTEVDLGRYNKVSRIEAHSTSQEFLLTVDINTE
                     LFPVRVNDTLTVMLSSTLSIDGSETVQGGSWRAPQPGERSLADDYDYVMYGTAYRFEE
                     VAGKKDLIAVYYSFGGLLMRLEGNYRGLSNLKQENAYLLVRR"
     gene            complement(<867215..>867742)
                     /locus_tag="KLTH0D10560g"
                     /db_xref="GeneID:8295408"
     mRNA            complement(<867215..>867742)
                     /locus_tag="KLTH0D10560g"
                     /product="KLTH0D10560p"
                     /transcript_id="XM_002553123.1"
                     /db_xref="GeneID:8295408"
     CDS             complement(867215..867742)
                     /locus_tag="KLTH0D10560g"
                     /note="highly similar to uniprot|Q12056 Saccharomyces
                     cerevisiae YOR226C ISU2 Conserved protein of the
                     mitochondrial matrix required for synthesis of
                     mitochondrial and cytosolic iron-sulfur proteins"
                     /codon_start=1
                     /product="KLTH0D10560p"
                     /protein_id="XP_002553169.1"
                     /db_xref="GeneID:8295408"
                     /db_xref="GOA:C5DEX6"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:C5DEX6"
                     /translation="MFRTLLARNSLGASARSVLRAPVPVTGAAVPRFVGNPVAQPARR
                     AYHPKVIDHYTNPRNVGSLDKNLENVGTGLVGAPACGDVMKLQIQVNDDTGVIENVKF
                     KTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKA
                     AIKDYRSKRKSTVLK"
     gene            <869369..>872800
                     /locus_tag="KLTH0D10582g"
                     /db_xref="GeneID:8295409"
     mRNA            <869369..>872800
                     /locus_tag="KLTH0D10582g"
                     /product="KLTH0D10582p"
                     /transcript_id="XM_002553124.1"
                     /db_xref="GeneID:8295409"
     CDS             869369..872800
                     /locus_tag="KLTH0D10582g"
                     /note="similar to uniprot|Q12276 Saccharomyces cerevisiae
                     YOR227W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10582p"
                     /protein_id="XP_002553170.1"
                     /db_xref="GeneID:8295409"
                     /db_xref="UniProtKB/TrEMBL:C5DEX7"
                     /translation="MCRVGQVNSARNRSTIICVSPCTCYTPIIENWPNLLITNQCPFF
                     NVETPSLTSSKLLKYCKQRMSKSLDVDVDVDWLYKGKRKAKQARRERSNSVSNGSLSH
                     VAANQAPLQDAAPESPKPKPATSETKSPPSTPKRSSSVSDKSKKSLFGTLFRRNSHGS
                     GDRPSIPIPLPKSRSNSNASSHAPEKPSGHSNGTGAMNAAVSQYLNEPSSPEVKDPAP
                     IHEDRLVLNRNPHRKSLPIESLAKTRLRRVTFAVDKFGMDPPQQIPSRKPKRGNVLVP
                     QDLTCPTPSISVGITNTQGSIEQSASPLNEESKEYKLAVEEHRRALKESEKHQQEAHY
                     AAQRIAHEVLKFKAKPQSGPSVLPSTSSSLTATESHPSSATNTVIDDRARNLEIDKPI
                     HMHETHFQDETTDPNDEEDKLTLDKIYTRCCHLREILPIPSTLKQVKGKSSPLQTLKF
                     LNPRPTLIDILSFCDFISIVPVHNVIFDNVSLNPEMLKNVISSLVSSKVVEKIGFRNV
                     VFTSEGWKLLCKFLMRNNSLLKLDISQTKIKPDLDKSLYRAKMDWNLFIDVLQRREGR
                     PLEELLINGVKFEDFDTFVNLLTTFASERSQTRKRLGIAQSDLSAEQLKFVMSWVSDY
                     KIQGVDMAFNDLSDLVKPLVGKLSSLPFSHLNYFTLNNTNIMTAYDAALLLRALSKLP
                     NLYFLDLSNLPQIFPEVFPYLNKYLPRMTNLKRLHLDSNEFTSREVAMVTNVLPKCSE
                     LLHLSLLNIPQESFTTATCATVYDCVRQCSKLTNLDIAYNCIPEEISSRIAICFMRRM
                     QRDFELDDLTNQDDLLFDGTLLSETAENVFEKLNNFEDLETDATRRYLLKKYWEKFNR
                     VHDRVQSTIDEMFEKRSAGELNLQSKENLLRLLFLENNLSNILDVLKSYPQVADVAGI
                     ERNTRSANSENLLSGLSSEAENQSHVKPHLMATDSGRTIDVTTGTPILVKTPSHVALV
                     GKKQEEEEGEFHKWGFFVQQQNSIYPDHHLRNAAYESAEKRPGSAASSAESPKSSQPS
                     AASQATTHAIISKIPSGTELRDAVMRAKGINSIEELIGNVNRNRVTLDNIYGVPLHPM
                     SPALSDTAARTTPISQVLRSSSSVSEASSEDEDEEKVDETYDKLLNSLSKVRSNK"
     gene            complement(<873026..>873877)
                     /locus_tag="KLTH0D10604g"
                     /db_xref="GeneID:8295410"
     mRNA            complement(<873026..>873877)
                     /locus_tag="KLTH0D10604g"
                     /product="KLTH0D10604p"
                     /transcript_id="XM_002553125.1"
                     /db_xref="GeneID:8295410"
     CDS             complement(873026..873877)
                     /locus_tag="KLTH0D10604g"
                     /note="weakly similar to uniprot|Q12106 Saccharomyces
                     cerevisiae YOR228C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10604p"
                     /protein_id="XP_002553171.1"
                     /db_xref="GeneID:8295410"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:C5DEX8"
                     /translation="MGLKEVTPEPIRNLRPVEGIEKPSGILNFLNARFVRLSLRKIQK
                     HSIWPLMVYFPLHAVNTLVVPAISPESAPNDVLMMVRAILPGFTSALLKWSITAHVLS
                     GLALRIWGSFSRWKTHRRRGKSIPQDQKERESQRAIGLIGGLSGYCIGVSKQLAYNPQ
                     VVTGYILTPLLWYHGRIMKEVPLEQDFGAIDIDFPKWILQNDNAFIKWFGGILPLSVL
                     IWAASYHVVAGFCNFAKIRRMDVRKSLSTLILFLTTSGIISLWRLSKSSPVFQASSFP
                     QILRRVF"
     gene            <874019..>875023
                     /locus_tag="KLTH0D10626g"
                     /db_xref="GeneID:8295411"
     mRNA            <874019..>875023
                     /locus_tag="KLTH0D10626g"
                     /product="KLTH0D10626p"
                     /transcript_id="XM_002553126.1"
                     /db_xref="GeneID:8295411"
     CDS             874019..875023
                     /locus_tag="KLTH0D10626g"
                     /note="similar to uniprot|Q03012 Saccharomyces cerevisiae
                     YPL138C"
                     /codon_start=1
                     /product="KLTH0D10626p"
                     /protein_id="XP_002553172.1"
                     /db_xref="GeneID:8295411"
                     /db_xref="GOA:C5DEX9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DEX9"
                     /translation="MGVLPEWCPTYSSRKKDPVTGEEVFCICKKPDSGELMVGCDGCD
                     DWFHFSCLKIPQKFNELVFSFFCPYCQCGITGPGASSGNLPKTLWRRKCRLPECYKPC
                     AENSKYCSEDHAVSYMCNLIGRVESKGFDAQDVLRQMLQNSDLEKFQKMGHEGVPTPP
                     EGLAPGLFEGDARLRDLESQADKIRTLTRPEIEQQLKKLEAYVAWVKRVNHLLFTSAS
                     EDQDGGSSSKNSRALKRKKKSTKPKSICGYHPELRIVCSAEEFAPQYNESEIELYSVC
                     CKLRCPRHLDWAGIQETSLRFQLETLESSLERLALLQKIREDQLKMQVYKELSKSKQA
                     "
     gene            <875331..>876751
                     /locus_tag="KLTH0D10648g"
                     /db_xref="GeneID:8295412"
     mRNA            join(<875331..875337,875409..>876751)
                     /locus_tag="KLTH0D10648g"
                     /product="KLTH0D10648p"
                     /transcript_id="XM_002553127.1"
                     /db_xref="GeneID:8295412"
     CDS             join(875331..875337,875409..876751)
                     /locus_tag="KLTH0D10648g"
                     /note="weakly similar to uniprot|Q12206 YOR229W
                     Saccharomyces cerevisiae WTM2 WD repeat containing
                     transcriptional modulator 2"
                     /codon_start=1
                     /product="KLTH0D10648p"
                     /protein_id="XP_002553173.1"
                     /db_xref="GeneID:8295412"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DEY0"
                     /translation="MSEAKGNKIKNEEFKIWKKSVPSLYQHITTIKPSYTRLFEGAER
                     IPKVVAFTHKIVPDREKGTFTTSLLCSQGSDIYEVDFQLPLGLHSNSEALPDPQYSSA
                     FAEIVHSEKHEPKWTYQGNTIIKLEYVGGAEADAVAMTSTGSLAWFKDGCKVPVYVME
                     ELVGPATSFSRIHNQGSTNNWIAADFAVSENTETVVKSQQSMATGPGEEHSLLKIVDN
                     SQSPGNLIRTISIPGVSVTQSIKFHDNNMFSTCSDDNGIRFYDIRGDGKPLWTVFEPH
                     DGKLTCYDVSPTLETLFITGSDTGVLKLWDLRSVIACEIEQKEPTEIAKLYHSGADPV
                     ADVRFGISSPTEVLSVGDSGNVYHWNLEPIFLREGDEDDEMAESEELQQQCLEFMHTG
                     GGRRSLGQSRKRETVAWHPIVQGVVGCVDPDGLLTVYRGHYGATDKARAQDEREDNE"
     gene            <877472..>878806
                     /locus_tag="KLTH0D10670g"
                     /db_xref="GeneID:8295413"
     mRNA            <877472..>878806
                     /locus_tag="KLTH0D10670g"
                     /product="KLTH0D10670p"
                     /transcript_id="XM_002553128.1"
                     /db_xref="GeneID:8295413"
     CDS             877472..878806
                     /locus_tag="KLTH0D10670g"
                     /note="some similarities with uniprot|P32490 Saccharomyces
                     cerevisiae YOR231W MKK1 Mitogen-activated kinase kinase
                     involved in protein kinase C signaling pathway that
                     controls cell integrity upon activation by Bck1p
                     phosphorylates downstream target Slt2p functionally
                     redundant with Mkk2p"
                     /codon_start=1
                     /product="KLTH0D10670p"
                     /protein_id="XP_002553174.1"
                     /db_xref="GeneID:8295413"
                     /db_xref="GOA:C5DEY1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DEY1"
                     /translation="MASMFRPPDSARGNSRSPKLSLPPSLKYNSSEAPSQSGSGLTPA
                     INTPCSSSSSQTLVFPPPEKLSSSSSSSITTLKKRPVPPPIPSLVIPKSAGAGTPDRS
                     PFADSFEKLRIDNSEISGSASASPSAVSPAPPNPIADVHELGEETWQSGIVKDHVVTM
                     GILGEGAGGSVTKCRLKYGTKVFALKTITTVNSDAETQKQVLRELQFNRTCKSEYIVR
                     YYGMFADGSSSSIYIAMEYMGGKSLHAIYKHLLDRGGRISEKVLGKVAESVLKGLSYL
                     QERKIIHRDIKPQNILLNEVGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQP
                     YSVTSDVWSLGLTLLEVAQGQFPFGSDKMAANMPPIELLMLILTFTPELNDIPESNVT
                     WSKSFKSFIQYCLNKEPRERPSPRQMLRHPWIQGHMKKPCNMHKFITKCWEE"
     gene            <879032..>879748
                     /locus_tag="KLTH0D10692g"
                     /db_xref="GeneID:8295414"
     mRNA            <879032..>879748
                     /locus_tag="KLTH0D10692g"
                     /product="KLTH0D10692p"
                     /transcript_id="XM_002553129.1"
                     /db_xref="GeneID:8295414"
     CDS             879032..879748
                     /locus_tag="KLTH0D10692g"
                     /note="similar to uniprot|P38523 YOR232W Saccharomyces
                     cerevisiae MGE1 Protein of the mitochondrial matrix
                     involved in protein import into mitochondria"
                     /codon_start=1
                     /product="KLTH0D10692p"
                     /protein_id="XP_002553175.1"
                     /db_xref="GeneID:8295414"
                     /db_xref="GOA:C5DEY2"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:C5DEY2"
                     /translation="MRLLTSNIPKMVVRPTMGARLCTRMTARPATMTKFQTPTLGMRF
                     YSDAAKQSEAAENAEGAQEESPKGPASEEQKKVQELEEKLAVKDKEAAEYKDRLLRSV
                     ADFRNLQEVTKKDIQKAKDYALQKFAKDLLDSVDNFGHALNAFKPESTQQSTELSELY
                     TGVKMTKDIFEKTLKKHGIEKIDPMGETFDPNRHEATFELPNPEKQPGTVFHVQQVGF
                     TLNNRVIRPAKVGIVKDPAN"
     gene            <880389..>883007
                     /locus_tag="KLTH0D10714g"
                     /db_xref="GeneID:8295415"
     mRNA            <880389..>883007
                     /locus_tag="KLTH0D10714g"
                     /product="KLTH0D10714p"
                     /transcript_id="XM_002553130.1"
                     /db_xref="GeneID:8295415"
     CDS             880389..883007
                     /locus_tag="KLTH0D10714g"
                     /note="similar to uniprot|Q03002 Saccharomyces cerevisiae
                     YPL141C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10714p"
                     /protein_id="XP_002553176.1"
                     /db_xref="GeneID:8295415"
                     /db_xref="GOA:C5DEY3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DEY3"
                     /translation="MTSVPQRHTYYGAPTSSYTQSRQSASYSSQKRKHVTFGPYIVGS
                     TLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVKIYREINALKHL
                     NHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESAACRLFAQLISGVYY
                     MHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSPCYAAPELVV
                     TARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDY
                     IAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPHLPFLSVMPEEWDHVSKNQELLRQ
                     PPQKGEAVNSARPRSNCSVSSTNSKGEKRNSLIMDSSLYSQPVPPQQSQSHAVAMPSS
                     PSPRLRQSPVKSNNRHSRSNSAASIALQAVVDAEREYHATHPPFTSSASTSALQFEVS
                     PHSTSPRLYTFSPTKANQNTVTSLRDSVIIETSPQKGSGAFLIASSLKESPNGTGLPE
                     ASSVPTTSGFKAPLAVKAQVPHHGTHNLALHRRPRPTSYHPASCSTFGDTSQAPTSQP
                     AVSGEATTGHTQANIGKSTSQGIMHRDSFSMNKPFVDMQIVAGDLIKSGGDGDTVAKK
                     IHDQVEDADHRVDLSRQRRQSQRYSVVYDKLFGVAQQSEDNAVEDAGPGGSTVERGAS
                     GTSVKRDKKRFSIMSIYSPSRSSVDSGSPKNEDKHKRTGSENNPSGSSKRTPSRQESL
