GenomeNet

Database: RefSeq
Entry: NC_013082
LinkDB: NC_013082
Original site: NC_013082 
LOCUS       NC_013082            1632914 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome F complete sequence.
ACCESSION   NC_013082
VERSION     NC_013082.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 1632914)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1632914)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1632914)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928170.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1632914
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="F"
     gene            complement(<4885..>5721)
                     /locus_tag="KLTH0F00110g"
                     /db_xref="GeneID:8292403"
     mRNA            complement(<4885..>5721)
                     /locus_tag="KLTH0F00110g"
                     /product="KLTH0F00110p"
                     /transcript_id="XM_002554171.1"
                     /db_xref="GeneID:8292403"
     CDS             complement(4885..5721)
                     /locus_tag="KLTH0F00110g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00110p"
                     /protein_id="XP_002554217.1"
                     /db_xref="GeneID:8292403"
                     /db_xref="GOA:C5DJX9"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DJX9"
                     /translation="MMSDAWGLQAKEYAEKLQKGPPKASVDAILQAVDSLLPFEKAKS
                     ILDNGCGTGLGTQTLIDKYGHQLPDLIHLVAADLSPGMIESVRMTKAAHKGNRFWDRL
                     ELQVCSVDNMSKTQNSCFSHIIASLVFFFAKPEATFSEAYRILQPGGVIGFTSFRENQ
                     WMDLRNVAKKINPGLEPAPLPAEWASEEWIKRQLEKANFIDIKIEPMEVYVELDDSLP
                     LATLLVRSGIPEMSAVFQSLTDEEKDRAVQLIVEELAERYPKRPAKIPGILLVSSARK
                     QL"
     gene            complement(<6732..>7352)
                     /locus_tag="KLTH0F00132g"
                     /db_xref="GeneID:8292404"
     mRNA            complement(<6732..>7352)
                     /locus_tag="KLTH0F00132g"
                     /product="KLTH0F00132p"
                     /transcript_id="XM_002554172.1"
                     /db_xref="GeneID:8292404"
     CDS             complement(6732..7352)
                     /locus_tag="KLTH0F00132g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00132p"
                     /protein_id="XP_002554218.1"
                     /db_xref="GeneID:8292404"
                     /db_xref="GOA:C5DJX7"
                     /db_xref="InterPro:IPR004898"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="UniProtKB/TrEMBL:C5DJX7"
                     /translation="MRGQAVVAIFTSLLTASTVSSSPSYYGSPERQRNKRELLPRSSG
                     TSVLKAAQTVAAGKTFDGGMKVFDRGVTCTGQAEGSSSDAVFIIESGGTLSNVIIGPN
                     QIEGIHCKGGCTLNNVWWSDVCEDAFTIKTQTESQTTYIKGGGAFGAADKVIQHNGAG
                     TVSVSDFTVGDFGKLYRSCGNCKNMYKRNVVLNNITATSGKILVGM"
     gene            complement(<18324..>18956)
                     /locus_tag="KLTH0F00176g"
                     /db_xref="GeneID:8292406"
     mRNA            complement(<18324..>18956)
                     /locus_tag="KLTH0F00176g"
                     /product="KLTH0F00176p"
                     /transcript_id="XM_002554173.1"
                     /db_xref="GeneID:8292406"
     CDS             complement(18324..18956)
                     /locus_tag="KLTH0F00176g"
                     /note="similar to uniprot|P53058 Saccharomyces cerevisiae
                     YGL258W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F00176p"
                     /protein_id="XP_002554219.1"
                     /db_xref="GeneID:8292406"
                     /db_xref="InterPro:IPR019435"
                     /db_xref="UniProtKB/TrEMBL:C5DJY1"
                     /translation="MWLSTLFLFVTGILSTSVAAFRYDWSNITCKGLHGPHCGTYLLK
                     VKNQNDTYLGQSYFVGADALANDATDAWGRLLHEEYRFIPRLTTVQTLNDTGNFRPFV
                     GTTDMSTCNFQSVENAVVPYINTVTNELSYDSWASISMNATAVTGVAPQLLKASTYGI
                     QVAICNPGFITDLFQSPTVNLFNVEDTLPSWCEAIEVEAVCPADVNYDTR"
     gene            complement(19990..20062)
                     /locus_tag="KLTH0F00198r"
                     /db_xref="GeneID:8292407"
     tRNA            complement(19990..20062)
                     /locus_tag="KLTH0F00198r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8292407"
     gene            21017..21087
                     /locus_tag="KLTH0F00220r"
                     /db_xref="GeneID:8292408"
     tRNA            21017..21087
                     /locus_tag="KLTH0F00220r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=62.63"
                     /db_xref="GeneID:8292408"
     gene            complement(<21856..>22284)
                     /locus_tag="KLTH0F00242g"
                     /db_xref="GeneID:8292409"
     mRNA            complement(<21856..>22284)
                     /locus_tag="KLTH0F00242g"
                     /product="KLTH0F00242p"
                     /transcript_id="XM_002554174.1"
                     /db_xref="GeneID:8292409"
     CDS             complement(21856..22284)
                     /locus_tag="KLTH0F00242g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00242p"
                     /protein_id="XP_002554220.1"
                     /db_xref="GeneID:8292409"
                     /db_xref="GOA:C5DJY2"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5DJY2"
                     /translation="MDSRGLTISLESIKKVCLMLLEPNYKSRQEVCDKIYENYATLLQ
                     DAVVESKEKPRSGQQRRTLLSKDTRLFLESVFEKKRSPNSRERKAIADKCGLTPIYIS
                     FSVFSSSQGHGSQQKTFPTYSPIFLTFFMFWSNFRTFNTP"
     gene            <22655..>23332
                     /locus_tag="KLTH0F00264g"
                     /db_xref="GeneID:8292410"
     mRNA            <22655..>23332
                     /locus_tag="KLTH0F00264g"
                     /product="KLTH0F00264p"
                     /transcript_id="XM_002554175.1"
                     /db_xref="GeneID:8292410"
     CDS             22655..23332
                     /locus_tag="KLTH0F00264g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00264p"
                     /protein_id="XP_002554221.1"
                     /db_xref="GeneID:8292410"
                     /db_xref="UniProtKB/TrEMBL:C5DJY3"
                     /translation="MILSELNKVENMNWTEGYAECHLPKVANQIKYKFGTQKTLGKDR
                     FPCIAQRKCPKQICHFVTSGKTDKIKQSGLKSRNKFILMRGLLHCMVQQLRNCSDPFN
                     ANRAKVEEVSKIASAIWRTNKGVFQSYHEMLAVFEDSKSTNITISKSTLKKLTEAIGR
                     ECIPSTYSYETLTNGADTTAMESKKTYKAFCGRFSLKEATGRVRKKKPTQTFALRSAK
                     IEDIFLI"
     repeat_region   complement(24067..24483)
                     /rpt_type=long_terminal_repeat
     gene            complement(<26133..>27077)
                     /locus_tag="KLTH0F00308g"
                     /db_xref="GeneID:8292412"
     mRNA            complement(<26133..>27077)
                     /locus_tag="KLTH0F00308g"
                     /product="KLTH0F00308p"
                     /transcript_id="XM_002554176.1"
                     /db_xref="GeneID:8292412"
     CDS             complement(26133..27077)
                     /locus_tag="KLTH0F00308g"
                     /note="highly similar to uniprot|P28272 Saccharomyces
                     cerevisiae YKL216W URA1 The enzyme catalyzes the
                     conversion of dihydroorotic acid to orotic acid
                     dihydroorotate dehydrogenase"
                     /codon_start=1
                     /product="KLTH0F00308p"
                     /protein_id="XP_002554222.1"
                     /db_xref="GeneID:8292412"
                     /db_xref="GOA:C5DJY4"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005720"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024920"
                     /db_xref="UniProtKB/TrEMBL:C5DJY4"
                     /translation="MPASLKTEFLGQSFENPFMNASGVHCMSKRELDELKNSGAGSYI
                     TKSSTTLSREGNPAPRYHSVPLGSINSMGLPNEGFDYYLDYVLQYQKENPENVPPFFS
                     VAGMSLNENLELLKKIQDSEYRGITELNLSCPNVPGKPQVAYDFEITKEILTKAFEFF
                     KKPLGVKLPPYFDFAHFDIMAKILNEYPLAYVNCINSIGNGLYIDIEREAVVIKPKDG
                     FGGLGGEYVKPTALANVRAFYTRLNPSIRIIGTGGIRTGQDAFEHILCGATMLQVGTE
                     LYKEGASIFERLGKELKEIMEKKGYNSIEEFRGKLNNL"
     gene            complement(<27980..>28891)
                     /locus_tag="KLTH0F00330g"
                     /db_xref="GeneID:8292413"
     mRNA            complement(<27980..>28891)
                     /locus_tag="KLTH0F00330g"
                     /product="KLTH0F00330p"
                     /transcript_id="XM_002554177.1"
                     /db_xref="GeneID:8292413"
     CDS             complement(27980..28891)
                     /locus_tag="KLTH0F00330g"
                     /note="similar to uniprot|P32331 Saccharomyces cerevisiae
                     YPR058W YMC1 Putative mitochondrial inner membrane
                     transporter member of the mitochondrial carrier (MCF)
                     family"
                     /codon_start=1
                     /product="KLTH0F00330p"
                     /protein_id="XP_002554223.1"
                     /db_xref="GeneID:8292413"
                     /db_xref="GOA:C5DJY5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DJY5"
                     /translation="MSDELTMPQVVDDLADKSDFHRATKDVLAGISGGIAQVLVGQPF
                     DITKVRLQTSSTSTTAFKVIKDLIKNEGVSAFYKGTTTPLIGVGLCVSSQFGTNEAMK
                     RYFHRKNNFQSPTLRLSEYYVCGFVSGSANAFLATPIEHVRIRLQVQTKSLAEAEYRG
                     AIDCIKKLLAEGKLMRGFTPTISRTSHGFGVYFLSYETMICGERKRGVARENIPAWKL
                     CLFGALSGSLLWMMVYPFDVIKSVMQTDKLRKPVYGNNVVEVAKNIYRERGAGAFLKG
                     FGPTMLRSLPVNGATFTTFEMAMRLMN"
     gene            <30187..>30670
                     /locus_tag="KLTH0F00352g"
                     /db_xref="GeneID:8292414"
     mRNA            join(<30187..30250,30300..>30670)
                     /locus_tag="KLTH0F00352g"
                     /product="KLTH0F00352p"
                     /transcript_id="XM_002554178.1"
                     /db_xref="GeneID:8292414"
     CDS             join(30187..30250,30300..30670)
                     /locus_tag="KLTH0F00352g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00352p"
                     /protein_id="XP_002554224.1"
                     /db_xref="GeneID:8292414"
                     /db_xref="UniProtKB/TrEMBL:C5DJY6"
                     /translation="MTRYFACLYIQRRLASSGARKREVQQVNRERERLHWESEKNARK
                     QVEEVLVAGSRAVVARTSASESATNLANCFNNFIADGANGDFAALATSIAEFTVATAG
                     SKDAQDFLCALKDLTGTEEEMTDKVIDLNIHLQRLFANQTLT"
     gene            complement(<30927..>31676)
                     /locus_tag="KLTH0F00374g"
                     /db_xref="GeneID:8292415"
     mRNA            complement(<30927..>31676)
                     /locus_tag="KLTH0F00374g"
                     /product="KLTH0F00374p"
                     /transcript_id="XM_002554179.1"
                     /db_xref="GeneID:8292415"
     CDS             complement(30927..31676)
                     /locus_tag="KLTH0F00374g"
                     /note="weakly similar to uniprot|P01365 Saccharomyces
                     cerevisiae YCR040W MATALPHA1 Transcriptional co-activator
                     involved in regulation of mating-type-specific gene
                     expression targets the transcription factor Mcm1p to the
                     promoters of alpha-specific genes one of two genes encoded
                     by the alpha mating type cassette"
                     /codon_start=1
                     /product="KLTH0F00374p"
                     /protein_id="XP_002554225.1"
                     /db_xref="GeneID:8292415"
                     /db_xref="GOA:C5DJY7"
                     /db_xref="InterPro:IPR006856"
                     /db_xref="InterPro:IPR017931"
                     /db_xref="UniProtKB/TrEMBL:C5DJY7"
                     /translation="MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKP
                     QAIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFI
                     GFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLE
                     ENYQQSYEESELDSECMAKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSL
                     NSLPFFEEHNRTTDWMLSSILQCDQVPYYPN"
     gene            <31990..>32612
                     /locus_tag="KLTH0F00396g"
                     /db_xref="GeneID:8292416"
     mRNA            join(<31990..32051,32348..>32612)
                     /locus_tag="KLTH0F00396g"
                     /product="KLTH0F00396p"
                     /transcript_id="XM_002554180.1"
                     /db_xref="GeneID:8292416"
     CDS             join(31990..32051,32348..32612)
                     /locus_tag="KLTH0F00396g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00396p"
                     /protein_id="XP_002554226.1"
                     /db_xref="GeneID:8292416"
                     /db_xref="GOA:C5DJY8"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR008422"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5DJY8"
                     /translation="MSHISVSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNA
                     TAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLL
                     EPILNS"
     repeat_region   complement(33726..34066)
                     /rpt_type=long_terminal_repeat
     gene            complement(<34215..>35240)
                     /locus_tag="KLTH0F00440g"
                     /db_xref="GeneID:8292418"
     mRNA            complement(<34215..>35240)
                     /locus_tag="KLTH0F00440g"
                     /product="KLTH0F00440p"
                     /transcript_id="XM_002554181.1"
                     /db_xref="GeneID:8292418"
     CDS             complement(34215..35240)
                     /locus_tag="KLTH0F00440g"
                     /note="similar to uniprot|P25379 Saccharomyces cerevisiae
                     YCL064C CHA1 catabolism of hydroxy amino acids catabolic
                     serine (threonine) dehydratase"
                     /codon_start=1
                     /product="KLTH0F00440p"
                     /protein_id="XP_002554227.1"
                     /db_xref="GeneID:8292418"
                     /db_xref="GOA:C5DJY9"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:C5DJY9"
                     /translation="MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSR
                     GIGYMITKQAIKIRSEGNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRM
                     VQKIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSI
                     VDEIIDSLKEQKIDLKNIKAIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCE
                     VFNSSLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLR
                     FADETNIIPEPACGAALHLGYYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASL
                     FSKKILQ"
     gene            <35640..>36995
                     /locus_tag="KLTH0F00462g"
                     /db_xref="GeneID:8292419"
     mRNA            <35640..>36995
                     /locus_tag="KLTH0F00462g"
                     /product="KLTH0F00462p"
                     /transcript_id="XM_002554182.1"
                     /db_xref="GeneID:8292419"
     CDS             35640..36995
                     /locus_tag="KLTH0F00462g"
                     /note="weakly similar to uniprot|P25591 Saccharomyces
                     cerevisiae YCL063W VAC17 vacuole inheritance"
                     /codon_start=1
                     /product="KLTH0F00462p"
                     /protein_id="XP_002554228.1"
                     /db_xref="GeneID:8292419"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ0"
                     /translation="MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSD
                     KSSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAK
                     NDENFISYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNR
                     GDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHE
                     NRLNFFKDRQRLSISFIEDEEDVSDEATVISAGSLQSAYIFETDIKSSPFKSQIGEKE
                     IRIPKAGYLAVGEKSKGFNNLLSATPSAPQIGITEVDYKPNFGFSHQPGVEREASQSK
                     KMLSQLVSQGNKTKCKNWFNECDGLGKPISNTLRLLNNLVLVTSETGLRSVNNTTSAK
                     LLMPPRKRKEKQAAHGSCSIFIHGSSRSKFVTAPQQTKLHFKVSHGALQEALNTDLDF
                     K"
     gene            complement(<37017..>39998)
                     /locus_tag="KLTH0F00484g"
                     /db_xref="GeneID:8292420"
     mRNA            complement(<37017..>39998)
                     /locus_tag="KLTH0F00484g"
                     /product="KLTH0F00484p"
                     /transcript_id="XM_002554183.1"
                     /db_xref="GeneID:8292420"
     CDS             complement(37017..39998)
                     /locus_tag="KLTH0F00484g"
                     /note="weakly similar to uniprot|P25588 Saccharomyces
                     cerevisiae YCL061C MRC1 S-phase checkpoint protein found
                     at replication forks required for DNA replication also
                     required for Rad53p activation during DNA replication
                     stress where it forms a replication-pausing complex with
                     Tof1p and is phosphorylated by Mec1p protein involved in
                     replication checkpoint"
                     /codon_start=1
                     /product="KLTH0F00484p"
                     /protein_id="XP_002554229.1"
                     /db_xref="GeneID:8292420"
                     /db_xref="InterPro:IPR018564"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ1"
                     /translation="MDLIDNLRARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLR
                     RVKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKS
                     WAGPTNKPNYPKDKRRVSSNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQL
                     LLPDVDLHPTNQSSNNTILDGTITQISGFGETCHDNAIQATSKDVSDTSTFVPITTKT
                     KYSNSSLSFNANDPEEESNTIAMSPADATERDRTIRKRFDAQSFIESFDDETDELQSC
                     AASNASETEAPVLKQLEDGEKNANNLKKPTHFESNRENNPNKDSSSIKIFPTMFEENK
                     ADASAIILSSSSEEEEDYESKKPSFKAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQ
                     ILFASLRKANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLERELARNKKIRLREI
                     EQERQNERKDFGEQSSAFDYSNDELEEEPSDEEIDENQSSSPVSLHSGIVCADDAVEC
                     AANRMQDLKQTIKPNEEEDAIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGS
                     NIGNLNQIEQEQVGEHVGAHIENDLTTTGRNKNLIKPSSRSSSFQVEDNSHEDMNPGV
                     IRELIEKHKRKELLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDS
                     DLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLE
                     LSDDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALED
                     EGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNL
                     GSLPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNMLIDDQEDLLSRKRACSFF
                     ARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRK
                     RGHKPAAGFGIFASNSESFES"
     gene            complement(<40222..>41220)
                     /locus_tag="KLTH0F00506g"
                     /db_xref="GeneID:8292421"
     mRNA            complement(<40222..>41220)
                     /locus_tag="KLTH0F00506g"
                     /product="90S preribosome/SSU processome component KRR1"
                     /transcript_id="XM_002554184.1"
                     /db_xref="GeneID:8292421"
     CDS             complement(40222..41220)
                     /locus_tag="KLTH0F00506g"
                     /note="highly similar to uniprot|P25586 Saccharomyces
                     cerevisiae YCL059C KRR1 Essential nucleolar protein
                     required for the synthesis of 18S rRNA and for the
                     assembly of 40S ribosomal subunit"
                     /codon_start=1
                     /product="90S preribosome/SSU processome component KRR1"
                     /protein_id="XP_002554230.1"
                     /db_xref="GeneID:8292421"
                     /db_xref="GOA:C5DJZ2"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR024166"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ2"
                     /translation="MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTL
                     FPKYREAYLKSVWNDVTRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIK
                     LLARSVPFPQAVKILQDDTACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLT
                     KCYILVQGNTVSAMGPFKGLKEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEE
                     DWSRFLPMFKKRNVARKKPKNIKPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEK
                     EAKKLEERKREQAEKQVEKNKERAKDYVAPIEKGYEGSSKKRRHEVQESPKKKTKV"
     gene            <41595..>41909
                     /locus_tag="KLTH0F00528g"
                     /db_xref="GeneID:8292422"
     mRNA            <41595..>41909
                     /locus_tag="KLTH0F00528g"
                     /product="KLTH0F00528p"
                     /transcript_id="XM_002554185.1"
                     /db_xref="GeneID:8292422"
     CDS             41595..41909
                     /locus_tag="KLTH0F00528g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00528p"
                     /protein_id="XP_002554231.1"
                     /db_xref="GeneID:8292422"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ3"
                     /translation="MARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLIS
                     ELNEREHNTKRTPALESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGF
                     SL"
     gene            complement(<42092..>42340)
                     /locus_tag="KLTH0F00550g"
                     /db_xref="GeneID:8292423"
     mRNA            complement(<42092..>42340)
                     /locus_tag="KLTH0F00550g"
                     /product="KLTH0F00550p"
                     /transcript_id="XM_002554186.1"
                     /db_xref="GeneID:8292423"
     CDS             complement(42092..42340)
                     /locus_tag="KLTH0F00550g"
                     /note="similar to uniprot|Q96VH5 Saccharomyces cerevisiae
                     YCL057C-A"
                     /codon_start=1
                     /product="KLTH0F00550p"
                     /protein_id="XP_002554232.1"
                     /db_xref="GeneID:8292423"
                     /db_xref="InterPro:IPR007512"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ4"
                     /translation="MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLL
                     FKRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVKA"
     gene            complement(<42946..>43533)
                     /locus_tag="KLTH0F00572g"
                     /db_xref="GeneID:8292424"
     mRNA            complement(<42946..>43533)
                     /locus_tag="KLTH0F00572g"
                     /product="KLTH0F00572p"
                     /transcript_id="XM_002554187.1"
                     /db_xref="GeneID:8292424"
     CDS             complement(42946..43533)
                     /locus_tag="KLTH0F00572g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00572p"
                     /protein_id="XP_002554233.1"
                     /db_xref="GeneID:8292424"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ5"
                     /translation="MDTHPGKSRPLSKRGSRSCPDKPSTLEGQGKNIESALVSGLETI
                     AGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISR
                     SRLKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILVALELIQNIGYLTLVAADV
                     LAFGLTEKWKRLLERVSSIFAIARLLFSGFSSLTP"
     gene            complement(<43649..>44950)
                     /locus_tag="KLTH0F00594g"
                     /db_xref="GeneID:8292425"
     mRNA            complement(<43649..>44950)
                     /locus_tag="KLTH0F00594g"
                     /product="KLTH0F00594p"
                     /transcript_id="XM_002554188.1"
                     /db_xref="GeneID:8292425"
     CDS             complement(43649..44950)
                     /locus_tag="KLTH0F00594g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00594p"
                     /protein_id="XP_002554234.1"
                     /db_xref="GeneID:8292425"
                     /db_xref="GOA:C5DJZ6"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ6"
                     /translation="MITLRISSRTTPQGLQRDDLKARLIYQSMARSTEEKIAELQNLY
                     PDYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPESSSKRFKSRQQQTLNRFLDVRLLPK
                     AAIKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLELANKLLEALSKDTSFKPNE
                     FYLFGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDEIMMAQILVEELVNDVL
                     SQRTALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREF
                     RVRRVHPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDV
                     RVNLTFRNYALTTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYTEENSFKEGRE
                     CKGFAFACFKKKPPFTEFETDGSRWIADDDLEAKQAQRQLK"
     gene            <46437..>47438
                     /locus_tag="KLTH0F00616g"
                     /db_xref="GeneID:8292426"
     mRNA            <46437..>47438
                     /locus_tag="KLTH0F00616g"
                     /product="KLTH0F00616p"
                     /transcript_id="XM_002554189.1"
                     /db_xref="GeneID:8292426"
     CDS             46437..47438
                     /locus_tag="KLTH0F00616g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00616p"
                     /protein_id="XP_002554235.1"
                     /db_xref="GeneID:8292426"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ7"
                     /translation="MELQSKRSHSALGACQEGLPLKRRVLNLAPSPVSMSSRTNIPRS
                     SFLLSKNSTSEEDNEAYDSDFSKKPAVHFKTAPTVDSTLIDAVSKYSESEKEAPEDVG
                     RANAGAATDPHEGLDSSYLLERRRSLSRHPSFSSSSRKQTVPRSDSVAQERCFDYLLQ
                     SIDEVWARYCNTTATAEAKVYDNLSKPQRALDPYTESHDDSFARKSSTPVTPRYQRVL
                     SFASVNNFSDEDSDDTSGYKSEITNPTEYETDCDYRKISNLPDSIRLQSLKDRLCRAK
                     NDLEDLHDSNSFDDCVRFWRRWDMIKYSAVEMMEEDDDDDIIESVIEELERGRCIVN"
     gene            <47778..>50513
                     /locus_tag="KLTH0F00638g"
                     /db_xref="GeneID:8292427"
     mRNA            <47778..>50513
                     /locus_tag="KLTH0F00638g"
                     /product="KLTH0F00638p"
                     /transcript_id="XM_002554190.1"
                     /db_xref="GeneID:8292427"
     CDS             47778..50513
                     /locus_tag="KLTH0F00638g"
                     /note="weakly similar to uniprot|P37020 Saccharomyces
                     cerevisiae YJR040w"
                     /codon_start=1
                     /product="KLTH0F00638p"
                     /protein_id="XP_002554236.1"
                     /db_xref="GeneID:8292427"
                     /db_xref="GOA:C5DJZ8"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ8"
                     /translation="MPFKNAAAHNDSNTFHSAMKGSSRRIRGRSSQRGGVSRAASVNL
                     RLEGLPGPGVINEVVQGTESPHPHSKALSQLTQISSIRSPIRNAGPQDYFHINSQGSS
                     PTKYGSTDQGRNGQESEASLYSESTQPPYLFPKFRNLTETLNSETLLPRNYYDDFTSV
                     DWVKDYLYDVWQKQQMSALRGFTGKLKRVYGNAQDWVLITVVAFSCSLLAFFIDKAEE
                     LLVDLKRGYCKSNFFFNQQQCCASYTCANWKLWPEALRFLHGGVLRSDFMVYTFLSLI
                     LALSAAKVTLTTKYINPLAFQTDKKIFKTMYHAYGSGVPEVKTILSGFIIRKFLGTYT
                     LFSKSIALVLAIASGLSLGKEGPYVHLATCVGNIVSRQFAKFKLNGIERRVILSASAA
                     AGVTLAFGSPLGGVLFSLEEVSYFLPGNQLFKTFFSAIMANLFLRLLNPYGTGKAVLF
                     EVKYSSDWQTTELFLVTIIGAIGGVFGAYFCKFASFWGSWFRSKSFIREKHLREVALI
                     ALLTAALTFPNSYTNISVAELLANLASPCFSPDDFTGKHGLCPVDRKSFPSEIVPLSY
                     ALIVKIVLTSITFGVKVPAGIYVPSMVIGALFGRIFATWFEHLASLYPNFFVFTQICN
                     KSGLEGVCIDMGIYAMISAGAFMAGVTRMNVTLAIIIFELTSSYNYVVPISIAIAVSN
                     LVAHVIEPQSLYEMLMRKNDLPFLDNRKVRDFRNHDGLREIVSTLKQGNGNIYVNLSE
                     QKAFSSAVLREHLSNLQKEGLVDGCIPIINNGKLAGVLPAPELELALDKLKCFADEFK
                     LTQDLKVRLLEVDTSIPSRGGDKNFTSPIESFPNLTSQEEWLAVNEILEKLCDLTPIV
                     EKFPIMLDLNSSPSLVELIFTKLGNRFISVLDGDEFVGLVHRKHFIDYCRDKAIL"
     gene            <51436..>52404
                     /locus_tag="KLTH0F00660g"
                     /db_xref="GeneID:8292428"
     mRNA            <51436..>52404
                     /locus_tag="KLTH0F00660g"
                     /product="KLTH0F00660p"
                     /transcript_id="XM_002554191.1"
                     /db_xref="GeneID:8292428"
     CDS             51436..52404
                     /locus_tag="KLTH0F00660g"
                     /note="similar to uniprot|P25583 Saccharomyces cerevisiae
                     YCL055W KAR4 Transcription factor required for induction
                     of KAR3 and CIK1 during mating also required during
                     meiosis exists in two forms a slower-migrating form more
                     abundant during vegetative growth and a faster- migrating
                     form induced by pheromone"
                     /codon_start=1
                     /product="KLTH0F00660p"
                     /protein_id="XP_002554237.1"
                     /db_xref="GeneID:8292428"
                     /db_xref="GOA:C5DJZ9"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="UniProtKB/TrEMBL:C5DJZ9"
                     /translation="MSHDRTAPKNSIEHSRKRKSNASLKAAAHLHNNNYTDHYIHTGA
                     LPQKNVRNTDNPVEGYPNLQKLFRLKEKQIANHSSAPYGCRLDIDEMVPTLKNWIHNE
                     KIVFDVVMIGCLTDNQFIYPLLTGLPIDKLISKPGFLFIWGSAQKINELTRLLQNDGW
                     AKKFRKSEELVFIPIDKKSPFYPGLDNDDQVLFEKMQWHCWMCITGTVRRATDGHLIH
                     CNVDTDLSIETESTRKSAIPSHLYKVAENFSTATRRLHIIPARTGTETPVKVRPGWVI
                     MSPDVMLNNFDSKRYREDINKVGAHLPIRNEIELLRPKSPVQKRNS"
     gene            complement(<52524..>54041)
                     /locus_tag="KLTH0F00682g"
                     /db_xref="GeneID:8292429"
     mRNA            complement(<52524..>54041)
                     /locus_tag="KLTH0F00682g"
                     /product="KLTH0F00682p"
                     /transcript_id="XM_002554192.1"
                     /db_xref="GeneID:8292429"
     CDS             complement(52524..54041)
                     /locus_tag="KLTH0F00682g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F00682p"
                     /protein_id="XP_002554238.1"
                     /db_xref="GeneID:8292429"
                     /db_xref="GOA:C5DK00"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DK00"
                     /translation="MPSYTFGGLDFQETPAAPNPEPSNTKFGVRTTDSPAIKNAPLPA
                     EGPSSKHFSNLLVLALITGIPFYVTRKLGGGTKTFVFFFLLFVLPILMAYWTLASTFS
                     PRLNEKCKLPGKPIEHYLTFHDDRLARKYHDKKIPMETFHELYFANKVSFNGDALEIL
                     EYRHDWAQFSFTLSLFKFFLFGMIPEVIMHTRSQDEEQVRDHYDRGDDFYAWFLGPRM
                     VYTSGVISDIESEETLEQLQDNKLKVVCDKIDLKAGEYLLDLGCGWGTLAAYASKVCG
                     AKVTGITLGRNQTKWGNEKLELQGISETQSRILCLDYRDTPMATAEGKKYDKITCLEM
                     AEHVGIRKFGAFLQQVYDMLEDDGLFYLQYAGLRKSWQYEDLIWGLFMNKYIFPGADA
                     STPLDFVVGKLEGSGFEVVSIDNIGVHYSATLWRWYRNWMGNKDSVVNKYGVKWFRVW
                     EYFLATSTIISRQGSATCFQIVLRKNINAYHRIEYVPKQKGLLGPIKEGVPKWFK"
     gene            <55161..>57653
                     /locus_tag="KLTH0F00704g"
                     /db_xref="GeneID:8292430"
     mRNA            <55161..>57653
                     /locus_tag="KLTH0F00704g"
                     /product="KLTH0F00704p"
                     /transcript_id="XM_002554193.1"
                     /db_xref="GeneID:8292430"
     CDS             55161..57653
                     /locus_tag="KLTH0F00704g"
                     /note="similar to uniprot|P25582 Saccharomyces cerevisiae
                     YCL054W SPB1 AdoMet-dependent methyltransferase involved
                     in rRNA processing and 60S ribosomal subunit maturation
                     methylates G2922 in the putative tRNA docking site of the
                     large subunit rRNA and in the absence of snR52 U2921
                     suppressor of PAB1 mutants"
                     /codon_start=1
                     /product="KLTH0F00704p"
                     /protein_id="XP_002554239.1"
                     /db_xref="GeneID:8292430"
                     /db_xref="GOA:C5DK01"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DK01"
                     /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFM
                     EKSKVVIDLCAAPGSWCQVASNLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRS
                     KLRGYMKTWKADTVLHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKI
                     FRSKDYNKLIWVFSQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDSRLLDAREV
                     FEELPDGPQNNEAKIFNPEKKVRKRQGYEEGDYLLYHHKPIMEFVKCEDPIDMLGNLN
                     KFTVNSEDHEWKILKKLKQTTPEFMMCIEDLKVLGKKDFKMILKWRKAARELLGIEKE
                     EEPVVETTHLTEEEQIQSEVQALQEKQRLSQKREKRKKNEMKQKELTRMQMNMLTPMD
                     IGVESAELGRESLFNLKSAEKTGILDKLAKGKRRMVFTQGELAQDNDVHIADDAPLAD
                     RDDAAEADELESQLNSMYQNYKEKKAEKDAKYRAKQARGGDDNEWTGFGDEDSEHSSA
                     VEDDHVSEDENSDLSDSDDDEAINRLIAKMKNKEGENGLSSKAQALFNQSIFEGVEAD
                     LPAPEEPVNASVTAHVERLESLGKNQGDENNLSQESSSDSENSDFEVVAREDEDQVMD
                     SDFDSDDENQSQKEKHAEEIDIATVEAMTLAHQLALGQRTKHDLVDEGYNRYAFRDTE
                     NLPEWFLEDERPHSKINRPITKEAAIAIKEKMKALNARPIKKVAEAKARKAMRAVARL
                     EKIKKKAGLINDDGDKSEKDKADEIAKLMRKVTKKQKQKPKVTLVVATGKNRGLSGRP
                     KGVKGKYKMVDGVLKNEQRALKRIAKKHHKKK"
     gene            complement(<57703..>58947)
                     /locus_tag="KLTH0F00726g"
                     /db_xref="GeneID:8292431"
     mRNA            complement(<57703..>58947)
                     /locus_tag="KLTH0F00726g"
                     /product="KLTH0F00726p"
                     /transcript_id="XM_002554194.1"
                     /db_xref="GeneID:8292431"
     CDS             complement(57703..58947)
                     /locus_tag="KLTH0F00726g"
                     /note="similar to uniprot|P25580 Saccharomyces cerevisiae
                     YCL052C PBN1 Essential component of
                     glycosylphosphatidylinositol-mannosyltransferase I
                     required for the autocatalytic post-translational
                     processing of the protease B precursor Prb1p localizes to
                     ER in lumenal orientation homolog of mammalian PIG-X"
                     /codon_start=1
                     /product="KLTH0F00726p"
                     /protein_id="XP_002554240.1"
                     /db_xref="GeneID:8292431"
                     /db_xref="GOA:C5DK02"
                     /db_xref="InterPro:IPR013233"
                     /db_xref="UniProtKB/TrEMBL:C5DK02"
                     /translation="MNTSRKNDKTRVTILFEDAEDLQQNSVNALDSIVIKGRGQLVQR
                     RATSELPHNINKSFKTLRITWKSPESPGISAIAPPLSSGLNIYVSGDSERTPGAIRSA
                     KYDLLHSNDYDDSLISRFLPKDFNLTELRLKDRDYDIVVDDKIHVNEYYAIKDGFNET
                     LRYEEAYGRLEVGLFFAEPSDQLDANLNGLRCTWSFTGQIDKCQKTYLFYQQAHNMSI
                     NSTTVVEQVGPVGLHPTVRVDLRGETSSEHCRHFMYLAAPTGLFIDKFQSSPIFVAGA
                     DDLELPEYKIGDDTWGFESLFSLKPGQLNDIQLHTRYVKPRARGGFKHIHYSPIVFRA
                     CDTGNMEVQNNPFYTRSLGLESFFTNDTVFQHFHSATLSVSVPAANTNDFQAVWLVTS
                     MCLVLSVAYLLIKVYTRQNSQR"
     gene            <59375..>60589
                     /locus_tag="KLTH0F00748g"
                     /db_xref="GeneID:8292432"
     mRNA            <59375..>60589
                     /locus_tag="KLTH0F00748g"
                     /product="KLTH0F00748p"
                     /transcript_id="XM_002554195.1"
                     /db_xref="GeneID:8292432"
     CDS             59375..60589
                     /locus_tag="KLTH0F00748g"
                     /note="some similarities with uniprot|P25579 Saccharomyces
                     cerevisiae YCL051W LRE1 Protein involved in control of
                     cell wall structure and stress response inhibits Cbk1p
                     protein kinase activity overproduction confers resistance
                     to cell-wall degrading enzymes"
                     /codon_start=1
                     /product="KLTH0F00748p"
                     /protein_id="XP_002554241.1"
                     /db_xref="GeneID:8292432"
                     /db_xref="UniProtKB/TrEMBL:C5DK03"
                     /translation="MMDADRLKVPSSGEPLAPGDCTPSRRGHRHKRSFAISQDLDFLR
                     QPPGTPQEKPTHQTSPPVQHSDMSPRFFMSEESTFSHDVPNAIIDLDDALTTKPQSFT
                     SHRRAESAPANLILPFKIEPSKPPAQPLRIEEEDSESDNEYVLHDSLMSPLRAKSQSP
                     FLKSPSASTKSPQPARRSQYNNNALKINKQKERYLNYSKQLPAAGSQIQNQCCPQEPS
                     STSLSSDLTSEATTPAATVNTPNTPIFSVLKFSGRSPSPRKTFNFESQVYDLPSTDSA
                     VSDDGKDADDGNTLTFTVTNATYEPMHRRSKSVAACEASEGLRIPKEILLGEPGGSVD
                     LSKTVTDPKGEAAPSSKLEKPFKASVSGSYENRSVSDSAVVNDKISGSHSRRRGKLNI
                     LSSIFSRLKSSK"
     gene            complement(<60934..>61320)
                     /locus_tag="KLTH0F00770g"
                     /db_xref="GeneID:8292433"
     mRNA            complement(<60934..>61320)
                     /locus_tag="KLTH0F00770g"
                     /product="KLTH0F00770p"
                     /transcript_id="XM_002554196.1"
                     /db_xref="GeneID:8292433"
     CDS             complement(60934..61320)
                     /locus_tag="KLTH0F00770g"
                     /note="similar to uniprot|P00128 Saccharomyces cerevisiae
                     YDR529C"
                     /codon_start=1
                     /product="KLTH0F00770p"
                     /protein_id="XP_002554242.1"
                     /db_xref="GeneID:8292433"
                     /db_xref="GOA:C5DK04"
                     /db_xref="InterPro:IPR003197"
                     /db_xref="UniProtKB/TrEMBL:C5DK04"
                     /translation="MPQTITSIVKMGDFILRSPALSKVVVPVAQQFVKFAGYRQLGLK
                     FDDIIAEENDIAQTALRRLPEDEGYARAFRMIRAHQSELTHHLLPKSQWVKPEEDTLY
                     LTPYLLEAEAEAKEREELDNLQLTTK"
     gene            complement(<61554..>62507)
                     /locus_tag="KLTH0F00792g"
                     /db_xref="GeneID:8292434"
     mRNA            complement(<61554..>62507)
                     /locus_tag="KLTH0F00792g"
                     /product="KLTH0F00792p"
                     /transcript_id="XM_002554197.1"
                     /db_xref="GeneID:8292434"
     CDS             complement(61554..62507)
                     /locus_tag="KLTH0F00792g"
                     /note="similar to uniprot|P16550 Saccharomyces cerevisiae
                     YCL050C APA1 and similar to uniprot|P22108 Saccharomyces
                     cerevisiae YDR530C APA2"
                     /codon_start=1
                     /product="KLTH0F00792p"
                     /protein_id="XP_002554243.1"
                     /db_xref="GeneID:8292434"
                     /db_xref="GOA:C5DK05"
                     /db_xref="InterPro:IPR009163"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019200"
                     /db_xref="UniProtKB/TrEMBL:C5DK05"
                     /translation="MAQDLATKVRETYANAAKNGYVHFFQSDSKKLKDPETGVQYMVT
                     HAPSLLKKPERGDKEAEKRNPFAEPEPELTVCEDLFGEGEYKLLLNKFPVVPEHLLLV
                     TKEFKPQTSTLSPKDLITAYKLLQELDDEDEMVRNVVFYNCGASSGSSQDHKHLQMFK
                     LPEKFTLFQDRLCNGKEHYVPNVRTEPLQDSKLSFAHFAVPLPDEKEVDEELLAMTFV
                     SLLQRTLTFFQDWTNEKPELETGYNVLLTKEWLCVVPRSASKSKELNIGLNATGYAGL
                     VLVKHEDVWEKLQENPHLIDKLLLECGFPNTAGQSSNEYHY"
     gene            <62916..>63986
                     /locus_tag="KLTH0F00814g"
                     /db_xref="GeneID:8292435"
     mRNA            <62916..>63986
                     /locus_tag="KLTH0F00814g"
                     /product="KLTH0F00814p"
                     /transcript_id="XM_002554198.1"
                     /db_xref="GeneID:8292435"
     CDS             62916..63986
                     /locus_tag="KLTH0F00814g"
                     /note="similar to uniprot|Q04430 Saccharomyces cerevisiae
                     YDR531W Pantothenate kinase (ATP:D-pantothenate
                     4'-phosphotransferase EC 2.7.1.33) catalyzes the first
                     committed step in the universal biosynthetic pathway
                     leading to CoA."