                     VNDQADTSRKSSAAKKPEPTKQASTLKEVKADASRKTSNPISKQESLGQSSVHGDGKA
                     EARAEPEANKKNPTVQRSASLKKAAKPTQTRKKVNRSSVMVSSVAAGSTENARPREQS
                     TAKRVIDFFKRRSMRL"
     gene            complement(<883254..>883954)
                     /locus_tag="KLTH0D10736g"
                     /db_xref="GeneID:8295416"
     mRNA            complement(join(<883254..883558,883936..>883954))
                     /locus_tag="KLTH0D10736g"
                     /product="60S ribosomal protein L33"
                     /transcript_id="XM_002553131.1"
                     /db_xref="GeneID:8295416"
     CDS             complement(join(883254..883558,883936..883954))
                     /locus_tag="KLTH0D10736g"
                     /note="highly similar to uniprot|P05744 Saccharomyces
                     cerevisiae YPL143W, RPL33A Ribosomal Protein of the Large
                     subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L33"
                     /protein_id="XP_002553177.1"
                     /db_xref="GeneID:8295416"
                     /db_xref="GOA:C5DEY4"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018266"
                     /db_xref="UniProtKB/TrEMBL:C5DEY4"
                     /translation="MAESHRLYVKGKHLSYQRSKKTNNPNVSLVKIEGVATPEDAKFY
                     LGKRVAYVYRASKEIRGSKIRVIWGKINRTHGNSGVVRATFRSNLPAKTFGASVRIFL
                     YPSNI"
     gene            884714..885123
                     /gene="SNR17"
                     /locus_tag="KLTH0D10758r"
                     /db_xref="GeneID:8295417"
     ncRNA           884714..885123
                     /ncRNA_class="snoRNA"
                     /gene="SNR17"
                     /locus_tag="KLTH0D10758r"
                     /product="U3 RNA"
                     /note="C/D snoRNA SNR17 (U3 RNA)"
                     /transcript_id="XR_002432192.1"
                     /db_xref="GeneID:8295417"
     gene            complement(<885342..>885728)
                     /locus_tag="KLTH0D10780g"
                     /db_xref="GeneID:8295749"
     mRNA            complement(<885342..>885728)
                     /locus_tag="KLTH0D10780g"
                     /product="KLTH0D10780p"
                     /transcript_id="XM_002553132.1"
                     /db_xref="GeneID:8295749"
     CDS             complement(885342..885728)
                     /locus_tag="KLTH0D10780g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D10780p"
                     /protein_id="XP_002553178.1"
                     /db_xref="GeneID:8295749"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:C5DEY5"
                     /translation="MVKTTQHTIENPLGSPFHVLVSAPEPEIDTPKSPISMVVSTGAN
                     PAAQSLMAYVYAIGTARDVYSTVLVDTVDDTVRETATRIAKLCAKKSSRPCYLGVAGD
                     GGAGTLALDQLLLCRECVKLVERAAQ"
     gene            <885955..>886668
                     /locus_tag="KLTH0D10802g"
                     /db_xref="GeneID:8295418"
     mRNA            <885955..>886668
                     /locus_tag="KLTH0D10802g"
                     /product="KLTH0D10802p"
                     /transcript_id="XM_002553133.1"
                     /db_xref="GeneID:8295418"
     CDS             885955..886668
                     /locus_tag="KLTH0D10802g"
                     /note="similar to uniprot|P07807 Saccharomyces cerevisiae
                     YOR236W DFR1 Dihydrofolate reductase part of the dTTP
                     biosynthetic pathway involved in folate metabolism
                     possibly required for mitochondrial function"
                     /codon_start=1
                     /product="KLTH0D10802p"
                     /protein_id="XP_002553179.1"
                     /db_xref="GeneID:8295418"
                     /db_xref="GOA:C5DEY6"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012259"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:C5DEY6"
                     /translation="MALNRPPIVTIVACLMPEMGIGYNGKLPWRLKQEMAYFRQVTSA
                     TFADGKRNAVIMGRKTWESIPPKFRPLPDRVNVVVSRQFAEDLAPAQSSAPGSKLSSH
                     AGAAAPASPALWLSNSLTRCLDLLPQRVPDLERIYVIGGAEIYAQSNSLCDYMLITKI
                     EPESATERPPMDAFLDTQSIHALFQHDQSLPSFLPPAVSLPADPYISENGYRYNFALY
                     RRRSEPKTDLKTKECAPQK"
     gene            <887004..>888257
                     /locus_tag="KLTH0D10824g"
                     /db_xref="GeneID:8295419"
     mRNA            <887004..>888257
                     /locus_tag="KLTH0D10824g"
                     /product="KLTH0D10824p"
                     /transcript_id="XM_002553134.1"
                     /db_xref="GeneID:8295419"
     CDS             887004..888257
                     /locus_tag="KLTH0D10824g"
                     /note="similar to uniprot|P35844 Saccharomyces cerevisiae
                     YPL145C KES1 Member of the oxysterol binding protein
                     family which includes seven yeast homologs involved in
                     negative regulation of Sec14p-dependent Golgi complex
                     secretory functions peripheral membrane protein that
                     localizes to the Golgi complex"
                     /codon_start=1
                     /product="KLTH0D10824p"
                     /protein_id="XP_002553180.1"
                     /db_xref="GeneID:8295419"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:C5DEY7"
                     /translation="MSGYAASSTWTSFLKSVASFNGDLSTLTAPPFILSPTSLSEYSQ
                     YWGEHPDLFLGPNFITEPDAEGTSAEQLRMLAVTKWFISTLKSQYCSRNESMGTEKKP
                     LNPFLGELFVGKWENKEHPDFGETVLLSEQVSHHPPVTAYTIINDKNKTSLQGYNQVK
                     ASISTASLSVKQFGHALLEYGKFNEQYLITLPPLHIEGMLVASPFVELEGKAYIQSSS
                     GLLCVVEFSGRGYFSGKKNSFKARIFQKPSDASDKEKALYTITGQWSGTSTISKGKSK
                     KGEELFYDASKLRVEHLHVKPIEEQHSLESRKAWKKVADAVKGGDFSQIHQEKSALEN
                     AQRDLRKQEEAEGTKWKRRWFVLEDYTAGINDKFTSLASNLKLSTKNVPSGTLVGDKE
                     DKKEHSAAHWRFKRELWDSEKEIKA"
     gene            <888656..>890002
                     /locus_tag="KLTH0D10846g"
                     /db_xref="GeneID:8295420"
     mRNA            <888656..>890002
                     /locus_tag="KLTH0D10846g"
                     /product="KLTH0D10846p"
                     /transcript_id="XM_002553135.1"
                     /db_xref="GeneID:8295420"
     CDS             888656..890002
                     /locus_tag="KLTH0D10846g"
                     /note="similar to uniprot|Q12080 Saccharomyces cerevisiae
                     YPL146C NOP53 Nucleolar protein involved in biogenesis of
                     the 60S subunit of the ribosome interacts with rRNA
                     processing factors Cbf5p and Nop2p null mutant is viable
                     but growth is severely impaired"
                     /codon_start=1
                     /product="KLTH0D10846p"
                     /protein_id="XP_002553181.1"
                     /db_xref="GeneID:8295420"
                     /db_xref="InterPro:IPR011211"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:C5DEY8"
                     /translation="MAAEKERPSQYRQSSRKGKKAWRKNIDISDIEKSIRQQQDEEIT
                     HGAKDLSSLRNEDLFQVDTVGDEVWKQKLIKRKQIKKNLKSSEILDSIKTNSKVAPLK
                     HPKSQAAQDDEKKKIQGVSKKELRKLMALAGRIEGESKLKNAVSKKGLVRAGTNDLWG
                     AEEEVKVPSGIKLATKDSTAIPEELKKLSTTGWSIATVAPDTLKRAPMKVKDVEEIPH
                     AGKSYNPSSKEWTELVNSEYQSEKAREEARLQMQAYRERIKHLMETLDNNEEEDSEDD
                     EDEADENQEPQENAEASSEIKLSLNKPSANKKKTKYQRNKQRRHQEKLSLQKELKQLK
                     GQLRELERFEEIEKDVLEKQAAREAEKQTRVGKEKPNKKHKLGTKHSVIEGNLELKFS
                     DELSDSLRKLRPEGNLLYDAAKKLQSSGKIETRIPVKKGRRYAPRITEKWTYKDLK"
     gene            <890134..>891021
                     /locus_tag="KLTH0D10868g"
                     /db_xref="GeneID:8295421"
     mRNA            <890134..>891021
                     /locus_tag="KLTH0D10868g"
                     /product="KLTH0D10868p"
                     /transcript_id="XM_002553136.1"
                     /db_xref="GeneID:8295421"
     CDS             890134..891021
                     /locus_tag="KLTH0D10868g"
                     /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
                     YOR238W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D10868p"
                     /protein_id="XP_002553182.1"
                     /db_xref="GeneID:8295421"
                     /db_xref="UniProtKB/TrEMBL:C5DEY9"
                     /translation="MNKTNLIIVPCHSIWKIDDRLDSENYGQYPEHWFLAPFQYEGHD
                     HLAFIMHSLLAVEKLLDDVSGSLLLFSGSCTKADAGQVSEAQSYLSLTRKLLTAVIYE
                     VELPVSLLNSTDVHKACAHIAERIKAQGLTVTGLFTEHISTEEFALDSFDNLLYSLTR
                     FHELTSNYASSVTIAGFGFKTKRFLQCHACAIDYPLSKIEYLSYEPQPQYSETEKIEA
                     YFNDLNYQESKNALELFKIDWYGTKEPLLSKKIKRNPFTLSPNYRLPFELEKPILDDN
                     AFFETMIQGKMPWSNSSQI"
     gene            complement(<891012..>893504)
                     /locus_tag="KLTH0D10890g"
                     /db_xref="GeneID:8295422"
     mRNA            complement(<891012..>893504)
                     /locus_tag="KLTH0D10890g"
                     /product="KLTH0D10890p"
                     /transcript_id="XM_002553137.1"
                     /db_xref="GeneID:8295422"
     CDS             complement(891012..893504)
                     /locus_tag="KLTH0D10890g"
                     /note="similar to uniprot|P41909 Saccharomyces cerevisiae
                     YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
                     peroxisomal ATP-binding cassette transporter necessary for
                     transport of long-chain fatty acids into peroxisomes ABC
                     family long-chain fatty acid transporter"
                     /codon_start=1
                     /product="KLTH0D10890p"
                     /protein_id="XP_002553183.1"
                     /db_xref="GeneID:8295422"
                     /db_xref="GOA:C5DEZ0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ0"
                     /translation="MAETTITAQRLKELLVRLPHECIGIDLRGVARGKYAKVILKHLW
                     WLVRNPDTSLNHRKRAQIIFITLAFSAASAASGVGYAIYTLISRLRARTFGRTPVMRR
                     TRSQVMLENGARVMYVPYEENATNKKRILISPKSDDMYEHDKFLFKYFGKNKISQVFY
                     SKFISQLNIISRILVPKVTDQNSILLIFQIFFLVMRTWLSLFVARLDGQIVKDIISGN
                     SRKFLVDLLCWFLIAFPASYTNSAIKYLQRKLSLNFRINLTRYIHDMYLDKRLAFYKL
                     TFDNQASSSVIANIDNSITNDVTKFCDAICSVFANIAKPVIDLVFFSVYLRDNLGTVG
                     IVGIFVNYFITGYTLKRWTPPLGRLVSQRSTAEGDYYNYHLNLINNNEEIAFYHGTKV
                     ERTKVNALYDHLMDQMLLVDRVKVNYNILEDYVLKYTWSALGYAFASIPIVIATFSSG
                     VNNEDVNMREFIVNKRLMLSLADAGGRLMHSIKDIAQLTGYTNRIFILLSVLHRVHSN
                     VYNYGATVEEGEDSSGHNSLTSSDIVRGTLQRNFNGIRLENIDVVIPSKYGKDGTRLI
                     NKLSFQVPPVITLGNGNSDSNLNINKKLAFQGPGSSMLILGPNGSGKTSIQRIIAEIW
                     PIYNKNGLLSIPPASDLFCVPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHI
                     LGEVKLDYLLKRDKGWRYLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNA
                     ISADMEDYLFGLLKRYRFNFITISQRPSLIKYHDLALDISTDGTWRLQNLGTDEVITS
                     IEKEIEMLENKLKNVNVWEGERAALMRKLAHI"
     gene            <894176..>895039
                     /locus_tag="KLTH0D10912g"
                     /db_xref="GeneID:8295423"
     mRNA            <894176..>895039
                     /locus_tag="KLTH0D10912g"
                     /product="KLTH0D10912p"
                     /transcript_id="XM_002553138.1"
                     /db_xref="GeneID:8295423"
     CDS             894176..895039
                     /locus_tag="KLTH0D10912g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D10912p"
                     /protein_id="XP_002553184.1"
                     /db_xref="GeneID:8295423"
                     /db_xref="InterPro:IPR013744"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ1"
                     /translation="MSFSGVLHKYASRRVAFEFNSTPSKKVVVFIGGLGDGLLTVPYV
                     PKLAQELGSLGWSVIQIQFTSSFKGWGLTSLDQDVSEIKELVDYLKSTEGGSRERIVL
                     FGHSTGSQDTMHYLLKFGDTIDAGVLQASVSDREFFGQAVDKETWNRLNSKAKELVDK
                     GQKDEILPLEYAKVMSETPVTAYRWCSLALPGGDDDYFSSDIPDETLKTTFGRVKKPF
                     LVAYSEQDQIVPAYVDKKKLLDRWQACSNTDFWSKNSGLVNGANHQIEQVQSQDQLLS
                     MVREFLTEFQL"
     gene            <895142..>895927
                     /locus_tag="KLTH0D10934g"
                     /db_xref="GeneID:8295424"
     mRNA            <895142..>895927
                     /locus_tag="KLTH0D10934g"
                     /product="KLTH0D10934p"
                     /transcript_id="XM_002553139.1"
                     /db_xref="GeneID:8295424"
     CDS             895142..895927
                     /locus_tag="KLTH0D10934g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D10934p"
                     /protein_id="XP_002553185.1"
                     /db_xref="GeneID:8295424"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ2"
                     /translation="MTSISINFSGLGYLRSNSKGVDARGPLSRSTIRRNSHNTMARTL
                     RNGPAFSDPSVTVEPIQFKLFNSGDVATAFPVFSAEDLPDSLVDYMHQEFNKNVDAGQ
                     TYPHMQLMNREEFIDYWLHSFCAVALKTDKLVIGPEWNDWEDRFLGTFFVKPNYLPRC
                     SHNCNGGFLVNSLQRGQGIGYRLGQVYLSWAPLLGYTYSVFNLVFVTNVGSWKIWDKL
                     AFDRIGYLPKAAILKGFEQPVDAIMFGKDLTNVEPRLLADLHV"
     gene            <896070..>896660
                     /locus_tag="KLTH0D10956g"
                     /db_xref="GeneID:8295425"
     mRNA            <896070..>896660
                     /locus_tag="KLTH0D10956g"
                     /product="KLTH0D10956p"
                     /transcript_id="XM_002553140.1"
                     /db_xref="GeneID:8295425"
     CDS             896070..896660
                     /locus_tag="KLTH0D10956g"
                     /note="similar to uniprot|Q12036 Saccharomyces cerevisiae
                     YPL148C PPT2 Phosphopantetheine:protein transferase
                     (PPTase) activates mitochondrial acyl carrier protein
                     (Acp1p) by phosphopantetheinylation"
                     /codon_start=1
                     /product="KLTH0D10956p"
                     /protein_id="XP_002553186.1"
                     /db_xref="GeneID:8295425"
                     /db_xref="GOA:C5DEZ3"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ3"
                     /translation="MPMKRISSRLLNKRMLLLPATLAIPPHAAMLGIGTDIVYLPRFA
                     KIVEKHAPVGQSTTFRKIATKFMHPEEVRHLYQMLQLGYNSPSVVRYLAGVWATKEAI
                     FKSLAAQRLEIPLLPAQKIYTQVFYKTNEQDGAPRVEFDSSIERLHPEFARAYIANTR
                     FVLSIAHDEDYLVSFVCHIRGQAAENVVQKTPRPFS"
     gene            complement(<898726..>899616)
                     /locus_tag="KLTH0D11000g"
                     /db_xref="GeneID:8295427"
     mRNA            complement(<898726..>899616)
                     /locus_tag="KLTH0D11000g"
                     /product="KLTH0D11000p"
                     /transcript_id="XM_002553141.1"
                     /db_xref="GeneID:8295427"
     CDS             complement(898726..899616)
                     /locus_tag="KLTH0D11000g"
                     /note="similar to uniprot|Q12380 Saccharomyces cerevisiae
                     YPL149W ATG5 Conserved autophagy-related protein that
                     undergoes conjugation with Atg12p and then associates with
                     Atg16p to form a cytosolic complex essential for
                     autophagosome formation"
                     /codon_start=1
                     /product="KLTH0D11000p"
                     /protein_id="XP_002553187.1"
                     /db_xref="GeneID:8295427"
                     /db_xref="GOA:C5DEZ4"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ4"
                     /translation="MDNVRRRAWAGSLNLRVTVHPDLTLNSSNEPEHIISFRVPREIY
                     LVLYFPYILERVAPELRTNVTDFYNGWWLEMEGVPLSWNFPAGVLFDSLTGLDPALRS
                     SRHRHNSLNVWELTLRHEDQCPTNVIPIVRGRDQVREFWMHQWKQACFILNGASKQVM
                     SLSKPDTMKFWDSILRRDQNSFDTIKEKILPTFDNTRYVPLRVHLALPQIRFLEPQAK
                     VQHNNGHIRLGDVLSSEFPEWFPNDSSTPNLAKAVIQGIEVPLQLSVWYLYQELSSFD
                     GFLHVSLCLMTEDASLTSRS"
     gene            <899665..>901266
                     /locus_tag="KLTH0D11022g"
                     /db_xref="GeneID:8295428"
     mRNA            <899665..>901266
                     /locus_tag="KLTH0D11022g"
                     /product="KLTH0D11022p"
                     /transcript_id="XM_002553142.1"
                     /db_xref="GeneID:8295428"
     CDS             899665..901266
                     /locus_tag="KLTH0D11022g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D11022p"
                     /protein_id="XP_002553188.1"
                     /db_xref="GeneID:8295428"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ5"
                     /translation="MIFFKLISSPYQLINKAEKMHESESEHLGKAALLWSDLSETHDG
                     LDETPEETYIYFGIFHLDIIHGQSAEHLNRALKQFQDLIRPWNEFYPWTNYNGVKTEV
                     VEDSASAPYILGSLCITDNLEEESLVVSLLQRFSSLQGPEIFVKVTGSDGEVLLIESH
                     DVLPSEYEYPKGNNRLWIHEGKFKLIPSNVTPGRGMERSEALNFLLNTYYKLIEVPEV
                     SSILHQRFVLDTPEKYLRNLYQLPLELNNKQHFELLKKKPRLIGYIIKCLYQENLSHE
                     PEKIIEECENQPLTLLLPVSQCKLLSFYLQYSGIDLQSERLPSITGAIISRALEQVIR
                     YDKHFQRENFTSCSEALDSFQVQLVSQGYLKKEVPHQKANMGALLIEAEAEVAEEDTM
                     ERMQSLFTGIKSSLEEEDNNKQANESSDDSDTAADHEAQKFFSAQNIDIDEDDFFEFF
                     LTEALKVKKEDLKNYQSGSAPPSERYHEKEDEAEAVNEFEGHLSTDSRGHSNDTEALE
                     ELIEAMRLDPSAFENIQNILDLDSE"
     gene            complement(<901388..>903937)
                     /locus_tag="KLTH0D11044g"
                     /db_xref="GeneID:8295429"
     mRNA            complement(<901388..>903937)
                     /locus_tag="KLTH0D11044g"
                     /product="KLTH0D11044p"
                     /transcript_id="XM_002553143.1"
                     /db_xref="GeneID:8295429"
     CDS             complement(901388..903937)
                     /locus_tag="KLTH0D11044g"
                     /note="similar to uniprot|Q12152 Saccharomyces cerevisiae
                     YPL150W"
                     /codon_start=1
                     /product="KLTH0D11044p"
                     /protein_id="XP_002553189.1"
                     /db_xref="GeneID:8295429"
                     /db_xref="GOA:C5DEZ6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ6"
                     /translation="MFPSRLEQNQLKANISASYNKLYGQFSLTELRDVGNYRILKIVG
                     EGSFGKVYLASHRLTHQKVVLKMGSKNDPNVVREVFYHRQFDYVYITKLYEVIVTENS
                     VWMALEYCPGKELYEYLLIKKRIPLDECSHLFSQIVGAVFYAHSMKCVHRDLKLENIL
                     LDKKGQAKLTDFGFTRECATKGILETVCGTTVYMAPELIERKPYEGYKIDTWSLGIIL
                     YTMIHGAMPFDEEDDIKTKYRIVNNEPFYDDNFIDANGKDLIMQLLQKDPSQRPSLTQ
                     VLQHPFMFPHGSSILEKTDKTIKRQSQGCKHFHSKLERRLLKKLKQSGFDTQAIKQSV
                     NKKKCDALAGTWQLLLEKEKRSEILRHPKRSRSVLSVKKVFEPSLPSRKGSEDLKNPE
                     QGGKAASLKRIMSRKSDTVSIRQPINATQLKMSPQQSPAEQTEGSGNTRSNKKHNFFN
                     KMTNFFKTKKQNGIHYQNGSPSLSSKNADKRKRNTNSFESNKNSPHRSPTRNGNGLMP
                     GIDVEKKPHEKLKIEEPMLKKFKSNTSSEGSRQTSMGNYDSELDHRPANNEHEVPEGN
                     KLLEQRGRPMSILSQQSEMSNDTYNSEYSTDGNISNSKANSSISSNNRNISSVILSPT
                     GDLTDNQTTQSRVTTRRSMSIMSSASSASERSSRTDSFYDISTASSPKTMDLRAMGNY
                     SNADTMVPRMTVGSQWLSKRGRSPVGRRGRPPKRNISRKLMNHSSSAAQSVIQEESSF
                     DNEDDNSGALIEETEGQGIPDAPLLHDLETPSSISGTPSKPSTPICAEIQPTDTRPVL
                     FAMGRSFSGGSRWSRNLSEERILTSDFPSLQNAGVHSDIGSADDEDNSLDD"
     gene            <904878..>906359
                     /locus_tag="KLTH0D11066g"
                     /db_xref="GeneID:8295430"
     mRNA            <904878..>906359
                     /locus_tag="KLTH0D11066g"
                     /product="KLTH0D11066p"
                     /transcript_id="XM_002553144.1"
                     /db_xref="GeneID:8295430"
     CDS             904878..906359
                     /locus_tag="KLTH0D11066g"
                     /note="similar to uniprot|Q08645 Saccharomyces cerevisiae
                     YOR241W MET7 Folylpolyglutamate synthetase catalyzes
                     extension of the glutamate chains of the folate coenzymes
                     required for methionine synthesis and for maintenance of
                     mitochondrial DNA present in both the cytoplasm and
                     mitochondria"
                     /codon_start=1
                     /product="KLTH0D11066p"
                     /protein_id="XP_002553190.1"
                     /db_xref="GeneID:8295430"
                     /db_xref="GOA:C5DEZ7"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ7"
                     /translation="MRLSVPLRMSTRPARSYSDAIAALNSLQSNYANIMAIRASGDRK
                     NKMNIWEMQEWSRRIGYSTSDFNKLNIVHITGTKGKGSTAAFTQSVLQQYGDQIRKIG
                     LYTSPHLKSVRERIRINGQPICEEKFSSYFFDVWDKLEATSSPLDNFPHMTPGSKPGY
                     FKYLTLLSFHVFMQEGCDSCIYEVGVGGEFDSTNIIESPTACGVSLLGIDHTFMLGET
                     IEEIAWNKGGIFKKGSPAFTIAAQPTKGLEVLKERAQERETSLTEVPIFDSLKKIKLG
                     IAGDFQISNASLAVALASQHLVRLGVLDQNLQLAPDTELPQRFVDGLTSAKWNGRCQT
                     VQDGAITWLIDGAHTKDSIEAASGWFKSEVIKTPRKKVLLFNQQTRDAEALITNLHKC
                     LLPEVAFDRVIFTTNVTWKSGSYSADLVSMNTSKEQVENLEVQNALRDTWLRLEPHAK
                     VDVVANIESAIELVKAYNEPVEVVVTGSLHLVGGLLVALDGKD"
     gene            complement(<906439..>907707)
                     /locus_tag="KLTH0D11088g"
                     /db_xref="GeneID:8295431"
     mRNA            complement(<906439..>907707)
                     /locus_tag="KLTH0D11088g"
                     /product="KLTH0D11088p"
                     /transcript_id="XM_002553145.1"
                     /db_xref="GeneID:8295431"
     CDS             complement(906439..907707)
                     /locus_tag="KLTH0D11088g"
                     /note="some similarities with uniprot|Q96US5 Saccharomyces
                     cerevisiae YOR242C SSP2 Sporulation SPecific involved in
                     sporulation"
                     /codon_start=1
                     /product="KLTH0D11088p"
                     /protein_id="XP_002553191.1"
                     /db_xref="GeneID:8295431"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ8"
                     /translation="MAPRESLPDCWTTKIQGADIDNGSMRVRPSRLVSVSSMLGSGVG
                     ASSRSSSRWKQEAHDLFGLKRLARAYFRGEEHYTKEDVPDYGVMRFPPKGTRLRKNQT
                     SSATLIKPNCHAPQTTDGSMKPLLPQKKHCYSVSMGSLIEGRDVNVKPLKTPVAVESG
                     ENVSQFGDIKGLKKSTLNSSALLNKHHVNAAFLQNSHQDSENGEERVVEILELPQDVG
                     IQSLLSQVYGGPLEKVNVSKDQRGAPARGARLHFLFNEDAKSFISYGLSNNFRINGHI
                     VKPQWAPKSTCSLSNMNFDEVKDMVSANACAGRQEGTRARRCIVVKKTGCTKSPRSRQ
                     LHSNRQNLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALESFGE
                     PDSFMHKKYNRDWTMAYGRDTTDRACYHMF"
     gene            complement(<907970..>910036)
                     /locus_tag="KLTH0D11110g"
                     /db_xref="GeneID:8295432"
     mRNA            complement(<907970..>910036)
                     /locus_tag="KLTH0D11110g"
                     /product="KLTH0D11110p"
                     /transcript_id="XM_002553146.1"
                     /db_xref="GeneID:8295432"
     CDS             complement(907970..910036)
                     /locus_tag="KLTH0D11110g"
                     /note="similar to uniprot|Q08647 Saccharomyces cerevisiae
                     YOR243C PUS7 pseudouridylates U2 snRNA at position 35"
                     /codon_start=1
                     /product="KLTH0D11110p"
                     /protein_id="XP_002553192.1"
                     /db_xref="GeneID:8295432"
                     /db_xref="GOA:C5DEZ9"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR017091"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DEZ9"
                     /translation="MSEIEDKKRGNEAIAADAGPESTLDSHLDKKPKVMGPEGISETD
                     VGITKFLTDNVPGFLGQIKQRYTDFMVNEIDKQGNVVYLTDKGFKMPKAPKKSKEEET
                     EEELAEAERRKQFKVDEDLRAQLVELLGEEDVEKIEDSYKNVTKMETSRKFDGKAERT
                     KIHQLLRAAFNNQLESVTSPENTFLIALANRRSRVNKKDLVERNKDANGVENWGYGPS
                     KSFIHFTMYKENKDTMDVANVLSKFLKTPTRLIRFAGTKDRRAITCQRMSISKINIDR
                     LNALNRALKGVVLGGFKFEDESLSLGDLRGNEFTIAIRDVKVPEVSTVSLEQILADGC
                     AFIKENGFINYFGMQRFGTFSVSTHEVGKCLLLEQWEKAANLILAEQENVLPISKEAR
                     KIWSETKDPAAALKRMPRQCVAENAILHSLADQARNGDSAGNYLHCINKIPRNLRTMY
                     GHAYQSYVWNTVTSKRIELYGLKVVAGDLVIDESAQQGSKAGNASGDADADEEDDFAE
                     DLREAQFVRARPVTQEEVDAGKFSIEDVVLPSPGFDVVYPANESLRQIYVDVMNKDGL
                     DPFNMRRKIRDFSLAGSYRNIIHKPQDLSFKILHYSSPTQQLINTDLEILNNKKGKEN
                     GQKYMKDKLSRFPEDKGGESTAVILSFKLGVSAYATMLLRELMKLETSRRGDMCDVKT
                     HSEQAN"
     gene            <910259..>911572
                     /locus_tag="KLTH0D11132g"
                     /db_xref="GeneID:8295433"
     mRNA            <910259..>911572
                     /locus_tag="KLTH0D11132g"
                     /product="KLTH0D11132p"
                     /transcript_id="XM_002553147.1"
                     /db_xref="GeneID:8295433"
     CDS             910259..911572
                     /locus_tag="KLTH0D11132g"
                     /note="similar to uniprot|Q12417 Saccharomyces cerevisiae
                     YPL151C PRP46 Splicing factor that is found in the Cef1p
                     subcomplex of the spliceosome"
                     /codon_start=1
                     /product="KLTH0D11132p"
                     /protein_id="XP_002553193.1"
                     /db_xref="GeneID:8295433"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DF00"