                     /codon_start=1
                     /product="KLTH0F00814p"
                     /protein_id="XP_002554244.1"
                     /db_xref="GeneID:8292435"
                     /db_xref="GOA:C5DK06"
                     /db_xref="InterPro:IPR004567"
                     /db_xref="UniProtKB/TrEMBL:C5DK06"
                     /translation="MGQNIEFQENQWNSTGLLTIAVDIGGSLAKLVFNPRNCRTLIFE
                     TVETEKITEFMQLIHRIIKEYNSGDQATTRIIATGGGAYKFNDLLRSEFPRVIEIARL
                     DEMECLIKGLDFLIHEVPEEVFTYNDLDGEHVVVPEHAKVYPYMLVNIGSGVSISKVD
                     SPTKFTRVGGSSLGGGTLWGLLSLITGARTYDEMLDWAHSGDNTNVDMLVGDIYGTDY
                     GKIGLKSTHIASSFGKVFQRGTHAATADGVLSERPSQTSTEEIETRSRKFSNSDISKS
                     LLYAISNNIGQIAYLQAKVHNVPNIYFGGSYIRGHLMTMNTLSYAINFWSNGKKQAFF
                     LKHEGYLGAMGALLTFQDRSST"
     gene            complement(<64053..>65141)
                     /locus_tag="KLTH0F00836g"
                     /db_xref="GeneID:8292436"
     mRNA            complement(<64053..>65141)
                     /locus_tag="KLTH0F00836g"
                     /product="KLTH0F00836p"
                     /transcript_id="XM_002554199.1"
                     /db_xref="GeneID:8292436"
     CDS             complement(64053..65141)
                     /locus_tag="KLTH0F00836g"
                     /note="weakly similar to uniprot|Q6Q537 Saccharomyces
                     cerevisiae YDR532C Protein of unknown function that
                     localizes to the nuclear side of the spindle pole body and
                     along short spindles forms a complex with Spc105p"
                     /codon_start=1
                     /product="KLTH0F00836p"
                     /protein_id="XP_002554245.1"
                     /db_xref="GeneID:8292436"
                     /db_xref="GOA:C5DK07"
                     /translation="MADDPTINGLELQLNAAEEHATALTEEALQNQDLHYKEVVEQLK
                     RSVEQLVEDNESLFTAVDLPPEVDPTCISGRILDLAQLTQQLKSTHLQQETLDNFLRY
                     TISSTDILQLESESDERYASVSRAVSQLQDNDIIQLDSEVDQIKQDIRKAGQTIADQR
                     EALNELCLETGNLADECHTLLSELEEATRTREMVEKQAAVEVTNDHPVEEMYASWQSL
                     KEELQQESHLRRHLNQLKQSKASLEAILGTKNGNEHKDTNVMQEYASYDAFIRFWISK
                     FTNKEMENLEVFPRSNKFQFTHRGTDVVISLGPRGISRVELYGKGIPLEKIAAARKDV
                     NEEASRGEELYMSINRIIDKIKEHTTVS"
     gene            complement(<65935..>67287)
                     /locus_tag="KLTH0F00858g"
                     /db_xref="GeneID:8292437"
     mRNA            complement(<65935..>67287)
                     /locus_tag="KLTH0F00858g"
                     /product="KLTH0F00858p"
                     /transcript_id="XM_002554200.1"
                     /db_xref="GeneID:8292437"
     CDS             complement(65935..67287)
                     /locus_tag="KLTH0F00858g"
                     /note="similar to uniprot|Q04418 Saccharomyces cerevisiae
                     YDR527W"
                     /codon_start=1
                     /product="KLTH0F00858p"
                     /protein_id="XP_002554246.1"
                     /db_xref="GeneID:8292437"
                     /db_xref="InterPro:IPR013929"
                     /db_xref="InterPro:IPR013930"
                     /db_xref="UniProtKB/TrEMBL:C5DK08"
                     /translation="MDLLGDIVEKDVSEAPALHEAPPTGFPALYQPEKVSSWKVRLQQ
                     KNKQKRTSQTSKRERDTPAKRAVEEPVIPPETEAQRIHQENVTRMRSMTPEQLEQERR
                     ELLESLDPAVLHGLLKRAARREEPASLQESMKTVKAPLFAEVEGAPGTWVGGSREFSD
                     LPHLDDAAVDKALGIPETKAKHVKFQDQDDESRAEFPGDEEECFPEPLPDDDMAPQEY
                     QFVQQMDHMNNEDLLKDVHFIRPNTVDNDFEALDINDPSFDEKLHKKYFPDLPKESDK
                     MAWMKPVSSAKPTGLIEDVTQCRFDFQGSLVPPDREIKSTQDGLHHHSEEPELAGYTI
                     VELQHLSRSTFPAQRCIAIQTLGRILYKLGKQSYNQLIPEVDAGTYEEMGGAEAILNH
                     IYGMFWDLCKVSMVIESLTDAADENSTKNLSVRNYAIDALWLWKEGGGDFRTGKNENK
                     "
     gene            complement(<67565..>67795)
                     /locus_tag="KLTH0F00880g"
                     /db_xref="GeneID:8292438"
     mRNA            complement(<67565..>67795)
                     /locus_tag="KLTH0F00880g"
                     /product="KLTH0F00880p"
                     /transcript_id="XM_002554201.1"
                     /db_xref="GeneID:8292438"
     CDS             complement(67565..67795)
                     /locus_tag="KLTH0F00880g"
                     /note="similar to uniprot|P56508 Saccharomyces cerevisiae
                     YDR525W-A"
                     /codon_start=1
                     /product="KLTH0F00880p"
                     /protein_id="XP_002554247.1"
                     /db_xref="GeneID:8292438"
                     /db_xref="GOA:C5DK09"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:C5DK09"
                     /translation="MHARDWFLVFLSIFVPPIAVGLKRGFFTKDTLLNLLLFLLGYLP
                     GLIHALYVISKHPYPSVGGSLTQPNDGYGSLN"
     gene            complement(<67984..>68829)
                     /locus_tag="KLTH0F00902g"
                     /db_xref="GeneID:8292439"
     mRNA            complement(<67984..>68829)
                     /locus_tag="KLTH0F00902g"
                     /product="KLTH0F00902p"
                     /transcript_id="XM_002554202.1"
                     /db_xref="GeneID:8292439"
     CDS             complement(67984..68829)
                     /locus_tag="KLTH0F00902g"
                     /note="similar to uniprot|P32460 Saccharomyces cerevisiae
                     YIR030C DCG1 Protein of unknown function expression is
                     sensitive to nitrogen catabolite repression and regulated
                     by Dal80p contains transmembrane domain"
                     /codon_start=1
                     /product="KLTH0F00902p"
                     /protein_id="XP_002554248.1"
                     /db_xref="GeneID:8292439"
                     /db_xref="GOA:C5DK10"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="UniProtKB/TrEMBL:C5DK10"
                     /translation="MRIVLSSADRTPPATMRILLVNPNSTEAMTQAAGARVQAYLASA
                     YGAAAASLNVSLFTAPPDAPRMIDGEDASRESAAKCLPLLCRRAEPDALQYFDTFDGV
                     LIACFSDHPLVHMLQQRAERATQVTCIFHASLTACLARAGARFSIITSNDEWVALLDA
                     AAARLLGAEPPFASSKAPFKGTVASSVPVLDLHDPANLHAIAKRIYEENVVRLDTSTV
                     ILGCAGFSGMEAALSQEITKIAAQRDPGRTLHVTLVDSVISGVETLALMCRLRQDYDS
                     NMQQI"
     gene            <70601..>73144
                     /locus_tag="KLTH0F00924g"
                     /db_xref="GeneID:8292440"
     mRNA            <70601..>73144
                     /locus_tag="KLTH0F00924g"
                     /product="KLTH0F00924p"
                     /transcript_id="XM_002554203.1"
                     /db_xref="GeneID:8292440"
     CDS             70601..73144
                     /locus_tag="KLTH0F00924g"
                     /note="some similarities with uniprot|Q04412 Saccharomyces
                     cerevisiae YDR524C AGE1 ADP-ribosylation factor (ARF)
                     GTPase activating protein (GAP) effector ARF GAP with
                     effector function(s)"
                     /codon_start=1
                     /product="KLTH0F00924p"
                     /protein_id="XP_002554249.1"
                     /db_xref="GeneID:8292440"
                     /db_xref="GOA:C5DK11"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DK11"
                     /translation="MGSNTSLLARCGDARPGLVAVEPDGGEASLKFTLVDYQLALQAC
                     AAPTRYRLTVRHSGPASDLRCGARNVRGSPSYMPLPVQYLSAGDPNLVSASVSIAGLL
                     ESPGLYTVEAVLCKDTVFSAAVLIERPQKSKSAVLPTATQSHTKPQAEQTSQPAHSSS
                     TESVPRTEASLQKPGMPPSPRGSPAPFTFPPDGPQFRTLIAQCEGIVPQLRTDLKMCL
                     ERSSRVCDLLAAATKELTGLISNLQSLDTFSPSLSPHFHKTVTALRSSLSSQSQSLSR
                     LACLLQNHFNTPAHTYVTSLDSKQLASRHKIYHDQAKLFYSYMGKNLSSADSANLSKK
                     IQFELHRLDFFIYLTGLFNGPAARKLIYEWSRFPSSVFPNSSSSALLLQETAQYQSDF
                     KARKAQMNAQREKISRSRSFSDFSAQVSTQSHKVFKEGILWTYKGHGKSSGWHKQWVV
                     LKDSTLSEYSDWKTQGKKLSHPPLSLTFACIKRHESGNYNAFEIITTTGVTRAFRAES
                     KSDLDQWVQLLQIAVGLGTQTPSPEEESDTLTPLSIVASVDNCNKICCDCGGTSQVEW
                     ISINLLCVICIKCSAVHRSLGSHISKVRSLKLDSFTSKEILELLKFVSNKNLNSIYEA
                     ELPKRQVTSDSSNEERTAFISDKYVKKRYVSPLQEQEPEAVQKRLHHNLIKSIHLNSI
                     YLLQQCLAQGVDINSVKLDNGETVFQYSLQHYMGTKTEPIFFITEFLLLNGLQVGRLP
                     RDASSLSKTEYNYWKSKAETNGVYSTKPLVRSATTRETFKSMARIDTSGPSPPQSRQA
                     SSASETSDSGSKRWSIGGAMTLSSPVSASLSTPKSRNIKFPKLHGGKSH"
     gene            <73412..>74950
                     /locus_tag="KLTH0F00946g"
                     /db_xref="GeneID:8292441"
     mRNA            <73412..>74950
                     /locus_tag="KLTH0F00946g"
                     /product="KLTH0F00946p"
                     /transcript_id="XM_002554204.1"
                     /db_xref="GeneID:8292441"
     CDS             73412..74950
                     /locus_tag="KLTH0F00946g"
                     /note="similar to uniprot|P08458 Saccharomyces cerevisiae
                     YDR523C SPS1 dispensable for mitosis involved in
                     middle/late stage of meiosis required for spore wall
                     formation serine/threonine kinase homologous to Ste20p
                     expressed in middle/late meiosis"
                     /codon_start=1
                     /product="KLTH0F00946p"
                     /protein_id="XP_002554250.1"
                     /db_xref="GeneID:8292441"
                     /db_xref="GOA:C5DK12"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DK12"
                     /translation="MTKTSTVTGLDTFVKSYKSHKSKTTDAAVVMNEKPSRLYEIKEC
                     VGKGSFGDVFRATHRQTGEVVAIKIINLEETQDDIDVLAQEIYFLSELRAPFVTTYFK
                     TFVEDVSMWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKKIH
                     RDIKAANILLTDDGEVKLGDFGVSGQIMATLKRTTFVGTPYWMAPEIIAKKDNGYNEK
                     ADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIK
                     DPDLRPSAAELLGHKFLNKASWRGSGTLKREVDLVKALKKRTNYFKEPRHSVEDNVYP
                     ADGSMHLQNWNFETTKTSTTRKSELVCHRPSIEKRKPVAKLQIVEELSPKTETSHISA
                     MGSPNVDTPTTNATSPSMGHYNHEKDLDISMGLHEGEAIKKDIRPVDCKELNYFKHII
                     LYSFNRVLERARSGDTKLDVTRLRDIFEEAEGSQPGLSEAFVEEVYIRMEEIKGYIVE
                     TSFQ"
     gene            <75236..>76672
                     /locus_tag="KLTH0F00968g"
                     /db_xref="GeneID:8292442"
     mRNA            <75236..>76672
                     /locus_tag="KLTH0F00968g"
                     /product="KLTH0F00968p"
                     /transcript_id="XM_002554205.1"
                     /db_xref="GeneID:8292442"
     CDS             75236..76672
                     /locus_tag="KLTH0F00968g"
                     /note="similar to uniprot|P25380 Saccharomyces cerevisiae
                     YCL048W SPS22 Protein of unknown function redundant with
                     Sps2p for the organization of the beta- glucan layer of
                     the spore wall and similar to YDR522c uniprot|P08459
                     Saccharomyces cerevisiae YDR522C SPS2 Protein expressed
                     during sporulation, redundant with Sps22p for organization
                     of the beta-glucan layer of the spore wall and weakly
                     similar to YBR078w uniprot|P38248 Saccharomyces cerevisiae
                     YBR078W ECM3 GPI-anchored protein of unknown function and
                     weakly similar to YDR055w uniprot|Q12355 Saccharomyces
                     cerevisiae YDR055W PST1 Cell wall protein that contains a
                     putative GPI-attachment site"
                     /codon_start=1
                     /product="KLTH0F00968p"
                     /protein_id="XP_002554251.1"
                     /db_xref="GeneID:8292442"
                     /db_xref="UniProtKB/TrEMBL:C5DK13"
                     /translation="MKSSNIIAALLPLMCASASNAYLVQKVLDFNGVHKRPHAVTVGT
                     LNLEKRDTAPAFQSLQDEWSAEVTSQDAARFEKSSVIAELCKKGDHNIETANQLFELQ
                     RECKTVMGTIHINDFVDPVIDLGALQSIIGDFVIENLPEVVRIQGQNLVSVGGTLKIN
                     GLTSLTSIHLPALHHFNALECTVAPTLTSLTLAPNISHAKRVTISDTSLVEINMLENS
                     EDLELLNINNNRYMEHLRASVKRVHEQLSISSNSRELQVDFPDLQWANNVTVRDVLAA
                     SFPRLTSVNHSLEMIENDFDSFEVPLLESVGGTLGVILNSKLNHVDFGNVSVIHGGLM
                     IANNSNIAKINFLPELKEIGGAIHFIGNFQETEFPKLRLVRGSALLQSTSSTFDCAKW
                     TTPSGGNSIIRGGRIACTAGQRRKTARVNQDGKLLEHQETQFDSPAETQKETNLGSSI
                     IDKTSLSAFAWSLSFGWIAALICLVATY"
     gene            <77084..>79441
                     /locus_tag="KLTH0F00990g"
                     /db_xref="GeneID:8292443"
     mRNA            <77084..>79441
                     /locus_tag="KLTH0F00990g"
                     /product="KLTH0F00990p"
                     /transcript_id="XM_002554206.1"
                     /db_xref="GeneID:8292443"
     CDS             77084..79441
                     /locus_tag="KLTH0F00990g"
                     /note="similar to uniprot|Q04411 Saccharomyces cerevisiae
                     YDR520C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F00990p"
                     /protein_id="XP_002554252.1"
                     /db_xref="GeneID:8292443"
                     /db_xref="GOA:C5DK14"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DK14"
                     /translation="MTEPKNFHLPTDHEPTIHLNTDGNYVKKVRQEDSRSYNRSETEA
                     ARKPRKKRKTYSCEVCRKFKTRCDFEPLVGRCHRCSVLKIQCSLTKEREEEILAAIET
                     SSSVALPTSGVSSSEVSSKDSLVSHPVATTLNNRLNKLESNLNRLNSKLDLLVLLAQG
                     SNSAAANSVSNLAGDRKAGSAVGIADLSTNRGDLLGSKPLHNRLDDSDDQLTDEAVSA
                     FKDFSPPPPRPPQRLDLNGLKLQEPPLKLISDIDERLFPTKVESERDRIAKTQRPFVV
                     ARVNFLKFFDQHEQLCLDLSRDFLVKSHFWIIPGGIKEIDRSYVEKHLFISSVFAIIA
                     MGFDENNKYEEEQEIMYPLVERLLTNTLTMFEKLTDHDIEAILYCSMFNVSRKSKRHR
                     QMKLNSLVLTNFAISSLLNIIDFHKIKERVLSDKYDSLDLYHLRILNSLTACRLQYSI
                     GYGNFMMSDDLLKDFNNLTARFPQATFGDDIKISEINLSEIVNNIFLNFKTYFKEFTI
                     SFKNCLHNNQFALGSQENLNNGVGSSNDTLAFPELEYWLKNWDELLSKDGGGVLLFAF
                     NYYYIMICRSFLTEFYEEYHSDLHYFKCILKTMKNYCFQLLDGFLKLPSSLIKGAPVI
                     TVHQLVYACLTLCDFLHFFDASERQQILNLCTKIYWHLHTIGEKLNEATENVGKIINS
                     LIDTGKKKVHVGSDPFSLTEKPKHARKAHSILKKHTVSDSQNSPHSVESSSSHNSGIE
                     SATGAGFNMPDVGQFNSFEDFFQDFFENLKPTTQNIFSSMNQTPK"
     gene            complement(<79475..>80266)
                     /locus_tag="KLTH0F01012g"
                     /db_xref="GeneID:8292444"
     mRNA            complement(<79475..>80266)
                     /locus_tag="KLTH0F01012g"
                     /product="KLTH0F01012p"
                     /transcript_id="XM_002554207.1"
                     /db_xref="GeneID:8292444"
     CDS             complement(79475..80266)
                     /locus_tag="KLTH0F01012g"
                     /note="similar to uniprot|P25576 Saccharomyces cerevisiae
                     YCL047C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F01012p"
                     /protein_id="XP_002554253.1"
                     /db_xref="GeneID:8292444"
                     /db_xref="GOA:C5DK15"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DK15"
                     /translation="MLYRSPEGGKCLQILKRFQESISAFEIFHGQRHLDKCRRVLVLD
                     SSFNPPHMGHYTLVERAVKYYGSTDLQVILLLSINNADKEIKPASLDKRMDMMCIMAD
                     LLSKNSLPVSVGITKYAKFFEKSTAISKELGHSPKISYLVGFDTIVRVFDSKYYAPLS
                     VADALRDFMSETEFFCLTRDGETAVQQQLQYPGDIAKGVYEPNIPKSWHSKVVVEKGN
                     EFFSHVSSSSLRKTLYDPNKDVSASVPPEIYHYIKNQFPYDIFKH"
     gene            complement(<80327..>80752)
                     /locus_tag="KLTH0F01034g"
                     /db_xref="GeneID:8292445"
     mRNA            complement(<80327..>80752)
                     /locus_tag="KLTH0F01034g"
                     /product="KLTH0F01034p"
                     /transcript_id="XM_002554208.1"
                     /db_xref="GeneID:8292445"
     CDS             complement(80327..80752)
                     /locus_tag="KLTH0F01034g"
                     /note="similar to uniprot|P32472 Saccharomyces cerevisiae
                     YDR519W FPR2 Membrane-bound peptidyl-prolyl cis- trans
                     isomerase (PPIase) binds to the drugs FK506 and rapamycin
                     expression pattern suggests possible involvement in ER
                     protein trafficking"
                     /codon_start=1
                     /product="KLTH0F01034p"
                     /protein_id="XP_002554254.1"
                     /db_xref="GeneID:8292445"
                     /db_xref="GOA:C5DK16"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:C5DK16"
                     /translation="MLFKNLLCFLSLSSLSSISMAGSLTELEIKTIEEVPASECTIKA
                     SKGDLVSVHYSGSLLGSEEVFDSSYGRGVPIKFELGAGQVIKGWDQGILDMCIGERRE
                     LRIPSQLGYGSRGAGGVIPPNADLFFETTLVDIRRRDEL"
     gene            complement(<80904..>83219)
                     /locus_tag="KLTH0F01056g"
                     /db_xref="GeneID:8292446"
     mRNA            complement(<80904..>83219)
                     /locus_tag="KLTH0F01056g"
                     /product="KLTH0F01056p"
                     /transcript_id="XM_002554209.1"
                     /db_xref="GeneID:8292446"
     CDS             complement(80904..83219)
                     /locus_tag="KLTH0F01056g"
                     /note="similar to uniprot|P25574 Saccharomyces cerevisiae
                     YCL045C"
                     /codon_start=1
                     /product="KLTH0F01056p"
                     /protein_id="XP_002554255.1"
                     /db_xref="GeneID:8292446"
                     /db_xref="GOA:C5DK17"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:C5DK17"
                     /translation="MALSFNVWTIYLRVDRNSLASLKQPRLLVFTLCPIMLGAFRSFI
                     GITLLVVIKGLFVEAIFSDEAYHIDWQLSNVGPYQCVLPASATESNDQLLVLSTFNNG
                     TMISWLNKTSGELLERLPLGYRVADAMIEHNDLFLKLEDGSINAVDSMNGFSLDHPPT
                     EFSSSCNPDLSTIRFEDGKIKIMDHDTDLQIFSIDMPQDFKGIKYFRSDKENTLDLMY
                     STVGGKYTFTSVSDLTSTQTWTRDESLANIRAYTYVSSADPNLAQMFTELSQEGSMNV
                     LEAYQFRVKQTLNRLKNYLLEKKFSVGAIVKEFLEDEDEATLHQKDVSFGLLKYLIVA
                     TEEGKIAVLDVRDGRQLWNYESGLKDILNIEALRSDTEVVIFTKSGPSLTFDITRIET
                     EPYLLTNTNMAPVHSVEKISENGAFLFKRPGGGRFLLENPLNPITQDLYLLDHNSKEL
                     NAFIYQNEAITETWKTKVDEQEEIVAFSSRGEEHVANLGIVLGNRTVLYKYLYPHLAA
                     YATKNEENVLTIRIIDTVSGELLHTSFHEDEVDFNFPINLVFGEHWCVYTYFSTKPVP
                     EQKIAVIELYESLVANERVSEPLTEVNALENIQRPQFIQKAYLYPEVIKNIGLTKTKL
                     GITTKSIILELENGQVTILPKFILSARRVEESQLSADDKKEFMVMPYLSAIPINDQAV
                     LTHNRVLLTGPDSHLLSIPTDLESTTLVCTLGHDLFCTRVFPSSQFDKLSPSFEKGKL
                     MATVIGLLLICFFLRPLVDTKKLKLKWLVKD"
     gene            complement(<83274..>84608)
                     /locus_tag="KLTH0F01078g"
                     /db_xref="GeneID:8292447"
     mRNA            complement(<83274..>84608)
                     /locus_tag="KLTH0F01078g"
                     /product="KLTH0F01078p"
                     /transcript_id="XM_002554210.1"
                     /db_xref="GeneID:8292447"
     CDS             complement(83274..84608)
                     /locus_tag="KLTH0F01078g"
                     /note="similar to uniprot|P25573 Saccharomyces cerevisiae
                     YCL044C"
                     /codon_start=1
                     /product="KLTH0F01078p"
                     /protein_id="XP_002554256.1"
                     /db_xref="GeneID:8292447"
                     /db_xref="InterPro:IPR013911"
                     /db_xref="UniProtKB/TrEMBL:C5DK18"
                     /translation="MFSQELQSFHLCSVKKHRMLFSIFNITNPLVSSLHYGSPLRFIC
                     SLMGLYSPPDGSKAPNAPALAQKEAPDKPNDGALIKFYPRPSLGLRFWGPLVPASDNR
                     EGLWTLVGIQTVFGLLCLRRSRSIGSSIVKREISKIPSLNRFSVTRGSMYVSEHGPTA
                     FGSTNSFSRRGSNLWGFLRSTKFIALRKSLYLVGGTLLLSQSLLEACRLQILKYDPWY
                     EEARSVREKQFFNNIIKYYHEGIDPTKFKVKDASNGAVLPLSSPEVKQSVAFARATLE
                     ADSWFTSWFGPIEYKPMSFTEYLDRLEYHLEMTDFIRNGRNNDAASQLLGRPLSHGTA
                     ELEELIQKNRSSRKKIGNLMESAPRQSMPVVSGQRQSSLKGILLDPNIQSSEDIDLDE
                     TWSAFNPWLDLALETSLSIKFLPTVLMADDATGDSSIDHSSEDDSNDPKPNY"
     gene            complement(<84685..>86250)
                     /locus_tag="KLTH0F01100g"
                     /db_xref="GeneID:8292448"
     mRNA            complement(<84685..>86250)
                     /locus_tag="KLTH0F01100g"
                     /product="KLTH0F01100p"
                     /transcript_id="XM_002554211.1"
                     /db_xref="GeneID:8292448"
     CDS             complement(84685..86250)
                     /locus_tag="KLTH0F01100g"
                     /note="similar to uniprot|P17967 Saccharomyces cerevisiae
                     YCL043C PDI1 Protein disulfide isomerase and similar to
                     uniprot|P32474 Saccharomyces cerevisiae YDR518w EUG1"
                     /codon_start=1
                     /product="KLTH0F01100p"
                     /protein_id="XP_002554257.1"
                     /db_xref="GeneID:8292448"
                     /db_xref="GOA:C5DK19"
                     /db_xref="InterPro:IPR005788"
                     /db_xref="InterPro:IPR005792"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C5DK19"
                     /translation="MQLSRNLFLGISALAAALGNAQQEATAPEGSAVVKLTSENFADF
                     IKEHPLVLAEFYAPWCGHCKTLAPHYVEAAATLESKNIPLAQVDCTTEEELCMEHGIR
                     GYPTIKVFRNHQVDAPSDYQGGRTASAIVSYMISQSLPPVSILEGEEAADDFKDLLAE
                     SSGAVIVDGGVEGLNETFHELAELFRDDFTFVQYNGSDAKQKLSVYLPKQDAPIVFEG
                     KNASISHLVDWVQVETKPYFGDINGETFQSYMDSNVPLAYFFYTSPEERASYEDFFSK
                     LGKEHRGKINFVGLDASAFGRHAQNLNMKEQFPLFVIHDTVSNLKYGLPQLSEEEFSS
                     LTKPLELKTKDIAKFIKSFISGKVEPIIKSEEIPEKQESSVFRIVGKTHEDIINDETR
                     DVLVKYYAPWCGHCKRLAPVYEELANVYVTDKDAQDKVLVANVDATLNDVNVDLEGYP
                     TLILYPAGNKSTPVVYQGARDMESLMNFIQENGHHEINGTAILESKKAQEAKEADEEA
                     EAIEEESVEHDEL"
     gene            complement(<86725..>87819)
                     /locus_tag="KLTH0F01122g"
                     /db_xref="GeneID:8292449"
     mRNA            complement(<86725..>87819)
                     /locus_tag="KLTH0F01122g"
                     /product="KLTH0F01122p"
                     /transcript_id="XM_002554212.1"
                     /db_xref="GeneID:8292449"
     CDS             complement(86725..87819)
                     /locus_tag="KLTH0F01122g"
                     /note="similar to uniprot|Q04410 Saccharomyces cerevisiae
                     YDR517W GRH1 Golgi localized protein component of the
                     spindle assembly checkpoint homolog of human GRASP65 which
                     functions in postmitotic reassembly of Golgi stacks"
                     /codon_start=1
                     /product="KLTH0F01122p"
                     /protein_id="XP_002554258.1"
                     /db_xref="GeneID:8292449"
                     /db_xref="InterPro:IPR007583"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="UniProtKB/TrEMBL:C5DK20"
                     /translation="MFRIAKNLVRTFEQSVSDTIGAGTQLDSYFESVPPNLLSPGNNT
                     NELLHGLRVLACDESQVQLQSFFDYIIGIDDQPLPLSQNQHGYLYPDFGSITRLLNAA
                     CGSSVKLNLWSGKGGVYRDEYIRVERKKNVEDVPLDGSRDVVFQEFDALGFAVQWTPL
                     TAATYTYHVLELSDPTGPAAQAGFVPQEDYVVGCQEGLLATGGETLLQDILRSHAGQD
                     LVLYVFNAVSDCIRPVTVHVGHDGRLGCNMGYGFLHRIPAPFRQEPASAVEASFADAP
                     MSDQSFVPAGSSNIGIPQPSTDIQPTSTSQFIVPNPTHKRKQKHHKVAAATSIQDYFQ
                     EGKDPSPAFSTKSSSTPPPPPPVKNQDTTK"
     gene            <88845..>90329
                     /locus_tag="KLTH0F01144g"
                     /db_xref="GeneID:8292450"
     mRNA            <88845..>90329
                     /locus_tag="KLTH0F01144g"
                     /product="KLTH0F01144p"
                     /transcript_id="XM_002554213.1"
                     /db_xref="GeneID:8292450"
     CDS             88845..90329
                     /locus_tag="KLTH0F01144g"
                     /note="highly similar to uniprot|P17709 Saccharomyces
                     cerevisiae YCL040W GLK1 Glucokinase catalyzes the
                     phosphorylation of glucose at C6 in the first irreversible
                     step of glucose metabolism one of three glucose
                     phosphorylating enzymes expression regulated by
                     non-fermentable carbon sources"
                     /codon_start=1
                     /product="KLTH0F01144p"
                     /protein_id="XP_002554259.1"
                     /db_xref="GeneID:8292450"
                     /db_xref="GOA:C5DK21"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:C5DK21"
                     /translation="MSFDKVHQEKQRRLSKAVEEVCDELTLTSEKICELTHFFIESME
                     KGLGESKEDASYRGLPMIPTYVTGKPNGTESGVLLAADLGGTNFRICSVDLQGNHKFA
                     LQQMKSKIPDEFLEDDTVTSDDLFGYLARRTLAFVKKYHPEYLQNKEELKLGFTFSYP
                     VDQKSLASGTLIRWTKGFKIKDTLGKDVVQLYQESLEEQGLSMVRVVALANDTVGTFL
                     SHCYCSENTGSLTSGEIVEPVMGCIFGTGTNGAYMEKIENIKKLPEEVRQELLQSGKT
                     HMCINTEWGSFDNDLKHLPTTKYDIDIDQKFSSNPGFHLFEKRVSGMFLGEILRNVLL
                     DLFNKRFIFTQYTAEEKLPHRLKTPFELSSEVLSHIEIDDSSQLRETELSLLQSMRLP
                     TTYDERIAIQNLVRAISRRSAYLAAVPIAAILMKTGALNQRYHGEVEIGCDGSVVEYY
                     PGFRSMIRHALALSPIGPEGERKTHLCIAKDGSGVGAALCALVA"
     gene            <90708..>92939
                     /locus_tag="KLTH0F01166g"
                     /db_xref="GeneID:8292451"
     mRNA            <90708..>92939
                     /locus_tag="KLTH0F01166g"
                     /product="KLTH0F01166p"
                     /transcript_id="XM_002554214.1"
                     /db_xref="GeneID:8292451"
     CDS             90708..92939
                     /locus_tag="KLTH0F01166g"
                     /note="similar to uniprot|P25569 Saccharomyces cerevisiae
                     YCL039W"
                     /codon_start=1
                     /product="KLTH0F01166p"
                     /protein_id="XP_002554260.1"
                     /db_xref="GeneID:8292451"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DK22"
                     /translation="MPVEYQSSEERERRDCFFVPPYFKGKNSRCSSAGAPACTSSAIQ
                     SLPQASFDKTQLTKLLIDTLHEMGYTESAKTLQKESGGVRVESGSVQKLFSAVRLGQF
                     EEIDLQMLANLPLKNRALGTLPFPQSNTHSFQAGQENSESTTGNEDEENAMKIDNIIS
                     KNTDWSRFFTNMQNEHKILESVVQEMGDLDAPALSGLLDMIEILVLINKQVFLELMFD
                     QQESSLAVLFLRTVFRKFIQLWEVILMSQESTYALTPDALLKQMTSVLTSPLNLAEMS
                     DVWPGSVERARQTLIDSISNYVDPNELVPRGRLLTLLSQAIKYQSSQNLLNFEDEDDE
                     NSFIQEGASTYNLLQDNASSSNRINFQFEIQLCFSVGEIWYLEFSPDGKYLAAASADS
                     STDQKVHIYDVENEFRVYKILGGNDQCVLYLSFSPDSRYLVSCPFNEEAKIYDIHKKG
                     EPSDINSEFDDDSAPAEIIQPEDSFSLSSDETSGTTAAPRIWCCSWFHTERNKGRFAL
                     GSPDRDVIIYDLGTKSIISRLSRVTNATAASSHEQFPRVHDLKITPDDRYLILMAHEF
                     FVDAYDISQLPPVGRQGELPADLSSFHLSRVSRLNVGKRMTCLTIPQTKSSESALNSL
                     VLINVQPHELQLWDFKEQILVQKYFGQRQLQFIIRSCFGYENKVIASGSEDGKIYVWD
                     RIHGNIVGVINGHTSERDPPPNTANTFGRNCNIVAWNPANKNMFASGGDDGSIKIWSV
                     GHS"
     gene            complement(<92980..>94491)
                     /locus_tag="KLTH0F01188g"
                     /db_xref="GeneID:8292452"
     mRNA            complement(<92980..>94491)
                     /locus_tag="KLTH0F01188g"
                     /product="KLTH0F01188p"
                     /transcript_id="XM_002554215.1"
                     /db_xref="GeneID:8292452"
     CDS             complement(92980..94491)
                     /locus_tag="KLTH0F01188g"
                     /note="similar to uniprot|P25568 Saccharomyces cerevisiae
                     YCL038C ATG22 Protein required for the breakdown of
                     autophagic vesicles in the vacuole during autophagy
                     putative integral membrane protein that localizes to
                     vacuolar membranes and punctate structures attached to the
                     vacuole"
                     /codon_start=1
                     /product="KLTH0F01188p"
                     /protein_id="XP_002554261.1"
                     /db_xref="GeneID:8292452"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024671"
                     /db_xref="UniProtKB/TrEMBL:C5DK23"
                     /translation="MSYQAVTSDEEDQNRPEREVKTLNNIRGWYLYCFSSEPFIVSAV
                     STYVPLLLEQFARINGVLVKDHSVKCGSSDEKCVLGLLNNSVFIDTSSFALYTFSASV
                     LFQAVLVISISGLVDMWNSVKFRKNVLIAFGVCGALSTIAISQLSSSQYYSLALLSIL
                     ANCCYGVVNVVGNSLLPGFVRDLIDYNSHFKNSTVEDVTSVTSGRGSGVGYIGALIVQ
                     VCSIFLVRMSKAHDNIQVAVLLVGIWWLAWQFPLTWLLQDIIPPLIEDEQLQIRPSPK
                     YLTYGWKSLYEALKHARLLRDVMIFLLGWFIISDSITTINSTAILFAKTELKMGTLGL
                     IMVSILSLLSGIAGAFLIPQVLSYQLKQPPQRMMMSIIGWASVIPLYGTLGFFFDSVG