                     /translation="MSIDRIHGPEHAREVYLKHLWEKRFKNLAQVSPDLQKKIEDRKN
                     VLERYEEFRSASSAPSEPSTGALVHYEKPLPDTAQTASLVRKVYREDDSFNLLMERQS
                     RQLALEPSWHAPWKLMRVINGHNGWVRCVCVDPVDNEWFATGSNDTTIKVWDLASGKL
                     KLTLAGHVMTVRSIAISQRHPLMFSASEDKLVKCWDLEKNTVVRDYHGHFSGVHTVDV
                     HPTLDLIASAGRDAVVRLWDIRTRVPVMTLAGHKGPINQVKCFPVDPQIMSGSADSTV
                     RLWDIRAGKAMKILTHHSKSVRAIAGNPSESSVATASTSDIRSWRLQDGQLLTNFRSE
                     DTGIINCLSVNPDGVLFAGGDDGHLSFYDYKTGHKFQDLPTIKVPGSLESERGILSAS
                     FDQTGLRLITGESDKSIKVWKQIPGATQETHPNLPWNPRLESQRF"
     gene            <911708..>913045
                     /locus_tag="KLTH0D11154g"
                     /db_xref="GeneID:8295434"
     mRNA            <911708..>913045
                     /locus_tag="KLTH0D11154g"
                     /product="KLTH0D11154p"
                     /transcript_id="XM_002553148.1"
                     /db_xref="GeneID:8295434"
     CDS             911708..913045
                     /locus_tag="KLTH0D11154g"
                     /note="highly similar to uniprot|Q08649 Saccharomyces
                     cerevisiae YOR244W ESA1 Histone acetyltransferase
                     catalytic subunit of the native multisubunit complex
                     (NuA4) that acetylates four conserved internal lysines of
                     histone H4 N-terminal tail required for cell cycle
                     progression"
                     /codon_start=1
                     /product="KLTH0D11154p"
                     /protein_id="XP_002553194.1"
                     /db_xref="GeneID:8295434"
                     /db_xref="GOA:C5DF01"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="UniProtKB/TrEMBL:C5DF01"
                     /translation="MSHDEEKKPVVPKEISDIGELNIGCKCWVDKDGEERLAEILSIN
                     KRKSPPKFYVHYEDFNKRLDEWVLTPRINLGREVFFPQDEKDAKEAEKDKSSSKKQKQ
                     KKNTPASRSSSHSDAVDGEDVMDLDNLNVQGIKDEDISRDDEIKKLRTSGSMVQNSHE
                     VARVRNLNKIIMGKYEIEPWYFSPYPIELTDEDVVYIDAFTLQYFGSKKQYERYRSKC
                     TLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLSLLSKLFLDHKTLYYDVDPFLFYCM
                     TRRDELGHHLVGYFSKEKESAEGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGKA
                     GSPEKPLSDLGLLSYRAYWADTLIKLLMNHGTEITIDEISSMTSMTTTDILHTLKALN
                     ILQYYKGQHIIYMNEDVVQRYEKIKQKKGRNIDPAKLIWKPPVFTASQLRFAW"
     gene            complement(<913077..>914138)
                     /locus_tag="KLTH0D11176g"
                     /db_xref="GeneID:8295435"
     mRNA            complement(<913077..>914138)
                     /locus_tag="KLTH0D11176g"
                     /product="KLTH0D11176p"
                     /transcript_id="XM_002553149.1"
                     /db_xref="GeneID:8295435"
     CDS             complement(913077..914138)
                     /locus_tag="KLTH0D11176g"
                     /note="similar to uniprot|Q12461 Saccharomyces cerevisiae
                     YPL152W RRD2 Resistant to Rapamycin"
                     /codon_start=1
                     /product="KLTH0D11176p"
                     /protein_id="XP_002553195.1"
                     /db_xref="GeneID:8295435"
                     /db_xref="GOA:C5DF02"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:C5DF02"
                     /translation="MKPQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEY
                     QKPTGSSIESCCQLLEEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQR
                     AFDALDGTQCEELSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRN
                     MVLKLFIKYLGVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKS
                     IHNSEVVEMFGKRYLYFGCIDFINKVKTTASLRWHSPMLDDISGVKTWAKVAEGMIKM
                     YKAEVLNKLPIMQHFFFGSFLQCPEGISPPGTHAESHQHCSHSPLENTWGDCCGIRVP
                     SAVAATESQKAGPKRIPFD"
     gene            complement(<914281..>915780)
                     /locus_tag="KLTH0D11198g"
                     /db_xref="GeneID:8295436"
     mRNA            complement(<914281..>915780)
                     /locus_tag="KLTH0D11198g"
                     /product="KLTH0D11198p"
                     /transcript_id="XM_002553150.1"
                     /db_xref="GeneID:8295436"
     CDS             complement(914281..915780)
                     /locus_tag="KLTH0D11198g"
                     /note="similar to uniprot|Q08650 Saccharomyces cerevisiae
                     YOR245C DGA1 Diacylglycerol acyltransferase catalyzes the
                     terminal step of triacylglycerol (TAG) formation acylates
                     diacylglycerol using acyl-CoA as an acyl donor localized
                     to lipid particles"
                     /codon_start=1
                     /product="KLTH0D11198p"
                     /protein_id="XP_002553196.1"
                     /db_xref="GeneID:8295436"
                     /db_xref="GOA:C5DF03"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:C5DF03"
                     /translation="MCKTLNRTKQLAERLLRGHLSWAEVDNTADGLKRSDGRTATMDN
                     SKGLKQRGREGGRENGGEHGAEHRDENAASERSSKASGFLHHELDHVRLYDRNHQEGK
                     KLSEFVEEINHFQEPRPKLAFCSVKTPWRRRLQTLAVAWHVASFVYILAFAILALANP
                     IMWIIMFPYMAYYAFDRSPANGNVTKRYSKWMRGLTFWRYYCDYFPIQLHKTADLKPT
                     FTHKKHSSGCPSEDKYLVSFQLRLWPLRYSLKVNILKLGGAPPREVTGPRYIFGYHPH
                     GVAALGAFGAFATEGANWSKLFPGIPMCLMTLVNQFQIPFYRDYLLSLGVTTVSKKNA
                     LKVLERNHSICIVVGGAQEALMSKLGSADLVLKRRKGFIKLALETGNVCLVPCFAFGE
                     TDCYNILETDEKSYLHKFQLWFKKTYGFTIPLFFARGLFNYDFGLIPFRKPINVVTGN
                     PIYIKRKHDNPTVEEIDHYQKLYIDELQRTFDDYKRQFGYKDLELNLAE"
     gene            <916020..>918002
                     /locus_tag="KLTH0D11220g"
                     /db_xref="GeneID:8295437"
     mRNA            <916020..>918002
                     /locus_tag="KLTH0D11220g"
                     /product="KLTH0D11220p"
                     /transcript_id="XM_002553151.1"
                     /db_xref="GeneID:8295437"
     CDS             916020..918002
                     /locus_tag="KLTH0D11220g"
                     /note="weakly similar to uniprot|P36044 Saccharomyces
                     cerevisiae YKL201C MNN4 Putative positive regulator of
                     mannosylphosphate transferase (Mnn6p), involved in
                     mannosylphosphorylation of N-linked oligosaccharides;
                     expression increases in late-logarithmic and stationary
                     growth phases"
                     /codon_start=1
                     /product="KLTH0D11220p"
                     /protein_id="XP_002553197.1"
                     /db_xref="GeneID:8295437"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:C5DF04"
                     /translation="MKLTRRPQRPIKALKRAPYYLASIALLYIVFGIAIKHGSNEPRA
                     PSAQESSSFSKKDYYENFLQRLPVSRMGQDSISQINFETRAGSRRFTQKDELGKTLVP
                     ARSGHEVEPGREVLLPVASSFRQWERSLSTEERWSHSLAATMAFVSKLVRMGFKHPVV
                     PFSWRDWHDTSEITKTKVSGLSSEYFEVAESEAIKAARGARFLYLDGVAINKMVVLYN
                     ESCIELNARNLDSRKSAIFDPESGMLSDIRELESQRGPAFFNMSSVKQDISLNSQDHQ
                     SASREPLPSNHEDSAKLHPTKPISLPKIETRRNFKYHGKEEGVIELIEEDFDLDLSNR
                     IEEMSQISICDEYNGKNITVAESAFLQHLAFRHTEMLRETSRSLNEKHQTKFFNEVKL
                     DSKDREIWGQGCHHDWRFFRSITPQQQRLQVLHRMTRAWQSFASHQKIIYWLAHGNLL
                     SWFWQGTNFEWDYDIDIQVPMRHMEFLSANFNNSIIISDDEGYVGRYYLEVNPLYADK
                     NRGSGMNVIDARFIDVDTGLYIDLTSISNVVDSAGSHFGDKNYHSYQSFSYLNPLRET
                     MYEGSKTYIPAAVQNILSDEYPSGLSKMEYKDYVYNKTISGWISNSKNPNMIPEPLKI
                     MWKRHQLEIAALCPLEGFKDTKSCKDRTTSESGKKN"
     gene            <918232..>920619
                     /locus_tag="KLTH0D11242g"
                     /db_xref="GeneID:8295438"
     mRNA            <918232..>920619
                     /locus_tag="KLTH0D11242g"
                     /product="KLTH0D11242p"
                     /transcript_id="XM_002553152.1"
                     /db_xref="GeneID:8295438"
     CDS             918232..920619
                     /locus_tag="KLTH0D11242g"
                     /note="similar to uniprot|P22216 Saccharomyces cerevisiae
                     YPL153C RAD53 Protein kinase required for cell-cycle
                     arrest in response to DNA damage activated by trans
                     autophosphorylation when interacting with
                     hyperphosphorylated Rad9p"
                     /codon_start=1
                     /product="KLTH0D11242p"
                     /protein_id="XP_002553198.1"
                     /db_xref="GeneID:8295438"
                     /db_xref="GOA:C5DF05"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DF05"
                     /translation="MDYVTQPTQQATQATQKYIIEKFSQEQIDDDIVCRMICTTGQIP
                     IRDLRAELRDVVGKKESIKKLWTFGRNPQCDYHLGNTSRFSNRHFQIMLGEDGNLLLR
                     DTSTNGTWLNGERLVKERNQILSQGDEITVGWGVSQDVLSLVVFINDKFKQRLEAAKA
                     HGSKSAKSRSSRGASSSAQLTGILRDYSIKDEVVGQGAFATVKKAIERRTGKTHAVKI
                     INKRKVMGNMDGVTRELEVLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVA
                     AHGSVGEDAGREITRQVLEAVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAK
                     IQDNGTFMKTFCGTLAYVAPEVISGKNSEEKEGNKYSSLVDMWSIGCLVYVILTGHLP
                     FSGSTQQELYKQISAGSYHEGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPW
                     IRTADSQSFIDSQVSLSQSMSQQKASDNVSDAQQQFINMRATKPKDEQPQSSPQEPQT
                     QQPVFKIPGHRPVRYTQSCVPENSQPSSLKQVRTANFDFNYASQASDESQQPVQIPRG
                     RVPPRLADPDNEDDVRLNADSMTAAGGRFITLRSTAESSVKGVIEIKQGVNPFFIGRS
                     QDCSCKIEDNRLSRIHCFVLKKRHPIGDSIHESPAQGLEDLWYCHSGTNLSYLNDVKL
                     TQGTKALLYEGDEIKIISDRANNFVISFVVEINDSTGLFNHGKPFPGHERLVEQQTPD
                     ELGLTRKLTDLKKAFASQNSSKRVRSISLSQDPNKKAKRARLDKADKGGANLQFI"
     gene            <920981..>922234
                     /locus_tag="KLTH0D11264g"
                     /db_xref="GeneID:8295439"
     mRNA            <920981..>922234
                     /locus_tag="KLTH0D11264g"
                     /product="KLTH0D11264p"
                     /transcript_id="XM_002553153.1"
                     /db_xref="GeneID:8295439"
     CDS             920981..922234
                     /locus_tag="KLTH0D11264g"
                     /note="highly similar to uniprot|P07267 Saccharomyces
                     cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
                     (proteinase A) required for the posttranslational
                     precursor maturation of vacuolar proteinases synthesized
                     as a zymogen self-activates"
                     /codon_start=1
                     /product="KLTH0D11264p"
                     /protein_id="XP_002553199.1"
                     /db_xref="GeneID:8295439"
                     /db_xref="GOA:C5DF06"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DF06"
                     /translation="MHLPSLLSLATLLVASFNSAEAKVHKSKVYKSKQHNDGSELGVM
                     MSVANLHQKYLSQFSKAYPEVDFASHAGSGIGLGAVEQDVLSAMGGHDVPLSNYLNAQ
                     YFTEITLGTPPQSFKVILDTGSSNLWVPSDECGSLACFLHSKYSHDASSSYKANGTNF
                     AIQYGSGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIA
                     VDKVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWLPV
                     RRKAYWEVKFDGIGLGDEYAELEGTGAAIDTGTSLIALPSGLAEVLNAEIGAKKGWSG
                     QYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLEVSGSCISAFTPMDFPEPVGPLAII
                     GDAFLRKFYSVYDLGNNAVGLAQAV"
     gene            <922942..>924978
                     /locus_tag="KLTH0D11286g"
                     /db_xref="GeneID:8295440"
     mRNA            <922942..>924978
                     /locus_tag="KLTH0D11286g"
                     /product="KLTH0D11286p"
                     /transcript_id="XM_002553154.1"
                     /db_xref="GeneID:8295440"
     CDS             922942..924978
                     /locus_tag="KLTH0D11286g"
                     /note="similar to uniprot|P28743 Saccharomyces cerevisiae
                     YPL155C KIP2 Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /codon_start=1
                     /product="KLTH0D11286p"
                     /protein_id="XP_002553200.1"
                     /db_xref="GeneID:8295440"
                     /db_xref="GOA:C5DF07"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DF07"
                     /translation="MIHKSPTRKHMSRFCNYPVPQTPVFQTGGGTFSSRRRKSSVTPL
                     TTPLSTTSVRRRSRQSSPSRSSMISSPTRTSSGSSSRGRSAEGLVNLDNVLEGGTTQQ
                     CRGTISVSIRLKPSDTNTRSPWYASDDHTIVHNDLGEFWFDKVFSPQTNNYGVYEEIG
                     KPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTRDEAGLILLSVEQIFSQIMKESVNNK
                     SYEVRVSYLEIYNEKIYDLLNYPSAKSPGGTYGSFQSKNVPGAGAELPVRDDARHGVR
                     VVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTELLSGTD
                     TTSTLSLCDLAGSERAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAATPP
                     PTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKNV
                     SMTVKRNEAEATHDKDELLHSLRRQLDEQQDLICELRRAQPPADQSSCEATPLGPSAT
                     VLMLRRENETLKKKLQHCERLLDKDDAAVEDEQFVEIVEMLPPAVGALLESKIQGLES
                     QLREHRAYTAQLEQRLSEAEAEARLVTQQARAQAQTLSGDDGTLQRVVREQEEELEEL
                     QRSLARKNKMLDALQSAKRLREGALRPLNRGLGAGAGAGLGDGRVAHKSGGVGT"
     gene            <925622..>926437
                     /locus_tag="KLTH0D11308g"
                     /db_xref="GeneID:8295441"
     mRNA            <925622..>926437
                     /locus_tag="KLTH0D11308g"
                     /product="KLTH0D11308p"
                     /transcript_id="XM_002553155.1"
                     /db_xref="GeneID:8295441"
     CDS             925622..926437
                     /locus_tag="KLTH0D11308g"
                     /note="some similarities with uniprot|Q12498 Saccharomyces
                     cerevisiae YPL156C PRM4 Pheromone-regulated protein
                     predicted to have 1 transmembrane segment
                     transcriptionally regulated by Ste12p during mating and by
                     Cat8p during the diauxic shift"
                     /codon_start=1
                     /product="KLTH0D11308p"
                     /protein_id="XP_002553201.1"
                     /db_xref="GeneID:8295441"
                     /db_xref="GOA:C5DF08"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="UniProtKB/TrEMBL:C5DF08"
                     /translation="MGFRVASGRVSSRSSHAVSCAVALLLILGFVALTSSDTVRLYGS
                     LANARDAEPAASATASAAASGASKHAGSHGRSHSRAEAAAKPSASAEAGPRAVEQIFS
                     DIRLEISDNSGVATRVATRAEIVRSEVVHGPRNYRPPSADFDPAANFQEILSASPVVL
                     FVDSAQDSERLRALLQRDYEVSPAPAVVDLEKHSRGAQLETYIRYYRTKPASATAVPR
                     QPPYLFVNGNSVINSDFQSDIQDLHAQNELLAKLKTVAEGNVMFARNNAPSNS"
     gene            complement(<926504..>927412)
                     /locus_tag="KLTH0D11330g"
                     /db_xref="GeneID:8295442"
     mRNA            complement(<926504..>927412)
                     /locus_tag="KLTH0D11330g"
                     /product="KLTH0D11330p"
                     /transcript_id="XM_002553156.1"
                     /db_xref="GeneID:8295442"
     CDS             complement(926504..927412)
                     /locus_tag="KLTH0D11330g"
                     /note="similar to uniprot|Q12052 Saccharomyces cerevisiae
                     YPL157W TGS1 TrimethylGuanosine Synthase"
                     /codon_start=1
                     /product="KLTH0D11330p"
                     /protein_id="XP_002553202.1"
                     /db_xref="GeneID:8295442"
                     /db_xref="GOA:C5DF09"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DF09"
                     /translation="MGRLNSSELEHFVHLGKRKYRRERRALKKLFRTNEHRVEPDVKV
                     VDRTIFKYWKNRLTLFSRMRNRDIYMTRELWFSVTPESVAKFVARFIKSCLPEAKVVL
                     DVYCGGGGNTIQLAQYFPKVYGVDNSLDHLYCAYRNAQAYGVEDRVWLKFGDWRVLSR
                     KRRFEKVAVDCVFSSPPWGGPEYLRSEVYDLEAALQPQGLRETLAGLLRISENVVLFL
                     PRNADLSQLSRVTRELLGEQALCKVLYVKQNGYMKGILCFWGARFYNYAGSTAEPSGA
                     AQESSGVAEPCEVAPGADTLDYSVDG"
     gene            <927949..>929754
                     /locus_tag="KLTH0D11352g"
                     /db_xref="GeneID:8295443"
     mRNA            <927949..>929754
                     /locus_tag="KLTH0D11352g"
                     /product="KLTH0D11352p"
                     /transcript_id="XM_002553157.1"
                     /db_xref="GeneID:8295443"
     CDS             927949..929754
                     /locus_tag="KLTH0D11352g"
                     /note="weakly similar to uniprot|Q99299 Saccharomyces
                     cerevisiae YPL158C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D11352p"
                     /protein_id="XP_002553203.1"
                     /db_xref="GeneID:8295443"
                     /db_xref="GOA:C5DF10"
                     /translation="MIRTPTRTKTLSFAGPQVDFHFPSPESAPNGSLDNYHMSNHHLL
                     NDAVARSPSQNSSGTSNGVDSAHYSFANISDNTTGVRNAGNGKRSSQAPSWSSGSGSC
                     RRYPVTLAPITNASALARPGDSGAADVRKNDTAAFLRRKRSPEDCALHSISTSAYTIP
                     TADNISFQITFGSSDKSHSLGSLRRSPSFGRRLPSRRTAGSSNNAPVSASLPARAASV
                     KSTQSTLKRSQAVRCKGGLLQFFMQVGVRAKNRIRRWRLAVRKKLFTYKAKRLAKKNK
                     KQTTSHLKRGNGYVSNIQRSISSASLRNSQRKNSDSASKETPATVARSGTLPNPLETP
                     PKTTRKSLRRSPSSIKRAASILTRANSSGTITQGTAEKNNAGENIPRTKLVRSGPSLS
                     LSSIARQPSIVVNNKVIPLTSLNEDTKDFTIEEEDEDEYVIDTDCMKKSVRGYSQSSS
                     GSSNSGKSSDETYHDSLENPTPDESLLPDEKVSRALDAWNHYLRAVVAQRVLMRLQIR
                     RFQESGGDPECQELIDAIISDYEENSSSHCDSDLRSDSTSLTSVSDCEGRVSSSVASD
                     VSVGITGSIFSARPFQQTMKNSVKRSLTLPVGFRV"
     gene            complement(<929788..>931119)
                     /locus_tag="KLTH0D11374g"
                     /db_xref="GeneID:8295444"
     mRNA            complement(<929788..>931119)
                     /locus_tag="KLTH0D11374g"
                     /product="KLTH0D11374p"
                     /transcript_id="XM_002553158.1"
                     /db_xref="GeneID:8295444"
     CDS             complement(929788..931119)
                     /locus_tag="KLTH0D11374g"
                     /note="similar to uniprot|Q03649 Saccharomyces cerevisiae
                     YMR210W Hypothetical ORF and weakly similar to YPL095c
                     uniprot|Q02891 Saccharomyces cerevisiae YPL095C
                     Hypothetical ORF and weakly similar to YBR177c
                     uniprot|P38295 Saccharomyces cerevisiae YBR177C EHT1
                     Possible serine hydrolase, may be involved in lipid
                     metabolism, null mutant slightly temperature sensitive at
                     37C"
                     /codon_start=1
                     /product="KLTH0D11374p"
                     /protein_id="XP_002553204.1"
                     /db_xref="GeneID:8295444"
                     /db_xref="InterPro:IPR000952"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DF11"
                     /translation="MESILHHLPIYSHVRQTRPFEPLKFVGEQSGTSTDLPTLVDKCS
                     PEFSNGAMALFHPLYFNGHLQTLYAAVRTFDKENMVYYKRLVVPCRDGGEATADFRVP
                     PFEKASDYTPPNQTKPLMPRYSFFTPEEERNLGSNDEKPLLIVLHGLTGGSHEAYVRS
                     LVDRITTNYGFEACVLNSRGCSESCITTPQLYNGVWTNDIRDFVVKLRALFPKRKFYL
                     VGFSLGASIATNYLGQEGSNSQIECAAILANPWDLCNASYYMYRTFLGRNLYGNHFSK
                     SLVKMLKDNLSVLKQDPYMAKLYAEKIDSVKTVEEFDNWFTSRMFGFNCSFEYYRYGT
                     SSNRIPLIRTPMLAISASDDPIVGSESLPIREIESNPYTLLIESSKGGHVAWFDAHGE
                     RWYEEPLCRFFSGFHSDVALEGLKPDLASVTLPHANKFKGDRLVDATVRDY"
     gene            <931339..>932016
                     /locus_tag="KLTH0D11396g"
                     /db_xref="GeneID:8295445"
     mRNA            <931339..>932016
                     /locus_tag="KLTH0D11396g"
                     /product="KLTH0D11396p"
                     /transcript_id="XM_002553159.1"
                     /db_xref="GeneID:8295445"
     CDS             931339..932016
                     /locus_tag="KLTH0D11396g"
                     /note="similar to uniprot|Q99373 Saccharomyces cerevisiae
                     YPL159C PET20 Protein required for respiratory growth and
                     stability of the mitochondrial genome"
                     /codon_start=1
                     /product="KLTH0D11396p"
                     /protein_id="XP_002553205.1"
                     /db_xref="GeneID:8295445"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:C5DF12"
                     /translation="MIVFRGLRPGVRAGRSAIPKLQRCQSSFTFSTNKLLMQKEQLKD
                     EKRKNRRGEAKGEELAAEKDGKKRMASELRGKQRKTDFSWLPKAPSTDHLKHRDVSTT
                     LLYSGYRPFVLNSSEQKQTDSTLYEFAMKLEALGDPLPWISSATGTEFYGEWDNIPAD
                     VIKKLRPFQPPTDDPAAKDKEALKLLQKEIVQKEKDKLINRAKGRKKPILKLLQLSKK
                     IGSENGN"
     gene            complement(<932256..>932531)
                     /locus_tag="KLTH0D11418g"
                     /db_xref="GeneID:8295446"
     mRNA            complement(<932256..>932531)
                     /locus_tag="KLTH0D11418g"
                     /product="KLTH0D11418p"
                     /transcript_id="XM_002553160.1"
                     /db_xref="GeneID:8295446"
     CDS             complement(932256..932531)
                     /locus_tag="KLTH0D11418g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D11418p"
                     /protein_id="XP_002553206.1"
                     /db_xref="GeneID:8295446"
                     /db_xref="UniProtKB/TrEMBL:C5DF13"
                     /translation="MQDAVSVEMMGTDLDQTLSEHFTEEEQFWLYARDQDYDLDTCLE
                     LCDHVQLLNEDILTNNVEQRPEIVRAELDFAKFESREKSGSVDYQTA"
     gene            complement(<932979..>936275)
                     /locus_tag="KLTH0D11440g"
                     /db_xref="GeneID:8295447"
     mRNA            complement(<932979..>936275)
                     /locus_tag="KLTH0D11440g"
                     /product="KLTH0D11440p"
                     /transcript_id="XM_002553161.1"
                     /db_xref="GeneID:8295447"
     CDS             complement(932979..936275)
                     /locus_tag="KLTH0D11440g"
                     /note="highly similar to uniprot|P26637 Saccharomyces
                     cerevisiae YPL160W CDC60 Cytosolic leucyl tRNA synthetase
                     ligates leucine to the appropriate tRNA"
                     /codon_start=1
                     /product="KLTH0D11440p"
                     /protein_id="XP_002553207.1"
                     /db_xref="GeneID:8295447"
                     /db_xref="GOA:C5DF14"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DF14"
                     /translation="MSSDTGSKGLVLENTARRDALIAIEKKYQKLWAEEHVFEIDAPS
                     IEEESVSIDSEELQRKYPKFMSSMAYPYMNGVMHAGHCFTLSKVEFSVGFERMNGKRA
                     LFPLGFHCTGMPILACADKLKREAELFGSDFSKAPAEEEEDEAAAAKEEVKTESEDVT
                     KFKAKKSKAAAKKGRGKFQFEIMLQLGIPHEEVVKFADPQFWLTYFPPLCQSDCSAFG
                     SRIDWRRSFITTDMNPYYDAFIRWQMNKLKELGKIKFGERYTIYSEKDGQACMDHDRQ
                     SGEGVTPQEYVGIKIETLEFAEAAKKVVESSDALDKSKRFYFVAATLRPETMYGQTCC
                     FVSPKINYGIFDAGDAYYITTERAFKNMSYQKLTPKRGYYKPLVTISGKDFIGSKIRA
                     PLSAYDELRILPMETVIATKGTGVVTCVPSNSPDDYMTTRDLQNKSQFYGIDPEWVKH
                     EPVPIIRSERYGDLTAQKICEELKIRSPKDTVPLAEAKKIAYKEDFYNGTMIYGKFKG
                     EKVEVAKGKLKAELIANNEAFVYNEPESLVVSRSGDDCIVSLEDQWYVDYGEQTWKEQ
                     AIECLNQMNTFAPEVKNAFEGCLEWLKNWAVCRTYGLGTKLPWDEKYLVESLSDSTIY
                     QAFYTIAHLLFKDYYGNEIGPLGIEANQMTPAVFDYIFQHTDNVETDIPIESLQKLRR
                     EFEYFYPLDVSISGKDLITNHLTFFIYTHVALFPKKFWPRGIRANGHLMLNNAKMSKS
                     TGNFMTLKQIVEKFGADASRIALADAGDTIEDANLDETNANAAILRLYNLKEWADEVV
                     KNLDGLRSGPITEFFDVSFENELNALVEETYKQYELTNYKSALKTGLFDLQTARDYYR
                     ESCEVMHRDLVLRYIEFQVLVLAPIAPHFAEYIWREVLGNTKSVQITRFPRATKPVDA
                     GALSALEYLRNLQRSIRESEGQALKKKKGKGSDVDITKPAKMTLLISESFPEWQSEYI
                     ELVRKLFESQELDDNKKIKQMVNPKDMKRAMPFISMLKQRLVAEPVETVFNRELPFDE
                     VATIKATVENVKKCCQVIKCQEFQFISFPYGAKVGKDIFTGEQVDIPNAAKVVENAIP
                     GNPGIIIANI"
     gene            complement(<938262..>939236)
                     /locus_tag="KLTH0D11462g"
                     /db_xref="GeneID:8295448"
     mRNA            complement(<938262..>939236)
                     /locus_tag="KLTH0D11462g"
                     /product="KLTH0D11462p"
                     /transcript_id="XM_002553162.1"
                     /db_xref="GeneID:8295448"
     CDS             complement(938262..939236)
                     /locus_tag="KLTH0D11462g"
                     /note="similar to uniprot|Q08651 Saccharomyces cerevisiae
                     YOR246C Protein with similarity to oxidoreductases"
                     /codon_start=1
                     /product="KLTH0D11462p"
                     /protein_id="XP_002553208.1"
                     /db_xref="GeneID:8295448"
                     /db_xref="GOA:C5DF15"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DF15"
                     /translation="MPARNLDQLPYYDLRKQRKVALVTGGNSGIGWYTVLHLYMHGFV
                     VYVAGRNSSRVNRAMKDIKKEARTRIKTLATDQRHPVGELHFLSLDLTALKVVEKAAK
                     RFRSLESSLDVLINNAGVMALPYSVTEDGFEIQLQTNYVAHFLLTMRLLPSVKRCRGR
                     IITVSSIGHNLEFSYFSLSQSFNYKPNMLFTWMRYAMAKTASIQFAKMLAIKHPDVLC
                     ISVHPGLVMKTNLFSYWTRLPIVGIFFWFFFQLVGYFFGVSNEEGSVATLKGALSTEL