                     LKHKGEMYMMAIWYGIAMGGLSAVSRTIFSLIIPSGKESTFFSLFSLTDKGSSVLGPF
                     LAGLITDKTHNIRYSFYLLLFLLLISLPVFGMLNIERGKKEARELGDIQTLND"
     gene            complement(<95054..>96409)
                     /locus_tag="KLTH0F01210g"
                     /db_xref="GeneID:8292453"
     mRNA            complement(<95054..>96409)
                     /locus_tag="KLTH0F01210g"
                     /product="KLTH0F01210p"
                     /transcript_id="XM_002554216.1"
                     /db_xref="GeneID:8292453"
     CDS             complement(95054..96409)
                     /locus_tag="KLTH0F01210g"
                     /note="weakly similar to uniprot|P25567 Saccharomyces
                     cerevisiae YCL037C SRO9"
                     /codon_start=1
                     /product="KLTH0F01210p"
                     /protein_id="XP_002554262.1"
                     /db_xref="GeneID:8292453"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5DK24"
                     /translation="MSATVENTKDDIKEAQQVPEVPAEEVKTAKQPVLTPAPVPTSSP
                     WKAVPSATAAQTASSSRKWPSAQEAVEKLERREKQAPGAPVLKSTGKEKWVPMKASIV
                     VSGSKKLGGGGYNGANVAAKKQAGKKSRKNGPSTAKPRKQVQPQPVKDERELKDESTQ
                     SSNEADEATVASKDALEPSDAAAVASQAPESAFGDSAKKNGFHRRPHDSNQNGNYPRR
                     RYHQGAPKEGHGPFKSNQPYSSFPQKPNSAPFRQHNPNRSYNPGYRHKYQPRHSSGAF
                     YGPQPPHPFVAVNNVARQIEYYFSAENLAKDNYLRSQFTEDGFAPLSLIAKFYRMVNL
                     SFGGDETLILGALREIVANDTATVDVAEVQEETERNVGKFYVRSKNWEQWISKPEDEA
                     ENKADDQSTQKDTKQKIILKGDVLDAFKIEPPVFEAPQANDEPQPNAEPTTGTESEAE
                     P"
     gene            <96822..>98216
                     /locus_tag="KLTH0F01232g"
                     /db_xref="GeneID:8292454"
     mRNA            <96822..>98216
                     /locus_tag="KLTH0F01232g"
                     /product="KLTH0F01232p"
                     /transcript_id="XM_002554217.1"
                     /db_xref="GeneID:8292454"
     CDS             96822..98216
                     /locus_tag="KLTH0F01232g"
                     /note="similar to uniprot|P25370 Saccharomyces cerevisiae
                     YDR514C Hypothetical ORF and similar to YCL036w"
                     /codon_start=1
                     /product="KLTH0F01232p"
                     /protein_id="XP_002554263.1"
                     /db_xref="GeneID:8292454"
                     /db_xref="GOA:C5DK25"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:C5DK25"
                     /translation="MLRNCTRKPAKRLKVDTGRQKSVMSFSSHETEIYVRGENVPRNR
                     SSVSAYLKAAAGVKNVIGPKKSQMREQSFFKELVKVEYQPVPSRTQFIENYVKEFHKK
                     YQDQMALSHQQLESKLRLAKEQYQSLQQSLGAPPAEQAADGSDAKEDQKLIKLLRKIE
                     NEHSPKITDSPGSPNAKYVADSVRMLASQRTICFSVDVEAYERNTNVVTEIGISVFDP
                     RESMYSTVGNFRTFHLIVGESLRLRNGRFVCDVKDCFLLGESYVMPLSSCVEFIQTLL
                     NYYMVPHTPQERTWHRAFVGHNVKGDLKWLFSIGVNLPANIGHDTLSLDPKLERISIL
                     DTEKLYRVMYGSKGSSLGKILRLFKIPHAYLHNAGNDAYFTLKLLLHMCDVNYRRRLQ
                     MDDFYAVTATVEEWSRREKNKGSVNSHGKGNHEFTEYRSRRKQSLHTEFGGCRWFASA
                     SDALVGTPKPCEYE"
     gene            <98944..>100686
                     /locus_tag="KLTH0F01254g"
                     /db_xref="GeneID:8292455"
     mRNA            <98944..>100686
                     /locus_tag="KLTH0F01254g"
                     /product="KLTH0F01254p"
                     /transcript_id="XM_002554218.1"
                     /db_xref="GeneID:8292455"
     CDS             98944..100686
                     /locus_tag="KLTH0F01254g"
                     /note="some similarities with uniprot|P39712 Saccharomyces
                     cerevisiae YAL063C"
                     /codon_start=1
                     /product="KLTH0F01254p"
                     /protein_id="XP_002554264.1"
                     /db_xref="GeneID:8292455"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:C5DK26"
                     /translation="MVSAKLVYGLLASSALAQAAQTYKVPIQYESELEVSYYFREDND
                     LVSITSDAGGLVVTVDADNACDVLQSGMVVYRVDDGSASTLLTWDRYHVFHLENSAGQ
                     ELTWSSVNAQSCGAVSSSSLSSTVTLSTTYQLSSGVASSTGSGSGSITATDSGSTTAS
                     GASSGASTASGSASGSASISGSTSGSTSGSASGSASGTVSSGSTVSTSGAPSGSATKS
                     IPGYTSSVVTVTESGVVTSYTTYCPISTVPASSTEWQSSVITATENGVVTTYTTYCPI
                     SSETATQAPEKTKVVTTTESGHESVYTTTYPASQEKTVVTTTENGVVTTYTTYCPLSS
                     ETGTAAPQETKVVTTTENGQQTIYTTTCPASQETEIVTTTKSGHESVYTTTGPAPATG
                     ATSAVTTVVQPTTIVKTITSCSGGVCSTQSATETSQVTSVVTVSKSYAAASSTETSAT
                     GVESTPATGAESTPATGAESTPATGAESTPATGAESTPATAATGTAAGSSPATGAATT
                     GVESSASAPTGAAETGSGTAAPAATGTAASGSGSGASATPTAVSVSEYAGSAAKLGSS
                     GVFVAVVAMMASLL"
     gene            complement(<101034..>101450)
                     /locus_tag="KLTH0F01276g"
                     /db_xref="GeneID:8292456"
     mRNA            complement(<101034..>101450)
                     /locus_tag="KLTH0F01276g"
                     /product="KLTH0F01276p"
                     /transcript_id="XM_002554219.1"
                     /db_xref="GeneID:8292456"
     CDS             complement(101034..101450)
                     /locus_tag="KLTH0F01276g"
                     /note="similar to uniprot|P25373 Saccharomyces cerevisiae
                     YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
                     cerevisiae YDR513w TTR1"
                     /codon_start=1
                     /product="KLTH0F01276p"
                     /protein_id="XP_002554265.1"
                     /db_xref="GeneID:8292456"
                     /db_xref="GOA:C5DK27"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:C5DK27"
                     /translation="MEYSRTLTLVALVFTLFIIRRFFGSGFSKMASPQTVQHVRSLIK
                     DNKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEISGQR
                     TVPNIYILGEHIGGNSDLQALEASGKLDELLEKALA"
     gene            <101766..>102758
                     /locus_tag="KLTH0F01298g"
                     /db_xref="GeneID:8292457"
     mRNA            <101766..>102758
                     /locus_tag="KLTH0F01298g"
                     /product="KLTH0F01298p"
                     /transcript_id="XM_002554220.1"
                     /db_xref="GeneID:8292457"
     CDS             101766..102758
                     /locus_tag="KLTH0F01298g"
                     /note="similar to uniprot|P25369 Saccharomyces cerevisiae
                     YCL034W LSB5 Protein of unknown function binds Las17p
                     which is a homolog of human Wiskott-Aldrich Syndrome
                     protein involved in actin patch assembly and actin
                     polymerization"
                     /codon_start=1
                     /product="KLTH0F01298p"
                     /protein_id="XP_002554266.1"
                     /db_xref="GeneID:8292457"
                     /db_xref="GOA:C5DK28"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:C5DK28"
                     /translation="MGFLTDHPHTAVTDTIERVCSSEQFTLEVELASLIQQIRAGKSD
                     YENGNNQIEAARCLRKKLKYGNRLQQARALELMNLFVSQRIKFPEMYNDAKLLDRLRV
                     IAMQSGTDGSGQRYHPRIIKKCVAYILGWSAFLDEQGPSRSYEGLDALARKVKSKYTT
                     KPAGSRRRKGFMSDKADASIMSADDRYGIPHIDMTKEAPKIRLLISDSLATAVSLKNT
                     LMTLPRTVNSTDDEEATARFVQARAMRRKVLRYLQLVTEGEFLGSLLHANEELVASLS
                     AYDELSGNLFEEESLLSENDDDEDDDEVSYLSSALSTQPERCDSNDPFGDQNRI"
     gene            complement(<102876..>103376)
                     /locus_tag="KLTH0F01320g"
                     /db_xref="GeneID:8292458"
     mRNA            complement(<102876..>103376)
                     /locus_tag="KLTH0F01320g"
                     /product="KLTH0F01320p"
                     /transcript_id="XM_002554221.1"
                     /db_xref="GeneID:8292458"
     CDS             complement(102876..103376)
                     /locus_tag="KLTH0F01320g"
                     /note="similar to uniprot|P25566 Saccharomyces cerevisiae
                     YCL033C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F01320p"
                     /protein_id="XP_002554267.1"
                     /db_xref="GeneID:8292458"
                     /db_xref="GOA:C5DK29"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:C5DK29"
                     /translation="MIRSTARIFRGFAGTRSIVVSRLIYKRSFSISFVTRMSENWNPN
                     LTTEQLLVLRDKHTERPHTGAYLNNKDTGVYNCANCEAPLYKSETKFDSHCGWPAFYE
                     EVKKGAITYHTDYTMGMKRTEICCANCGGHLGHVFEGEGWKERLGLPVDARHCVNSAS
                     LNFKKQ"
     gene            <103495..>103752
                     /locus_tag="KLTH0F01342g"
                     /db_xref="GeneID:8292459"
     mRNA            <103495..>103752
                     /locus_tag="KLTH0F01342g"
                     /product="KLTH0F01342p"
                     /transcript_id="XM_002554222.1"
                     /db_xref="GeneID:8292459"
     CDS             103495..103752
                     /locus_tag="KLTH0F01342g"
                     /note="some similarities with uniprot|Q04406 Saccharomyces
                     cerevisiae YDR512C EMI1 Non-essential protein of unknown
                     function required for transcriptional induction of the
                     early meiotic-specific transcription factor IME1 also
                     required for sporulation"
                     /codon_start=1
                     /product="KLTH0F01342p"
                     /protein_id="XP_002554268.1"
                     /db_xref="GeneID:8292459"
                     /db_xref="InterPro:IPR021475"
                     /db_xref="UniProtKB/TrEMBL:C5DK30"
                     /translation="MSTKYPSTMSCTEAFDQLSACYSVGGQFRNYYRYGEFNACTRQL
                     EKFKFCVLHGTDPVKIQQWYRDQAKFNAMHRGSSDEIWEER"
     gene            <103936..>104844
                     /locus_tag="KLTH0F01364g"
                     /db_xref="GeneID:8292460"
     mRNA            <103936..>104844
                     /locus_tag="KLTH0F01364g"
                     /product="KLTH0F01364p"
                     /transcript_id="XM_002554223.1"
                     /db_xref="GeneID:8292460"
     CDS             103936..104844
                     /locus_tag="KLTH0F01364g"
                     /note="similar to uniprot|P25344 Saccharomyces cerevisiae
                     YCL032W STE50 Protein involved in mating response
                     invasive/filamentous growth and osmotolerance acts as an
                     adaptor that links G protein-associated Cdc42p-Ste20p
                     complex to the effector Ste11p to modulate signal
                     transduction"
                     /codon_start=1
                     /product="KLTH0F01364p"
                     /protein_id="XP_002554269.1"
                     /db_xref="GeneID:8292460"
                     /db_xref="GOA:C5DK31"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR015316"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DK31"
                     /translation="MSTNASAVEANMNEEVLNWGIDEVSIWCAQKLALDGGRRDKFQA
                     NLKEHGIDGQVLLDLELEDCKQLTDNDSSLAVQLKLEVNRLRAQKQTQEDEILAVLTQ
                     LYSTVSEKLQDFQSQYARLRLDVLEVVKKDPHASFPPIQLNTQHQQPQHDYFEGQKIV
                     TPGSSNNTFVRQAPARSHSNSTSQQTLGIGGSTTSTPGVAPQQTPSGGSGTEPLKHMR
                     ASKEDSCERVLKSAMKRHNLSEQDWRQYVLVICYGDQERILELDEKPVLMFKNLKQQG
                     LHPAIMLRQRGDFEEVGGGLTPGGRL"
     gene            complement(<104933..>105892)
                     /locus_tag="KLTH0F01386g"
                     /db_xref="GeneID:8292461"
     mRNA            complement(<104933..>105892)
                     /locus_tag="KLTH0F01386g"
                     /product="KLTH0F01386p"
                     /transcript_id="XM_002554224.1"
                     /db_xref="GeneID:8292461"
     CDS             complement(104933..105892)
                     /locus_tag="KLTH0F01386g"
                     /note="similar to uniprot|P25368 Saccharomyces cerevisiae
                     YCL031C RRP7 involved in rRNA processing"
                     /codon_start=1
                     /product="KLTH0F01386p"
                     /protein_id="XP_002554270.1"
                     /db_xref="GeneID:8292461"
                     /db_xref="InterPro:IPR024326"
                     /db_xref="UniProtKB/TrEMBL:C5DK32"
                     /translation="MKRRVNWSTRSLNNARYTEPQPTYKMSARVDSMKNGFLVIPFKL
                     PQSQKLEEHSEEACHYMFIKKHQSKSELEQNCLFLVNLPLLTHLENLKQGFGSIMSQY
                     GSVAHVAQLLHHDEFGLSEVDLSSLTSDLMSTGDAEEKRYTPRNTALLQFVDAASVDN
                     AWSALRKYSQERKQSKIVTWNFDSPSMATFINFYKPLDLDYLKEDVYSHMALFEQREQ
                     QAQEQAQSSIVDEDGFTLVVGKNTKNLNSIRKKILNKNPLLKHEKIVKPPTMVDKKAK
                     QDFYRFQIRERKKQEISELLKKFKQDQEKIKEMKSKRKFNPYA"
     gene            complement(<106050..>106442)
                     /locus_tag="KLTH0F01408g"
                     /db_xref="GeneID:8292462"
     mRNA            complement(<106050..>106442)
                     /locus_tag="KLTH0F01408g"
                     /product="KLTH0F01408p"
                     /transcript_id="XM_002554225.1"
                     /db_xref="GeneID:8292462"
     CDS             complement(106050..106442)
                     /locus_tag="KLTH0F01408g"
                     /note="some similarities with uniprot|Q02562 Saccharomyces
                     cerevisiae YDR511W ACN9 Protein of the mitochondrial
                     intermembrane space required for acetate utilization and
                     gluconeogenesis has orthologs in higher eukaryotes"
                     /codon_start=1
                     /product="KLTH0F01408p"
                     /protein_id="XP_002554271.1"
                     /db_xref="GeneID:8292462"
                     /db_xref="GOA:C5DK33"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="InterPro:IPR008381"
                     /db_xref="UniProtKB/TrEMBL:C5DK33"
                     /translation="MVKATFNLKVHASMAVARARRSSRQHIPLLPPLQLYRRILREHQ
                     NLPAPQRELGDQYVKNEFKLHKDTSNPLHIVGFLASWQDYLHIISKGEWQEGTMSSEV
                     IDKMSPDQVNQLYTLMKEVEGLHNEKPE"
     gene            complement(<106971..>109406)
                     /locus_tag="KLTH0F01430g"
                     /db_xref="GeneID:8292463"
     mRNA            complement(<106971..>109406)
                     /locus_tag="KLTH0F01430g"
                     /product="KLTH0F01430p"
                     /transcript_id="XM_002554226.1"
                     /db_xref="GeneID:8292463"
     CDS             complement(106971..109406)
                     /locus_tag="KLTH0F01430g"
                     /note="similar to uniprot|P00815 Saccharomyces cerevisiae
                     YCL030C"
                     /codon_start=1
                     /product="KLTH0F01430p"
                     /protein_id="XP_002554272.1"
                     /db_xref="GeneID:8292463"
                     /db_xref="GOA:C5DK34"
                     /db_xref="InterPro:IPR001692"
                     /db_xref="InterPro:IPR002496"
                     /db_xref="InterPro:IPR008179"
                     /db_xref="InterPro:IPR012131"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016298"
                     /db_xref="InterPro:IPR021130"
                     /db_xref="UniProtKB/TrEMBL:C5DK34"
                     /translation="MGFPILPFFTSSEELKTVAGSKPYLGLTGQALLDLTKVSVDDAI
                     AFIENNSAYKFVCGLLGASNTLSDDDVVRLLNNGVSVLFLQDCSMAAPLVQLGVPKER
                     LAVLEGATYTCNFGVVQKFSTSQIVEASALSTDKLADALFSSLKTDRDDKLYTTLVVD
                     THERCLGLVYSSKESIKQAFEQQVGVYYSRSRNEIWVKGLTSGNTQKLVNINIDCDGD
                     ALKFVVVQEGKKSDFCHLNTTSCYGEFQQGLVGLEGLLRQRLENAPEKSYTRRLFSDP
                     ELLTAKIKEEAEELTEAADKKEVAWEAADLFYFAMVKLVASGVSLDDVERNLHVKHLK
                     ITRRKGDAKEKFLQKKPSEESKAEAAAETVDDGSISLNVVSDQDKKGVSEALSRPIQK
                     TADIMHLVNPIVERVRNEGDKALLEFTQKFDGVKLDSPVLEAPFPKEYFEGLTDEMKE
                     ALDLSMENVRKFHEAQLQKETLEVVTQPGVVCSRFPRPIEKVGLYIPGGTAVLPSTAL
                     MLGVPARVAECQEIVFASPPRKSDGKVSPEVVYVAQKVGASKIVLAGGAQAVAAMAYG
                     TESIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEKADADFVA
                     SDLLSQAEHGVDSQVILVGVALSEKKVAEIQDAVHRQALELPRVDIVRKCIAHSSIIL
                     CDSYETAFDMSNDYAPEHLILQIENAQDYVKLVFNAGSVFVGAYTPESCGDYSSGTNH
                     TLPTYGYARQYSGVNTSTFQKFITSQVVNPQGLENIGRAVMSVAKVEGLDAHRNAVKI
                     RMQKLGLLPESFQ"
     gene            complement(<109643..>110863)
                     /locus_tag="KLTH0F01452g"
                     /db_xref="GeneID:8292464"
     mRNA            complement(<109643..>110863)
                     /locus_tag="KLTH0F01452g"
                     /product="KLTH0F01452p"
                     /transcript_id="XM_002554227.1"
                     /db_xref="GeneID:8292464"
     CDS             complement(109643..110863)
                     /locus_tag="KLTH0F01452g"
                     /note="similar to uniprot|P11709 Saccharomyces cerevisiae
                     YCL029C BIK1 Microtubule-associated protein component of
                     the interface between microtubules and kinetochore
                     involved in sister chromatid separation essential in
                     polyploid cells but not in haploid or diploid cells
                     ortholog of mammalian CLIP-170"
                     /codon_start=1
                     /product="KLTH0F01452p"
                     /protein_id="XP_002554273.1"
                     /db_xref="GeneID:8292464"
                     /db_xref="GOA:C5DK35"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C5DK35"
                     /translation="MENYEKKIGSFIQIPNVGRGQLKYVGAVEGKPGIFVGVDLLANI
                     GKNDGTFRGKRYFDTEYTQSGLFIQLQKVASLIDLATGSASRRETLGDAHGGSRRSAS
                     LTDPRSPTPIRANSRQSSAVFSDTMDIDHEDRRVLSAPGRDLELKIQQQNQELSQYKK
                     VLSEQRIVLEEIQPAIDDYEEKLQQMEAQVSSLEAQLSKERETQRRQKQYFETEHEQL
                     LSVVEELHTEIRENEKRMLNAAQPSQPSDLSELTAENEALRNELEDLKAQQAASAVTA
                     KKWEKEREQLKLQIDSLSSEYQYVNKELRDAHEKLKVSQESQSDLSEIEQLKLQLEAA
                     NAKIQELEQGSPRPTTPALTTGSDPIERESESLPLYIPKKADRAAGRPKWCALCERDG
                     HNSVDCPYENDQLF"
     gene            <111050..>111286
                     /locus_tag="KLTH0F01474g"
                     /db_xref="GeneID:8292465"
     mRNA            <111050..>111286
                     /locus_tag="KLTH0F01474g"
                     /product="KLTH0F01474p"
                     /transcript_id="XM_002554228.1"
                     /db_xref="GeneID:8292465"
     CDS             111050..111286
                     /locus_tag="KLTH0F01474g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F01474p"
                     /protein_id="XP_002554274.1"
                     /db_xref="GeneID:8292465"
                     /db_xref="UniProtKB/TrEMBL:C5DK36"
                     /translation="MDSPVICVSLSDTLNACEALSEFYRDYSGNFGFQARKGFYISND
                     SVALVLAVRGNSNGPKAVQKKHCERSCHSKKPAD"
     gene            <112409..>113776
                     /locus_tag="KLTH0F01496g"
                     /db_xref="GeneID:8292466"
     mRNA            <112409..>113776
                     /locus_tag="KLTH0F01496g"
                     /product="KLTH0F01496p"
                     /transcript_id="XM_002554229.1"
                     /db_xref="GeneID:8292466"
     CDS             112409..113776
                     /locus_tag="KLTH0F01496g"
                     /note="some similarities with uniprot|Q8TFP8 Saccharomyces
                     cerevisiae YCL028W RNQ1"
                     /codon_start=1
                     /product="KLTH0F01496p"
                     /protein_id="XP_002554275.1"
                     /db_xref="GeneID:8292466"
                     /db_xref="UniProtKB/TrEMBL:C5DK37"
                     /translation="MPNYACHVLHSLLSMWPKPASLTYFSSWHLFRERFEKLECTRLQ
                     LRFNTWSSDTDQAKQNYRMNVDQLINQAQQLFEQGRHQEAVESLTTATKQDPSPNQQS
                     YIEETINKIGQHVVNNGDESGTRGIGGSLMSAFMGGQGNSGYGGSQSQLSKLALLSTI
                     LGSSNKNSGSFNLGSVASMFTGSGKQNTQNYGNNNYGNNNYGNPQNNYGYNNGGNQSG
                     SGSGLSSLAGKLFGGKHSSQQNNTPPPPPPQQQQQSGSFGSLASMTSSFLGGGKQSNH
                     GNQVPPPQQYGNPQQGSYGQMYNSGSQGQQQGQYGNYGEQGNYGPPGGHRPQGNHGPP
                     GGFGSQGGNFGGRQGNSGSHENFGQGGGYGQTGRHEQQGRFENQDNFGSQGNYGQGGY
                     GQQNNFSESGFEGRRGGQASEYYQGQQSGSGQGYQRPSDNQNQESSGQGFSFAGNFVP
                     GNGRN"
     gene            complement(<113886..>115841)
                     /locus_tag="KLTH0F01518g"
                     /db_xref="GeneID:8292467"
     mRNA            complement(<113886..>115841)
                     /locus_tag="KLTH0F01518g"
                     /product="KLTH0F01518p"
                     /transcript_id="XM_002554230.1"
                     /db_xref="GeneID:8292467"
     CDS             complement(113886..115841)
                     /locus_tag="KLTH0F01518g"
                     /note="some similarities with uniprot|P36110 Saccharomyces
                     cerevisiae YKR013W"
                     /codon_start=1
                     /product="KLTH0F01518p"
                     /protein_id="XP_002554276.1"
                     /db_xref="GeneID:8292467"
                     /db_xref="GOA:C5DK38"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR002413"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:C5DK38"
                     /translation="MKYSSIAGLCMAVAAVSAQTTTTDDFTATAIDLTLTKPGATGSS
                     GVTSAPSSSATGSSAAPSGSSVAPSGSSSVPSGSSAAPSGSSAAPSGSSGVPSGSSAA
                     PSGSSAAPSGSSAAPSGSSVAPSGSSSVPSGSSGVPSGSSAAPSGSSAAPSGSSAAPS
                     GSSAAPSGSSSVPSGSSAAPSGSSAAPSGSSAAPSGSSSVPSGSSAAPSGSSAAPSGS
                     SGVPSGSSAAPSGSSAAPSGSSAAPSGTSSVAPSSSAISSGSSSVPSGSIITSGSSSA
                     PVSSSVPSSSFSLSSSAPNSVWYSNTSSTYPSTTGGLTSLPITSDSSSSPSSSESSTT
                     DSSSSDAISTVASSSDVSSSLASSSAVSSVVVSSSDVSSSAPSSSVASSSAPSSSVAS
                     SSAPSSSVASSSDTSSILASSSAASSVAVSSSAASSSAPSSSAATSSSATSSSSLLAA
                     SASNAAMTTITGSSVTSSSVASSTTASATTTLDAATASAILSEHNAKRSLHSNTPDLT
                     WDDSLSAWAYAYAESLSGTSYDPCSGNLVHSSTRNNQGENIGFGTVSDPNTLVDYWYD
                     EIQYYDYDNVTGITHDGQEVGHFTQLVWASTTKVGCAVIQCDTMAKYGQNSQYLLCEY
                     TPAGNIYNGTPGQDEFSFFKENVQRLK"
     gene            <117357..>119114
                     /locus_tag="KLTH0F01540g"
                     /db_xref="GeneID:8292468"
     mRNA            <117357..>119114
                     /locus_tag="KLTH0F01540g"
                     /product="KLTH0F01540p"
                     /transcript_id="XM_002554231.1"
                     /db_xref="GeneID:8292468"
     CDS             117357..119114
                     /locus_tag="KLTH0F01540g"
                     /note="weakly similar to uniprot|P11710 Saccharomyces
                     cerevisiae YCL027W FUS1 Membrane protein localized to the
                     shmoo tip required for cell fusion expression regulated by
                     mating pheromone proposed to coordinate signaling fusion
                     and polarization events required for fusion potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0F01540p"
                     /protein_id="XP_002554277.1"
                     /db_xref="GeneID:8292468"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DK39"
                     /translation="MPASATSSTASQTLLLQPSVKGTVVESVYVEVYVLPGQTKPFSS
                     STASVRTLSILNRYQSATSDSSASRTSRTSQQTRSTQTLLQLMQSASSSTTLVQSASV
                     SPASSEIVDKISAGQNASSATIALSIGLPLGIFCLAFFLIFALLWLRRRSAVRPPQDP
                     FAKSPADVASNHQTPWKRFVDRCLAPKESTHSHSFHSNAGATIKYKISTVNPQATSPG
                     ALPSYSEHVQTPQKVALPFNRSSSSHRIEAFLYTKPPGLKSIQSTLETTSAASDNPFD
                     NSHQLPNGGKWTYESPLSRWFLTKSLYLQDQVKQPLKSSNVKLKELNILSRVSKNKIQ
                     SPYPDETSPILSDTDRLSESKTSYASSQLDPLVYRSSSLKYTERKKPTGLTNIRAVSS
                     AQRSPAGPHPQPSAAEVDIKPQFIRKTNSESSSFLDSSRVKNACTYKSSAPPNDRKKR
                     RNNKKLRIHLDQIARKPLPLTPKPLLSGKKSGSLLKHAFMHKPLAGASDGLAQDEVYI
                     VIRNYSPRLMDEITVQVGEHVKLLAKHTDGWCLVEKCDSSGNPLCEASSDQQEIGGEF
                     YLNESRGIIPGVCLNKVTS"
     gene            complement(<119234..>119821)
                     /locus_tag="KLTH0F01562g"
                     /db_xref="GeneID:8292469"
     mRNA            complement(<119234..>119821)
                     /locus_tag="KLTH0F01562g"
                     /product="KLTH0F01562p"
                     /transcript_id="XM_002554232.1"
                     /db_xref="GeneID:8292469"
     CDS             complement(119234..119821)
                     /locus_tag="KLTH0F01562g"
                     /note="similar to uniprot|Q96VH4 Saccharomyces cerevisiae
                     YCL026C-B Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F01562p"
                     /protein_id="XP_002554278.1"
                     /db_xref="GeneID:8292469"
                     /db_xref="GOA:C5DK40"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="UniProtKB/TrEMBL:C5DK40"
                     /translation="MSPAAAPFLEALVARRTIYALKPELPSGVELKDVKDIVQTIIKH
                     TPTSFNTQGNRAVILTGESHRKVWDHVYNSIPIENFKKRPLSARDEAFGTVVFMVNNQ
                     QTKEMQQNFPAWADLFPEFVAHSSGSAQISAWTALEKIGLGAHLQHFNELVASALPED
                     AIKEEWVVQGQLVFGLPDAPAGEKTFIENEVKVFE"
     gene            complement(<120227..>122017)
                     /locus_tag="KLTH0F01584g"
                     /db_xref="GeneID:8292470"
     mRNA            complement(<120227..>122017)
                     /locus_tag="KLTH0F01584g"
                     /product="KLTH0F01584p"
                     /transcript_id="XM_002554233.1"
                     /db_xref="GeneID:8292470"
     CDS             complement(120227..122017)
                     /locus_tag="KLTH0F01584g"
                     /note="similar to uniprot|P48813 Saccharomyces cerevisiae
                     YDR508C GNP1 High-affinity glutamine permease also
                     transports Leu Ser Thr Cys Met and Asn expression is fully
                     dependent on Grr1p and modulated by the Ssy1p-Ptr3p- Ssy5p
                     (SPS) sensor of extracellular amino acids"
                     /codon_start=1
                     /product="KLTH0F01584p"
                     /protein_id="XP_002554279.1"
                     /db_xref="GeneID:8292470"
                     /db_xref="GOA:C5DK41"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DK41"
                     /translation="MSKQPADSAGIGLQDLKSNTGSESIEKVSLPASDYQYHDGQVLS
                     RFQRLTNSFKRAGEHGRGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGML
                     VGNGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPA
                     LGFSVAWVYCLQWLCVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARG
                     YAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIHHFK
                     GIIATMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFL
                     VPYNSDELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSR
                     LLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISG
                     LSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFW
                     VAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVF
                     DEDLLKQEDAEYEESIRNSGWLSRVAHFWC"
     gene            complement(<122821..>124635)
                     /locus_tag="KLTH0F01606g"
                     /db_xref="GeneID:8292471"
     mRNA            complement(<122821..>124635)
                     /locus_tag="KLTH0F01606g"
                     /product="KLTH0F01606p"
                     /transcript_id="XM_002554234.1"
                     /db_xref="GeneID:8292471"
     CDS             complement(122821..124635)
                     /locus_tag="KLTH0F01606g"
                     /note="similar to uniprot|P48813 Saccharomyces cerevisiae
                     YDR508C GNP1 High-affinity glutamine permease also
                     transports Leu Ser Thr Cys Met and Asn expression is fully
                     dependent on Grr1p and modulated by the Ssy1p-Ptr3p- Ssy5p
                     (SPS) sensor of extracellular amino acids"
                     /codon_start=1
                     /product="KLTH0F01606p"
                     /protein_id="XP_002554280.1"
                     /db_xref="GeneID:8292471"
                     /db_xref="GOA:C5DK42"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DK42"
                     /translation="MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRF
                     VDSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLA
                     TGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAY
                     PALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIV
                     INFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRG
                     NNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLM
                     TAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVAN
                     SALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVF
                     TWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMIL
                     LILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVD
                     LVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC"
     gene            <125692..>126309
                     /locus_tag="KLTH0F01628g"
                     /db_xref="GeneID:8292472"
     mRNA            <125692..>126309
                     /locus_tag="KLTH0F01628g"
                     /product="KLTH0F01628p"
                     /transcript_id="XM_002554235.1"
                     /db_xref="GeneID:8292472"
     CDS             125692..126309
                     /locus_tag="KLTH0F01628g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F01628p"
                     /protein_id="XP_002554281.1"
                     /db_xref="GeneID:8292472"
                     /db_xref="UniProtKB/TrEMBL:C5DK43"
                     /translation="MRGPEESRLEVITRKGVYPVLLRALIFELCGRLLFYVFCITADR
                     QGTQPLNPLQTMVRTQTLGTTMISAVTSREWCSDVRVFGNSTRRASTRLGAVLTQTIG
                     YESPRSRARVTASITISAQVLCSGLSYVVMCGCSTTLAFGRHCRAGRRLLSLHTRVPL
                     AFKLALWPSHSSLSVSVTPGPENFAVHAHITLQDIIYSFFPLVAK"
     gene            <126388..>126672
                     /locus_tag="KLTH0F01650g"
                     /db_xref="GeneID:8292473"
     mRNA            <126388..>126672
                     /locus_tag="KLTH0F01650g"
                     /product="KLTH0F01650p"
                     /transcript_id="XM_002554236.1"
                     /db_xref="GeneID:8292473"
     CDS             126388..126672
                     /locus_tag="KLTH0F01650g"
                     /note="highly similar to uniprot|Q12306 Saccharomyces
                     cerevisiae YDR510W"
                     /codon_start=1
                     /product="KLTH0F01650p"
                     /protein_id="XP_002554282.1"
                     /db_xref="GeneID:8292473"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DK44"
                     /translation="MSEPQQESKPDIKPETHINLKVSDGSSEIFFKIKRTTPLRRLME
                     AFAKRQGKEMDSLRFLYDGVRIQADQTPEDLDMEDNDIIEAHREQIGGAL"
     gene            <127277..>130771
                     /locus_tag="KLTH0F01672g"
                     /db_xref="GeneID:8292474"
     mRNA            <127277..>130771
                     /locus_tag="KLTH0F01672g"
                     /product="KLTH0F01672p"
                     /transcript_id="XM_002554237.1"
                     /db_xref="GeneID:8292474"
     CDS             127277..130771
                     /locus_tag="KLTH0F01672g"
                     /note="similar to uniprot|Q12263 Saccharomyces cerevisiae
                     YDR507C"
                     /codon_start=1
                     /product="KLTH0F01672p"
                     /protein_id="XP_002554283.1"
                     /db_xref="GeneID:8292474"
                     /db_xref="GOA:C5DK45"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DK45"
                     /translation="MSTHSRQNSVVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQ
                     HESTGQQAAVKIVSKSIFGNQSNSSTIVGSNDPDVLPYGIEREIIIMKLLNHPNVLRL
                     YDVWETNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVRFFRQIIIGISYCHALGIVH
                     RDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFES
                     DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKIL
                     TVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVDGTIDDTIIGN
                     LVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQQEQLKQQRRSQAMQVSPK
                     KTGLRKSNSRRSINSTTPKKKTRAPVISASSSHKRPVSFSRLSYSNGSNTDHNTPNSS
                     GKRSSVNLSSNKRISALINPNSSPTPASKRASLRELDPSAPPIPVDMLKDYNKAAPKA
                     NRKSSRISKRLSFLPGNKRGSITTKLIATYAKISEDNDWEYIEKETKRTSADFATLCD
                     EIFEHEKYEQIRREKEELERRVREAKEQEERERRQREEEERRQREEELARQREFEEER
                     YHRQREVQENIDREMALLKEGYETSSGVDPNKNRSVSAPVESVLKVDKRSSMDALDGD
                     IMDLLNRRTFSLETRPKSRLDPGIYTLEEVPNSDIKDGGRDLKTEKTILETIRRSKFL
                     GSSFDINKELARERRLKEERAAALKQRKKEDRVVSNATGNYSENGYEPQTLPKNAAAT
                     KISNDAGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMYSTKASFTNLADHLRGKT
                     DLQSINGSPPSTSRMEPETEFMFESVDGEGKETADTSADSRLYEVAEGNDPKGAARSA
                     VRLNFADRFNKPTSPPPQSVEDPNGIKLPSLPPLDKAKSDGVNGLGLYQPASDSSETE
                     IHHQPKSMIPVDAEQKEAAEAKPEEQKQVPPKDVESAPAPLNKVMKKNTEAEKNQPNQ
                     PAPNAVKKNNKSFFRRFSGKSDDEKRPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYG
                     LKDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKL
                     VKEIEKILESKKALVFNN"
     gene            <130898..>132805
                     /locus_tag="KLTH0F01694g"
                     /db_xref="GeneID:8292475"
     mRNA            <130898..>132805
                     /locus_tag="KLTH0F01694g"
                     /product="KLTH0F01694p"
                     /transcript_id="XM_002554238.1"
                     /db_xref="GeneID:8292475"
     CDS             130898..132805
                     /locus_tag="KLTH0F01694g"
                     /note="similar to uniprot|Q04399 Saccharomyces cerevisiae
                     YDR506C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F01694p"
                     /protein_id="XP_002554284.1"
                     /db_xref="GeneID:8292475"
                     /db_xref="GOA:C5DK46"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:C5DK46"
                     /translation="MLLRWAPNLLLGAFALADTKLYELGISKGVSKEGKQVISLNGKN
                     DTVGPIIRVNSGDTLNLLVNNDICNANDYEQYGELYCDTSIHFHGVVLNNNGADLGVL
                     HDGVPGVSQYSIPSGMSYWYNFTIPENLCGTYWYHSHSSVQYGDGLRGIFLVDCDYRQ
                     KYIERVIAKLEADGTDGTLLENLPPQGAKVPVQEVVMAVTDWYSKSSVEILSQVMSPY
                     GGPDPSVEGSMMNGDTGSVKFEVAEGVEYVALRVINTGMSGTNVLHVEGHRLCVIETD
                     GVLTKPYMIDTLSIAVGQRFTVLVKLNKEAPARVVHGCGKMMGYVTKTHWLLRPGQVA
                     GDDYVGRVVHLPGLDKNEMYKQFVPLEGELLPEPSQQLSLDYEFDGDEAREPFGTTMY
                     TVNGDTMQEFMPDGVLIEGARGVREPIPLHGGGVVEIAINSIDHMTHPWHMHGHTFQV
                     VSVGRKRDGPLYFDNPESPAMKRYLADVAEWQDKVPMTRDTINIPGRSYAVIRLRADN
                     PGFWLLHCHVEWHMAKGLGVVFAEGDALVSAVSKPFARQSDAAGASTALPEPSSTADA
                     AATPTVSAVRAISTAADAPASSAAPATSQQQPSPEAAMPAASASKGKVLAIYLLIMCT
                     LNVAIWLFFFR"
     gene            <133903..>136104
                     /locus_tag="KLTH0F01716g"
                     /db_xref="GeneID:8292476"
     mRNA            <133903..>136104
                     /locus_tag="KLTH0F01716g"
                     /product="KLTH0F01716p"
                     /transcript_id="XM_002554239.1"
                     /db_xref="GeneID:8292476"
     CDS             133903..136104
                     /locus_tag="KLTH0F01716g"
                     /note="similar to Saccharomyces cerevisiae YLR177W
                     Hypothetical ORF and weakly similar to YDR505C
                     uniprot|P50896 Saccharomyces cerevisiae YDR505C PSP1 Asn
                     and gln rich protein of unknown function; high-copy
                     suppressor of POL1 (DNA polymerase alpha) and partial
                     suppressor of CDC2 (polymerase delta) and CDC6 (pre-RC
                     loading factor) mutations; overexpression results in
                     growth inhibition"
                     /codon_start=1
                     /product="KLTH0F01716p"
                     /protein_id="XP_002554285.1"
                     /db_xref="GeneID:8292476"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:C5DK47"
                     /translation="MSSSTKIDGYKSANGEIMESKRAELSAELPSINSTTSLSDNLAL
                     RNYYDKLLFKNSSGKSLTDLPGQAAGARPAERPVERRNVDFISGFGAPRSVQMTPSNS
                     EPLHMPLFQVGGERSLGMFNGVPGSGVPGSGVPGSGIPGSGVPGAALPGTGVSFSFGN
                     PLPFAPGAATAAAATSRNNSVGSSGSSGSTILTSPTSYYAALTQQSLSPTGALSPITS
                     AGTANFLGLDLQSQQMLQPQQQQQQQQQQQQQYLQQKQQQYMQQNPFNADRRSSYISD
                     SLIHSHANPELRVHAGLPTNLEQLYNATAAPKLRYTQMPQKHQSVPKVNYKPPAGAPL
                     TGGVAGGNPGSQQIENGLILVNGQQLMASAELQKLYHDCGSNYFSSDEACQFLDRVKT
                     LLSGAENSEMAANIGRFLSFLKSSNLNYNPQSDAFVSGNENRRNSSTSAYLHYKPLVL
                     VALKNGKLELLSMPQSANMSMCRQDLVVIDGDRGKDLALVVEPHVELDLALFINFLKK
                     KIHFDSLITNRDQHFPNSQFIRALVDSIHGHTDELNSKLYDVIELTQLIIPSKQVLRF
                     ATSWEVTTNLHNKFQDELKALHIALLKLKSLNSGLNHHQHQQQRPNLNIKILNAEFQF
                     DRKKLTFYYVCQERNDFRELIKELFKFYKTRIWLCAIPNNLDIESKYYDNQLKELKMY
                     QEMMQHCAGEDLLDKGRSSGFVVAPALSSIALDNFQIGVYKELVNELFAPK"
     gene            complement(<136381..>137007)
                     /locus_tag="KLTH0F01738g"
                     /db_xref="GeneID:8292477"
     mRNA            complement(<136381..>137007)
                     /locus_tag="KLTH0F01738g"
                     /product="KLTH0F01738p"
                     /transcript_id="XM_002554240.1"
                     /db_xref="GeneID:8292477"
     CDS             complement(136381..137007)
                     /locus_tag="KLTH0F01738g"
                     /note="similar to uniprot|P14306 Saccharomyces cerevisiae
                     YLR178C TFS1 Carboxypeptidase Y inhibitor (putative) lipid
                     binding protein supressor of a cdc25 mutation and to
                     YLR179C uniprot|Q06252 Saccharomyces cerevisiae YLR179C
                     Protein of unknown function, transcription is activated by
                     paralogous transcription factors Yrm1p and Yrr1p along
                     with genes involved in multidrug resistance"
                     /codon_start=1
                     /product="KLTH0F01738p"
                     /protein_id="XP_002554286.1"
                     /db_xref="GeneID:8292477"
                     /db_xref="InterPro:IPR001858"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:C5DK48"
                     /translation="MNYAINVTQASSDSLTTHKIIPDVVQDKSFKPQGLLAVEYSAAA
                     PVAMGNTLTVEETQSKPKFHFTLDPKSEFKIRDADLFTLVMTDPDAPSRTDKKWSEFC
                     HFVAADIRLATETSRSTSSAVPDFIASELSGGKTLVDYHPPGPPKGTGKHRYVFLLYK
                     QPGDSSAFTKIADRPNWGFGSPATGVHKWASENHLELVAANFFFAESK"
     gene            <137634..>138617
                     /locus_tag="KLTH0F01760g"
                     /db_xref="GeneID:8292478"
     mRNA            <137634..>138617
                     /locus_tag="KLTH0F01760g"
                     /product="KLTH0F01760p"
                     /transcript_id="XM_002554241.1"
                     /db_xref="GeneID:8292478"
     CDS             137634..138617
                     /locus_tag="KLTH0F01760g"
                     /note="weakly similar to uniprot|Q04396 Saccharomyces
                     cerevisiae YDR503C LPP1 Lipid phosphate phosphatase
                     catalyzes Mg(2)-independent dephosphorylation of
                     phosphatidic acid (PA) lysophosphatidic acid and
                     diacylglycerol pyrophosphate involved in control of the
                     cellular levels of phosphatidylinositol and PA"
                     /codon_start=1
                     /product="KLTH0F01760p"
                     /protein_id="XP_002554287.1"
                     /db_xref="GeneID:8292478"
                     /db_xref="GOA:C5DK49"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5DK49"
                     /translation="MPHGVRTAQQSKLHKSRDCSFKRYSRLPTRRAYARDKGAARTQI
                     TTPHHAFPQPQPPLNPSNMPPSLKSAVAYVAGFVPLYAACVVLIAALGFSEFHMAPRL
                     SRQVRTDDPAIKKSFVAHETVTPVQCLFLAFPLPVLVLAGWCTVGSDSLVSRYQRRSF
                     ARLARPDWVPAKFHLFHISCVALALALGINGVLTNGFKLLLSNARPDFLARCQPADPL
                     ALYVSVAQCTQPDKLVLYEGLKSTPSGHSSFAVAGLGFLYLWLARHTCVSRLRHVWCP
                     LLCVFVMASRVVDHRHHWYDVLTGGALGLAVCVGVWRTLMREEPQANLLPA"
     gene            <139467..>140615
                     /locus_tag="KLTH0F01782g"
                     /db_xref="GeneID:8292479"
     mRNA            <139467..>140615
                     /locus_tag="KLTH0F01782g"
                     /product="KLTH0F01782p"
                     /transcript_id="XM_002554242.1"
                     /db_xref="GeneID:8292479"
     CDS             139467..140615
                     /locus_tag="KLTH0F01782g"
                     /note="highly similar to uniprot|P10659 Saccharomyces
                     cerevisiae YDR502C and to uniprot|P19358 SAM1
                     S-adenosylmethionine synthetase catalyzes transfer of the
                     adenosyl group of ATP to the sulfur atom of methionine one
                     of two differentially regulated isozymes (Sam1p and
                     Sam2p)"
                     /codon_start=1
                     /product="KLTH0F01782p"
                     /protein_id="XP_002554288.1"
                     /db_xref="GeneID:8292479"
                     /db_xref="GOA:C5DK50"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:C5DK50"
                     /translation="MAKTFLFTSESVGEGHPDKICDQVSDAILDACLREDPLSKVACE
                     TAAKTGMIMVFGEITTKAQLDYQKIVRDTIKQIGYDSSDKGFDYKTCNVLVAIEQQSP
                     DIAQGLHYEQALEDLGAGDQGIMFGYATDETPELMPLTIMLAHKLNIAMADARRDGSL
                     PWVRPDTKTQVTVEYKQEEGRWIPLRIDTVVVSLQHADEISTEDLRSEIQKKVVEKVC
                     PADMLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDYSK
                     VDRSAAYAARWVAKSLVNAGICKRVQVQFSYAIGIAEPLSLHVDTYGTSSKSDEEVIE
                     IIKRNFDLRPGVLVRELDLARPIYLPTASYGHFTNQEYPWEKPKELKL"
     gene            complement(<140897..>142075)
                     /locus_tag="KLTH0F01804g"
                     /db_xref="GeneID:8292480"
     mRNA            complement(<140897..>142075)
                     /locus_tag="KLTH0F01804g"
                     /product="KLTH0F01804p"
                     /transcript_id="XM_002554243.1"
                     /db_xref="GeneID:8292480"
     CDS             complement(140897..142075)
                     /locus_tag="KLTH0F01804g"
                     /note="similar to uniprot|Q07057 Saccharomyces cerevisiae
                     YLR181C VTA1 Protein involved in endosomal protein sorting
                     binds to Vps20 and Vps4 and may regulate Vps4function has
                     coiled-coil domains mutants show class E vacuolar-protein
                     sorting defects"
                     /codon_start=1
                     /product="KLTH0F01804p"
                     /protein_id="XP_002554289.1"
                     /db_xref="GeneID:8292480"
                     /db_xref="InterPro:IPR023175"
                     /db_xref="UniProtKB/TrEMBL:C5DK51"
                     /translation="MGLPTSIKRELKLSGDFEFAVPVIGYYIKLHLVEELLGLAERTD
                     EVVSTATQLLDKIEGFKQNAEDDAVKQLLENQTKAKTYFLNFALSLYNEQLSKIQQGT
                     INQDLSRALWCCIDLFGAFLGLWGKSEATEDEVQQSQKRIKYCKVYLSKLARGELKPV
                     RPTQENAPDNKDVDSLLSELRKVEGDGEEEDDEEEEEISQQGEGKTEEEREGPGPETE
                     GKDPENSNLDPESVNEFIKSLEEDPSLGDPSESKELELRDSQPEQEQERRDTEELIRK
                     MRELDNDAEEQSDTELQPGGEEPKFELPSAPTDIGARPAFIDSDDEPEKVATAPSKVV
                     QQPTHFKPEDLKKMWNREDQISEVQKRAKFAISALNYEDIKSAKEELAKALELLNDIQ
                     "
     gene            <142334..>144325
                     /locus_tag="KLTH0F01826g"
                     /db_xref="GeneID:8292481"
     mRNA            <142334..>144325
                     /locus_tag="KLTH0F01826g"
                     /product="KLTH0F01826p"
                     /transcript_id="XM_002554244.1"
                     /db_xref="GeneID:8292481"
     CDS             142334..144325
                     /locus_tag="KLTH0F01826g"
                     /note="similar to uniprot|P09959 Saccharomyces cerevisiae
                     YLR182W SWI6 Transcription cofactor forms complexes with
                     DNA-binding proteins Swi4p and Mbp1p to regulate
                     transcription at the G1/S transition involved in meiotic
                     gene expression localization regulated by phosphorylation
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0F01826p"
                     /protein_id="XP_002554290.1"
                     /db_xref="GeneID:8292481"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DK52"
                     /translation="MDIREYEHHYDLNGQATVVKLVRDLNKDSFLVDALVPLLASAAN
                     VEKSNGDWRNLVLQKFGILVERDGQGNEWISRGKTWELLKILNLHDAYRDVFEEPGDT
                     DEDDNSARFDGETREKRSLKGTTHQLGSPLKKLKPAEAFQTVRTFSHDLDLASPLAVQ
                     LAKKPLKTFQPEERVKLEHLLQHILFPDDQSIQFETALRNLEETYPQTRLNLDIPIDE
                     HGNTSLHWLCSIANVRLTKDLIHTGADRLLGDMSGESALVKAVKSVNNYDSGTFEELL
                     DYLYPCLILLDEMGRTVLHHIVITSGMPGCASAAKYYLDILMGWIVKKQAREVAGDAD
                     IIMTTVDLKWFISHVLNARDINGDTCLNIASRLGNVSIVEALLDYGADPRISNNSGLR
                     PVDFGAGASKIEASTANADNGATVTALGPDSAVLINNIQSLINTISQDYDMEIKQHKE
                     QLKKLHSELKTQRELLSSSRDRLAQARQLRDEHTQLTEQVSNIQQAIGEEDASFKKVS
                     DELGINDESLDMAEFDADEPFRIEFIYEFLEKKLEAEYSGDLEKFLGNASLDELTAQL
                     MEESSGQEESIPPAVLLRARICAYEKNEESLNKSLESVHQKQADLEGRFRRVLSLCLK
                     IDEDKVDDMLDGLLQAISTEDPEDIDTDEMQSFLSKHNV"
     gene            complement(<144487..>146034)
                     /locus_tag="KLTH0F01848g"
                     /db_xref="GeneID:8292482"
     mRNA            complement(<144487..>146034)
                     /locus_tag="KLTH0F01848g"
                     /product="KLTH0F01848p"
                     /transcript_id="XM_002554245.1"
                     /db_xref="GeneID:8292482"
     CDS             complement(144487..146034)
                     /locus_tag="KLTH0F01848g"
                     /note="similar to uniprot|Q04383 Saccharomyces cerevisiae
                     YDR501W PLM2 Plasmid Maintenance and to uniprot|Q06266
                     YLR183C Saccharomyces cerevisiae TOS4 Transcription factor
                     that binds to a number of promoter regions, particularly
                     promoters of some genes involved in pheromone response and
                     cell cycle; potential Cdc28p substrate; expression is
                     induced in G1 by bound SBF"
                     /codon_start=1
                     /product="KLTH0F01848p"
                     /protein_id="XP_002554291.1"
                     /db_xref="GeneID:8292482"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C5DK53"
                     /translation="MPGQFPPSSPIAACPADPDDPFYQPSEKHSPSTLKFFHKKIAPV
                     DHEYPTPHPSSTLGRSSSPVKARDSHVLGSQTHSDYELEQDLRRELSSRGSASVRPIQ
                     IPLNSRLETRLSIGRKQAACDIVLPRHKNISRLHAFVTYYPESREVKLECKGSNGLIV
                     AFPLKLDLDLTVCSHPEKAFRLMRSKPEQQLSSREVVKNAKLTSFVLLEGESVLMPYI
                     DGTLIDFRHAECELAVYEPLGDSDDDSQNATETEDELQPLQITSDDFEPRTPDNEVVH
                     IPLHTAFPPKLHVKERLLSLEPQPLLAEPATPLQHKDTKDTTLEEHKESFGGAVEIEE
                     PKTPQRQTLDSHFEKQDPQTPLLKTEANARRRKLASPSPEKTHKRKNQQKVSPLSAEE
                     ILLNVSSRGVDVLELQHILANHLAFSNVQQVPFTQLRDVNSTVSTLAPKELRALLEAE
                     RCIGVIYRQGKDAAGKPLDEEYYYDVENDSDENRRQLVSALKGGRSNLRSCRRVHKQY
                     FWKKPAK"
     gene            <149177..>150085
                     /locus_tag="KLTH0F01892g"
                     /db_xref="GeneID:8292484"
     mRNA            <149177..>150085
                     /locus_tag="KLTH0F01892g"
                     /product="KLTH0F01892p"
                     /transcript_id="XM_002554246.1"
                     /db_xref="GeneID:8292484"
     CDS             149177..150085
                     /locus_tag="KLTH0F01892g"
                     /note="similar to uniprot|P47137 Saccharomyces cerevisiae
                     YJR096W"
                     /codon_start=1
                     /product="KLTH0F01892p"
                     /protein_id="XP_002554292.1"
                     /db_xref="GeneID:8292484"
                     /db_xref="GOA:C5DK54"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DK54"
                     /translation="MTHSIDINRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTAL
                     QEGYRHIDTAVVYENQKQAAQGVHRFLEETGTPREEVWFTTKLWNTQQGRDATPRALE
                     EIAADVKEFIGYVDLLLLHSPLTDAQRRLETWAVLERAVQEPASSALEIRAIGVSNFG
                     VRHLQELLEVATVKPVVDQLELHPWLPRAELRAFLRENGILAEAYSPLTQGVRLQDPE
                     LLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWKVSLDQE
                     LWDALDKPDSHDVATWGQKDPTEYTV"
     gene            <150478..>151115
                     /locus_tag="KLTH0F01914g"
                     /db_xref="GeneID:8292485"
     mRNA            join(<150478..150484,150856..>151115)
                     /locus_tag="KLTH0F01914g"
                     /product="60S ribosomal protein L37"
                     /transcript_id="XM_002554247.1"
                     /db_xref="GeneID:8292485"
     CDS             join(150478..150484,150856..151115)
                     /locus_tag="KLTH0F01914g"
                     /note="highly similar to uniprot|P49166 Saccharomyces
                     cerevisiae YLR185W RPL37A protein and to uniprot|P51402
                     Saccharomyces cerevisiae YDR500C RPL37B protein,
                     components of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L37"
                     /protein_id="XP_002554293.1"
                     /db_xref="GeneID:8292485"
                     /db_xref="GOA:C5DK55"
                     /db_xref="InterPro:IPR001569"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR018267"
                     /db_xref="UniProtKB/TrEMBL:C5DK55"
                     /translation="MGKGTPSFGKRHNKSHTLCNRCGKRSFHIQKKTCASCGYPAAKM
                     RSYNWGAKAKRRRTTGSGRMGYLKNVSRRFKNGFQTGVAKPQSA"
     gene            complement(<151241..>153382)
                     /locus_tag="KLTH0F01936g"
                     /db_xref="GeneID:8292486"
     mRNA            complement(<151241..>153382)
                     /locus_tag="KLTH0F01936g"
                     /product="KLTH0F01936p"
                     /transcript_id="XM_002554248.1"
                     /db_xref="GeneID:8292486"
     CDS             complement(151241..153382)
                     /locus_tag="KLTH0F01936g"
                     /note="similar to uniprot|Q04377 Saccharomyces cerevisiae
                     YDR499W LCD1 Essential protein required for the DNA
                     integrity checkpoint pathways interacts physically with
                     Mec1p putative homolog of S. pombe Rad26 and human ATRIP"
                     /codon_start=1
                     /product="KLTH0F01936p"
                     /protein_id="XP_002554294.1"
                     /db_xref="GeneID:8292486"
                     /db_xref="InterPro:IPR018622"
                     /db_xref="UniProtKB/TrEMBL:C5DK56"
                     /translation="MDDWDDDDEDDLIEALSKKPPREPSFGSTQSFQRTQNDPKGTET
                     QSAVAVSAEEAKDIEMKLLKAQGEASMLRDKLALFEAEKERERKTQTQKQKELELQHQ
                     HELDLIKADLQKAEDEKKFLAFSGRSSHRSPGRHAAANTPEASSGESVSAATKKRKLE
                     EPPRRYITLKPNRIVSDEVDLFVNSAISHRLAGSRLSTLEILNNIYLGHVKDFKFKIL
                     DIAGDGPVGKGIFDMLMSHIRSPLKLDQFIEILLECLAMLIKEISQHEKECDTAVPFL
                     VALMHHCITFRPSAIHTMALKDLFNFMVDLIRTHRSVLKRPLRKSDLELDVGPDIFQY
                     EFIRILTVLYAFDVLEDGLKIVQSLPVSFQAAFMDDAFRGAVDDISRYSLTISYQPVI
                     NVIHNTVEMFNCIANMLLEAPELKEKVPVRWWDNIINRLYHILNKGTSNTARNELELS
                     TLHLFDEINIFGLIRNIGDNHNGQLISLLVKENEPWHLPRVIMRDFPKEQGITNRATD
                     VEWWAVNMKIGIVKLFEKLAIAYRDGPVERNMLKVLARLLAQTQEVLLTVLLGEDSEN
                     IHVYYEFFSQTLKLIYHMWKSGQWELRLLREAEAELTVCLWRVVFGTTHEGSRVEMAE
                     HKTLADRFDELRLQQDAELYEDAFENEVPDFVAEETRAQSFSRLKEIMGIGAEETTRQ
                     MAKTMLEGITSMEDADALYMAMQAGSAELGP"
     gene            <154767..>155525
                     /locus_tag="KLTH0F01958g"
                     /db_xref="GeneID:8292487"
     mRNA            <154767..>155525
                     /locus_tag="KLTH0F01958g"
                     /product="KLTH0F01958p"
                     /transcript_id="XM_002554249.1"
                     /db_xref="GeneID:8292487"
     CDS             154767..155525
                     /locus_tag="KLTH0F01958g"
                     /note="highly similar to uniprot|Q06287 Saccharomyces
                     cerevisiae YLR186W EMG1 Protein required for the
                     maturation of the 18S rRNA and for 40S ribosome production
                     associated with spindle/microtubules nuclear localization
                     depends on physical interaction with Nop14p may bind
                     snoRNAs"
                     /codon_start=1
                     /product="KLTH0F01958p"
                     /protein_id="XP_002554295.1"
                     /db_xref="GeneID:8292487"
                     /db_xref="GOA:C5DK57"
                     /db_xref="InterPro:IPR005304"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:C5DK57"
                     /translation="MVEDSKVRDALKTGEKKSLPASLVPQAPMVLTSRDKVTQRMIVV
                     LSMASLETHKISSSGPGGDKYALLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDS
                     PINKAGKLQVYIQTSRGVLVEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLL
                     KVIKNPITDHLPTKCRKVTLSFDAPVIRVQDFIEKLDKDESICVFVGAMARGKDNFAD
                     EFVDEKIGLSNYPLSASVACSKFCHGAEDAWGIL"
     gene            <155740..>157611
                     /locus_tag="KLTH0F01980g"
                     /db_xref="GeneID:8292488"
     mRNA            <155740..>157611
                     /locus_tag="KLTH0F01980g"
                     /product="KLTH0F01980p"
                     /transcript_id="XM_002554250.1"
                     /db_xref="GeneID:8292488"
     CDS             155740..157611
                     /locus_tag="KLTH0F01980g"
                     /note="similar to uniprot|P53835 Saccharomyces cerevisiae
                     YNL279W PRM1 Pheromone-regulated multispanning membrane
                     protein involved in membrane fusion during mating
                     predicted to have 5 transmembrane segments and a coiled
                     coil domain localizes to the shmoo tip regulated by
                     Ste12p"
                     /codon_start=1
                     /product="KLTH0F01980p"
                     /protein_id="XP_002554296.1"
                     /db_xref="GeneID:8292488"
                     /db_xref="GOA:C5DK58"
                     /db_xref="InterPro:IPR026777"
                     /db_xref="UniProtKB/TrEMBL:C5DK58"
                     /translation="MPFKPYLELRGRISQVWLNQHTLIFTLAAVKLAFFSASLKQAIE
                     RSKQSILSSCDSADYFYTQFVGVAPTYMCQFGNYLVQQSIKESIKTSLAAVSLLVYAG
                     EKLSTFLFDFYFGTYICLATSAVDGAVSVATNTTEKVLDFVNGTVETLGEDLNSGLSD
                     ISEAINKVVGALNDVESFFKGSDSTDITSQFKSVNLTIEKLRDFQIPSSIDSKLEALS
                     NSTPNFDTVINKTHSEISKPFELVRSKITALNVSKIMVQSQGLYVPSNSSNSSSLGPC
                     ASSKPDIVKFYAGLSNAISVALIVLALALALAAIAATMPSLWEESRKWRKLIKLQRDV
                     NQAKIDYAYLKNGHCPDAIESYQKVYERWSTAFGAWLAPRISNSEHVQQKVRWCVAYA
                     MSPRALTILAVSITGVVVCICQFILIAALRRAATGDGVQQLTSSSLSYANASLHNDMS
                     VWATSANQYINSTSSSLNSELFGWVNTTTTAVNATVNSAIDDIDTTLADFFNGTLLYK
                     PMTSVVRCTIENKLYKIQSAMTWLNEKLQISLPLVDQATLSATLNRELSTQNSASSSN
                     AALQVGQKIVQNAQTLILAILHQYRTATLFELGVSLVLFAVWILQWLIAITYCIMFT"
     gene            <158021..>161119
                     /locus_tag="KLTH0F02002g"
                     /db_xref="GeneID:8292489"
     mRNA            <158021..>161119
                     /locus_tag="KLTH0F02002g"
                     /product="KLTH0F02002p"
                     /transcript_id="XM_002554251.1"
                     /db_xref="GeneID:8292489"
     CDS             158021..161119
                     /locus_tag="KLTH0F02002g"
                     /note="similar to Saccharomyces cerevisiae YLR187W SKG3
                     Protein of unknown function; green fluorescent protein
                     (GFP)-fusion protein localizes to the cell periphery,
                     cytoplasm, bud, and bud neck; potential Cdc28p substrate
                     And to YNL278W uniprot|P53836 Saccharomyces cerevisiae
                     YNL278W CAF120 Part of the evolutionarily- conserved
                     CCR4-NOT transcriptional regulatory complex involved in
                     controlling mRNA initiation, elongation, and degradation"
                     /codon_start=1
                     /product="KLTH0F02002p"
                     /protein_id="XP_002554297.1"
                     /db_xref="GeneID:8292489"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DK59"
                     /translation="MRSPTKGLLAPPKTFQKSDDKNSRSRSSSFSRLFSSGSSDNSPR
                     RQVPPLQEISTSAIPPELVPIVTLLSAQSHRRYHEGVFLILKDLNSDGSPATRTWKEV
                     YGVLIGNQLALWDARLLAENGQRPEDLMEATSKPTYVNFTDASFRPLDHKEAVIAEGK
                     KQLQNTIVVSTTLKNRYFLQFSDKEAFTQWHAALRLSAFEFTALQEAYTGAFLSTKGA
                     KLGDIRVILADTKFDYEDWVSVRFGAGMPWKRCYAVVSQPSKKSKSKLICGEINFYEN
                     EKKTKKVKAMTTVKDACAVYALYPSSPVLIDTSTMIKLEGKVSFGKKDAPTLTDIFIM
                     PEKHYAVPGYDTIIRFLIPIMNAFQLYGRPKRLIADRNNLDSLLFGLPTLPHVHFLQL
                     QDIMPLASSASNMEWSILDWRNHIKALLLKKIDQGYTGCGSSEGLTGALASPAIGSND
                     LFDSSPLPTSPLLASVSRLPSENKTEFGSIKSNLRNAATTDNIDGNTSKSGLHDSSSK