                     EREWDNGKYYTTGGIESKPSYVANNLDNAASTWLWTIHELRDRGYEPT"
     gene            <941011..>942834
                     /locus_tag="KLTH0D11484g"
                     /db_xref="GeneID:8295449"
     mRNA            <941011..>942834
                     /locus_tag="KLTH0D11484g"
                     /product="KLTH0D11484p"
                     /transcript_id="XM_002553163.1"
                     /db_xref="GeneID:8295449"
     CDS             941011..942834
                     /locus_tag="KLTH0D11484g"
                     /note="similar to uniprot|P39011 Saccharomyces cerevisiae
                     YPL161C BEM4 Protein involved in establishment of cell
                     polarity and bud emergence interacts with the Rho1p small
                     GTP-binding protein and with the Rho-type GTPase Cdc42p"
                     /codon_start=1
                     /product="KLTH0D11484p"
                     /protein_id="XP_002553209.1"
                     /db_xref="GeneID:8295449"
                     /db_xref="UniProtKB/TrEMBL:C5DF16"
                     /translation="MDFENVLFRLKPILDSGSSSQIAKDQDLCNRCVAVLDELAVQLR
                     SPTNRDFIRESGVLSKLLKLFNDGLRELSGDKSPTVNWLIFSAELTRCIANCVADNDD
                     NRAEFCTLALESAEAFEANFPKIFELTDTATEHVLDLQFKSLALVKNLCLNNEVYTRE
                     CSHILTIPLVNLLHSRNLTEFDEHALDIVVMTTDLLSEFVKFSSNSIALKELLIMARL
                     MALISPKIAEQPTEDQITNGDANCEESSEDTEDADPFLELHQCLALCIECVVSKNEAL
                     DLSLSDSTHKLQQLLLQSLSLAELKNTFENKLIMMRRLLFIIGMVSANVTNTNVQDRA
                     MCYATLLQPNGVYNKAAALIVLSNSISSRETADQVSSNIGLGQIVQACSAFKDPMQFQ
                     GLLDILKKLLNLANVYDLTDEDLKLLFAELRICHEQCQVYQDVSPLLDALLGKFAAVC
                     PGSLLLKQISDPNFKTLIIQRGGIPACLLIDKFVVGDRNLANGLLADLWASAFRFQEL
                     SKISTPHLFQLLKSLGIYFRSVGDNDANIVFKQHSSQLVTLLEAIVPMSTNTDSASKS
                     IFNNARFVAGMILNLLNGKELTSNEFQLRNLAKQLLAPIES"
     gene            <942952..>943761
                     /locus_tag="KLTH0D11506g"
                     /db_xref="GeneID:8295450"
     mRNA            <942952..>943761
                     /locus_tag="KLTH0D11506g"
                     /product="KLTH0D11506p"
                     /transcript_id="XM_002553164.1"
                     /db_xref="GeneID:8295450"
     CDS             942952..943761
                     /locus_tag="KLTH0D11506g"
                     /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
                     YPL162C"
                     /codon_start=1
                     /product="KLTH0D11506p"
                     /protein_id="XP_002553210.1"
                     /db_xref="GeneID:8295450"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="UniProtKB/TrEMBL:C5DF17"
                     /translation="MNSGTGDDSCQLLGPISLLIQTLMGVAAISGLLLKRRYEVPKRR
                     WRVWFFDISKQVFGSLIIHFLNLGISILKQRKAHFLMVLDDDPGGDQCDWYFLNLLMD
                     TTVGTLVLWFVLGLLEEGLRRLGVQNIESGNYYPSRDSSRETEEGPPIRNEPLFSAFG
                     KQLLIFVCGLSIMKFCVFLILTYFEVVATWFAELVLGWSDNWPNFQVFLVMFVFPILL
                     NFFQCFCIDNIIKLHPRNLSTSELENFEEGPILYSPGLQNASHTKAMYGST"
     gene            <944475..>945056
                     /locus_tag="KLTH0D11528g"
                     /db_xref="GeneID:8295451"
     mRNA            <944475..>945056
                     /locus_tag="KLTH0D11528g"
                     /product="KLTH0D11528p"
                     /transcript_id="XM_002553165.1"
                     /db_xref="GeneID:8295451"
     CDS             944475..945056
                     /locus_tag="KLTH0D11528g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0D11528p"
                     /protein_id="XP_002553211.1"
                     /db_xref="GeneID:8295451"
                     /db_xref="UniProtKB/TrEMBL:C5DF18"
                     /translation="MRFTTVVASLIAASGFASASEYLNQTTTLRPSGSSSLLNAVTTE
                     LTTQTFDSTSTVTLMTTITMSGGQSTGSTTTSAASASSAALTAGQNNKGAFVGSASSA
                     SSSTSEIWSTITSTLYTTQSVTLSNSQVSASVSAYEKQIVIGTSIPSCTPQTVTVTAE
                     KTKYITVTAGQTSSAAPVYTPSAGPYSNSTMSI"
     gene            <945401..>947494
                     /locus_tag="KLTH0D11550g"
                     /db_xref="GeneID:8295452"
     mRNA            <945401..>947494
                     /locus_tag="KLTH0D11550g"
                     /product="KLTH0D11550p"
                     /transcript_id="XM_002553166.1"
                     /db_xref="GeneID:8295452"
     CDS             945401..947494
                     /locus_tag="KLTH0D11550g"
                     /note="similar to uniprot|Q12083 Saccharomyces cerevisiae
                     YPL164C MLH3 Protein involved in DNA mismatch repair forms
                     a complex with Mlh1p to promote meiotic crossing-over
                     mammalian homolog is implicated mammalian microsatellite
                     instability"
                     /codon_start=1
                     /product="KLTH0D11550p"
                     /protein_id="XP_002553212.1"
                     /db_xref="GeneID:8295452"
                     /db_xref="GOA:C5DF19"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR028830"
                     /db_xref="UniProtKB/TrEMBL:C5DF19"
                     /translation="MSQGIRKLTDDVAKSLKSSASIDCITTALRLLLQNSIDAGASHI
                     TVFLDLPNRVFTVADNGLGMTRRDLTCFGQQNYTSKLTDVQDVDHLKTYGFKGCSIFE
                     ISNVAKIRVISKHESASSGWMKELGGRSEDINNPITEIEKLEKGTVVTVDDFFHNLPV
                     RLESLERPTSGELLDRVRFDIFEILVVHPEVEICINTEGACAGHSKFLETRGIKRSLP
                     ETEKLLLCLQDVFGLEGENSTLKPVHAQFTDYVVDGLISEVPTFHIKIQLLYVNGLKC
                     EDSALLRPISRAFRNARNCWNQTHGRSGYEMHVLKISMPRCKAKILGGERSLGLGTKQ
                     YQIIHALIFKIIESVFNVKLNQYTAIAHRPSKFNTSCTAWKSSNYSLRSASGFEEGKI
                     PALKKPKPEPPEHSRNLKSTSTDIDFKKLIQNAGCRGSSEASQEPIMSPFSTLQEHFV
                     DRSLFKRFRVVNQVDKKFVLLKSYGSNPDILSLVLLDQHAADERIKYESLLNGFIWGM
                     LTSPHLHIRKAHIEVDLSPKEYHIFQQCKNELHQWGILFEGKPVAKPRHLVKLTALPD
                     PLQHRSIEALKNGIIQHACDLRHLRKNHFRSQSTQKLESGAAQNFAWWNYLNSIPTMI
                     TDSLKSKACRSAIMFGDYLSPQETTLLVEMLGKCRNPFYCAHGRPSLVPIFTHNGCSH
                     TNFTEVPAFTDYRLT"
     gene            complement(<947503..>949554)
                     /locus_tag="KLTH0D11572g"
                     /db_xref="GeneID:8295453"
     mRNA            complement(<947503..>949554)
                     /locus_tag="KLTH0D11572g"
                     /product="KLTH0D11572p"
                     /transcript_id="XM_002553167.1"
                     /db_xref="GeneID:8295453"
     CDS             complement(947503..949554)
                     /locus_tag="KLTH0D11572g"
                     /note="weakly similar to uniprot|Q08683 Saccharomyces
                     cerevisiae YOR249C APC5 Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="KLTH0D11572p"
                     /protein_id="XP_002553213.1"
                     /db_xref="GeneID:8295453"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:C5DF20"
                     /translation="MTLEQSIIITDTLTPHDISILILIGFFCSGIERFDQRIMIKLLP
                     PLSPHEELPVLFGSQQRENTKTIVLPYLLDLILFLIENEQKSAASRLISTLKAVSTVD
                     GISKLIRALETHCLRSSYRELLKSSERKTVKRELTRSSLLGSFVERCSIKYKIQDFNE
                     SEMLWRNLRIYVRRFEKTSLFKTIESQLPELDHFMSFTLRGEGGSETIESLEELQRMG
                     LPERYNDLLLNEEDIIVMISSDHLKTLLNEEVCLLLDGHANIRNSTEKIINCMSLEDC
                     SKFPSVHILKGLEQLNDQRYDSFLTLLYRYFDYMLGQHSEPNFHMSLLSLASFYAHFN
                     DNEAAVKTFEEAIAVARENKDTKTLNFILMWVFEFIVKFPSLAVKFHVSAEQIINYLK
                     SCPSDQSASVFEMAYKFETLWTMLNSESVVGILEALFKASLITLQNATNKPKLSLLAN
                     HNAQVWEYLGSQSLQQTYKNVAKTYLKKSSDFSHKARKLLSSKDSGIIRHELHTSRSP
                     LLTYHERKSLEIMGISHLGSIGECDEAIRLANAKLRECKSEFLDVNNEQRFALAKCQI
                     MIKCGMEMRCLPIFTKVMEDVIIAGNAHLAALCILLLSRVLLSLRKFSELEELLNSTM
                     HTVLKFTEPGINRAFFDIYYLNKCEKENAGEDLTRASSYLGALKGLRDQLQNNNVVLF
                     N"
     gene            complement(<949719..>951041)
                     /locus_tag="KLTH0D11594g"
                     /db_xref="GeneID:8295454"
     mRNA            complement(<949719..>951041)
                     /locus_tag="KLTH0D11594g"
                     /product="KLTH0D11594p"
                     /transcript_id="XM_002553168.1"
                     /db_xref="GeneID:8295454"
     CDS             complement(949719..951041)
                     /locus_tag="KLTH0D11594g"
                     /note="similar to uniprot|Q08685 Saccharomyces cerevisiae
                     YOR250C CLP1 cleavage/polyadenylation factor IA subunit
                     interacts with Pcf11p in the 2-hybrid system
                     cleavage/polyadenylation factor IA subunit"
                     /codon_start=1
                     /product="KLTH0D11594p"
                     /protein_id="XP_002553214.1"
                     /db_xref="GeneID:8295454"
                     /db_xref="GOA:C5DF21"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028606"
                     /db_xref="UniProtKB/TrEMBL:C5DF21"
                     /translation="MASLPGLNDSLHPADLGVDLNEPKHVSITAGSEWRVDVPQESKL
                     TIKVHSGVAEIFGTELASDVPYVFQGTKFAVYAVEDAEFEWTSPELTSHSISSDTNMK
                     FIYNVHFALEKLRVSSFEGPRVLIVGESCTGKTSLAKTLCAYAIKFKAHQPMMVNLNP
                     QECIYSPPGCLTATPISDVIDVSSSTWGQSMTSGATKLHNKQPIVKSFGLEQISENKE
                     RYVSTFQQLANAVRGRVQNDSTVRRSGLIIDTPPLGQLSDDFSELKEIIYQFKVNAVV
                     VCAKDDTLALKLNEHLPVETLAIVRLPTSSGVVQTDDVYKRALQRNAIREYFYGDFNT
                     VLSPYTIGVDSDMITVWQPKSVLVQSDSQDDLLPVEINASNLQHALVAISYASRRSSS
                     EEVSASPILGFALIMDVNDTKRKLRVLLPVPGLLPDKAMILTAYRYLE"
     gene            complement(<951182..>952090)
                     /locus_tag="KLTH0D11616g"
                     /db_xref="GeneID:8295455"
     mRNA            complement(<951182..>952090)
                     /locus_tag="KLTH0D11616g"
                     /product="KLTH0D11616p"
                     /transcript_id="XM_002553169.1"
                     /db_xref="GeneID:8295455"
     CDS             complement(951182..952090)
                     /locus_tag="KLTH0D11616g"
                     /note="similar to uniprot|Q08686 Saccharomyces cerevisiae
                     YOR251C catalyzes transfer of the sulfane atom of
                     thiosulfate to cyanide to form sulfite and thiocyanate"
                     /codon_start=1
                     /product="KLTH0D11616p"
                     /protein_id="XP_002553215.1"
                     /db_xref="GeneID:8295455"
                     /db_xref="GOA:C5DF22"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DF22"
                     /translation="MSLFKIISPKALAEKLQQEATRRIVAVDSTWYLPYLQKNAKKEF
                     MELERLPNAVFFDIDGVKDANSPYPHMLPDAATFNASMSELGIRKNDILVVYDRVGNF
                     SAPRCAWTLAVFGHELVYLLNNFPAYKAEGFPLDTTPRTSFSELEPSDYKSDADFTKQ
                     EVVSYEEIHKLVEDGKLAEVYNVFDARALPRFTGESSEPRPEIPSGHIPGAQPMPFTD
                     VVKNGIFEMDSRLAAENLEKYLESSGCKYDPSKPTVAMCGTGVSGVIIKTALESAGIK
                     HVKLYDGSWTEWALRSEPKYVAKGRS"
     gene            <952307..>953368
                     /locus_tag="KLTH0D11638g"
                     /db_xref="GeneID:8295456"
     mRNA            <952307..>953368
                     /locus_tag="KLTH0D11638g"
                     /product="KLTH0D11638p"
                     /transcript_id="XM_002553170.1"
                     /db_xref="GeneID:8295456"
     CDS             952307..953368
                     /locus_tag="KLTH0D11638g"
                     /note="similar to uniprot|Q12529 Saccharomyces cerevisiae
                     YPL165C SET6"
                     /codon_start=1
                     /product="KLTH0D11638p"
                     /protein_id="XP_002553216.1"
                     /db_xref="GeneID:8295456"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5DF23"
                     /translation="MMPIEEAVYISELFDIRTTDNSGRACFASKDLKKGTDVLCLTKC
                     LGASTCYEFRKEVCSQCFQYDGGQRMKVRLNNKFLKGAGLWFCTENCRDQFLRQEHVD
                     HLIDALETLLVSWEIQAKKRIGSIDRASNSSISTEKIESLWQDIRDNWITRIDRMKPT
                     KRVLQLPIINEDEYVCARFVIHCLFTLKTTDTSSLHMAAFRNLQSNESSKISRFPVLL
                     DLQKRVFQTLYILLPPFLKSGFDIPTFRHILGSEYGNSFGIWQNEEASDSREYLGYWV
                     LPEASFFNHSCAPNLIKHRFGNKMIFTLNSDVTKDQELCIDYKDILDLKVDERRHILK
                     ENWFFSCECPRCKIEMQIN"
     gene            complement(<953365..>953880)
                     /locus_tag="KLTH0D11660g"
                     /db_xref="GeneID:8295457"
     mRNA            complement(<953365..>953880)
                     /locus_tag="KLTH0D11660g"
                     /product="KLTH0D11660p"
                     /transcript_id="XM_002553171.1"
                     /db_xref="GeneID:8295457"
     CDS             complement(953365..953880)
                     /locus_tag="KLTH0D11660g"
                     /note="some similarities with uniprot|Q12092 Saccharomyces
                     cerevisiae YPL166W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="KLTH0D11660p"
                     /protein_id="XP_002553217.1"
                     /db_xref="GeneID:8295457"
                     /db_xref="GOA:C5DF24"
                     /db_xref="PDB:4HPQ"
                     /db_xref="PDB:4P1W"
                     /db_xref="UniProtKB/TrEMBL:C5DF24"
                     /translation="MNSENTIVYVRVAGRARNGFVDPLKFYWDLERDRSLWSSVSKLD
                     NTKKTIDWKRLSREFKAPEHFIRKRSYALFAKHLKLLERQIEAKTRSLAVTEDELNYT
                     DEDDERNSISHGEDDFEAAEGLKNLRTSKVLKQRVPGEGRNGESSLSELSNLSVSKSA
                     LEEALLDRLQL"
     gene            <953995..>958497
                     /locus_tag="KLTH0D11682g"
                     /db_xref="GeneID:8295458"
     mRNA            <953995..>958497
                     /locus_tag="KLTH0D11682g"
                     /product="KLTH0D11682p"
                     /transcript_id="XM_002553172.1"
                     /db_xref="GeneID:8295458"
     CDS             953995..958497
                     /locus_tag="KLTH0D11682g"
                     /note="similar to uniprot|P14284 Saccharomyces cerevisiae
                     YPL167C REV3 Subunit of DNA polymerase zeta which is
                     involved in DNA repair required for mutagenesis induced by
                     DNA damage"
                     /codon_start=1
                     /product="KLTH0D11682p"
                     /protein_id="XP_002553218.1"
                     /db_xref="GeneID:8295458"
                     /db_xref="GOA:C5DF25"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:C5DF25"
                     /translation="MSSGAPESGSFSTLAEDLIHIQINSYDSYQEVPGAFDRLSGNSL
                     PNRQFNHVPVIRVYGSLPSGHNVLCHIHGAFPYIYVPYDGEKGDSAQTIQSRCTQLHS
                     CLETKLKESYNRKGSAEEEEGKEKEKKDGFPENLKFVADVSPIRAVPFYGYHVGYSVF
                     YKISLLSSATTTKTAEFLREGKATGKRSQVFEAHIPFLLQFSADYNLFGCSWLKLSKC
                     FFRSPLLNPAHSQDLLQRNESLDEFLGRFYRKGENESGDDCERIGNSLLEIDAVPQFI
                     NNRNEIDFRDIHGTLFESSQIGPDETLFIPSTKNLWTQTTHLRKQFGLDPYQPIPEQH
                     RFSRLPEWQSHKELLSFLQKAKDRTIPKSKSFSESVSKSMFSAARHLDLPHESLCQLW
                     PDSHPRVGLDLSHRVQNQNTNRESFNSDSTSNDIVYSSDSETASEREMEMEQFHNTEN
                     TKEGKKTETEARLQSSAPLNPQKDTGAVDSFNDQILTQSMAHKRPSKGEGLLNQRPKK
                     LIRPVYAQSISAPSSGFRYKKLSLEFYNILQDLEDRGIPKIDYMDPYFRSPEDLKKKD
                     YIYSGRKFSLNSTHVTCRRPIEFANRTVRLESTSDERQPKNSWKYAIAPPTYSTVHDY
                     ILHTCKVNYRSQIDFKTMSNERGYKFKSNNSLKGLNSGDHNPLSHLTLEIFATSKANR
                     LPDPNFDPVQLIFWKIDPDSFPIDIGISTEGIMAYHEKDDAEFISHLNSASWSTPVAF
                     FQSEEEMINGVADLVLLLDPDIISGFELHSSSWGYLIERLESAYERDLCEEIARVKYK
                     TFNKRKDVWGFSHDSGIHIAGRHTLNIWRLLRSGLNLLKYTLENITFHVLHERLPHFS
                     PSALTSLWESRSNITALTTLISYWKKRVNINMKLLHSQQTINQTIEQARLIGIDFYSV
                     ISRGSQYKVESVLMRLCKCEHFLVLSPSKTQVRDQKALECIPLVMEPESAFYKSPLVV
                     LDFQSLYPSIMIGYNYCYSTIVGTVHEYNSKKTAIGASKVKFARGLLHELEDHLTISP
                     NGVMYLKESVRKSMLAKMLTDILHTRLMIKATMSDLKSKNETVAKLLNNKQVALKLLA
                     NVTYGYTSASFSGRMPCSDVADSIVQTGRETLEKAISLIESHSQWGAKVVYGDTDSLF
                     VYFPGKSREEAFKFGKEMAKAITTCNPFPITLKFEKVYHPCLLVSKKRYVGYSFEKED
                     QNEPKFDAKGIETVRRDGHPAQQKIVEKSLRILFDSKDLSAVKSYVQDQFRKIMKGQV
                     SVQDFCFAREVKLGSYKSEKTAPPGAVVAAKKKAADHRAGPQYRERIPYVVVKGRPGQ
                     ILRERCVPPEMFLSNDSLELDATYYITKTLLPPLQRFFNLIGVDVSQWYVEMPRFQDI
                     GNYQDGNLPEFMRTTSCFNCKKEIREKTKDLCAECFENKSQTITNLLQEDVSIRKHFK
                     SILTVCRACCQPFTKNSLDNLNKIVTQCDAQDCPVYYSRVKYKGYMSTARSAQLRDIL
                     KGLDHW"
     gene            <958658..>959227
                     /locus_tag="KLTH0D11704g"
                     /db_xref="GeneID:8295459"
     mRNA            <958658..>959227
                     /locus_tag="KLTH0D11704g"
                     /product="KLTH0D11704p"
                     /transcript_id="XM_002553173.1"
                     /db_xref="GeneID:8295459"
     CDS             958658..959227
                     /locus_tag="KLTH0D11704g"
                     /note="highly similar to uniprot|Q08687 Saccharomyces
                     cerevisiae YOR252W RBF17 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0D11704p"
                     /protein_id="XP_002553219.1"
                     /db_xref="GeneID:8295459"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:C5DF26"
                     /translation="MPLSKSLSKIQKNNKSQGKNLTVHPKGRKFQKLTAATLREDKIA
                     AKKKAHNERKSNELSRVKFIQDVISSESFKDQKVFSLGETVVFIQEFISRDDGELEEL
                     KKKRRTNRPPSTRQVVLQQRRDYETKELASGFLVPDLGDAENVDFLRKWNQTFGSLNT
                     MKLIRVNAKAEQVVGGSKGTKPPTDVEMQ"
     gene            complement(<959234..>960448)
                     /locus_tag="KLTH0D11726g"
                     /db_xref="GeneID:8295460"
     mRNA            complement(<959234..>960448)
                     /locus_tag="KLTH0D11726g"
                     /product="KLTH0D11726p"
                     /transcript_id="XM_002553174.1"
                     /db_xref="GeneID:8295460"
     CDS             complement(959234..960448)
                     /locus_tag="KLTH0D11726g"
                     /note="some similarities with uniprot|Q12467 Saccharomyces
                     cerevisiae YPL168W"
                     /codon_start=1
                     /product="KLTH0D11726p"
                     /protein_id="XP_002553220.1"
                     /db_xref="GeneID:8295460"
                     /db_xref="UniProtKB/TrEMBL:C5DF27"
                     /translation="MICVNSLRAYLRHNLPRELRFYVARGPTHPFSSLSSISDTGNID
                     DIAAVAFTKKLKNVVRHSKIPEQNSQLSREIIALCESSGLKCDFLTSSKIKRLYNMLL
                     QGKISTLQIMNALKSARNQKMVNVMDPKKSIDNQKDKKADISQYEFLQINPASSEKFG
                     KILDEMGCSETRKPFKQKVGTRRENEVPPLKGSDEIDLGVLHSFLQSAEKQKKEQKQF
                     AWNQARAYEWNEKNSPAAFSPGMMLFDSTYTPLRSKLMRNFRGSNVRGQGTGTVKTAF
                     TYTTEMLFYNLKDSTTHVMLWKNQGNNVHIEYRDLFTVINGSQRPPEQLLKVITNFEG
                     KDWELTGEATIDGVRQIVFKRDTTKHSSNRVSSKIFNMTLLSVFLGFAAYGAIQKYRS
                     TRYTVTTSAEPS"
     gene            <960571..>961059
                     /locus_tag="KLTH0D11748g"
                     /db_xref="GeneID:8295461"
     mRNA            <960571..>961059
                     /locus_tag="KLTH0D11748g"
                     /product="KLTH0D11748p"
                     /transcript_id="XM_002553175.1"
                     /db_xref="GeneID:8295461"
     CDS             960571..961059
                     /locus_tag="KLTH0D11748g"
                     /note="similar to uniprot|Q08689 Saccharomyces cerevisiae
                     YOR253W NAT5 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat-shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="KLTH0D11748p"
                     /protein_id="XP_002553221.1"
                     /db_xref="GeneID:8295461"
                     /db_xref="GOA:C5DF28"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DF28"
                     /translation="MSRNLVNLDNVYSNNVGTFQKIANTVLNVTYPDKFFQEQFDGGK
                     ETLFAQLGYYGEVAVGAVRAQLISNKNGGVKASGVYIQIFAVLENYRGKGVGSQLLKF
                     VEEQCKAHFQHNIYVHVAVDNEKGIQWYQRKGFEQEGEVLKNYYKDTTGAPDALILKK
                     SL"
     gene            complement(<961180..>963138)
                     /locus_tag="KLTH0D11770g"
                     /db_xref="GeneID:8295462"
     mRNA            complement(<961180..>963138)
                     /locus_tag="KLTH0D11770g"
                     /product="KLTH0D11770p"
                     /transcript_id="XM_002553176.1"
                     /db_xref="GeneID:8295462"
     CDS             complement(961180..963138)
                     /locus_tag="KLTH0D11770g"
                     /note="similar to uniprot|P14906 Saccharomyces cerevisiae
                     YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
                     Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP and
                     Lhs1p forms a channel competent for SRP-dependent and
                     post-translational SRP-independent protein targeting and
                     import into the ER"
                     /codon_start=1
                     /product="KLTH0D11770p"
                     /protein_id="XP_002553222.1"
                     /db_xref="GeneID:8295462"
                     /db_xref="GOA:C5DF29"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:C5DF29"
                     /translation="MTQSYDYDEGSETWPFFVLAVLCVVLVPLTLMQAYEIIAAKDED
                     SSSQSSPLEKLSEKYTGDQVKRFRAKFAPKKSKLLARRNLVIIAGWCMVAFLINKIGS
                     NGAIKDAATLLFDPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLE
                     EQYVMITKAYKALTDEITRENYLRYGHPDGPQATSHGIALPKFLVDSSASTLMVLGYI
                     ALLGFILPFFVSRWWSKTQSFTKKGIHARSASYFADRLFNFKPSQVVTTGLILNWLSH
                     AAEFKLLYPDLTQETFESLLYDHINRRHSGELETAKLRIVAKTHALLFGLLDIATTFR
                     NLEISTVAIDTFKSIVQATPLTSHSQILQLPNVDAKRFEEGSVDDIRTLGKLFTFEDE
                     KIGKILGIEDETKLRETLSVAANIPHLKLLRAEFTVPGESVVTPLSTPHISVKVLVRS
                     AKHKFFTPNKIPDELYKEEQDFDSLRDPFASLSNQPALPRTFAPHFPAKRSGCWCALV
                     VLQKDGKVIQTPMLVDRLSFANLNKDFDKRTVKDLEKEFNPEEWEIGTIKIPFSQPAP
                     DQKGDYYFRVIVKSTEYFGADLDFTLPMMVRELSEVEGAEKIADDSASDEDDSDLEDD
                     EEDSNDELEDDEDSDYTDIDTDTEVEEN"
     gene            <963412..>965235
                     /locus_tag="KLTH0D11792g"
                     /db_xref="GeneID:8295463"
     mRNA            <963412..>965235
                     /locus_tag="KLTH0D11792g"
                     /product="KLTH0D11792p"
                     /transcript_id="XM_002553177.1"
                     /db_xref="GeneID:8295463"
     CDS             963412..965235
                     /locus_tag="KLTH0D11792g"
                     /note="similar to uniprot|Q99257 Saccharomyces cerevisiae
                     YPL169C MEX67 Poly(A)RNA binding protein involved in
                     nuclear mRNA export component of the nuclear pore ortholog
                     of human TAP"
                     /codon_start=1
                     /product="KLTH0D11792p"
                     /protein_id="XP_002553223.1"
                     /db_xref="GeneID:8295463"
                     /db_xref="GOA:C5DF30"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:C5DF30"
                     /translation="MNNLFQNSNNVGVAAQQAVLQNRVKVGVKGWQNATKQDLVSFVS
                     RKTRIGIQDSYVEGNLVIGFVNSRNEASSLLNWNGVRFAGNALKFEILGDNVGLGGAP
                     GTNNTIALLKAFLYKRYNPQAKMLDLGNLRNDPDLTANGLFSTTSTQSKMFPAMMKLA
                     SKEDQMVVESVNLSNNNLKDLNMISSLAQTYPNLKNLCLANNQISRFRALEVWKNKFK
                     DLRELLMMNNPITTEPLYRSEIMRLFPKLIILDSVLLRDENKLQQIYSLPMKLQQFFF
                     ETNELGQSSIDFVSNFLNLWDTNRTQLMALYTPQSQFSVCIDSSVPSSSVPNSDQNPT
                     FSYYLPLSRNLTKISSDKTKQQRLALGQEAIDKLFRSLPKTKHALQEQPLNYSLEAFS
                     YPQVNGFIITLHGFFDESGAPEIDANKSTPNTSGNRNRRFNHGHGSSTNKLTKKSFDR
                     TWVIVPNPGGVVVASDMLTIRPYADGSWLQAQAQPQAVSQPPIQSQQHPQSQPQVPLP
                     NNPQSQLPNVIQPQIPGVAQTPVPNMPLQGSVGVPLLLPPEVQSKLSPVQLELLNRLH
                     QQTRLNAEYTYMLADQSGWNFDVALKGFQDSVNNIPREAFI"
     gene            <965505..>966515
                     /locus_tag="KLTH0D11814g"
                     /db_xref="GeneID:8295464"
     mRNA            <965505..>966515
                     /locus_tag="KLTH0D11814g"
                     /product="KLTH0D11814p"
                     /transcript_id="XM_002553178.1"
                     /db_xref="GeneID:8295464"
     CDS             965505..966515
                     /locus_tag="KLTH0D11814g"
                     /note="weakly similar to uniprot|Q08692 Saccharomyces
                     cerevisiae YOR255W OSW1 Protein of unknown function
                     required for the construction of the outer spore wall
                     layers"
                     /codon_start=1
                     /product="KLTH0D11814p"
                     /protein_id="XP_002553224.1"
                     /db_xref="GeneID:8295464"
                     /db_xref="UniProtKB/TrEMBL:C5DF31"
                     /translation="MRAPPAPRKSRARFVRRKAGQVYQVISLRRLKKKYNLHRLHKIH
                     RNNIRNGNPRGVPPYRCDALSFSNELLHVTSNSVSPAAKHKPLLIASFPNGCSRSPRV
                     KILQKNMLSRFWMSKRRFKLRRFNPGLEKAFIDEEDALSNDCFRSCRLIKKQTSKFAD
                     VKFDFEKKNVFKTVCMSTDHLEDRTPRFLEFNAGQSIRLEEFPSLNLARGEIRNFERP
                     GPFALECEASVLQQLRQKAKHRLEWLRWNVSELAPRLSTLAAPDVFIVSGIVRPYDAS
                     SDLLDADLRTMQTKISALVEASRHAGSAFNSYNQMLRKLETISPRASKTIRRATTRQL
                     VR"
     gene            complement(<966612..>967064)
                     /locus_tag="KLTH0D11836g"