                     ASDDKGFVTETAPSATQVSRNGGSFEDVSDDKKQSRKKLTPTIDIQDSNFSEFEREAL
                     KPKTSEALGFRKSELSTIYDKYSQMPFGDSAGQPPSLPIDRDNRDSFGAYNDYIGSPK
                     VKNLDISNLRDSNSTDQTDLSRVHDFSGEGGRRSFADSFQSGEPAPAEERSVKDDVLE
                     DFYSLSQQISKMGLDSQDRASFSASKANVNDDFNFEASETNDSIGALDNVFDPDYLEQ
                     NQMLDNESNYTANESKSQYSGDNTNLSYQPLQRDQAQPSYGGEGFTYSQKLPKQRAAN
                     HVVTPTSPQFYPNHPVENQNAGSAERLGKMKHSPAYPNLNTVNTQTNGSPSHRRNPVP
                     PPPQGAQYSPNNMQHRRPGPQGVPSGAPRPVPQQYPQQVPQQAFQQVPRAMSKPVPQQ
                     VPYSNRPYVPAGAPNAYGRPNPPAQYPPTGAVPLGQPGNPRGPGYAMGPHPQARPMRH
                     TASQTMNQAAPQVFSQSIPHPNSKLQAKSAQPSPRAGGFSQFMPATANNPNPYSANPY
                     TS"
     gene            <161423..>163627
                     /locus_tag="KLTH0F02024g"
                     /db_xref="GeneID:8292490"
     mRNA            <161423..>163627
                     /locus_tag="KLTH0F02024g"
                     /product="KLTH0F02024p"
                     /transcript_id="XM_002554252.1"
                     /db_xref="GeneID:8292490"
     CDS             161423..163627
                     /locus_tag="KLTH0F02024g"
                     /note="similar to uniprot|P33310 Saccharomyces cerevisiae
                     YLR188W MDL1 Half-type ATP-binding cassette (ABC)
                     transporter of the inner mitochondrial membrane mediates
                     export of peptides generated upon proteolysis of
                     mitochondrial proteins plays a role in the regulation of
                     cellular resistance to oxidative stress"
                     /codon_start=1
                     /product="KLTH0F02024p"
                     /protein_id="XP_002554298.1"
                     /db_xref="GeneID:8292490"
                     /db_xref="GOA:C5DK60"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DK60"
                     /translation="MKLSTFGLSGLIGNARLPILRAGIGRPSLLLQVRSLHNGKTSFE
                     RQLAAMLQNRTIMRQVRWQHSNASKPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMF
                     FALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDS
                     EKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDA
                     SFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVM
                     MLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRH
                     YAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSF
                     MIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVE
                     FKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAI
                     LIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIG
                     QANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDS
                     RSEEVIARTLHSRTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASNT
                     DSQLNKLLRKEEEPVQPGEITNAPHRPEGSDQRPEGPSDGAATFELAPVTKA"
     gene            <164010..>165473
                     /locus_tag="KLTH0F02046g"
                     /db_xref="GeneID:8292491"
     mRNA            <164010..>165473
                     /locus_tag="KLTH0F02046g"
                     /product="KLTH0F02046p"
                     /transcript_id="XM_002554253.1"
                     /db_xref="GeneID:8292491"
     CDS             164010..165473
                     /locus_tag="KLTH0F02046g"
                     /note="similar to uniprot|P08465 Saccharomyces cerevisiae
                     YNL277W MET2 L-homoserine-O-acetyltransferase catalyzes
                     the conversion of homoserine to O-acetyl homoserine which
                     is the first step of the methionine biosynthetic pathway"
                     /codon_start=1
                     /product="KLTH0F02046p"
                     /protein_id="XP_002554299.1"
                     /db_xref="GeneID:8292491"
                     /db_xref="GOA:C5DK61"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DK61"
                     /translation="MIEYPVRESSLKGVDPESLEATNPYVKLVKNQRIVEVPELELES
                     GVVLKNFPIAYKTWGELNERGDNVIVVCHALTGSSDVSDWWGPLLGPDLAFDISRFLV
                     VCLNSMGSPYGSFSPMNINAQTGEPYGPEFPLCTVRDDVRAHRIVLDSLGVNSIACVV
                     GGSMGGMLALEWSVTFGKAYVKNMVALATSARHSAWCISWSEAQRQSIYSDPNYLDGY
                     YSHENPPVVGLAAARMSALLTYRSRNSFENKFSRRSPSVAQQEKSNKQSVKLKPSNLQ
                     EHNLSIHNDGHRRSIAQERKSSVSSDTSSNDSLRSVSSSTSTSSVVTLSKNSRAIKPA
                     QTYFSAQSYLRYQGKKFIDRFDANCYISITRKLDTHDLARERFEYEEDLDRVLNSIEQ
                     PSLVIGIKSDGLFTYSEQEYLAANIPNSRLEKIDSPEGHDAFLLEFKLINELIINFLK
                     ENAKEITESPPRLWQDLGEREIVKNSLFGEAEEVTNW"
     gene            complement(<165601..>169410)
                     /locus_tag="KLTH0F02068g"
                     /db_xref="GeneID:8292492"
     mRNA            complement(<165601..>169410)
                     /locus_tag="KLTH0F02068g"
                     /product="KLTH0F02068p"
                     /transcript_id="XM_002554254.1"
                     /db_xref="GeneID:8292492"
     CDS             complement(165601..169410)
                     /locus_tag="KLTH0F02068g"
                     /note="similar to uniprot|Q06321 Saccharomyces cerevisiae
                     YLR189C ATG26 UDP-glucose:sterol glucosyltransferase
                     conserved enzyme involved in synthesis of sterol glucoside
                     membrane lipids involved in autophagy"
                     /codon_start=1
                     /product="KLTH0F02068p"
                     /protein_id="XP_002554300.1"
                     /db_xref="GeneID:8292492"
                     /db_xref="GOA:C5DK62"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002213"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR004276"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DK62"
                     /translation="MPGEKPDTDEISEVEQRPATVVESPKRRWRRSMPPVGRMYQSFT
                     SFASSNRNSSDGGSSNPVFSDEDSSGPHGGEDKDQEHDLAIPCGMAKSIVGLLTTASV
                     YAGMGDIEQAESICEGEESDASDDSGPTDRSEAFERSEPSKNPGTPEVNKDDEVEGPA
                     SSSPSDVTVGADENSEANDSNPISETPSQISKKDTLFEISVVPNSDLQSIMTSSSNSR
                     QSKIYRKLISKFGLNEDEDQFVLTCPCWLLKDLLIQGHTVLTTRHLLFFAFLPKSTGA
                     TKMSGNLSTVSGRLRGRWTRHWAVLKDHTLSFYNSPKDLYFPILTIDLRYATKVELSK
                     HNGEATGDFRIFTEGKTFKFRADSNYAARSWCSALKKQVFATQNSENDSMSVKIPLAN
                     IIDMDEQLVVAQSVTLRIRVLESSQSFAVDDYFFMFLNKKDLKLKETINTLLLELDRV
                     SPEELGSTTIANETGESPLVDEDTQKGSHPERRGRSRSTSKKLFKRVLSPMSRSPGHS
                     LSMSISIPFSTKSSHTGKGRLRAVTDGFSRKLPTGNVEEHVSVKHPADIEVEPSNEDQ
                     EVVPKETAANESVPDPADEGKGRNFRLASWTPKPIKNMGNMWNAHPVHYETEGPDMFP
                     GDDPYLTTPKEQSIAAKRFRSHFSLDGTESLHAAYYTYLNKNIPVYGKLYLGASVVCF
                     RSLIPGTKTKMILPIKDVENCYKERGFRFGYFGLVLVIHGHEELFFEFSLQSSRDDAE
                     FAMLKLLDAVKPRLDGVSAAKTNVKNGNTESSSGRNKQLTEAAKLRMLEDKINAEGYD
                     LPMMIEENPYFKTSITPKKSYKFGLLTIGSRGDVQPYIALGKGLVREGHHVTIITHAE
                     FGEWIESYGLGFIEIAGNPAALMSLMVQHGSMNVGLLRDASSQFRGWIKDLLDTSWSA
                     CQGLDILIESPSAMAGIHIAEALKIPYFRAFTMPWTRTRSYPHAFIVPDQKRGGNYNY
                     FTHVLFENILWKGIGGQVNKWRVEKLGLEKTNLYMMQQNKVPFLYNISPSIFPPSVDF
                     SEWVKVTGYWFLDSKDDYDPPVELVKFIEKARASNKKLVYIGFGSIVINDPKEMTRAV
                     VDAILDADVFCILNKGWSDRLDNDIKKNAEQEVFPDCIYNSGSVPHDWLFPKVDAAVH
                     HGGSGTTGATLRAGLPTVIKPFFGDQFFFAGRIEDIGAGISLKKLNSKSLSRALKEVT
                     TNSRIINKAKQIQQEISKEDGVSVAISCIYAELAYARSLVVAKAKGTQSDAKDPSSPE
                     ENTWFLV"
     gene            complement(<170047..>171369)
                     /locus_tag="KLTH0F02090g"
                     /db_xref="GeneID:8292493"
     mRNA            complement(<170047..>171369)
                     /locus_tag="KLTH0F02090g"
                     /product="KLTH0F02090p"
                     /transcript_id="XM_002554255.1"
                     /db_xref="GeneID:8292493"
     CDS             complement(170047..171369)
                     /locus_tag="KLTH0F02090g"
                     /note="similar to uniprot|P40015 Saccharomyces cerevisiae
                     YER019W ISC1 Inositol phosphosphingolipid phospholipase C
                     hydrolyzes inositolphosphosphingolipids activated by
                     phosphatidylserine cardiolipin and phosphatidylglycerol
                     mediates Na and Li halotolerance contains a P loop-like
                     domain"
                     /codon_start=1
                     /product="KLTH0F02090p"
                     /protein_id="XP_002554301.1"
                     /db_xref="GeneID:8292493"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DK63"
                     /translation="MSDVDAGADIKFLTLNTWGLKYVSKFRKERLREIANKLAGRSMA
                     LPLHGLEEDSGSDDYDVVALQEIWCKSDWEYIEETCRHRYPYRRIFYSGIIAGPGLAI
                     LSKIPIESTFLYRFPINGRPSAFFRGDWYVGKSVSVTLLKPTSSSSNALAILNSHMHA
                     PYAQSGDAAYYCHRSCQAWDMSQMANLYKKAGYAVVIVGDLNSKPGTLPHKFLTKETG
                     FVDSWEQLHGKQDLVRISKLDPLLQIKQGGTTCDSILNTWRSMRRPDEACRLDYALVD
                     PSRLQTLEACVRFTERIPEIGSFSDHFAYNCKLRLLPRNAAAAGGSKETRERILEKMN
                     IYDEMLQVIENYKRVSRWQKLWRSAHFWIAVFCIVVVHVVITFTSNRAGWSSVFWAFF
                     LTVTTASGLIDGLISFLFGRSELRALEEVSTEVRDAKLNAHRALDGKV"
     gene            <171589..>172328
                     /locus_tag="KLTH0F02112g"
                     /db_xref="GeneID:8292494"
     mRNA            join(<171589..171793,171847..>172328)
                     /locus_tag="KLTH0F02112g"
                     /product="KLTH0F02112p"
                     /transcript_id="XM_002554256.1"
                     /db_xref="GeneID:8292494"
     CDS             join(171589..171793,171847..172328)
                     /locus_tag="KLTH0F02112g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F02112p"
                     /protein_id="XP_002554302.1"
                     /db_xref="GeneID:8292494"
                     /db_xref="InterPro:IPR013255"
                     /db_xref="UniProtKB/TrEMBL:C5DK64"
                     /translation="MQIEHFAELRHEMESFQTKLTAALEERKLTLLRAVEGYLQDVQQ
                     LEARQQESNNRLKQLKSQERALEQEIEISERERDETIAKAEVYKARKQQIDSERAVLT
                     RDSQELRKLLLQKQDEIQNKRIILQKQQQKDSLDAKAYEELLGLRIEAPEPEILKFIF
                     NRVSEFEENASCEIAIDLSQASYKIIHSAPRLEAGAVTDLELKLSSDGDLGSFLKESR
                     AQLITEYSRQ"
     gene            <172432..>173496
                     /locus_tag="KLTH0F02134g"
                     /db_xref="GeneID:8292495"
     mRNA            <172432..>173496
                     /locus_tag="KLTH0F02134g"
                     /product="KLTH0F02134p"
                     /transcript_id="XM_002554257.1"
                     /db_xref="GeneID:8292495"
     CDS             172432..173496
                     /locus_tag="KLTH0F02134g"
                     /note="similar to uniprot|P25625 Saccharomyces cerevisiae
                     YCR044C PER1 Vacuolar membrane protein that seems to be
                     involved in Mn2 homeostasis mutant is dependent on
                     activation of the unfolded protein response pathway for
                     viability"
                     /codon_start=1
                     /product="KLTH0F02134p"
                     /protein_id="XP_002554303.1"
                     /db_xref="GeneID:8292495"
                     /db_xref="InterPro:IPR007217"
                     /db_xref="UniProtKB/TrEMBL:C5DK65"
                     /translation="MLCLWVFLTLSGLVQRTLGSPGDWLDEFIDCKELCEASIPCAGF
                     EGIEIPSGASAEITYFTEASAIQKYFLFWDCKSNCDYQCQQVVTQIRIAEGEKVVQFH
                     GKWPFKRLFGMQELFSTLFSVANFFPHYRGYKLLQRELSRLPARKRSRFILKKYLYVA
                     IAGMLAWTSSSIFHFRDLEVTEKLDYFFAGATVLSGFHGILIRILRLDKSDQFRHAVT
                     AAVLLIFSLHVLRLYLDWSYTYNMRFNVLFGLLQYILLLTLAYKNYRQLKAGKLPRKS
                     HHPPRENLYFELCVVPVALVVGTALAMSCELFDFFSYSWQIDSHAIWHACTVLPSWKL
                     YDFFLHDFHYLDACEDSSSD"
     gene            <173860..>175536
                     /locus_tag="KLTH0F02156g"
                     /db_xref="GeneID:8292496"
     mRNA            <173860..>175536
                     /locus_tag="KLTH0F02156g"
                     /product="KLTH0F02156p"
                     /transcript_id="XM_002554258.1"
                     /db_xref="GeneID:8292496"
     CDS             173860..175536
                     /locus_tag="KLTH0F02156g"
                     /note="similar to uniprot|P53838 Saccharomyces cerevisiae
                     YNL275W"
                     /codon_start=1
                     /product="KLTH0F02156p"
                     /protein_id="XP_002554304.1"
                     /db_xref="GeneID:8292496"
                     /db_xref="GOA:C5DK66"
                     /db_xref="InterPro:IPR003020"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="UniProtKB/TrEMBL:C5DK66"
                     /translation="MTLRGGLVSKAPREMFGFWSEDRAKLSQTEEDTDDTQSNLRTKF
                     PKPFAGIAHDLRDRLPVYWSDWSDSWDYRVIPSVIETFFNNLLPAIAFAQDMFDRTDH
                     SYGVNEVLLASTVGGVVFGLLAGQPLCIVGVTGPITIFNYTVYEVIKPLHTNYFGFMF
                     WVCIWSMIFHFLLAIFNAVCLLQYVTTFPCDVFGLFNNVVYMEKGIQILVRQFKKNGK
                     VDLSAGFASTVVALLMTMFGLSSKLITKTPFFSHRIRTFIADYSTALSVVFWSGFIHF
                     GGFLSDIDFQKLPITKSFIPTSHLRDRTTWLAYEAISTRDIFIALPFGLVLTTLFYFD
                     HNVSSLMAQRYQYRLKKASTFHYDFALLGATTGVSGILGIPAPNGLIPQAPLHTESLL
                     VRDKRGEVVRCVEQRFTNTAQGLLTLATMSRPLLVCLGQIPQAVLSGLFFIMGLNNLL
                     HNAILGRIMLLITERDKRDLRNLIYKVPLPKVLIFLSLSLAGFAAEFAISNTIAAIGF
                     PLILLLTVIVSLFFPKWFSPEDLKILDEGVAEEFTLKNLQVSSLTGTSAT"
     gene            <175709..>176068
                     /locus_tag="KLTH0F02178g"
                     /db_xref="GeneID:8292497"
     mRNA            <175709..>176068
                     /locus_tag="KLTH0F02178g"
                     /product="KLTH0F02178p"
                     /transcript_id="XM_002554259.1"
                     /db_xref="GeneID:8292497"
     CDS             175709..176068
                     /locus_tag="KLTH0F02178g"
                     /note="similar to uniprot|P25361 Saccharomyces cerevisiae
                     YCR043C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F02178p"
                     /protein_id="XP_002554305.1"
                     /db_xref="GeneID:8292497"
                     /db_xref="UniProtKB/TrEMBL:C5DK67"
                     /translation="MIPEPVDPGLLREHAFYDSGDLGVVLSKDTYTEFGGFKSIFKYG
                     LGYFNYASGLDREVHERSLAYMLKFHILQHFGLYCCITMVALVVSFIALSQVQGNAMG
                     RNKKAEKDGDDVYYVKV"
     gene            complement(<176232..>177281)
                     /locus_tag="KLTH0F02200g"
                     /db_xref="GeneID:8292498"
     mRNA            complement(<176232..>177281)
                     /locus_tag="KLTH0F02200g"
                     /product="KLTH0F02200p"
                     /transcript_id="XM_002554260.1"
                     /db_xref="GeneID:8292498"
     CDS             complement(176232..177281)
                     /locus_tag="KLTH0F02200g"
                     /note="similar to uniprot|P53839 Saccharomyces cerevisiae
                     YNL274C Putative hydroxyisocaproate dehydrogenase"
                     /codon_start=1
                     /product="KLTH0F02200p"
                     /protein_id="XP_002554306.1"
                     /db_xref="GeneID:8292498"
                     /db_xref="GOA:C5DK68"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:C5DK68"
                     /translation="MSKPVVLRLGAVKYAQEAWEKLAKIADVVTIEDSTTRPEFLKMC
                     QDPNSAVSKAQIVSRTFASVQQTGRFDKELAQKLPSSVVAVCHNGAGYDQIDTSDFAD
                     RKIQVSNVPELVNNATADTHVFLMLGALRNFEYGRRLMLENKWPSGGAAAGAPVGHDP
                     EGKVVGVLGLGGIGRAIVERLKPFGFKKFIYHNRNRLSPELENGCEYVSFEQLLEQSD
                     VVSINIPLNAKTRHIIDEAAISKMKDGVVIVNTARGAVIDEKALIAALKNGKVRSAGL
                     DVYEHEPQVPQELLDLPNVCGVPHMGTHSVETIKIMEEFVVENVKSVINSGKVLSIVP
                     EMKNDAWAKDQKPLV"
     gene            <177818..>182149
                     /locus_tag="KLTH0F02222g"
                     /db_xref="GeneID:8292499"
     mRNA            <177818..>182149
                     /locus_tag="KLTH0F02222g"
                     /product="KLTH0F02222p"
                     /transcript_id="XM_002554261.1"
                     /db_xref="GeneID:8292499"
     CDS             177818..182149
                     /locus_tag="KLTH0F02222g"
                     /note="similar to uniprot|P23255 Saccharomyces cerevisiae
                     YCR042C TAF2 TFIID subunit (150 kDa) involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="KLTH0F02222p"
                     /protein_id="XP_002554307.1"
                     /db_xref="GeneID:8292499"
                     /db_xref="UniProtKB/TrEMBL:C5DK69"
                     /translation="MQEATSPPSAIPSFQRPRTASGFRANSSNQSAKDSLSAHTAMAP
                     LKATPRASGSSQLFLAAPEAAFKIAHQRVFVDVDLANHSLVGYTEIILIPLSDRLEFV
                     TLDCKQMNVTGVIVENRRCDNYIHDDPYRWYAEKYSKGQLLDSPLYRCNSVEQSHFLR
                     NKFSELNHASESTDSNRSQLTIRIPPSVKITLQDANAVSFTPITPSIRTPAQDTIYSP
                     ITIRINYELHNPTTGLQFDTSREQALWNACTTNTELNSSASHWLPCVDTLEEKCTWEL
                     EFSIPKKVRDIGTSNIVGATQPRRHRRNPNTPGRDNEHDTDSGIDNIDNDGHDADNRN
                     QNEDDDEEMDEEDEEDNPLNREMVVCCSEFSSGKEVPHPTDLSRKVASFQIFNPVAPH
                     HIGWAVGPFQTWVLPQVKAQEEPEEDPDEPYAPVQNQEDEERDVIPIQIYTLPSPDVD
                     ERTILNSTLVTHEILDFYSKEFGSYSFTSYCLLFLPSIAGDHMDFAGATFCNTRLLYP
                     PEVIDPTFTTTDKLTWALAAQWAGVNVTPLDMNDMWCCIGMAGYMALQFSKHLMGLNE
                     FKYRVKLLSEQVVEQDWEKPPMADSFTQASMPISSLSKQLQFIKLKAPIVLYILDRRM
                     TKTERSFGMSRVLPKIFLQAMSGDLPNSTLSTAHFQHVCERVNKNKLENFFKEWVYGS
                     GVPIFRITQRFNKKRMVVEMGIRQCQVQELGLGKTVGDEGFSSSAMNHLCSPNKNLTP
                     VFTGSMTIRIHEADGTPYEHIVELKDTFTKLDIQYNTKYKRLKRRRKINKTAKQEGKD
                     PTPAENPDVLVAEDENEDIVLVNCLGDVLLSAKDCNQWNLTDPMVTSEGDEFQQQNEA
                     FEWIRIDADFEWVCKIHINQPDYMFASQLQQDRDVEAQIDSIRFFEDVVVNSNVNSMV
                     YSSILTRTVMDERYFYGVRIEACRALSRFIMQQPNTDNFSGGARHLIKIFQYYFCYEN
                     SNIPFDNDFSDYQRYFLQKAIPQLLAEVRNQNDVCPRYVKRFLLDILRYNENGDNSYY
                     DTHYVVTLITSVVTSALQDPEDASFYQDLLHELRRFKNLDQWIPSYQLLVTKCIMIQH
                     LRLAIDGFYVFDDIANILEYTVKEKLNSTSETSFHATEGLQDLLLTSFEVLLVDGGIK
                     NKEALKLFFEYMLLHPDPYVRTQLISVLVDSIDFIATKRYLEDLDDDIDSIHTTINLP
                     SGMESGKLGDSNIIIENYSAEASSKRETQMRASIGGLITLMRRRFASYAPLKQIIWDS
                     LHSPLTSVYQKKCLFDVIRVIYKLQDNFYVTLPIPRDRRLVAKNIGNGIVKIRREGIL
                     KINLAPKIKINSKRKPPVSTKSSSVKLKLNLPNSKKSSTPSRRQSNPSVNSSPLPRKK
                     QKIVRSSVTKIGSLPLRFVKISSSRGTVDVSAAQFNENVTIVKSNARALVMKIKMPRG
                     SKKEEDS"
     gene            <182354..>184459
                     /locus_tag="KLTH0F02244g"
                     /db_xref="GeneID:8292500"
     mRNA            <182354..>184459
                     /locus_tag="KLTH0F02244g"
                     /product="KLTH0F02244p"
                     /transcript_id="XM_002554262.1"
                     /db_xref="GeneID:8292500"
     CDS             182354..184459
                     /locus_tag="KLTH0F02244g"
                     /note="similar to uniprot|Q12232 Saccharomyces cerevisiae
                     YOR154W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F02244p"
                     /protein_id="XP_002554308.1"
                     /db_xref="GeneID:8292500"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:C5DK70"
                     /translation="MVVIGRILHLLVLFRASACFTSEPQEISTSSSAGQSELSSFLSK
                     ESRGTSTTQQSSAEVPQTQYDQHSVSTVSVTSSGNFTQTSSSLDKDTYIENSAYSPPD
                     ESGSASRSLQGTKSSLVAIAEAQESDFNETDTTFLSFDEWKKEKLGEESLQKAKPPAR
                     VNRPVDSSVYKGEAMGDDFEIDVGLFTSSKQDLNEEPEGKLYKDKFNYASLDCAATIV
                     KTNSEASGANAVLHENKDKYLLTPCSASNKFVVIELCQDILVEEIVMANYEFFSSTFS
                     KVRFSVSNSYPPKNGWKVLGEFDAANTRNLQKFGISNPLIWARYLRVEVLAHHGNEFY
                     CPISVIRVHGKTMMDDFKLDESNSLYSEDAVEQASPEGQLKECRQEKLAPHNLSESML
                     RECQFPQFPQADNVSILSKLDFLSTQCPAVLPHLKFDQFLKDINQSVCDTKIHQPQLD
                     ISTSAPSSSTEESIFKTIMKRLTLLESNSTLSLRYIEEQSMLLSKAFASLERNQAKKF
                     QSLVQAFNQTIVSNLGDINFFTQQLRESSIKLLEEQKLANDQFTSETFHRLESMKKDA
                     IFQRRLSYTMLFAFVILLVYVLLTKEAYIDEYMEDDGWYLNSPPLKKFKDNFLRRAGK
                     STDDRRSLVFCTSRDYSENDEKSDVSASTSSASLYDEFATKVAHEMDGNVLSYRKPTT
                     SLEEEDIDIDEALSEGSSR"
     gene            complement(<184716..>186182)
                     /locus_tag="KLTH0F02266g"
                     /db_xref="GeneID:8292501"
     mRNA            complement(<184716..>186182)
                     /locus_tag="KLTH0F02266g"
                     /product="KLTH0F02266p"
                     /transcript_id="XM_002554263.1"
                     /db_xref="GeneID:8292501"
     CDS             complement(184716..186182)
                     /locus_tag="KLTH0F02266g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F02266p"
                     /protein_id="XP_002554309.1"
                     /db_xref="GeneID:8292501"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C5DK71"
                     /translation="MNGVEERARRAKILAQLESQACEHSLEDYRADVQGYLWDLEFQN
                     RADPTMIESQPELEWYMRPYLIDFLIELHGYFRLRPETLFLACSIADRYLSKRMVYKK
                     HYQLVMTTALWIAAKYEDKKSRTPLVRELVALCRDAYDSTMFAQMELHMLSTLGWNVG
                     SVASVYGSLSLFLGMDIFSGSPAGQAGVAVLSDLAGFLAELSMYEKDYMYFSTAVQAL
                     SAVLVASKVLNNTAMADFIYCSLAHQQGPVRCGTLCAHSPKEQLPLLRLDEQTLEDIR
                     QCSLLFVNDLYKTKTLNKPLPAALLHKYSRSSFEPFLERFTSCNMNSFITLTQLTQAV
                     GSSDQTLLRQSTRSLTDICIGLLIPPTTADVANSRLALHTFDGSTPCGDENAGRAVFR
                     RSSSACNTLGVPSAPQLSMQTLDVRCSSPAASTVSANSVFSSGQSTLSQSSASSPMLL
                     TSRKQFPIRMNSFSSVYSHHPNQRVLTRFDSTESTMAE"
     gene            <186895..>188037
                     /locus_tag="KLTH0F02288g"
                     /db_xref="GeneID:8292502"
     mRNA            <186895..>188037
                     /locus_tag="KLTH0F02288g"
                     /product="KLTH0F02288p"
                     /transcript_id="XM_002554264.1"
                     /db_xref="GeneID:8292502"
     CDS             186895..188037
                     /locus_tag="KLTH0F02288g"
                     /note="weakly similar to uniprot|P25381 Saccharomyces
                     cerevisiae YCR045C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F02288p"
                     /protein_id="XP_002554310.1"
                     /db_xref="GeneID:8292502"
                     /db_xref="GOA:C5DK72"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="UniProtKB/TrEMBL:C5DK72"
                     /translation="MRLFMAALFGLRAAGAVRFVAELGDTASVEEVLGEQYAATVAGG
                     GVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLAR
                     LSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDP
                     VATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKLA
                     AVTKRPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGA
                     LTIGSIDVARNDALAPFTNFAECVDLFTAGVDVATLGLDHSSEHHLSGTSISAGVASG
                     LVAYYMSIGHYGMDAVNKIKLLSLPNVIPNLQQRSPETRNAILQNL"
     gene            <188430..>192074
                     /locus_tag="KLTH0F02310g"
                     /db_xref="GeneID:8292503"
     mRNA            <188430..>192074
                     /locus_tag="KLTH0F02310g"
                     /product="KLTH0F02310p"
                     /transcript_id="XM_002554265.1"
                     /db_xref="GeneID:8292503"
     CDS             188430..192074
                     /locus_tag="KLTH0F02310g"
                     /note="similar to uniprot|P53840 Saccharomyces cerevisiae
                     YNL273W TOF1 Protein that interacts with topoisomerase I"
                     /codon_start=1
                     /product="KLTH0F02310p"
                     /protein_id="XP_002554311.1"
                     /db_xref="GeneID:8292503"
                     /db_xref="InterPro:IPR006906"
                     /db_xref="UniProtKB/TrEMBL:C5DK73"
                     /translation="MSTLGSSQIPEATGEFGSPQRSAEDGQPVVDNSSQILKARIALL
                     ATAIGGPDHSSEVDPPPYVIGDDCLACLKDLKRWFKLVDDKQSRWDVAAAAAQYNILT
                     EDLLPILINWDKAHCDAIKKAKKKGGTPEDYLGNKSYHHKIALNALQLMVLMTWPLIL
                     TDQSTQNQVAHYSELKKSQVKYKKAILSVENGRVLRSAIRLAVEVIKTEKRLRTPKDN
                     VVLRLVLNFFRNIVAIEPSDLTISSKKSLSKGINSTDMLPPSVSRDDISLSAVVGAFQ
                     TNKVFKFLLTLSSSINQEFDAAFINVPLLELIFFLIKNASHSTFFPAGGKTSSKPNQK
                     NEGLGQTQVGSELSRLLKKEREMKKTVVRNTSTRHSRFGSLLSIQTSEHQRLTVSGGQ
                     NILDGDFALQKMDSRKKWNKRSVMKDEHVEGLASNFLNFNEEARYWDNATALVLKEFV
                     DDFIEVGFNSLLRSVTDYFTTEEDKMVVVHQIQYLLFYSWFLKYQRLAKQSDPKLNFQ
                     PVMFALRDTACILVSQILRKAVEQKVWAVVHAGMIAFNEIMSTLATMGPEDEDIAQYV
                     KGQILQEERIKLLSSLPRTASNHSTSYIRSCVSLVHTLLRMLESDSIESKEPQESNKN
                     AKGRDGTFSLIEAERIAEEEGIEIEEALEIMEQRFRKASLDYNKVQRAFSVETTVKTY
                     ISFLQRFRDLEDGDIKKAIQFLYRVFAGVKEESLLYRIDFMILLKDLLGPTGLSMASR
                     SRKHVVKFADFYMARFKERLKASPSWFVSILFPTIHDREAGHYQKYGEKLMANQNQIV
                     LPSSKFIEAEELIGLSASALLDFKFGVLVSSLIDNEKRECVEALKQALTRTCNVLKSW
                     LLNEVSRGDEFGHTSKEFFEPEDAFVKRSTYRDPDFRALLQLCGYEVPQSVKGKCVLI
                     PSTPIPEIESSITLLVKYLTNAFDTPNGLPSSSYLTRPNTQGAEDDSYYFTNDGIQTE
                     AEQDDTGNQDQYFKALESDALTNNLHSTRGVALKKRKKATRKDNAKPKTNKQNSNPRK
                     SEREPSTNSEPSNKRQNITSAEYISDSDDSSDESMHSIFYENEMYMRFLLDKHGGLLP
                     PDKFALFSVFSNERIKNGGLTTNDYSSLFGGPIPSLEGLKRSEGLEAPQTVSGKINND
                     LHDREVPRLLANQQKHLHGSSPTGSEVIQPLSNHPLLSDASDKDDEEVSKTPAQTRKR
                     QRVMFEDDDE"
     gene            complement(<192112..>193521)
                     /locus_tag="KLTH0F02332g"
                     /db_xref="GeneID:8292504"
     mRNA            complement(<192112..>193521)
                     /locus_tag="KLTH0F02332g"
                     /product="KLTH0F02332p"
                     /transcript_id="XM_002554266.1"
                     /db_xref="GeneID:8292504"
     CDS             complement(192112..193521)
                     /locus_tag="KLTH0F02332g"
                     /note="similar to uniprot|P39981 Saccharomyces cerevisiae
                     YEL064C AVT2 Putative transporter member of a family of
                     seven S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="KLTH0F02332p"
                     /protein_id="XP_002554312.1"
                     /db_xref="GeneID:8292504"
                     /db_xref="GOA:C5DK74"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DK74"
                     /translation="MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLS
                     VDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVL
                     LSLLVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCII
                     IGDTIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMV
                     VIVVIVVIKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKT
                     PSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCF
                     GFNMLTTFPLEIFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLT
                     TCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLIS
                     STQTIISYINGGDQKHCET"
     gene            complement(<193705..>195906)
                     /locus_tag="KLTH0F02354g"
                     /db_xref="GeneID:8292505"
     mRNA            complement(<193705..>195906)
                     /locus_tag="KLTH0F02354g"
                     /product="KLTH0F02354p"
                     /transcript_id="XM_002554267.1"
                     /db_xref="GeneID:8292505"
     CDS             complement(193705..195906)
                     /locus_tag="KLTH0F02354g"
                     /note="similar to uniprot|P17065 Saccharomyces cerevisiae
                     YNL272C SEC2 Guanyl-nucleotide exchange factor for the
                     small G-protein Sec4p located on cytoplasmic vesicles
                     essential for post-Golgi vesicle transport"
                     /codon_start=1
                     /product="KLTH0F02354p"
                     /protein_id="XP_002554313.1"
                     /db_xref="GeneID:8292505"
                     /db_xref="InterPro:IPR009449"
                     /db_xref="UniProtKB/TrEMBL:C5DK75"
                     /translation="MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIAS
                     QRESLQNYEDLRQQLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVE
                     DLTASLFDEANNMVADARRETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYN
                     LEEESNDRLKSNQASVAAEDSVASSSESALEKTMNALNGTASPPSPALFSPLLKSLRY
                     DLVLYNEFLKFIAALPQCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRN
                     LMSLMIDGSIVVEPVSGINETYRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPV
                     AIESPCSFCSESRNDILEHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEI
                     FAFLRSLKSGAWHLEAVTISKTNNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFM
                     AGLSKTLPLKTSYTVESASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLED
                     VVETKVGPVVAVDRPGNDSIVGDGLVPELGQEARESFSLHNEEEVDNEEGFDFEKMNS
                     TLESAGLEGKETSQTTQTSSGNPTTLDPRTSEGGDAGAKIGASFVQTIADSDTGASSP
                     IQESQTKTARTVEKKAAVPGSIDLDEQNYAQNVEAPARMVKSRTSEAPNGEGTAENII
                     ELVAESDTKKITGKAPESASSDHAKSRSELPSQSATDDEEAGFDDARSTFS"
     gene            complement(<196194..>202124)
                     /locus_tag="KLTH0F02376g"
                     /db_xref="GeneID:8292506"
     mRNA            complement(<196194..>202124)
                     /locus_tag="KLTH0F02376g"
                     /product="KLTH0F02376p"
                     /transcript_id="XM_002554268.1"
                     /db_xref="GeneID:8292506"
     CDS             complement(196194..202124)
                     /locus_tag="KLTH0F02376g"
                     /note="some similarities with uniprot|P41832 Saccharomyces
                     cerevisiae YNL271C BNI1 Formin nucleates the formation of
                     linear actin filaments involved in cell processes such as
                     budding and mitotic spindle orientation which require the
                     formation of polarized actin cables functionally redundant
                     with BNR1"
                     /codon_start=1
                     /product="KLTH0F02376p"
                     /protein_id="XP_002554314.1"
                     /db_xref="GeneID:8292506"
                     /db_xref="GOA:C5DK76"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014767"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DK76"
                     /translation="MNRSSNSKSSKAPHNRSASSSSGNGGIFSNLKRLTTGSGNSSVS
                     HNTQKLDISDISSPKKINLPDTGEFSHKPLSKQSTLNMASLSAYTDAVGAHNRSASNA
                     SVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGP
                     DGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQS
                     EVKKFMNSKNASKSSTVVGGSSSAVPDSPSASNFTSSTSPNGSFTGLSRPKISTSSVN
                     TSEQFYSSNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDW
                     VQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEA
                     VMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFC
                     DNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGS
                     LVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILN
                     KMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTD
                     AEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSA
                     IQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVR
                     QRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDE
                     KGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMED
                     IENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAVSESEEKAQQISALKLEELRKKLA
                     SLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALA
                     GKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKAAEKSNETPLRTATSSDSSEDE
                     MDDKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSF
                     MNRVKRTGAVPYLGELSGKIGSSSYIKPSEAEENVGIGIMVDEKPLSRRVQEDAAGVS
                     QLESNEEKPALSHDLDKNTTHSKPITIGENLAAAKTAGKQQAHEDEGTTEGSSTDKDS
                     HEIASATSAPPPPPPPPMDLFAKNGAPVKTDNPDPAVSDTKSAAAPPPPPPPPPIPPM
                     LASSSSGSTSKAGAPPPPPPPPPPPPALLSQSSNNGPPPPPPPPPPFGASVSRNKSAT
                     PSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSR
                     LEKAFAAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCD
                     RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRA
                     DRLYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNV
                     LDVILAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFND
                     FLKELEPVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKV
                     LPTLPEARKKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKK
                     AQVYNLKLEEEERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVM
                     DRLLEKLKNAGPAKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSP
                     DNNSSEVQLNEADTSPTPERRVRDSNATSPASHDTGSSDLTDRARNLLIELRGPESPG
                     VKMSAQHQRLSKLRARRKNDSSSSGSENRLNFVGAGQAENSDEQNEPEVLKSKPESAN
                     DDDNGEQSDSSDGEFLDA"
     gene            complement(<202746..>204413)
                     /locus_tag="KLTH0F02398g"
                     /db_xref="GeneID:8292507"
     mRNA            complement(<202746..>204413)
                     /locus_tag="KLTH0F02398g"
                     /product="KLTH0F02398p"
                     /transcript_id="XM_002554269.1"
                     /db_xref="GeneID:8292507"
     CDS             complement(202746..204413)
                     /locus_tag="KLTH0F02398g"
                     /note="similar to uniprot|P04817 Saccharomyces cerevisiae
                     YEL063C CAN1 Plasma membrane arginine permease requires
                     phosphatidyl ethanolamine (PE) for localization
                     exclusively associated with lipid rafts mutation confers
                     canavanine resistance"
                     /codon_start=1
                     /product="KLTH0F02398p"
                     /protein_id="XP_002554315.1"
                     /db_xref="GeneID:8292507"
                     /db_xref="GOA:C5DK77"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DK77"
                     /translation="MEMQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASS
                     QERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVT
                     QSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYW
                     TLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAG
                     KTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESA
                     NPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNS
                     GTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICV
                     GIVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISR
                     DDLPFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVI
                     FQVIFKSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA"
     gene            <205827..>207692
                     /locus_tag="KLTH0F02420g"
                     /db_xref="GeneID:8292508"
     mRNA            <205827..>207692
                     /locus_tag="KLTH0F02420g"
                     /product="KLTH0F02420p"
                     /transcript_id="XM_002554270.1"
                     /db_xref="GeneID:8292508"
     CDS             205827..207692
                     /locus_tag="KLTH0F02420g"
                     /note="similar to uniprot|P32487 Saccharomyces cerevisiae
                     YNL268W LYP1 Lysine permease one of three amino acid
                     permeases (Alp1p Can1p Lyp1p) responsible for uptake of
                     cationic amino acids"
                     /codon_start=1
                     /product="KLTH0F02420p"
                     /protein_id="XP_002554316.1"
                     /db_xref="GeneID:8292508"
                     /db_xref="GOA:C5DK78"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DK78"
                     /translation="MARKKEACAPCASPGLYCKSSGEAKRPVSSSRQLQSTEQSIHQR
                     CCSVPKHPGMTEKNSLHSRARRGSGATAGEPKLKAHSDDFEMYVYSQDEPSTDPLGSD
                     TESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFM
                     GTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSV
                     TGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYA
                     LVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELV
                     GITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSP
                     FVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTP
                     QGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQC
                     LKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLM
                     LLVVVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA"
     gene            <208501..>211584
                     /locus_tag="KLTH0F02442g"
                     /db_xref="GeneID:8292509"
     mRNA            <208501..>211584
                     /locus_tag="KLTH0F02442g"
                     /product="KLTH0F02442p"
                     /transcript_id="XM_002554271.1"
                     /db_xref="GeneID:8292509"
     CDS             208501..211584
                     /locus_tag="KLTH0F02442g"
                     /note="similar to uniprot|P39104 Saccharomyces cerevisiae
                     YNL267W PIK1 Phosphatidylinositol 4-kinase catalyzes first
                     step in the biosynthesis of phosphatidylinositol-4
                     5-biphosphate may control cytokineses through the actin
                     cytoskeleton"
                     /codon_start=1
                     /product="KLTH0F02442p"
                     /protein_id="XP_002554317.1"
                     /db_xref="GeneID:8292509"
                     /db_xref="GOA:C5DK79"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021601"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:C5DK79"
                     /translation="MSETAPDSDSSDLAPSTSAPGSNQLLLKFINSAHFTLYNNIEYL
                     TRYSQNIGIHFYLCQKLLTFPHNELQFYIPQLVQVLLTVETESIALEELLLKLSAENP
                     HFALLTFWQLQALLGDLSTDPSSYAFQVARRVINSLQNVLFNPHKVAAESEKIHENVA
                     PALVLCSMVIGSCALPGLGEFAKPLVQSQGKRQKSYVFKLAKNAMRNLTKNLTLKNTL
                     LNQGRSSSNGSHSKESNALVELVDGVTTREDTLFKKPREKPLTSLNFDMIDDVGEKMF
                     QERISNSIKMPKRKSRTTDQSYVHRIYQRSALTGASDSVYEDEYTNSMPDLHKEMTNN
                     RSTSSLNSLKSQSGNESEVDDRSIKKVNSDPLADDYHDDTIRIDTMRRRSRQGKDLTT
                     LQLSQLSIPKKIRILKSNYFRCETQLAIALESISQRLAQVPSEARLSALRAELLLLNR
                     DLPAEVDIPTLLPPNKKGKLHKLVKITANEAQVLNSAEKVPFLLLIEYLRDEMDFDPT
                     TEENENVLRRNPGEESFIFDLASITKDANSHAEEITAVNEARNSRSSLRVSSTNEATQ
                     VTSEKEVDLGDVSVVNLTNHNEAETYRRELMVQSAAKVPVIPNDSTNRNPELQFLNNL
                     EEIRSELEGVEFGGPSASSAEDLATQMRISAVMLAQLDKSPQQLHGSTNQIRAKIIAS
                     MQEVQDRFGFQDLEAIHGMAGQRKLENDLKTGGLQGTKKDMSYLGENWNAKKERIRAT
                     SEFGEAENWDLCSVIAKSGDDLRQEAFACQMIQAMANIWAKENVGVWVKKMKILITSA
                     NTGLVETITNAMSVHSIKKSLTQQMVENGELNEKGQIASLKDHFARAYGDPTEFKYSR
                     ARDNFAFSLAAYSIICYVLQVKDRHNGNIMVDNEGHVVHIDFGFMLSNSPGSVGFEAA
                     PFKLTYEYVDLLGGLEAEPYKKFVRLTKDGFKALRKYADQLVSMCEIMQKDNMQPCFN
                     AGEQTSAQLRQRFHLELTEQECDDFVENVLVGKSLGSIYTRLYDQFQLISQGIYS"
     gene            <212372..>213523
                     /locus_tag="KLTH0F02464g"
                     /db_xref="GeneID:8292510"
     mRNA            <212372..>213523
                     /locus_tag="KLTH0F02464g"
                     /product="KLTH0F02464p"
                     /transcript_id="XM_002554272.1"
                     /db_xref="GeneID:8292510"
     CDS             212372..213523
                     /locus_tag="KLTH0F02464g"
                     /note="similar to uniprot|P53230 Saccharomyces cerevisiae
                     YGR046W Essential protein of unknown function mRNA is
                     targeted to the bud via the mRNA transport system
                     involving She2p"
                     /codon_start=1
                     /product="KLTH0F02464p"
                     /protein_id="XP_002554318.1"
                     /db_xref="GeneID:8292510"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="UniProtKB/TrEMBL:C5DK80"
                     /translation="MLRLSRVANSVTGLRSNGRAVVLRLNSTHAYGHQKDSFQPIVHG
                     PIMSSTGKMRHDVLQDELRLLEQGIKKSDELTSQFTNYRYKFKKLPPNYGSNQLLTID
                     GDLQKDLDGVVAHFRAPIKYAFGYGSGVFQQSGYSKTQDSPQIDLILGVSHPEHFHSL
                     NMRQNPHHYSSLRYFGSQFVSKFQEIGAGIYFNPFVDINGQTVKYGVVSMENLLRDIA
                     TWDSFYLAGRLQKPVKVLKNDLSVQYWNQLNLKAAATLAKHLISQDSKKPLDELEFYT
                     QITALSYVGDIRYKVGGENPDKVKNIVEKNFTQFQEYYKPIYKDVIVNNSHYLPRGFT
                     FENSIQLLESRIFRTSTLQTLKGIFTAGITKSIRYAWAKKLKAMKRKSS"
     gene            complement(<213688..>214482)
                     /locus_tag="KLTH0F02486g"
                     /db_xref="GeneID:8292511"
     mRNA            complement(<213688..>214482)
                     /locus_tag="KLTH0F02486g"
                     /product="KLTH0F02486p"
                     /transcript_id="XM_002554273.1"
                     /db_xref="GeneID:8292511"
     CDS             complement(213688..214482)
                     /locus_tag="KLTH0F02486g"
                     /note="similar to uniprot|P53843 Saccharomyces cerevisiae
                     YNL265C IST1 Putative translation initiation factor as
                     suggested by computational analysis of large- scale
                     protein-protein interaction data"
                     /codon_start=1
                     /product="KLTH0F02486p"
                     /protein_id="XP_002554319.1"
                     /db_xref="GeneID:8292511"
                     /db_xref="InterPro:IPR005061"
                     /db_xref="UniProtKB/TrEMBL:C5DK81"
                     /translation="MCIQRLRYAQEKQQSLAKKARRDVAQLLADGKEQKAHYRIESLI
                     NDDVHEELLEVLELYCELLHARIALLCSVQDEADLIENHAENGLNEAARAVVFATLHA
                     PEIKELQQAKELLTLKFGNDFTRTIIDEKLGVPDKVLKKCSPRLPDEELITLYLKEIA
                     ITYEVPFSKLEEASREEAEHEKSPTPTDSSSEDSRPIVAVDNNSLEDGKHAITVKKPR
                     KDSDTMGSDLKVPRDMKKDVKVKNNKQNAHDTDLDELKKRFAALRR"
     gene            complement(<214785..>217952)
                     /locus_tag="KLTH0F02508g"
                     /db_xref="GeneID:8292512"
     mRNA            complement(<214785..>217952)
                     /locus_tag="KLTH0F02508g"
                     /product="KLTH0F02508p"
                     /transcript_id="XM_002554274.1"
                     /db_xref="GeneID:8292512"
     CDS             complement(214785..217952)
                     /locus_tag="KLTH0F02508g"
                     /note="similar to uniprot|P33339 Saccharomyces cerevisiae
                     YGR047C"
                     /codon_start=1
                     /product="KLTH0F02508p"
                     /protein_id="XP_002554320.1"
                     /db_xref="GeneID:8292512"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DK82"
                     /translation="MVEENANENGEEKNIDEEEFYGNLDELRDLIDDENDGRTDGNVT
                     GFSDSTASEDEVFDERLLEQDGTHLDAEQLEEKGSIDENHYEDADLLAEFSDYGEFSD
                     DEYDEQDFMDAIREANNFKVKRKNKAKKKKESVGKAPKRNVRERVLDPEVAQLLSEAN
                     EAFVRNDIQVAEHLYNEVIKKDVKNFAAYKTLGDIYQLQGRFNDCCNSWFLAAHLNPS
                     DWEFWKVVATLSSDLGHIRQAIYCYTRALRMNSDDWECLYGRSILYKKTNQLGRALEG
                     FQRLHNNNPYDGNLLRELAILYVDYNRINEAIELYIKIFEANVQKREALISAAENAVE
                     SSGESGNESNDDESEDLDEAEEGYKEYSHINWKKIHKKFRCIAFDWSSLNILAELFLK
                     QSGENTGIKTIKKCARWIQKREKQTFWDNVNDDSEFDKRRFKNSKFDALSKEEKEKSY
                     ILPIDIRVRLGLLRLNNKHVLEAMNHFQALYDETFVDITDLFFEVACALTKAERFQEA
                     IEFFAPLLQIPDYCTLEVYKPLSKCYKEVEDYENAKLIFKKLVELAPEDLETKLTLAE
                     IYYHLEDHETFNALLLEVVETRKQQATDIRQDVAGLNDQPNQGPEERSTNELGKPLLE
                     DIHIRKTAAKRKRTPQDAERERKEREKRITSNVLDKYNRLKIYKEGMEKGQESQTTLW
                     IDTASDLIDVFSSVKNFFVKSRSKKFVGVIKRSRKFNKIIDYKIKRLSKLSEGENLLD
                     GLPLLEERVSLTSSTELRGLTYQQWFELFMELSLVITKLQSVEDGLSVIETAQEVNVF
                     AQDPEKVKMMKFVNLAIVLRLEDEDELVENLRGVLNQFQFNRKVFQCFMFCVARGQMS
                     SDILSSTVQQKFFLRQLKAYDSIRYGQHVAGQASVTNKKVSNPDKFKSPYLHYIYAML
                     LYSSKGFLLALQYLNRLEPELYEDPMINLMTGLAHLHRSMQRLTASRHFQILHGLRFL
                     YRYHDIRANRYSSTEKQEADYNIGRAFHLLGLFSIATRYYQKVMTEYGDEKLKRHAAY
                     NCILIYNESGNPELANSLMEKYLSI"
     gene            <218224..>219279
                     /locus_tag="KLTH0F02530g"
                     /db_xref="GeneID:8292513"
     mRNA            <218224..>219279
                     /locus_tag="KLTH0F02530g"
                     /product="KLTH0F02530p"
                     /transcript_id="XM_002554275.1"
                     /db_xref="GeneID:8292513"
     CDS             218224..219279
                     /locus_tag="KLTH0F02530g"
                     /note="similar to uniprot|P53044 Saccharomyces cerevisiae
                     YGR048W UFD1 Protein that interacts with Cdc48p and Npl4p
                     involved in recognition of polyubiquitinated proteins and
                     their presentation to the 26S proteasome for degradation
                     involved in transporting proteins from the ER to the
                     cytosol"
                     /codon_start=1
                     /product="KLTH0F02530p"
                     /protein_id="XP_002554321.1"
                     /db_xref="GeneID:8292513"
                     /db_xref="GOA:C5DK83"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="UniProtKB/TrEMBL:C5DK83"
                     /translation="MFSGFGGFGGFNAGFVNIPQKFEDFFRCYPISMMNDRIRKDDAN
                     FGGKIFLPPSALNKLTMLNVRYPMLFELTVPDTKKVTHGGVLEFIAEEGRVYLPQWMM
                     ETLGVNPGSLLQIASTDVPLGQFVKIEPQSVDFLDISDPKAVLENVLRKFSTLTVDDI
                     IEINYNSKLYRIKVLEVKPESSSNSICVIETDLVTDFAPPVGYVEPDYRTEHRKSQKP
                     KLDPSAQGLGPMSQRIDYATSVKSTSTTRAFVGTGQSLSGRTANKSEERELERPMISL
                     DNEPAPLRLPEGQLFFGFPVVLPKKASDSQDENTEESQFQGAGQSLRQSNKRRGKKDH
                     SSPRPKAPKSPEVIEID"
     gene            complement(<219375..>222959)
                     /locus_tag="KLTH0F02552g"
                     /db_xref="GeneID:8292514"
     mRNA            complement(<219375..>222959)
                     /locus_tag="KLTH0F02552g"
                     /product="KLTH0F02552p"
                     /transcript_id="XM_002554276.1"
                     /db_xref="GeneID:8292514"
     CDS             complement(219375..222959)
                     /locus_tag="KLTH0F02552g"
                     /note="similar to uniprot|P53120 Saccharomyces cerevisiae
                     YGL140C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F02552p"
                     /protein_id="XP_002554322.1"
                     /db_xref="GeneID:8292514"
                     /db_xref="InterPro:IPR018820"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:C5DK84"
                     /translation="MGNAKLRGKRVGRFLKRHFPCSRILAQRIFKSTVHATVALIFCL
                     IPKVRDRLGNQPSMLPLIAVMVHPGRRVSATIQGAIYCITGLLFGLAYSLLGRFIAQR
                     CLGHTWHTVSEGEQYAHNYKSYESALAILAVFETIMLFVHGWMRSVSHHYFHIVFPLF
                     LVVHFAFLAPLTQDAGTVAKAFSVPFYLGIALSIFWNLLLFPEFGSTYLGNATVDALN
                     EIHKSIDSAVNFFISIDVKKPSDSLYKKESISLAKLIKLKGSIDSKVSNCGLVLDECM
                     YEISYSYVPPSELKTVTKTFKELSMYINALVNACQLELILVGRGDRESVNNDLMNIET
                     ERELRHGDATKLLKVLNKMKGVVFDLHKNMSQSLYMAKVAIACSYDVNLKKVDKSEVF
                     SDEFAAAFENNRNIPTDFDFEGAVEGLIAGVIEFDLKAREELIHLDEDLLQPNDEMFL
                     FSSFLMNFKETTNSVITLMKETHKVYQKRKVQEAKGALRGKTLWIHFLSNYDAFKTWI
                     TGANTSRTITESQSLTGGNIENNYRPPADMGVKRPQGEESALLSQRKPNNVKRLSKDL
                     VLPITKAVENTKRSGSMKTSTRKQSFGNPLIKVMIFCHDFYTRYNFHFRFGLQVTVAL
                     MLASFPMFIPKAREWYVNYRGAWIGFVCILALEPSVGGTFWVFFLRGVGVILGAAWAY
                     VSYLAGCNQTNPYLEVVVTIFGAVPGFYYLLGSPYVKAAIIQIISIYVVMLAAIIPSD
                     NQGSILVNFAKRCLAVGYGGGVAVLAQMTMFPMTAREQLNEEISFVAGCISEMQILLA
                     SGLEGEPLKSSLTEERFQKCAKISQSAKSALSRASDYKGLTRQEPRLKGEYTELEKVF
                     TQMIYIQRQIIDRMDNMILLRKQYGSAIIEELNQMVHSYRRQYVASITALMRAVQEAV
                     LNKTPLPQYLPSARIAHRRLVNKVQETLKVKYASQMKSMQPRVLTDLFRDESSDDDEG
                     TNEELFMTTHKRRSTLPPHEYIMKEKFLSWNASSAAAEEIIEYVEELVFLTKIIVGVN
                     EFKYGFLSRPLYEDWAAEAALKFDKFFEKGAPRKRGAVSKSNKAENNRPTHPLTPTTS
                     RDSDHDTDEFERDMPVALNNTPSVKSEASEDLDLARIASRKSGLKKLPSGFRKRAFSI
                     SSRNNPEEQINPLSKLRTLGKGEIEEESSLESDSDEELPLALKKMILN"
     gene            complement(<223080..>224204)
                     /locus_tag="KLTH0F02574g"
                     /db_xref="GeneID:8292515"
     mRNA            complement(<223080..>224204)
                     /locus_tag="KLTH0F02574g"
                     /product="KLTH0F02574p"
                     /transcript_id="XM_002554277.1"
                     /db_xref="GeneID:8292515"
     CDS             complement(223080..224204)
                     /locus_tag="KLTH0F02574g"
                     /note="similar to uniprot|P53844 Saccharomyces cerevisiae
                     YNL264C PDR17 Phosphatidylinositol transfer protein (PITP)
                     downregulates Plb1p-mediated turnover of
                     phosphatidylcholine found in the cytosol and microsomes
                     homologous to Pdr16p deletion affects phospholipid
                     composition"
                     /codon_start=1
                     /product="KLTH0F02574p"
                     /protein_id="XP_002554323.1"
                     /db_xref="GeneID:8292515"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:C5DK85"
                     /translation="MGLFSKRNVEVRKEYNKSDIIKCNKAIRPRSQRSGKSKRVTGLS
                     KEELLVFGNVLKHFQQEGCTFPVQSPRVKDSEHCQKLPEQPLSSWEKCWLTADRILRF
                     LRSAKWDQEEAIARLTNTVIWRREFGIIDNEGRFHSSLVEAASSENESGGMLLLGYDR
                     SQRPILIVRPGRQNTTTSFAQVQHLIFMVESALVLMPPGVESMTVLIDFQTPAGIPFT
                     RMPPISVSRQVLHLLQKHYPECLGKAILINIPWYGWNFLKLFHPLIDPTTRSKVRYED
                     AFDDHVEETQLENSYGGRLNFTYEHELYWPDLIQLLSERSRVVYKKFLELGGQIGQSE
                     FDLKDVSDVVEQPTCDGDQDFSLMSHDHIGDGFPGEKHKV"
     gene            complement(<224401..>225249)
                     /locus_tag="KLTH0F02596g"
                     /db_xref="GeneID:8292516"
     mRNA            complement(<224401..>225249)
                     /locus_tag="KLTH0F02596g"
                     /product="KLTH0F02596p"
                     /transcript_id="XM_002554278.1"
                     /db_xref="GeneID:8292516"
     CDS             complement(224401..225249)
                     /locus_tag="KLTH0F02596g"
                     /note="weakly similar to uniprot|P52868 Saccharomyces
                     cerevisiae YGL128C"
                     /codon_start=1
                     /product="KLTH0F02596p"
                     /protein_id="XP_002554324.1"
                     /db_xref="GeneID:8292516"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5DK86"
                     /translation="MDLESVFQDHVNLYELLGIVVEGPEDLAKLSPLQIRRNFRQQAL
                     KHHPDKNRQVSDSRQKFHQLDIAAKILSDPKLRSAYDQWFIGVFFEQQIANEARQEQT
                     RKLYQREMAVKRDRTQGTPNIAVFEEHGQYLRKLKHFKLPYGDWKRMDYSPENTNRKL
                     TKSCTLRFELQNHKLLQSKQELGDLMSNALQVRLVDLYYSPRNDYSADSTIVAYAVLP
                     HINDTLRVLTEWNVKKPCSDSSPFFSYIEDISPKTQHTSFTFTNQEQLRPYIKERLGR
                     SPVISR"
     gene            complement(<225395..>226483)
                     /locus_tag="KLTH0F02618g"
                     /db_xref="GeneID:8292517"
     mRNA            complement(<225395..>226483)
                     /locus_tag="KLTH0F02618g"
                     /product="KLTH0F02618p"
                     /transcript_id="XM_002554279.1"
                     /db_xref="GeneID:8292517"
     CDS             complement(225395..226483)
                     /locus_tag="KLTH0F02618g"
                     /note="similar to uniprot|P53845 Saccharomyces cerevisiae
                     YNL263C"
                     /codon_start=1
                     /product="KLTH0F02618p"
                     /protein_id="XP_002554325.1"
                     /db_xref="GeneID:8292517"
                     /db_xref="InterPro:IPR005578"
                     /db_xref="UniProtKB/TrEMBL:C5DK87"
                     /translation="MISCFTTSKNIESSCLTFTALKGYESIKLEAAPEPRRKEIITDL
                     KNQFVNKEMSYNPYAYVADTGAMNVNDRQQHAQHSSSINDPTHQQFHNNLSGPAAPSS
                     EQSQGFSFQDPRSSMAYQLGQSAFSNFIGQNNLNQFQENLTKATGDSSSLSHYFQVSN
                     SYVFRKLKTILMPFLHRNWQRVPNASSQGSTSAPSFQVPRVDLNSPDMYIPVMGLVTY
                     ILAWNFQQGMQGSFDPENLYQRLSTTLASVLLDLFILKMGLYLLVSSKSPTTSITELA
                     CYVGYKFVPLTLALLLPSKPYLVSLVGKVYLLIAFGVFLLRSVKFNLFVDSGNDVHTV
                     KKSVVKKCNYFLFVYGFVWQSVLMWLMG"
     gene            <226621..>233223
                     /locus_tag="KLTH0F02640g"
                     /db_xref="GeneID:8292518"
     mRNA            <226621..>233223
                     /locus_tag="KLTH0F02640g"
                     /product="KLTH0F02640p"
                     /transcript_id="XM_002554280.1"
                     /db_xref="GeneID:8292518"
     CDS             226621..233223
                     /locus_tag="KLTH0F02640g"
                     /note="similar to uniprot|P21951 Saccharomyces cerevisiae
                     YNL262W POL2 Catalytic subunit of DNA polymerase epsilon
                     one of the major chromosomal DNA replication polymerases
                     characterized by processivity and proofreading exonuclease
                     activity also involved in DNA synthesis during DNA repair"
                     /codon_start=1
                     /product="KLTH0F02640p"
                     /protein_id="XP_002554326.1"
                     /db_xref="GeneID:8292518"
                     /db_xref="GOA:C5DK88"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="InterPro:IPR029703"
                     /db_xref="UniProtKB/TrEMBL:C5DK88"
                     /translation="MASRFRGSSTAKFVKKPPGDRSNGINTAVNTTAQQLVESTKKDE
                     IDTLMGFERYTAPQHNGKNVSIEETPGRTGWLVNMHPTLVPQDSGLTKGSALSPTGVS
                     GVDFYFLDEEGGGFKSTITFDPYFLVACRDESKTNDVEEYLKKHLEHCLKRVEVVIKN
                     DLSMSNHLVGLQRTMLKLTFANTNNLFEARKILRPIVMDNENNQLQRSMYSSNNGTAQ
                     DTKMLISDIREYDVPYHVRVAIDKDIRVGKWYKVASQGFLEIKEKVAFADPVVLAFDI
                     ETTKAPLKFPVATVDQIMMISYMIDGDGFLITNREIISEDIEDFEYSPKPEYPGYFTI
                     FNEADELALLERFFEHIRDVRPTVISTFNGDFFDWPFVETRAKINGLDMYEEIGFAPD
                     SEGEYKSTYCAHMDCYRWVKRDSYLPQGSQGLKAVTQAKLGYNPIELDPELMTPYAYE
                     KPQLLSEYSVSDAVATYYLYMKYVHPFVFSLCTIIPLNPDEVLRKGTGTLCEMLLTVQ
                     AFKGDILLPNKHTDPIERFYDGHLLESETYVGGHVESLEAGVFRSDIKNHFNIDPEVI
                     DDLLEDLPHALKFCVEVENNCKVEDVVNFEEVRQAVEKRLFDLKDNTKRHELPLIYHV
                     DVASMYPNIMITNRLQPDSVKSDRDCASCDFNRPGKSCDRKLQWSWRGEFFPSKMDEY
                     NMVKRALQNETFPNKNKKSYKQFLSFEELSYSDQVAHIKKRLTDYCKKVYHRVKTNEV
                     VERTAIICQRENPFYVNTVRSFRDRRYEFKGLAKNWKQKHSSISSEQKHERDEAKKMV
                     ILYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARSIVEKIGRP
                     LELDTDGIWCIIPESFPDEFKFNLKNGKKLFLSYPCSMLNYKVHQKFTNHQYQTLVDP
                     VRHKYETESDNSIFFEVDGPYRAMVLPTSKEEGKGIKKRYAVFNNDGSLAELKGFELK
                     RRGELQLIKNFQSDIFKVFLEGDSLEACYASVAAVANRWLDVLDSKGIMLEDEDLIEL
                     ICENRSMTKTLKEYEGQKSTSITTAKRLGEFLGEEMVKDKGLQCKYIISSRPLNTPVT
                     ERAIPVAIFSADLALKRSFLRRWLADSSLENFDPRAIIDWDYYRERLASVVQKIITIP
                     AALQSIQNPVPRVEHPDWLKKRISVNDDKFKQTSLTSFFKSSKVKPLVRDIEDAFEER
                     PISIQNKVGRVTSKKHQKRKNMIEEEQENLVLPPTFPSMEEDYIGWLSYQKIKWKIQA
                     RDKQRRTQLFGSRSGISERTALGNIMRKHAESYANSTWEILEYRQTSQPGVLDVSVLL
                     DRKIHTLKFKIPKSIYMKFKTNQPSGHGIENCIVEKSPAILPYKSVGSESKTPLYKLT
                     LPEDDYLEEIEKTTSVLNKENVLGIYESSITASERAIMELGSAVEFTSSAIGALGKGL
                     QKGFEQKNLHPSSSQRYLEKFSLEVGYLLHLSTNIGYEYFILYKGWDANTEVFVLKPS
                     TNAQELNPSSVQSLFKELRAQKSDKLDSHYDILRYPDSIDVQSHSFTDLRALYKKLSK
                     SISQMNEEKGAQCLMLLQSPYTQKLRQTIKPFRQMPLVEISSAELALPHLKWQHIVTK
                     KITNHILSLGKWLQNLMNLSRYSNIPICNIRLEKMSFVIDVMYARRLKKDNIVLWWND
                     VYPLPDHGGSEKDFNPSMASLMSDLDISITNSPSVYDTVVLEIEMSNLTINTVLTSAV
                     INEAEGSDLAESNFSIGGEGEYIGGGALVEDSFSGVSLSVLRALLKSLWDDALDENET
                     ADSLVHAFIHWVQSADSKLFDYALKYHVHNLTKKAILQLVNVCKNLGSEAIYADRGKL
                     LLKTNKVTVESCYAYSQYLIKAIRTAPLFSFLDLSITRYWDLLIWMDSFNFGGRACTS
                     IVDSESQDLRAYSQWHIKSFLPRIYQQEFDDWMIIILDSMVKAKERHYFDNAQSQRLT
                     QITTGKSNDDEEVDGVLAGFTHRFGQPLIHRVQKLFKTQKEYILDPNFSADYAPPNLP
                     GSHLKTHNPLLELVKNLCHIMMLSKTQTLEVRSLRKELLKIFEVREFDWESEFKDPSY
                     SLKVSNLACEHCAFITDIDFCKVERKEFLVCEQCQRLFNNNLLQEHLVQTLQIELQNY
                     YVQDLKCAKCGKIKDELMSSHCPCSGSWINSISEEALNKKIIVYRRVAEYFAFDIVSA
                     TVDELDGSSF"
     gene            <233389..>234804
                     /locus_tag="KLTH0F02662g"
                     /db_xref="GeneID:8292519"
     mRNA            <233389..>234804
                     /locus_tag="KLTH0F02662g"
                     /product="KLTH0F02662p"
                     /transcript_id="XM_002554281.1"
                     /db_xref="GeneID:8292519"
     CDS             233389..234804
                     /locus_tag="KLTH0F02662g"
                     /note="similar to uniprot|P50874 Saccharomyces cerevisiae
                     YNL261W ORC5 Subunit of the origin recognition complex
                     which directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing"
                     /codon_start=1
                     /product="KLTH0F02662p"
                     /protein_id="XP_002554327.1"
                     /db_xref="GeneID:8292519"
                     /db_xref="GOA:C5DK89"
                     /db_xref="InterPro:IPR020796"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DK89"
                     /translation="MVINVPSVKFRDYQVDAVSSFVSEDPSFAPPNVVIQGHHSSGKT
                     LTMRKFFEYNPQIYNCWLNPIELVSWKPLLQHVARMISSTLANLFPDISCEEQDALEA
                     EDFYLLIKFLHAVLRSYQLLEKDISLFVVFDGFDQLQELDSELLPKFIKLHELLPPNL
                     RVQLKFIYIVHDTAFLSRYSTYNLPTIIFPRYKHEQVAEILLQKKVSEYIESEKLLCK
                     VVSCGLDPEDSTFEQIAENYIKIIIQAFHSYTGNDIVALGDLMDSKWESYVQSITAEN
                     INEPLSLYRSNIDLYTTTGDTFVAEEEACVETGDSERATAYELSCISKFLLIAAYLCS
                     YLEPRYDSKIFSKKSHLRAGRSSYGRRAKMETNPRYLQPSLFPLERLFSIFQAIFPVE
                     EQENHSIFHHTEPMRANVEVYENLAELNSLKLITTATPKNVDYLSYKLKWKVNVPWEI
                     ITELASSVNFDIADYFSGLHY"
     gene            <234959..>236029
                     /locus_tag="KLTH0F02684g"
                     /db_xref="GeneID:8292520"
     mRNA            <234959..>236029
                     /locus_tag="KLTH0F02684g"
                     /product="KLTH0F02684p"
                     /transcript_id="XM_002554282.1"
                     /db_xref="GeneID:8292520"
     CDS             234959..236029
                     /locus_tag="KLTH0F02684g"
                     /note="weakly similar to uniprot|P38852 Saccharomyces
                     cerevisiae YHR156C LIN1 Nuclear protein that physically
                     interacts with Irr1p a component of the cohesin complex
                     may link together proteins involved in chromosome
                     segregation mRNA splicing and DNA replication"
                     /codon_start=1
                     /product="KLTH0F02684p"
                     /protein_id="XP_002554328.1"
                     /db_xref="GeneID:8292520"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:C5DK90"
                     /translation="MNNDHDGSSDNEAIKEEGFVRKKRKLTVSSDLYDDDSSDNESDD
                     EDEGLKTDPSAKITDTAIDNRDQGEDDMFASDSEGTSMNQKNSSEHLPNGNARKWDDK
                     QNDVASNGGVQIEAFNLDEESRTGAFDQFGNYTENPSRGDESEAQDYWLDGYNNEGLI
                     QQVRAAQKERLKREKLERSKALDQKRVLTLDGALKRLFFFLSADETTLEALGRLNSYR
                     RLFGKKTKYPRYEAREGDDSQELRELKIKHTVSAIEFVTDLLDIIERKGITDVYELTR
                     SKVETLIKEESLDNQDLDNYETKLWSFKWLTDLATVNESYTNYEMQCWKQEYFADNVI
                     VKFVEDGDEIRNWIYIECLHFM"
     gene            complement(<236068..>236556)
                     /locus_tag="KLTH0F02706g"
                     /db_xref="GeneID:8292521"
     mRNA            complement(<236068..>236556)
                     /locus_tag="KLTH0F02706g"
                     /product="KLTH0F02706p"
                     /transcript_id="XM_002554283.1"
                     /db_xref="GeneID:8292521"
     CDS             complement(236068..236556)
                     /locus_tag="KLTH0F02706g"
                     /note="similar to uniprot|P53846 Saccharomyces cerevisiae
                     YNL260C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0F02706p"
                     /protein_id="XP_002554329.1"
                     /db_xref="GeneID:8292521"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:C5DK91"
                     /translation="MDFDETLDLEEQFYRDGFEEGRHENLTHNYLEGKQYGLQVGFQR
                     YILIGLIEGVCNAVKSQNVSSAAQKNACLILDMVNKISMGNDEVSVQTYETNIVKIRN
                     KFRLLLLALSRYVKEQDSLPSLGLSFQSVEKISKIVAGELSSYVESDAAEVSSQPQNE
                     MW"
     gene            complement(<236844..>237065)
                     /locus_tag="KLTH0F02728g"
                     /db_xref="GeneID:8292522"
     mRNA            complement(<236844..>237065)
                     /locus_tag="KLTH0F02728g"
                     /product="KLTH0F02728p"
                     /transcript_id="XM_002554284.1"
                     /db_xref="GeneID:8292522"
     CDS             complement(236844..237065)
                     /locus_tag="KLTH0F02728g"
                     /note="highly similar to uniprot|P38636 Saccharomyces
                     cerevisiae YNL259C ATX1 Cytosolic copper metallochaperone
                     that transports copper to the secretory vesicle copper
                     transporter Ccc2p for eventual insertion into Fet3p, which
                     is a multicopper oxidase"
                     /codon_start=1
                     /product="KLTH0F02728p"
                     /protein_id="XP_002554330.1"
                     /db_xref="GeneID:8292522"
                     /db_xref="GOA:C5DK92"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="UniProtKB/TrEMBL:C5DK92"
                     /translation="MSTQNHYHFNVVMSCEGCSNAIRRVLTRLEPDVSKIDISLEKQT
                     VDVYTVLPFETILEKIKKTGKEVKSAKKL"
     gene            complement(<237265..>239487)
                     /locus_tag="KLTH0F02750g"
                     /db_xref="GeneID:8292523"
     mRNA            complement(<237265..>239487)
                     /locus_tag="KLTH0F02750g"
                     /product="KLTH0F02750p"
                     /transcript_id="XM_002554285.1"
                     /db_xref="GeneID:8292523"
     CDS             complement(237265..239487)
                     /locus_tag="KLTH0F02750g"
                     /note="similar to uniprot|P53847 Saccharomyces cerevisiae
                     YNL258C DSL1 Endoplasmic reticulum (ER)-localized
                     peripheral membrane protein required for Golgi-to-ER
                     retrograde traffic component of the ER target site that
                     interacts with coatomer the major component of the COPI
                     vesicle protein coat"
                     /codon_start=1
                     /product="KLTH0F02750p"
                     /protein_id="XP_002554331.1"
                     /db_xref="GeneID:8292523"
                     /db_xref="InterPro:IPR021875"
                     /db_xref="InterPro:IPR021876"
                     /db_xref="UniProtKB/TrEMBL:C5DK93"
                     /translation="MAQACGIIDQELHCISQQLKRILNDQDAILAGIESDPNLKMEGS
                     ARREEPSDVQAILNQDVQLSKKLGALKELNLVANLIDEFKANFELWELENCYYSLQNL
                     HKRLEKVDMSLFPIQFQGLLKVHIDSLHVDLLSRIDKVMRQFWDISARSVTFNQKIAV
                     DRDDVLLEYDSFSLFLKSCFFSQDHFEPTSWFVATMNMGDAKDKVTNLLATAFNEWVR
                     LQTVQEKLKQFLFSANVCLSLKGCTLGASENPGNLDDTLKSFEALVMFMKDVTTAEDT
                     AVILAKLGNTLLTEIVKFVKQNSSHLFAPGTNYKNSVVSLNTMLTELSHKGGKSWQYA
                     GRELDNLINDDSVINNLMLDKLLQEQISAIRKQFASGDWKNKRAIKVKARKTSLSVLS
                     GERSKAHKTGTGTSDDEWAWDHDNVSAEVGEDEDGWGSETEIALDSKEAHDPIVLSKK
                     DAEGENDWQNAWDEAASLGDDFDDTMKVTQVPDLFKQIFTDFEAGCEKIGQNKISAVV
                     DYKRNVLLTSFMAMCMCRYEEWWQLYHDVDFILSESADARKLYRLHELNSHFVNTHVE
                     NLKKTARKIMGQQLQNFQASDKSPNWGITIESLLPYIETAALPALLKLRNPRILSGFL
                     EYLYADCLVNEILSWRMISEKNSENLAELINLLLTGTDVRQVETDPKIVHSREKLEII
                     GRVLTAHLTDIMDMFSNGDFYLFSTDEVVQWIVMLFADTGLRRECIDEIRTIREEQGT
                     "
     gene            complement(240125..240218)
                     /gene="SNR71"
                     /locus_tag="KLTH0F02772r"
                     /db_xref="GeneID:8292524"
     ncRNA           complement(240125..240218)
                     /ncRNA_class="snoRNA"
                     /gene="SNR71"
                     /locus_tag="KLTH0F02772r"
                     /product="snR71"
                     /note="C/D snoRNA monocistronic SNR71"
                     /transcript_id="XR_002432199.1"
                     /db_xref="GeneID:8292524"
     gene            complement(<240488..>244186)
                     /locus_tag="KLTH0F02794g"
                     /db_xref="GeneID:8293302"
     mRNA            complement(<240488..>244186)
                     /locus_tag="KLTH0F02794g"
                     /product="KLTH0F02794p"
                     /transcript_id="XM_002554286.1"
                     /db_xref="GeneID:8293302"
     CDS             complement(240488..244186)
                     /locus_tag="KLTH0F02794g"
                     /note="similar to uniprot|P38717 Saccharomyces cerevisiae
                     YNL257C SIP3 Protein that activates transcription through
                     interaction with DNA-bound Snf1p C- terminal region has a
                     putative leucine zipper motif potential Cdc28p substrate
                     and to uniprot|P38851 Saccharomyces cerevisiae YHR155W
                     YSP1 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F02794p"
                     /protein_id="XP_002554332.1"
                     /db_xref="GeneID:8293302"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DK94"
                     /translation="MAVEKTPKGPSHLLKLISVSFKEASLDSPSFRASTNFYHVQIES
                     FESWIENVLRFYKHKFLPSLDDFKQISDTFFAQALPPADYLYNGVVENQMYTPMILEA
                     FHSDLCSLSNRLLVLLRGDPESFLSHVLKISTDIIEPYREKRKNFDYYQSKHDTLLAK
                     YQSTKISGPNVEPSSMREDAFQLFEARKSYLEASLDLAWEISQIQEALDVAISGVVGT
                     LVRRDPMKNTIMNTPKGGDQAMDLYSRHSRWHLQMVENNASLLEDMKRAKEQVQAFTI
                     KQLEPSRDLRDYNIKGINQASLLDHSSQGSKKSTEKSGWLFMKTQVGKPARTVWVRRW
                     CFVKKSVFGMFLLSPAETAVEETDKFGVLLMNVRYDPNEERKFCFEAQIAGAEPGTNN
                     GRSNTAERISLVFQTESLSDLKSWLQVFDEAKKHVLSLEKDDSEYELSFSRIPPIFFE
                     FACSSSNQTDQQLTSFDPNGLYGKSILQLMKAAFSETGSIIFPQDSPFETPLLKTPIS
                     TKLTKLSVISSYYLVNDGVPNAITANFWGSVNWSEFCFNTRKVDGNNYKERQSPVPEA
                     HTPQAERTSPTWSPMNYPDFYQRGMRNADLQFRSLFFPTAIQRNLERSDELLLLSFPC
                     SWSPNTKQGFSGMCYITARNIYFYMNSMGFICLLNRSLEDIVSVEEVKIEGDNKAGIL
                     KLYDMNELSMSCSIFFDNPELIATKIRQLLQNGTTEELKSEKEILSLFASIDRDFDDK
                     SRPSTPSTNLKGGEEATAVESLFRPLENPLNELRKRQQSFQSRYCSVFKMDFNISPKG
                     LMHVLFGDKSSAFPSCYLLADRSGSGNTTTAWQVRDSGDLKEAVRIVHFKIGHTQTFF
                     PPEGNGSGDSKNVAYLDMLQRMKLAKEGEYYEVDQESGHIKVPFAKAFRVLSKYIIIS
                     RSDPNPRKSKGLDKASSCSLYLYYDVAFSDEMTGARFRNLNVFDKFLKTLVLHTLRYE
                     SVLTRNVVQQYLDKIGKHGRVLKAIRLCGQLALVQGSEKTAHLGDNGKTNVARYSRSS
                     LLRFMMRTILFYTVNVIFAVTRMFFQFIYAVLTNARMINKAVLLALALSIIANFSLLG
                     KTTWSYWSVKAADKLFKSYVDIENKPMERALYIDDLDLLSDSLTNVQDACLEKFLEST
                     REVESKYRQTRHELALKRNELLVELKILNTMEKEMVHGEYVTFLLNEMQNCRTVEKDM
                     PDVWANDSQLHDHCSRCSSEYKSIQHLL"
     gene            complement(<244375..>245595)
                     /locus_tag="KLTH0F02816g"
                     /db_xref="GeneID:8292525"
     mRNA            complement(<244375..>245595)
                     /locus_tag="KLTH0F02816g"
                     /product="KLTH0F02816p"
                     /transcript_id="XM_002554287.1"
                     /db_xref="GeneID:8292525"
     CDS             complement(244375..245595)
                     /locus_tag="KLTH0F02816g"
                     /note="similar to uniprot|P54857 Saccharomyces cerevisiae
                     YDR058C TGL2 Triglyceride Lipase"
                     /codon_start=1
                     /product="KLTH0F02816p"
                     /protein_id="XP_002554333.1"
                     /db_xref="GeneID:8292525"
                     /db_xref="GOA:C5DK95"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DK95"
                     /translation="MSDISTRNSQSSDRKPWVIWKRIRSLLEPKQASFRKVYAAHEDV
                     DFEQFTKTYFKTITDRVKYGEAITSIPKKSHFTAPKNPIVLCHGFSGFDRLILVPSIA
                     RITRVLNNHTASSNSEQLLENDTEDSRMKGLLEVEYWFGVKEALEAKGCTVISARVPG
                     FASIEERANTLNEFIERETKHLRLSQKSSDIYNSPGAKNERQPHKRVKVNLIAHSMGG
                     LDSRFLISRIPNKNFEVVSLTTVSTPHRGSEMADFLVGLASDMQKGLPTESTVKLLPP
                     AIYELTTSSMKEFNRVTPNSKDVAYFSYGASCQPKWFNLFYASWHLMFSLSGGELNDG
                     LVTVRSSKWGNYMGTLQNTDHLDVINWKNRLQKEVASKVFKISDSIGEQVQPELDVLD
                     FYLSIADNLAQRGF"
     gene            complement(<245748..>246740)
                     /locus_tag="KLTH0F02838g"
                     /db_xref="GeneID:8292526"
     mRNA            complement(<245748..>246740)
                     /locus_tag="KLTH0F02838g"
                     /product="KLTH0F02838p"
                     /transcript_id="XM_002554288.1"
                     /db_xref="GeneID:8292526"
     CDS             complement(245748..246740)
                     /locus_tag="KLTH0F02838g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F02838p"
                     /protein_id="XP_002554334.1"
                     /db_xref="GeneID:8292526"
                     /db_xref="GOA:C5DK96"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DK96"
                     /translation="MSVLLETTEGDLAVDLDFDKCPVESFNFLKLCKSGFFDYQCFYN
                     LNKDYSVECGDALLGNEYRGSLRIHSTSIQGLCGNKEPSAELLKSSQAYSKSTLAHLG
                     DIAFLVSLLENSTPVIGSRFMISLAEDDTIYENIVRFGRVADEYLQALRKMFIKVTDD
                     QKRPNVDIRIKKAYILHDPFPDPECFRCFQIEMPIKTVRLPPHLTNRPNQESGLDEQK
                     KIEREMRSKELTLEILGDIPYVGIKPSERVLFVCRLNPITRAKDLATIFHRFGEIDVI
                     EIVRDKETGSSLGYGFIEFTKKESCEMAYSKMDGVLIDDRRIHVDFCQSARKLR"
     gene            complement(<246868..>248406)
                     /locus_tag="KLTH0F02860g"
                     /db_xref="GeneID:8292527"
     mRNA            complement(<246868..>248406)
                     /locus_tag="KLTH0F02860g"
                     /product="KLTH0F02860p"
                     /transcript_id="XM_002554289.1"
                     /db_xref="GeneID:8292527"
     CDS             complement(246868..248406)
                     /locus_tag="KLTH0F02860g"
                     /note="similar to uniprot|P53318 Saccharomyces cerevisiae
                     YGR255C COQ6 Putative flavin-dependent monooxygenase
                     involved in ubiquinone (Coenzyme Q) biosynthesis located
                     on the matrix side of the mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0F02860p"
                     /protein_id="XP_002554335.1"
                     /db_xref="GeneID:8292527"
                     /db_xref="GOA:C5DK97"
                     /db_xref="InterPro:IPR000689"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR010971"
                     /db_xref="InterPro:IPR018168"
                     /db_xref="UniProtKB/TrEMBL:C5DK97"
                     /translation="MPETRVQLYFLYIYLIGTMLGNGHSAKRAPRTLKRQVMGPSKLR
                     IVQRQLFRALATSVKPKKTDVLIVGGGPAGLTLAAAIKTSPYLSGLSTTLVDAGDLKT
                     KVAGFYDAPPEKYTNRIISLTSQSKQFLEQRVGVQLMEERLQAFDGLFVSDGCSDAHL
                     EMERGSMGYMVEILNIQSSVLRRLSELNASGLQLIDQTKVEDIRYEDPEDHQSWPVVS
                     LSNGEVYKTRLLVGCDGFNSPVRKFSKIESRGWFYNRFGVVATMKLDYPPFKVRGWQR
                     FLPTGPIAHLPLPGDDATLVWSTTEPLSRLLLSIDPEQFVLLVNAAFVLEDADMQYYY
                     KQLEQGSITTQELKSDIAYRTELVYSKLDNDAFIDEIYPPAVSSIDSTSRARFPLKLS
                     HADSYVADRIALVGDAAHTTHPLAGQGLNMGQGDVESLVKALEKAYQRGLDLGSLLAL
                     EPYWADRYPTNNMLLGVVDKLHKLYSTDFGPIVAARSFGLKAIQSLGPIKDFMMAKVS
                     GPSQ"
     gene            <248890..>251325
                     /locus_tag="KLTH0F02882g"
                     /db_xref="GeneID:8292528"
     mRNA            <248890..>251325
                     /locus_tag="KLTH0F02882g"
                     /product="KLTH0F02882p"
                     /transcript_id="XM_002554290.1"
                     /db_xref="GeneID:8292528"
     CDS             248890..251325
                     /locus_tag="KLTH0F02882g"
                     /note="similar to uniprot|P53848 Saccharomyces cerevisiae
                     YNL256W FOL1 Multifunctional enzyme of the folic acid
                     biosynthesis pathway has dihydropteroate synthetase
                     dihydro-6-hydroxymethylpterin pyrophosphokinase and
                     dihydroneopterin aldolase activities"
                     /codon_start=1
                     /product="KLTH0F02882p"
                     /protein_id="XP_002554336.1"
                     /db_xref="GeneID:8292528"
                     /db_xref="GOA:C5DK98"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="InterPro:IPR016261"
                     /db_xref="UniProtKB/TrEMBL:C5DK98"
                     /translation="MNRHRMMSSSLKKMQSGVISRDKVHIEKLALQAIIGPDSWNRVT
                     PQECNISLEMATDFEKASRSDELKYSLNYAVISKDISHFVNPRQNYKSLGLLAERVLH
                     HIKDGYPGIQSLALKAQAGDAHIRSDGVSVVVHAPASEQTPDQLVISNLKLLTLIGVF
                     TFERLQKQYVTIDINMPWMRQPEGNVEYRDVIDSVVSFVESSNFKTVEALVDSVAQIV
                     TQQDYFTNHPDAPVIVKVIKLNAITATRGVGVSCTRTKKDFLGKPLLEVNSSSAQLGN
                     ASFNLPVSRSAQTASSSSMNVAYLAFGSNVGDRTSNIQCAIDSLNAHKDLHVTKVSSI
                     FESEPMYFQNQRLFLNGCIEVKTLLSPQELLKLCKKIEYEELKRVKEFDNGPRSIDLD
                     IILYKTEDGANVVLTTDDLIIPHPRLLERSFVLEPLCELISFSEVHPVTAEPIIEHLN
                     QIYEQERDEDVLCKVIPLPRIGGKDRFLKFKNKPIRDSVTGRFSTQTISSTYTMGILN
                     TTPDSFSDGGLLSDNLDMQVERIRVIVQEVLKLSEQVIIDIGGCSTRPNSEQASQQQE
                     LERTIPLIKKIRSDKTIPHEKVILSIDTYRAGIAKLAIEAGVDLVNDISGGQFDADMF
                     AVLAEHPNVGYIMSHTRGDTSTMTKLTKYSDAEAEENTIEYVYGHEERGEDTVLVRNI
                     GRELAQQYAKAVEVGVKRWQIVLDPGVGFAKHSMQNLEAIKGINVLKNYSLARDQHFI
                     HFRNLPVLVGPSRKKFIGKITGDETAADRDFTTGTVAGACVGFGADIVRVHDTKNCVK
                     SIRMADALYRQTL"
     gene            complement(<251463..>251951)
                     /locus_tag="KLTH0F02904g"
                     /db_xref="GeneID:8292529"
     mRNA            complement(<251463..>251951)
                     /locus_tag="KLTH0F02904g"
                     /product="KLTH0F02904p"
                     /transcript_id="XM_002554291.1"
                     /db_xref="GeneID:8292529"
     CDS             complement(251463..251951)
                     /locus_tag="KLTH0F02904g"
                     /note="highly similar to uniprot|P53849 Saccharomyces
                     cerevisiae YNL255C"
                     /codon_start=1
                     /product="KLTH0F02904p"
                     /protein_id="XP_002554337.1"
                     /db_xref="GeneID:8292529"
                     /db_xref="GOA:C5DK99"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C5DK99"
                     /translation="MSGSQKACYVCGKIGHLAEDCESERLCYNCNQPGHVQSDCTMAK
                     TVEFKQCYNCGETGHVKSECDVQRCYNCNQTGHISRDCADPKKPRFAGGAAPSRANKV
                     SCYRCGGPNHMAKDCLQSDSKCYACGKVGHISKDCPAGSSAKTCYNCNEAGHISRDCP
                     VN"
     gene            complement(<252354..>253478)
                     /locus_tag="KLTH0F02926g"
                     /db_xref="GeneID:8292530"
     mRNA            complement(<252354..>253478)
                     /locus_tag="KLTH0F02926g"
                     /product="KLTH0F02926p"
                     /transcript_id="XM_002554292.1"
                     /db_xref="GeneID:8292530"
     CDS             complement(252354..253478)
                     /locus_tag="KLTH0F02926g"
                     /note="some similarities with uniprot|P53850 Saccharomyces
                     cerevisiae YNL254C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F02926p"
                     /protein_id="XP_002554338.1"
                     /db_xref="GeneID:8292530"
                     /db_xref="GOA:C5DKA0"
                     /db_xref="InterPro:IPR028094"
                     /translation="MAPEHAHYNGSKKIRSLREDKLASGAKARSRYGEACFQRGRVIK
                     EARGQHTALRAGKDYETNLRRKREFRVPLELEPGRLRVQETTPSLDSAGTDDQDSENA
                     ESDGDLPIEVICDLEVIPQDVDEQELQRLRRENDRSSSPAGANEGIDDEEAGEEKVSF
                     PSPQHSKHSHGPTGSEQEHFQRVSCVRHSYMQKLKLPQPLLAEELLERTLKYFPLVEK
                     ILSGQHPSMYYDHARSAFKRSRRAVLSIDEFRRLDLSLFTAGYYGVRRQMRVAVEVLH
                     HYRDLIARQNNRVLRWWGVSDFAQYVLAPELLSALCQEEMNLPTLEDAWDVMEATTEF
                     GLLVADDGPLEEWEVPAHLARLEAAGHSSNLREDPSNDKR"
     gene            <254134..>255333
                     /locus_tag="KLTH0F02948g"
                     /db_xref="GeneID:8292531"
     mRNA            <254134..>255333
                     /locus_tag="KLTH0F02948g"
                     /product="KLTH0F02948p"
                     /transcript_id="XM_002554293.1"
                     /db_xref="GeneID:8292531"
     CDS             254134..255333
                     /locus_tag="KLTH0F02948g"
                     /note="weakly similar to uniprot|P53851 Saccharomyces
                     cerevisiae YNL253W TEX1 transcription export complex
                     component"
                     /codon_start=1
                     /product="KLTH0F02948p"
                     /protein_id="XP_002554339.1"
                     /db_xref="GeneID:8292531"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DKA1"
                     /translation="MPNLDSAQAVEKYVSFYPECQKEVMADDHYSQLTLKNSSRFAHA
                     SVEEGNRVVALEFNTRGTYLAYSREDGSLNLWKVKSDRAQTYSVVREVHGIGRKISSI
                     SWHPVTHFLLATVGGTSQVNIWDASTGVLIKSFETSTETTNLKCCYDASGRWLGVLSS
                     TNEFYMFDADQNYNLASVSELGSECAESGDQVTALCWSPDSKHLYAGRRSGKLGVFAV
                     RNPGLEEQLQVSGHTSAIYCLRIDPQSRFLIAGGDDAVCSVWDASNMCCETVISDFDT
                     PIIDMDLSRDALALALCSETQTRVYSVSSGACIFQLDQKNRVDDQKFRFYPEKMSFVT
                     IAENECVVKYYVPKITEPPLQKEWAEADKRKRPARKVSSLGNLGAARRDDEPPRRGRF
                     SKRPLRR"
     gene            complement(<255421..>256305)
                     /locus_tag="KLTH0F02970g"
                     /db_xref="GeneID:8292532"
     mRNA            complement(<255421..>256305)
                     /locus_tag="KLTH0F02970g"
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /transcript_id="XM_002554294.1"
                     /db_xref="GeneID:8292532"
     CDS             complement(255421..256305)
                     /locus_tag="KLTH0F02970g"
                     /note="similar to uniprot|P36528 Saccharomyces cerevisiae
                     YNL252C MRPL17 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /protein_id="XP_002554340.1"
                     /db_xref="GeneID:8292532"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:C5DKA2"
                     /translation="MRLEEAEVFVNGLLQQHKGGSMTFQQVALRGMATASKPRAIKAG
                     LILSRIPIVTQEATTLEKQYYEYQSELERRLMWTFPQYFYFRKGTLSEKRFLAAQRGP
                     VSRQPGVWFPKGVPDVRHNRERRTKQEVTLPKSSESESLSGANNEDDVSRPVVPNSRI
                     TDADRENDTTSLERQLSSTLYLIVKNAAGKWAFPSFSVPLDSEAKKPLHITAEAGLRE
                     LGGPNINTWTVSNTPAGVLGDAQATEFMIKSHIVSGRFVLQPQKQYDAFAWLTKSEIQ
                     QRVEEAYFKELSCILADN"
     gene            complement(<256926..>258650)
                     /locus_tag="KLTH0F02992g"
                     /db_xref="GeneID:8292533"
     mRNA            complement(<256926..>258650)
                     /locus_tag="KLTH0F02992g"
                     /product="KLTH0F02992p"
                     /transcript_id="XM_002554295.1"
                     /db_xref="GeneID:8292533"
     CDS             complement(256926..258650)
                     /locus_tag="KLTH0F02992g"
                     /note="similar to uniprot|P53617 Saccharomyces cerevisiae
                     YNL251C NRD1 RNA-binding protein that interacts with the
                     C-terminal domain of the RNA polymerase II large subunit
                     (Rpo21p) required for transcription termination and 3' end
                     maturation of nonpolyadenylated RNAs"
                     /codon_start=1
                     /product="KLTH0F02992p"
                     /protein_id="XP_002554341.1"
                     /db_xref="GeneID:8292533"
                     /db_xref="GOA:C5DKA3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DKA3"
                     /translation="MQDEHDEFVATLESFKDLKSGISGSRIKKLTSYALDHVSEEPKL
                     MQLVIDYSKSSPDTHKLGSLYIIDSIGRAYLEQARARDDYIKASAKEGSCAHGVYTLG
                     EAIQELLSDAISKSNSDHKDKIRTLIDIWDRSGLFQKGYLNAVRARWFSMGDNPSGAP
                     PGSSNQPVLSQDPATRCVEILQNLRPAANVPQVAVPADLISTDVAAQQSALFRLLSDL
                     QQHQAAFRAPPPQQVAPARQNHVVESNIQQPAQASRQDRRERYSTSSRRARSRSPPRR
                     ENHRSSEGPNASNNHHLYPGEENVPSNNHFRPKPVSVDPTIPPEHIKVFSRTLFVGGV
                     PPSMKEYDIAHVLRPYGEVQSVILNSSRKHAFVKVYSRQEAENVLNNFNKDGSSPLRT
                     RWGVGFGPRDCCDYQHGYSVIPLHRLTDADKKWTTSAEWGGTGGQPLQPYMAFEEPDI
                     VVGEGVSSKAISQKMPTDSGRNGPKSGKPVRNPPFRQSPGQNQFYGQMATAPIPAPIQ
                     APNQYPPAGYGASPPIQSYGMQPAMAVQPVPAMYGGMQQQAAPPQQSQFDPTAQLNSL
                     MSMLNQQK"
     gene            <260568..>262406
                     /locus_tag="KLTH0F03014g"
                     /db_xref="GeneID:8292534"
     mRNA            <260568..>262406
                     /locus_tag="KLTH0F03014g"
                     /product="KLTH0F03014p"
                     /transcript_id="XM_002554296.1"
                     /db_xref="GeneID:8292534"
     CDS             260568..262406
                     /locus_tag="KLTH0F03014g"
                     /note="similar to uniprot|P53749 Saccharomyces cerevisiae
                     YNR063W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F03014p"
                     /protein_id="XP_002554342.1"
                     /db_xref="GeneID:8292534"
                     /db_xref="GOA:C5DKA4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DKA4"
                     /translation="MTAARSGKRKVGRRACMLCKLKKLKCDGNYPCGRCAKSGVPSEC
                     GYEADRRKCRAYGSDGTKAYVFKSSPFSSQHPSEGSFKNEATVHHLSEHKIETSPDPL
                     IKSIQDATLSFNERKDSEYDMWNFKPMVFNFNNFNLQDVGFDDFLRVFDDVDPFSTED
                     GSDQFPFAEPAELPLGAPFGNDNKESRLERSDLIEILFQSDYHAPPGISKDHLLDLER
                     RHEDLQDDSADSNDIFLLSTTLCLGALTSHKRELLRTRSEGFVSRSSIPDRAARAFNY
                     YTIAKNLIPDVLLHSSIDGFCGLVLMANFMTMMVSLEEQFYLSANALQIAVTLRLHER
                     EKFNELVKINSHNIGLFFLFWNIWCSSCMLGSFLGVKPTLPLADIGIPLPFDMAVTGK
                     ISSLSLKFMQLRIQIASLLTKISRYYIEDHMTTATFMGLEEELHDISNQVAKLKCLPI
                     LDEHTYHRSRLLILELASMESQVALLLYRSNLLCKRSFEAVHTAKKIVYEIWSHYSKQ
                     FEKNERDLINHLDWNFSYPLRTAFLTLWIACIVLRKYQRLLSFLQDDNLTEYTLAIEV
                     LQDLVKLLPVHQNLLNLITSLGEAGKPHSSGPDRSSHFWMSLLTEP"
     gene            <262704..>264139
                     /locus_tag="KLTH0F03036g"
                     /db_xref="GeneID:8292535"
     mRNA            join(<262704..262823,262877..>264139)
                     /locus_tag="KLTH0F03036g"
                     /product="KLTH0F03036p"
                     /transcript_id="XM_002554297.1"
                     /db_xref="GeneID:8292535"
     CDS             join(262704..262823,262877..264139)
                     /locus_tag="KLTH0F03036g"
                     /note="similar to uniprot|P53748 Saccharomyces cerevisiae
                     YNR062C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F03036p"
                     /protein_id="XP_002554343.1"
                     /db_xref="GeneID:8292535"
                     /db_xref="GOA:C5DKA5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DKA5"
                     /translation="MANQKNQSSLLRKLAVSLIAIQFSLDSCVYLSNVIQYIQTLESK
                     NPEHYLSVLQAVSAAVQVASSFFIGNIAEWVGSIKWIIIILYFLSFAGNFLYSCGGAI
                     SLNTLLGGRIVCGTASASAAIVYSYITSVAQERNAIFELLTSYRTSAGIFMALGQLVA
                     ILFALCDFKVGNYRITSYNAPTFASSFMILIVGVFLAVLLEDPKIAKSDGKKGSLLGA
                     WRQFFDAPARKVFACLILLWTMFLSTLIVSEVLYFMPVFLTLQVHWKTEYEGAAFMVA
                     AFLGVAGSFLAPNLVKMMSERESSENSLLKKGRSSEDTKVMIPIEQLRADVFYRNQVL
                     LSIFALLIFLAGQALIIAASEALSHNALPPTNSGILFVAGLSIVMVGYNCLGSSIPAI
                     FSTHIDPKLKVRLMPCIGAISGIGKLVAPIVFGALYKTCLGLPIGVGLGMILVGISIP
                     PLIWLLMKKY"
     gene            <264710..>268606
                     /locus_tag="KLTH0F03058g"
                     /db_xref="GeneID:8292536"
     mRNA            <264710..>268606
                     /locus_tag="KLTH0F03058g"
                     /product="KLTH0F03058p"
                     /transcript_id="XM_002554298.1"
                     /db_xref="GeneID:8292536"
     CDS             264710..268606
                     /locus_tag="KLTH0F03058g"
                     /note="similar to uniprot|P12753 Saccharomyces cerevisiae
                     YNL250W RAD50 Subunit of MRX complex with Mre11p and Xrs2p
                     involved in processing double-strand DNA breaks in
                     vegetative cells initiation of meiotic DSBs telomere
                     maintenance and nonhomologous end joining"
                     /codon_start=1
                     /product="KLTH0F03058p"
                     /protein_id="XP_002554344.1"
                     /db_xref="GeneID:8292536"
                     /db_xref="GOA:C5DKA6"
                     /db_xref="InterPro:IPR004584"
                     /db_xref="InterPro:IPR007517"
                     /db_xref="InterPro:IPR013134"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKA6"
                     /translation="MSAIYKLSIQGIRSFDSNERETIEFGKPLTLIVGTNGSGKTTII
                     ECLKYATTGDLPPNSKGGAFIHDPKITGEKDVRAQVKLAFMSPNDVNMIVTRNIQLLV
                     KKTTNTFKTLEGQLVAINRGERTTLSSRAAELDTQVPLYMGVPKAILDYVVFCHQEDS
                     LWPLSEPSNLKKRFDEIFQAMKYTKALDNLKAIKKDMSVESKLLKQSVEHLKVDRDRS
                     RATKINISTLEKRIDEYKEQARQAEEQLDEITEQSDKLFKSNQEFQEVLSKMDGLKHS
                     KNSLEEQINRLEGSTEVLNLPKVELERLVANFSSTLEEKQGQIKELEDILVTKRHVLE
                     QTREQYNTLISQQGELNARKSTHEDHIKELSTLKAELREKDGLSGADILTDLESKVLS
                     SNSHFDLITAQNKQCIERLRNQISELQSTRAKQEQHLIYCGNDKNKLASEIDSLESKL
                     KAMSNLEEDLAKEEDKMNNFKTRLDTHESEDEINSIGFQIKEKNSSILLMEDELEKNQ
                     RELLKVNEQADLSAKYSLIQQSLDKKRVEVDDLVSKVTADKRAQEWNLWSQSDSEFEF
                     RKAHISLQKEYALLTQENNKITKGLAEKEFLLAQLRREKDANDEKLVMLDKKITEGLP
                     EDCSIEDYITIMEETEESYRVAVENLKMHKTTLEFNLKALEVAKENNCCYLCQREFHD
                     GKEQSTLLKELQSRTDTKFEETLTKIVEEEKDYLDSLRRLESDVSSLKVLKKSQEALT
                     LDYEKVSKDLQQKTSEAAESDAKVQMVKKDIDHAELVLRPLVENLSRVTRELKALGSE
                     FQNISDEVRLRNGLDSNFKTVEELQAAQKQLNDSLRDARKEIGLLQEAKEMKSREYNN
                     LLGLIREKSFKVDELKKQLRDRENITSTIKDRKSAISQTDTIIQTVTSTLTDLSVSIN
                     EAKNKLSLVSDKANTEEVRVKGELDSLRSKRDRYAMLWSHIRDFEDKYSPQLENCKND
                     IELSRKMIHSLKDEVETLDNRMREQSQKVKDSANEQKNLRLNIDLINLKLKLVKVEKD
                     LRDLHVQNAEAQRDKYQQESTRLRALFEKLSSDNAGRMGEIKQLQNQIRSLLNQLNTD
                     YKDVDSIYQKEWVQLQTKTLVTDDIDVYSKALDSAIMKYHSLKMHDINRIIDELWKRT
                     YSGTDVDTIKIKSDEVTTSARGKSYNYRVVMYKQDAELDMRGRCSAGQKVLASIIIRL
                     ALSETFGVNCGVIALDEPTTNLDEENIESLAKSLNNIIEFRRHQKNFQLIVITHDEKF
                     LRYMGAADFTDHFYKVKRDDRQKSQIEWVNINKVTD"
     gene            complement(<268621..>270222)
                     /locus_tag="KLTH0F03080g"
                     /db_xref="GeneID:8292537"
     mRNA            complement(<268621..>270222)
                     /locus_tag="KLTH0F03080g"
                     /product="KLTH0F03080p"
                     /transcript_id="XM_002554299.1"
                     /db_xref="GeneID:8292537"
     CDS             complement(268621..270222)
                     /locus_tag="KLTH0F03080g"
                     /note="similar to uniprot|P53583 Saccharomyces cerevisiae
                     YNL249C MPA43"
                     /codon_start=1
                     /product="KLTH0F03080p"
                     /protein_id="XP_002554345.1"
                     /db_xref="GeneID:8292537"
                     /db_xref="GOA:C5DKA7"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:C5DKA7"
                     /translation="MAKTSPTSAGLGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTN
                     HGGNRVTQSSTDIMSAIHGCIQDLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIH
                     GVKQEPCHNVVFWMDSSATLECEIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEA
                     EGHKLEVFDLHSYIAYELAIKYGWDTSRIINKPNENRIGHDGELKGWDAGFYNDVLKL
                     PANVKIGPIHALNTESPVRVASCIDCYSNWFSMCSSSPNNSLFMAAGTSTCYLYANTE
                     NKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFETHPAARAYSMDKSKL
                     FSAIESAIEKLEQDFGESVHFRSKHMFTYGELQGNRTPYCDSSMSGMFIGETTDTSFQ
                     DLVLKYVTILEFLAFQVKHIKECFKAEIKDIRIAGSQAKNTRLLTLFSLVNDQITVKI
                     PAQRTDYMGVEGAYLLGKAAHKNINIIDLIDKRDRLQSHILELGPMKLGNHNTKLKQL
                     LEAKYKIYLDMAQTQMRYRAMVDSV"
     gene            complement(<270371..>271609)
                     /locus_tag="KLTH0F03102g"
                     /db_xref="GeneID:8292538"
     mRNA            complement(<270371..>271609)
                     /locus_tag="KLTH0F03102g"
                     /product="KLTH0F03102p"
                     /transcript_id="XM_002554300.1"
                     /db_xref="GeneID:8292538"
     CDS             complement(270371..271609)
                     /locus_tag="KLTH0F03102g"
                     /note="highly similar to uniprot|Q01080 Saccharomyces
                     cerevisiae YNL248C RPA49 RNA polymerase I subunit A49"
                     /codon_start=1
                     /product="KLTH0F03102p"
                     /protein_id="XP_002554346.1"
                     /db_xref="GeneID:8292538"
                     /db_xref="GOA:C5DKA8"
                     /db_xref="InterPro:IPR009668"
                     /db_xref="UniProtKB/TrEMBL:C5DKA8"
                     /translation="MSEKRAFSEINVERFESEPSIAVGSFFKGVRVPKRTKFELYRNK
                     KSADKYMIHGENDRIEYSGSTDDDSSASSQYVVGIYDPSKRSVQLYKAPVIATKVASK
                     SKKDLSGPEIKQNNLRASALRNALGEAFGTKKAKKAIADIERNRIDSDKLVEAAVDIV
                     DSVKTASKDLPTRQELQQVSSQDRTTPQANVDATDVEQIYPIHNIIPKKEWQFIRVGP
                     VLKETDDQKRLELFPFTKSQYVSKKLPTLTQAAQMTKLQLLYYVSLLLGVYENRRVSD
                     KAKLLEHLNAPPEVLVDGILDRFTIVRPGQYGRSKERGFFIDPQREDKLLCYILAIIL
                     HLDNFIVEISPLAQELGLKPSKIVNLFKNLGAIVKGATVSQAEAFGIPKSAASTYKIA
                     TMKVPFKIPEMSRRSGVPRR"
     gene            <271947..>272435
                     /locus_tag="KLTH0F03124g"
                     /db_xref="GeneID:8292539"
     mRNA            <271947..>272435
                     /locus_tag="KLTH0F03124g"
                     /product="KLTH0F03124p"
                     /transcript_id="XM_002554301.1"
                     /db_xref="GeneID:8292539"
     CDS             271947..272435
                     /locus_tag="KLTH0F03124g"
                     /note="similar to uniprot|P47138 Saccharomyces cerevisiae
                     YJR097W JJJ3 Protein required along with Dph1p Dph2p
                     Kti11p and Dph5p for synthesis of diphthamide which is a
                     modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain"
                     /codon_start=1
                     /product="KLTH0F03124p"
                     /protein_id="XP_002554347.1"
                     /db_xref="GeneID:8292539"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:C5DKA9"
                     /translation="MVQVRSYYEILGVDTKSTVAEIKKAYKEKLLCTHPDKNRTVEAQ
                     NVSIEEIKEAYQVLVNPSGKENYDKELAESYKKQGFYNGGEGLEDYSLDEFSYDPESS
                     GFHMDCPRCQMSNGFEFTDSLLEEHCIERTEGGFYVVVQCSACSLWLNVNFDVAEDYE
                     SS"
     gene            complement(<272447..>274261)
                     /locus_tag="KLTH0F03146g"
                     /db_xref="GeneID:8292540"
     mRNA            complement(<272447..>274261)
                     /locus_tag="KLTH0F03146g"
                     /product="KLTH0F03146p"
                     /transcript_id="XM_002554302.1"
                     /db_xref="GeneID:8292540"
     CDS             complement(272447..274261)
                     /locus_tag="KLTH0F03146g"
                     /note="similar to uniprot|P47139 Saccharomyces cerevisiae
                     YJR098C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F03146p"
                     /protein_id="XP_002554348.1"
                     /db_xref="GeneID:8292540"
                     /db_xref="GOA:C5DKB0"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DKB0"
                     /translation="MVTEKASIESSSEDSDLRRDIEAVSLVSEDESERDNSEISNAET
                     DVGPFIGGSKVANSSRPKPDKLHSIYDDDSESEDSNDETPPEHMDESRVNKQSHTIFT
                     FNLPFGGKSLLPTSPFTSLKNTFMPMSSEDKNKTKSRRKIKLKLKRQETISSVEEIEL
                     FKDQKGIDNVRARAVKRALKPESLFHTIRSFSLDQQAQTHDGYECERLESIWNELNGN
                     IVILGGYRGSILRDAETKKRVWIPIRAGLNIRKVDLLIGPKDEDEIEAQHKLYADGML
                     THLGPVDVCKKLIKKLRNNINVSIEEFGYDWRLSLEIPAKQLAKKLQEIYDKQDEKKG
                     TYLIAHSMGGLVAHKVLQDHTHLIRGIIYVGSPSQCANILGPLRFGDEVIFNKSILSA
                     EATFFMRSSFYFLPFDGRCFANKETLERYDLDFFDPDVWKKYGLSPLVDEERTKSEDE
                     IKIPSPDKDRFSLIPHVDMMRSLSSGNDTVSFQTPYNECEEYLVRTLKRTKKYLASLD
                     YDETKSYPPLAIVYGNRVPTVRGAKVSDRDQIKRGEYDEFYYGPGDGVVHHKWLLPEK
                     RGFPVVAKVASECAHVSLMTDFEAMAKAFISLVDNEKC"
     gene            <274654..>276975
                     /locus_tag="KLTH0F03168g"
                     /db_xref="GeneID:8292541"
     mRNA            <274654..>276975
                     /locus_tag="KLTH0F03168g"
                     /product="KLTH0F03168p"
                     /transcript_id="XM_002554303.1"
                     /db_xref="GeneID:8292541"
     CDS             274654..276975
                     /locus_tag="KLTH0F03168g"
                     /note="similar to uniprot|P53852 Saccharomyces cerevisiae
                     YNL247W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0F03168p"
                     /protein_id="XP_002554349.1"
                     /db_xref="GeneID:8292541"
                     /db_xref="GOA:C5DKB1"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="UniProtKB/TrEMBL:C5DKB1"
                     /translation="MYKCRTISKIWKTCERSVGMSATSSNVKVNQPKWRQPQEPEGAP
                     RLKLYNSLTRQKEDFVTISGDKNVTWYSCGPTVYDSSHMGHARNYVSIDINRRILQDY
                     FGYRIRFVQNVTDVDDKIILRARQSHLFERFAAENKEVTPLIQEKVNSALFAYIEANL
                     KKSFSSIGEYKAWFSSLDISKEKEANPKFAMYTSAVSDCITALEGTNDAETFLGLVKE
                     VLIPVLDKESGSTINEPEIFRKLPAFWEREFNKDMAALNVLEPSVTTRVSEYVPEIVD
                     FVKRIIDNGYAYATGDGSVYFDTVAFDKSEKHDYAKCQPWNKGKLDLINDAEGSLSNF
                     SSTNGKRSSNDFALWKSSKPGEPEWDSPWGKGRPGWHIECSVMACDVLGPNIDIHTGG
                     IDLAFPHHDNEIAQSEAFYDNHQWVNYFLHTGHLHIEGQKMSKSLKNFITIGEALKKY
                     SARQLRLAFSSAQWNSQLDFKEVLLVEVKSLEQSFNNFFRNARALKADLAHREDMGQH
                     VSKKLGDKEKSLLTELAAFQDKVHNAFCDNLSTPVALKFLSELVTKANLYISSAGSDI
                     RIEPLLEVVRYITKILEVIGFPSRDDHLGWLDEAGGQSQTGENREELLMPYVKCLSNF
                     RDDVRRLAIDKASSTEFLKLTDRVRDNDILDLNVSIDDRSDQASLVKFLTNDEKEEYK
                     KQIMEKDQRQKEKEAKKKEQARLREAKEAERRLKAQLSPNEMFRNSELYSVWDEEGLP
                     LKDKDGVDITKSMLKKLKKQWEQQKKLHEEYFG"
     gene            <277312..>278195
                     /locus_tag="KLTH0F03190g"
                     /db_xref="GeneID:8292542"
     mRNA            join(<277312..277328,277394..>278195)
                     /locus_tag="KLTH0F03190g"
                     /product="KLTH0F03190p"
                     /transcript_id="XM_002554304.1"
                     /db_xref="GeneID:8292542"
     CDS             join(277312..277328,277394..278195)
                     /locus_tag="KLTH0F03190g"
                     /note="similar to uniprot|P53853 Saccharomyces cerevisiae
                     YNL246W VPS75"
                     /codon_start=1
                     /product="KLTH0F03190p"
                     /protein_id="XP_002554350.1"
                     /db_xref="GeneID:8292542"
                     /db_xref="GOA:C5DKB2"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:C5DKB2"
                     /translation="MEEDKVSKSLEALARVEDEVEKAERETEFLRLKKLSAVYLNRKE
                     AIAGIPGFWKVVLSQHSDFANYVRAADLKYIDCISAIEVTWLCVEDEKADHRDFTVTI
                     NFDAIDGDFESQTVSKTFRIEHDVSKFIYRSKRTEEDDLRDEELGFLTSTPTEIKWPK
                     SFDGINPSLVTDKTTSEGKRNYRTGMKSFFSWFKWTGLKPGKEFPNGDGLASLISEDL
                     YPNCTKYYTEAQIDLEEENVDEDDESDEPLQLESSDGEPEDCDGKQKSVKRRKV"
     gene            complement(<278216..>278830)
                     /locus_tag="KLTH0F03212g"
                     /db_xref="GeneID:8292543"
     mRNA            complement(<278216..>278830)
                     /locus_tag="KLTH0F03212g"
                     /product="KLTH0F03212p"
                     /transcript_id="XM_002554305.1"
                     /db_xref="GeneID:8292543"
     CDS             complement(278216..278830)
                     /locus_tag="KLTH0F03212g"
                     /note="similar to uniprot|P53854 Saccharomyces cerevisiae
                     YNL245C"
                     /codon_start=1
                     /product="KLTH0F03212p"
                     /protein_id="XP_002554351.1"
                     /db_xref="GeneID:8292543"
                     /db_xref="InterPro:IPR019339"
                     /db_xref="InterPro:IPR022209"
                     /db_xref="UniProtKB/TrEMBL:C5DKB3"
                     /translation="MGTGDLNLLKSWNPHLLKNKKKVWETEQQLLDEQRKFKERQIEI
                     EKERQLDDLTSLNRTGSKLQQKNGMEWMYNDPAATNEQNTDFLLGKKRIDTSILKKNE
                     QPYTQKKDRHFDTSNKGIHSILENKRPAASTDLSRDDPLAAFQKAQEIRRNTARSDRI
                     SKVHKPRPNLPESGSRNKQTIPHAVSRQPPQNNRKSRSTYDMDY"
     gene            complement(<279196..>279522)
                     /locus_tag="KLTH0F03234g"
                     /db_xref="GeneID:8292544"
     mRNA            complement(<279196..>279522)
                     /locus_tag="KLTH0F03234g"
                     /product="KLTH0F03234p"
                     /transcript_id="XM_002554306.1"
                     /db_xref="GeneID:8292544"
     CDS             complement(279196..279522)
                     /locus_tag="KLTH0F03234g"
                     /note="highly similar to uniprot|P32911 Saccharomyces
                     cerevisiae YNL244C SUI1 translation initiation factor
                     eIF1"
                     /codon_start=1
                     /product="KLTH0F03234p"
                     /protein_id="XP_002554352.1"
                     /db_xref="GeneID:8292544"
                     /db_xref="GOA:C5DKB4"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="UniProtKB/TrEMBL:C5DKB4"
                     /translation="MSIENLKSFDPFADTGDNETATANYIHIRIQQRNGRKTLTTVQG
                     VPAEYDLKRILKVLKKDFACNGNIVKDEEMGEIIQMQGDQRAKVCEFMITQLGMKKKN
                     IKIHGF"
     gene            <280245..>282368
                     /locus_tag="KLTH0F03256g"
                     /db_xref="GeneID:8292545"
     mRNA            <280245..>282368
                     /locus_tag="KLTH0F03256g"
                     /product="KLTH0F03256p"
                     /transcript_id="XM_002554307.1"
                     /db_xref="GeneID:8292545"
     CDS             280245..282368
                     /locus_tag="KLTH0F03256g"
                     /note="some similarities with uniprot|P33338 Saccharomyces
                     cerevisiae YNL243W SLA2 Transmembrane actin- binding
                     protein involved in membrane cytoskeleton assembly and
                     cell polarization adaptor protein that links actin to
                     clathrin and endocytosis present in the actin cortical
                     patch of the emerging bud tip dimer in vivo"
                     /codon_start=1
                     /product="KLTH0F03256p"
                     /protein_id="XP_002554353.1"
                     /db_xref="GeneID:8292545"
                     /db_xref="GOA:C5DKB5"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:C5DKB5"
                     /translation="MSRFDVDLDRAVRKACSYEETAPKRKHVRTCIVFTWDHKSSRAF
                     FNAMKTQPLGEDEVSVFKALITIHKVLQEGHPSAIVEGIKNREWIESLGRIYSIGGGD
                     GYGRIIEEYVQFLLRKLVFHRSHKGFNGTFEYEEYVSLVTTSNPDEGYETILDLMDLQ
                     DALDEFSRVLFASISSGRKNECKISALVPLVAESYGIYKFITSMIRAMHKQTGEDGAM
                     EPLHERYVSQHARLFEFYADCSAIKYLTSLIRIPKLPTEAPSLVDSPSPEPSLSRPST
                     RNSARRSITPSEKPPSLKAERSFSAVTPSQTEYVATPGPQISGVFSNGAYNIPSSQPT
                     GGVSGFVPFMSSHPTGVVGGLVPVMSSNPTGGLVGNQTGYFGNVGLDTPNSLETQRAL
                     EQQRTNQLLLQQQQQQQQQQQLEQQAILERERQRQLELQQQQRQLEIEREHQLAQQQQ
                     EQALFEERLRSQQNMYQQAAQQDQYQTDLNALREQHERDQMVIQQYDNRVLALEKELE
                     NMNLNVNEQLSNKEEQVKTMEQWKEKYDGLARLYAQLRQEHLAVLKKLKKSQQVESSA
                     KEAIHKAEVLEHEKEDLRREVQQVNRERERLHWESEKNARKQVEEVLVAGSRAVVART
                     SASESATNLANCFNNFIADGANGDFAALATSIAEFTVATAGSKDAQDFLCALKDLTGT
                     EEEMTDKVIDLNIHLQRLFANQTLT"
     gene            <283035..>283712
                     /locus_tag="KLTH0F03278g"
                     /db_xref="GeneID:8292546"
     mRNA            <283035..>283712
                     /locus_tag="KLTH0F03278g"
                     /product="KLTH0F03278p"
                     /transcript_id="XM_002554308.1"
                     /db_xref="GeneID:8292546"
     CDS             283035..283712
                     /locus_tag="KLTH0F03278g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F03278p"
                     /protein_id="XP_002554354.1"
                     /db_xref="GeneID:8292546"
                     /db_xref="UniProtKB/TrEMBL:C5DJY3"
                     /translation="MILSELNKVENMNWTEGYAECHLPKVANQIKYKFGTQKTLGKDR
                     FPCIAQRKCPKQICHFVTSGKTDKIKQSGLKSRNKFILMRGLLHCMVQQLRNCSDPFN
                     ANRAKVEEVSKIASAIWRTNKGVFQSYHEMLAVFEDSKSTNITISKSTLKKLTEAIGR
                     ECIPSTYSYETLTNGADTTAMESKKTYKAFCGRFSLKEATGRVRKKKPTQTFALRSAK
                     IEDIFLI"
     gene            complement(<283918..>285474)
                     /locus_tag="KLTH0F03300g"
                     /db_xref="GeneID:8292547"
     mRNA            complement(<283918..>285474)
                     /locus_tag="KLTH0F03300g"
                     /product="KLTH0F03300p"
                     /transcript_id="XM_002554309.1"
                     /db_xref="GeneID:8292547"
     CDS             complement(283918..285474)
                     /locus_tag="KLTH0F03300g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F03300p"
                     /protein_id="XP_002554355.1"
                     /db_xref="GeneID:8292547"
                     /db_xref="GOA:C5DKB7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DKB7"
                     /translation="MDDKGNSRKALRSCVRCRKNKIKCDLQEKRPGSCTPCSRRGIEC
                     YVDYVVPHQRSQELINLFQNVEDVKRSMGKLTSSYEKIAREHVPFFCMDRQGFSPSVG
                     SKVLKLAEGEFIIIALSGEGLRVNNYLINSEDIEVALKDFQDVVGTLLQLYERPDCGR
                     SCVNETVIDESVGKYTVENLFHSEQLPFLLCVVNFYFEIPGLKYNELFDTILEDYCFM
                     AIEDEKSGKNFDRRTLSKLIIGHSSSDFNFLFNGEMFIKKFTLYLFYHIVIYGVRYYM
                     DCFMEKYIRTLENVRKKVNIEKNWEVKWVNFYIKVFGLMDNMKEVLEIGEENDPFLKV
                     LEYDSLIVNSDISIDTRFPDVLKQCHQDVKPLLRRGHMRIPFVKEFMAQFITMNYFVA
                     NLKFKKCLNEMESMKYTGFNTKVISELGSEAKCLCCDVNKGENENKLYAERGSAEDVV
                     VEDPEECSANGNMRAGVRKVRYEEYDVYDIVATCLTKDGYKDILRRSCCGLVRDMCEK
                     VIIEGMIMKL"
     gene            <286122..>286886
                     /locus_tag="KLTH0F03322g"
                     /db_xref="GeneID:8292548"
     mRNA            <286122..>286886
                     /locus_tag="KLTH0F03322g"
                     /product="KLTH0F03322p"
                     /transcript_id="XM_002554310.1"
                     /db_xref="GeneID:8292548"
     CDS             286122..286886
                     /locus_tag="KLTH0F03322g"
                     /note="weakly similar to uniprot|P32800 Saccharomyces
                     cerevisiae YJL210W PEX2 RING-finger peroxin peroxisomal
                     membrane protein with a C-terminal zinc-binding RING
                     domain forms putative translocation subcomplex with Pex10p
                     and Pex12p which functions in peroxisomal matrix protein
                     import"
                     /codon_start=1
                     /product="KLTH0F03322p"
                     /protein_id="XP_002554356.1"
                     /db_xref="GeneID:8292548"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DKB8"
                     /translation="MIVNKIDGDKLDNDLYSHLWALYDDKIKPTSNREEFKLLLKTLA
                     FHFSTKSNGIQTTTYGSALAGTSFQTAKLSLFAANILMPYLVQKLQTFLYNADNNLLP
                     KIRIVETLISVWSLSTFIQLLSGSPKQYLSIFHKIFRIKISTFMQSQFYQNTITASME
                     FQNTQLLYNALLQLLNNQVSQSKLIQKLLRSSTKKGIKRQNAFNCPYCDEAPNIPYRT
                     SCCNKILCYLCVVKTLEFKNCAGCNTTNFSAAPLYH"
     gene            <287064..>289019
                     /locus_tag="KLTH0F03344g"
                     /db_xref="GeneID:8292549"
     mRNA            <287064..>289019
                     /locus_tag="KLTH0F03344g"
                     /product="KLTH0F03344p"
                     /transcript_id="XM_002554311.1"
                     /db_xref="GeneID:8292549"
     CDS             287064..289019
                     /locus_tag="KLTH0F03344g"
                     /note="weakly similar to uniprot|P07252 Saccharomyces
                     cerevisiae YJL209W CBP1 Protein required for COB mRNA
                     stability or 5' processing required for translation of COB
                     mRNAs"
                     /codon_start=1
                     /product="KLTH0F03344p"
                     /protein_id="XP_002554357.1"
                     /db_xref="GeneID:8292549"
                     /db_xref="UniProtKB/TrEMBL:C5DKB9"
                     /translation="MIRPLKGLTTQRAAPAYLRVCMLHTERETQLKITTSELNYCILN
                     QKTYSTSQLDRKIKEYWKVSKANSTTNFETPSVQPRIFLTGTDLFKYDNKQNKVSAVY
                     RCFVRWEIIRAQPPLRGKLFANNLIHSSPLSPSDLKNTDIDILPFLIHNCITYEDIPN
                     AIDLFIWYNTKTPGKELHRTLINAMIQCIAESSQIEPHYHLLKFTQLMNFLNEKSIEH
                     TLSEHQALQISNKAMSLDNNPLLTKKVLSYVLDVAYNKSNTVRTAQVEALYSLISSDY
                     KSNNAAGVLLHWTAVRDHYTTISKHDTRILYKIIKLFTKQKAYRQRCAELISSIEPQL
                     YVNNALLLPSIINFASATKSYSLATKIMSNITTYSNFNTQKQILKSRFFLSTLLRLHL
                     TFEDSIGVERILTEIRKEHNSLTSADYQVIVSHLLKSRKPQDLLKALTLSNKIEGLKG
                     IPSITTIINHLTLLKTHEVEKLNLNVGATIHNLLLKAHNNDPAHKTKLWDILASIFVR
                     SLTTYKHNTTPWWTNEIYDKTTKVDFLKLCYETSKNKTPMDITVNPFVSPNPKDTVIK
                     LSATNIIVILRTIAREANHHRRSDVFLWCMNEMTKNGMSEEEIELDWNNMEKHQIRRF
                     KNKTKNGITKNLQKHGLKSFKTLLRKK"
     gene            complement(<289075..>290079)
                     /locus_tag="KLTH0F03366g"
                     /db_xref="GeneID:8292550"
     mRNA            complement(<289075..>290079)
                     /locus_tag="KLTH0F03366g"
                     /product="KLTH0F03366p"
                     /transcript_id="XM_002554312.1"
                     /db_xref="GeneID:8292550"
     CDS             complement(289075..290079)
                     /locus_tag="KLTH0F03366g"
                     /note="similar to uniprot|P08466 Saccharomyces cerevisiae
                     YJL208C NUC1 Major mitochondrial nuclease has RNAse and
                     DNA endo- and exonucleolytic activities has a role in
                     mitochondrial recombination"
                     /codon_start=1
                     /product="KLTH0F03366p"
                     /protein_id="XP_002554358.1"
                     /db_xref="GeneID:8292550"
                     /db_xref="GOA:C5DKC0"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR018524"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:C5DKC0"
                     /translation="MSFRNVVCGFAGVGLGGGLVASFWGLPFGGNSRAKGNVVDNVSG
                     SVTSGGSEGSLKLSGSDVNPSAFFKYGFPGPVHDLHNREEYVSCYDRRLKLPYWVVEH
                     ITPESLANKSGDRKNSFFKEDESIPDRFRAKLRDYFRSGYDRGHMAPAANAKFNQRAM
                     DETFMLTNIAPQVGEGFNRDYWAHFEYFCRQLTQKYGSVRILTGPLFLPKRDPADGKN
                     KVTYEVIGNPPSIAVPTHFYKVIVAESPLRGPGSDNVAVAAFVLPNDKISNETKLTDF
                     EVPLDAVSRSTGLQLLQKLPSEKKKELCKEVDCHITVREFVKALPAPKSVPSLPSPSK
                     "
     gene            complement(<290517..>296435)
                     /locus_tag="KLTH0F03388g"
                     /db_xref="GeneID:8292551"
     mRNA            complement(<290517..>296435)
                     /locus_tag="KLTH0F03388g"
                     /product="KLTH0F03388p"
                     /transcript_id="XM_002554313.1"
                     /db_xref="GeneID:8292551"
     CDS             complement(290517..296435)
                     /locus_tag="KLTH0F03388g"
                     /note="similar to uniprot|P39526 Saccharomyces cerevisiae
                     YJL207C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F03388p"
                     /protein_id="XP_002554359.1"
                     /db_xref="GeneID:8292551"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DKC1"
                     /translation="MSAEPSDRITAQIEQSDSKKHTLLAWISASTWTLQKSEDAGKAE
                     SVLFQLDELIKCVSEKEEDFPVISYTLSENISNLYVLCLKVLRTRKPRIVYDTTITLS
                     NVLCEETMTAETGKKSKKKTYTYSAVKLASTVVLTQLAVLFAEELSSLLPPLLPDILK
                     NVKKTIEKEKNMHAAYLPCLMKLGAVILGTSPKIDHAIIGKLAKTIKNIMHEVVLDTQ
                     VYPISFIGLVIKSYGLLFKNDEFLSLQSSSNHLDTFKSKFMQNNYAYFGLLHDETRLD
                     TSSCIAEVLYDWCFQKKTISMDDVLTFLADVFLTSDARSVKSGSFEALAHFIGLALVA
                     DGEFLAGEKYLRIIVKLTGLVFDNSKTKAQKLDIISSYLEYFENLHSIILPHVSEPSK
                     LLILFAIYDCNEANSSDLLVDKEGEVHYSTLAFLQLSHRLMTELSSAFSSNSRHASTI
                     KTVLLELSTSSNFQIRIHGSNVLKTFLHFAPIHLSDVLEKSLEALSKELLVTNSFSFP
                     KVHGHTFVIANLIEISSTDYVPNELIMRILIFATSILKEHPVSSGLSAYFKQLVSWIL
                     LCGLMNYGDEDFLRTQSPQLFLFWNSVLTHTYNYRDEDELYKNVELRNHALTCLLAYL
                     GRIDISADIAKQVSFLLAKCTNFNNSIILKTKTIDNVLLQNENRILQIYLRVHEYVKH
                     EFNSAILILIVKNFADPNLYSESTQSGSDSMRSKQESSSKATASNSYVLNPSVLLSDT
                     SGFAYGLSSKVNGFTIDGLKASNCILSSRSLEPWGGESGFWYSCFEKEVYKPITSVLS
                     YDCLILLYGHNGYSTREVYSPRVTTSIINSSMEVFSLIFPFLNDKIQYSVLESMNSCI
                     FSKKTVSLRSIAIAINCCTAIHGALSIAQEHALAVEDSVASLLIKILKDIPINEDAIL
                     AKLKAECMGLVLAASSRNAAYNDTENENITGAYEIIVKDICDHDEPYSRVFNALSVSC
                     AQHFNSRRLKFAPALSLLESLVRDPHPIVHTWTLESISILIANIPTMDVSKASNLLLE
                     LESIYVSENYGKNSSSIWAVSYSSRFSSHRIIGKILVHLTQILGPEITRLSKSSVQAF
                     KNLFYLLLESKDSIQELQGVLIAVNLAAFKLNGDLSGELAIPASSKFIGEALYISLGR
                     RALLRSGRSSRVRLLEAYNESGVAASFQLLTQFVKLEMFHGLYRKLENLIWAYIALFP
                     DSQPAKDFVLEWFEHTFTQDLSWTERLCKLFFVSKSELLALASRNTPFVSSEGGVGGV
                     NLNEDTEEKDSIVENEEKAFTEESKAAVNLDSLSWETKLLIMTLLRKLFLNVKEERKL
                     MNVLYVKMPQLIKVCFSASTVNVPDVRKAGIEILGLLITTYNDRSWVAGETYLEEEEA
                     HFVSALMPAFESGSFPLIIPSALKVCAVYLCSSPTNSHPNSRISNLLVNSLTEIVEKP
                     ETWSVGEVKVSTKRSKTEVELSILDAWAHLANYAYKEKESKISELVKDYCETLAPLWI
                     IHLREFVSLNNSTSVINKGKNLKVGREKDWRFSKYKKVWLSFANAIASVNIIDKSVVS
                     RCLNEDDLHSFVFVVAAQCLQQLTLDFEIRDIKSSTLTVLYRILLIEVPYEPFFNDGV
                     HEEIEEIFERVVVTGNVEERTRLVDVIEVLVVGYLNQCSKQDHFFAEADKVYHLVRIL
                     LMLISSKLPFIRSESGEAVETSFEETELQFLRKCFSTAAKVISKFPVEFRTDLNACLL
                     FIVGRVFESPSRNSLVPVVLPLLKTLVCLGDPSDVEKDLIVVFFESNKNTIFGQLSKD
                     LAITTLSILENNGRDCFSDDDVTSVVTLLYEGLQSDSTVAVVVRAYKSLVKKSANSAE
                     CREIVRRFMLAVASEVDGAGGNPELLNVEALVDAVGAFSETCLQIDNFDSKAALSFSL
                     HLLLSLSRKVPAKCGLIRDEVIRLIKSDPDSSKSAVKENLVQDEKNSLMKLVSTPSQN
                     DERIEGGIELRIFS"
     mobile_element  297578..299163
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
                     /mobile_element_type="transposon"
     gene            <300417..>300815
                     /locus_tag="KLTH0F03432g"
                     /db_xref="GeneID:8292552"
     mRNA            <300417..>300815
                     /locus_tag="KLTH0F03432g"
                     /product="KLTH0F03432p"
                     /transcript_id="XM_002554314.1"
                     /db_xref="GeneID:8292552"
     CDS             300417..300815
                     /locus_tag="KLTH0F03432g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F03432p"
                     /protein_id="XP_002554360.1"
                     /db_xref="GeneID:8292552"
                     /db_xref="InterPro:IPR013924"
                     /db_xref="UniProtKB/TrEMBL:C5DKC2"
                     /translation="MSANSVLLIDGTSESSKQYDMHLVPCRIRTTGHTNELANNFKKD
                     AEESAEDNSQVVTYIRGRKIIGKPLTCLDRFQTVLLEPEQDPETPNTYKETARIGMVF
                     NYEREGNEARLQEEISKFEEHLQLADVIHD"
     gene            <301123..>302166
                     /locus_tag="KLTH0F03454g"
                     /db_xref="GeneID:8292553"
     mRNA            <301123..>302166
                     /locus_tag="KLTH0F03454g"
                     /product="KLTH0F03454p"
                     /transcript_id="XM_002554315.1"
                     /db_xref="GeneID:8292553"
     CDS             301123..302166
                     /locus_tag="KLTH0F03454g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F03454p"
                     /protein_id="XP_002554361.1"
                     /db_xref="GeneID:8292553"
                     /db_xref="UniProtKB/TrEMBL:C5DKC3"
                     /translation="MSLVGRKRGYDKEGLKNQENCNTNAAKRTKVNNHSRAAKFEQFI
                     DRAPHEIILQLKCLVSRQDIISLASTSKRVRERLLPYLFDRVKCSWPELLSSWRNPNG
                     VCAPIEHPELIEGIRITSFCSKNEWTFPFHVLFSPDPSTNPMGRLESLSMLSSGSTNF
                     FKYCGLVLNLKTLSITAVKSSSVFSLEHVKQFPSLQELRLVGFHIEDAEAEANPRNNL
                     GYLKLENCTWCYPFNLESFGKDKIHTLHLKYSNSFIVSERFKHLLSSPSFTNLRELSI
                     VNDEKSLELTISLKIMNLIHAMPSLETLILSGNIYNEALNGHASSGSSNHTSIVALNN
                     VKVFYSSFLRDLG"
     gene            complement(<302182..>304512)
                     /locus_tag="KLTH0F03476g"
                     /db_xref="GeneID:8292554"
     mRNA            complement(<302182..>304512)
                     /locus_tag="KLTH0F03476g"
                     /product="KLTH0F03476p"
                     /transcript_id="XM_002554316.1"
                     /db_xref="GeneID:8292554"
     CDS             complement(302182..304512)
                     /locus_tag="KLTH0F03476g"
                     /note="similar to uniprot|P39531 Saccharomyces cerevisiae
                     YJL204C RCY1 ReCYcling