                     /db_xref="GeneID:8295465"
     mRNA            complement(<966612..>967064)
                     /locus_tag="KLTH0D11836g"
                     /product="KLTH0D11836p"
                     /transcript_id="XM_002553179.1"
                     /db_xref="GeneID:8295465"
     CDS             complement(966612..967064)
                     /locus_tag="KLTH0D11836g"
                     /note="highly similar to uniprot|Q12091 Saccharomyces
                     cerevisiae YPL170W DAP1 Heme-binding protein involved in
                     regulation of cytochrome P450 protein Erg11p damage
                     response protein related to mammalian membrane
                     progesterone receptors mutations lead to defects in
                     telomeres mitochondria and sterol synthesis"
                     /codon_start=1
                     /product="KLTH0D11836p"
                     /protein_id="XP_002553225.1"
                     /db_xref="GeneID:8295465"
                     /db_xref="GOA:C5DF32"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:C5DF32"
                     /translation="MSFVKNFLFGGVKTSEDPTGLTGEVADNQTAKTEEPIVEGKFFP
                     RTLYKYNGHDDEKIFIAIKGKVFDCSQGRQFYGPSGPYSNFAGHDASRGLATNSFELD
                     TLRHWDQPMDDLSDLTGQDMESLNGWLEHFQNKYPCIGELVPEPGVNI"
     gene            complement(<967344..>969698)
                     /locus_tag="KLTH0D11858g"
                     /db_xref="GeneID:8295466"
     mRNA            complement(<967344..>969698)
                     /locus_tag="KLTH0D11858g"
                     /product="KLTH0D11858p"
                     /transcript_id="XM_002553180.1"
                     /db_xref="GeneID:8295466"
     CDS             complement(967344..969698)
                     /locus_tag="KLTH0D11858g"
                     /note="similar to uniprot|Q08919 Saccharomyces cerevisiae
                     YPL176C"
                     /codon_start=1
                     /product="KLTH0D11858p"
                     /protein_id="XP_002553226.1"
                     /db_xref="GeneID:8295466"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:C5DF33"
                     /translation="MVSSSNRYRPVGQDDIGDSPESNDSSASLAAEELPPNPPGYVEE
                     MREGQEPQFEIMDFDEDPLASTQSRVARLRQKFKNCVVTPVRNRIADPLAVLMSMASH
                     KVDYYLSKIGNPLILRRFVYVFFASLFIYYVSSSGLLPSERTTGTRGMFSDKTQLMSY
                     AKRALDLSKMENDLEYISSMPHMAGTKGDFAVSQYIREAFANNGLRVAGDAAFKTYLN
                     YPGNVSLTAYAKSGGKLSLELSEQNFNPLSVKGEVREANLLYAHYGSGEDYRKLKEEN
                     LIDDNTVALIHYSKNAGEQVVEAQEAGIKAIFFISDGYGEDQIDSIQQKSVQNFRYDM
                     GDPLSPGWTSSLRNRIELSESLMVPKIPTIPLSRRQAEQLRKEMTKEGGIKFEDGWYS
                     GTANDLKIDFSLDPVVRQEHFSWSIAGRIEGREQSDKAIIISSARDSACTGCTYPNYG
                     TAALLSLAQLFQQVKYKYGWKPLRTIYFISYDASQFGHAGATELLESELIKIKNEVYT
                     VLDISQLGVTSDSLNLDIQAHPLLFDFLKDEDLKTGVDTEIRTVQQFGDWSAFLAHGI
                     PVAAISAPHVLERKYPIESCDDTFERLKQSINEDYWEKSSEVLLYVFKMALKLADEPM
                     IPLGIAQYSETLQQLLQDLQESAEGLDVDFEQLGEGITAWKRIDEQSTNWVRAWNNIV
                     MVENEGIEPSFVAVDRWNWNKKLTHIGIRHCALQGLPHRPFYKNVLFGPTLKDQSPHS
                     SWSFPGIKDAIFDRDATRAQDQANLAAEILLKSAESFIEYAGST"
     gene            <969889..>971202
                     /locus_tag="KLTH0D11880g"
                     /db_xref="GeneID:8295467"
     mRNA            <969889..>971202
                     /locus_tag="KLTH0D11880g"
                     /product="KLTH0D11880p"
                     /transcript_id="XM_002553181.1"
                     /db_xref="GeneID:8295467"
     CDS             969889..971202
                     /locus_tag="KLTH0D11880g"
                     /note="similar to uniprot|P32363 Saccharomyces cerevisiae
                     YPL175W SPT14 UDP-GlcNAc-binding and catalytic subunit of
                     the enzyme that mediates the first step in
                     glycosylphosphatidylinositol (GPI) biosynthesis mutations
                     cause defects in transcription and in biogenesis of cell
                     wall proteins"
                     /codon_start=1
                     /product="KLTH0D11880p"
                     /protein_id="XP_002553227.1"
                     /db_xref="GeneID:8295467"
                     /db_xref="GOA:C5DF34"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:C5DF34"
                     /translation="MVCDFFYPQLGGVEFHIYHLSQKLISLGHLVVIITHAYGDRTGV
                     RYLTNGLKVYHIPYFVAYRETAFPTIFGSFLIVRNILIREQIQIVHTHVSVSPLTHET
                     LLHANVMGLQTLLTDHSLYGFDTLSEILNNKMLKFALTNTGAVICVSNTCKENMIIRS
                     KLNPSSISVIPNAVVSHDFTPATKGSKAPGEITIVVISRLYPNKGADLLTHIIPRICE
                     IEDKVKFIIGGDGPKFVDFQQMIESYRLQDKVQLVGAVQHENVRDVLCRGDIYLHASL
                     TEAFGTALVEAASCGLLIVTTTAGGIPEVLPKHMTVFAQETSVSCLVAATRKAIQSLR
                     EGTVDTTSFHEEISSMYDWVDVAKRTVAVYDSLAQSPMPRNKSWYKMLKNFHERNDGP
                     WAMPLYVLCYLVENMLYLFLEWWYPRSEIDLAPKWPINQNHAASP"
     gene            complement(<971208..>973667)
                     /locus_tag="KLTH0D11902g"
                     /db_xref="GeneID:8295468"
     mRNA            complement(<971208..>973667)
                     /locus_tag="KLTH0D11902g"
                     /product="KLTH0D11902p"
                     /transcript_id="XM_002553182.1"
                     /db_xref="GeneID:8295468"
     CDS             complement(971208..973667)
                     /locus_tag="KLTH0D11902g"
                     /note="weakly similar to uniprot|P33420 Saccharomyces
                     cerevisiae YPL174C NIP100 Large subunit of the dynactin
                     complex which is involved in partitioning the mitotic
                     spindle between mother and daughter cells putative
                     ortholog of mammalian p150(glued)"
                     /codon_start=1
                     /product="KLTH0D11902p"
                     /protein_id="XP_002553228.1"
                     /db_xref="GeneID:8295468"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:C5DF35"
                     /translation="MAELGKRVALNGLQGTVRFIGETEFAPGTWCGVELDEKCGKNDG
                     SVQGVRYFNQTLKDGLYGLFGRIETVRPISTSGSVASSPNESRNLHGVILKLQDKLYG
                     LHHRYADLELQLENCAIDKEALKEENEELMSVIIGLQQELATLRQDLSALQQEVDLRR
                     SIEEHEWETDAGKLSHEALWKRNQLVEVALSKLQESLDESNEECISLAAENDQIKMEL
                     SVTAAELDECKHVVESLASKSADNQIIDKLTEENTDLNARVESFKATVEELKSEHVVA
                     KDLQQIYSDLEEELSEQLRILRENADRDKHTITLLESERAELLHELERVKSHANTRDF
                     CQQIEQLSSQLSKTQMIAKRSVLNEKFSNIGLGDQGSRAPLTLSKQVQFLSNHLLQEQ
                     FPADLQVKLQGSFFLQLMAQELMAWHRQREIYTDTLHSFKPTAFQINEWKELIFDNKI
                     PQECSADSIAHHLKNQGGPLNKDASFLLSFISATAETFLPLIFDILSKDFDLKKVSLI
                     HSKAKQLATTCKKQQEQIPIGSAGVTHDPKISELLSTYFQDVVFILTSGKSDNDSIDR
                     AIESLEALNFVLENMKFDKISSASKVSVEQPKLQSNLLVEDRVHNSNGSTPKARLRDN
                     RIEELELKLKVYENKVERHKHQEETIVKLQQELHGLKCNKNTLEASVSALQARSSELT
                     EKLESERIRQNFLFPKPQMIDLVKEMEATDKIDLISQISDLRRVIVKHEEAKYTLEED
                     KWLRKPIEARGNIVNSEFFTKLNDAHKSIDCLVKSLDVVPLDVNYSGKERSTNISSYY
                     CKSLKERSIGIESLLSGLCKQ"
     gene            <973790..>974320
                     /locus_tag="KLTH0D11924g"
                     /db_xref="GeneID:8295469"
     mRNA            <973790..>974320
                     /locus_tag="KLTH0D11924g"
                     /product="KLTH0D11924p"
                     /transcript_id="XM_002553183.1"
                     /db_xref="GeneID:8295469"
     CDS             973790..974320
                     /locus_tag="KLTH0D11924g"
                     /note="highly similar to uniprot|P06704 Saccharomyces
                     cerevisiae YOR257W CDC31 Component of the spindle pole
                     body (SPB) half-bridge required for SPB duplication in
                     mitosis and meiosis II homolog of mammalian centrin
                     interacts with Kar1p"
                     /codon_start=1
                     /product="KLTH0D11924p"
                     /protein_id="XP_002553229.1"
                     /db_xref="GeneID:8295469"
                     /db_xref="GOA:C5DF36"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR029530"
                     /db_xref="UniProtKB/TrEMBL:C5DF36"
                     /translation="MSHRRTTPRGSLNGAGSYKPSNSENSVLQRELLEENKQEIFEAF
                     SLFDMNNDGFLDYHEFKVAARALGFEMSKTELLELLEKYDRDGRRLIHYDDFFLVMGE
                     RILERDPLDEIRRAFKLFDDDNTGKISLKNLRRVAKELGENLTDDELRAMIDEFDLDN
                     DGEISEREFIAICTDM"
     gene            <974554..>975435
                     /locus_tag="KLTH0D11946g"
                     /db_xref="GeneID:8295470"
     mRNA            <974554..>975435
                     /locus_tag="KLTH0D11946g"
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /transcript_id="XM_002553184.1"
                     /db_xref="GeneID:8295470"
     CDS             974554..975435
                     /locus_tag="KLTH0D11946g"
                     /note="similar to uniprot|P36534 Saccharomyces cerevisiae
                     YPL173W MRPL40 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /protein_id="XP_002553230.1"
                     /db_xref="GeneID:8295470"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:C5DF37"
                     /translation="MSGYQHLSKAGSRFLKQVERRPKHLVDHFKKFEEKSMPSFLVPS
                     IPRVENDQKFQSVREWVFMPGDRVVITRGRWKGQISVIQQHDKETNGFILDENGPTKT
                     VPVPKQFWSEGQNSHMVTFPIAVEKKDLKLVADIDDPAAPGQTKTVAVRDIVFKGSYF
                     DENYKQRMPFRCVSGQEDLVIPWPRPEPKADAELATPAEVAREQTFWVESIAKNPIPE
                     GALLTVRNPHSKWRRGTLSARDIAKLVAPKMPLTKTKKAYIAEQKELAAAPRRKLTSE
                     DKELIGSKIFQHLKQHL"
     gene            <975613..>976254
                     /locus_tag="KLTH0D11968g"
                     /db_xref="GeneID:8295471"
     mRNA            <975613..>976254
                     /locus_tag="KLTH0D11968g"
                     /product="KLTH0D11968p"
                     /transcript_id="XM_002553185.1"
                     /db_xref="GeneID:8295471"
     CDS             975613..976254
                     /locus_tag="KLTH0D11968g"
                     /note="similar to uniprot|Q08702 Saccharomyces cerevisiae
                     YOR258W HNT3 Member of the third branch of the histidine
                     triad (HIT) superfamily of nucleotide-binding proteins
                     similar to Aprataxin a Hint related protein that is
                     mutated in individuals with ataxia with oculomotor
                     apraxia"
                     /codon_start=1
                     /product="KLTH0D11968p"
                     /protein_id="XP_002553231.1"
                     /db_xref="GeneID:8295471"
                     /db_xref="GOA:C5DF38"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:C5DF38"
                     /translation="MSFRYVLKNYIVEPQLYPDEVLFFDSHAVIIKDAFPKSQFHFLI
                     LPRDLKITWTDPTSLSAEQKSKLQGYVDWALTRAFEDFTKSYTFSKEGMIPFEKKYQF
                     EDKQFFIDKFTQVGIHSVPSLKNLHIHVMTKDFYSDRMKNKKHYNSFNTTFFVNWRRL
                     PLEESPDATYLENEVIKKTDLKCCYCKKNFKNRFSELKLHLDREFKVRFTNQS"
     gene            complement(<976271..>977572)
                     /locus_tag="KLTH0D11990g"
                     /db_xref="GeneID:8295472"
     mRNA            complement(<976271..>977572)
                     /locus_tag="KLTH0D11990g"
                     /product="KLTH0D11990p"
                     /transcript_id="XM_002553186.1"
                     /db_xref="GeneID:8295472"
     CDS             complement(976271..977572)
                     /locus_tag="KLTH0D11990g"
                     /note="highly similar to uniprot|P53549 Saccharomyces
                     cerevisiae YOR259C RPT4 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates required for
                     spindle pole body duplication localized mainly to the
                     nucleus throughout the cell cycle"
                     /codon_start=1
                     /product="KLTH0D11990p"
                     /protein_id="XP_002553232.1"
                     /db_xref="GeneID:8295472"
                     /db_xref="GOA:C5DF39"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DF39"
                     /translation="MSEEQDPLMAAFQNAEGADGNATSENRASGRENDTEPARVEVDP
                     AQEARNKALTAFKKKLTEHRRYEDQLKQRRQGIRDMEKEYEKTENDIKALQSIGQLIG
                     EVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETD
                     PLVYNMTSFEQGDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYG
                     PPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFM
                     DEIDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALL
                     RPGRLDRKIEINLPNETGRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCIT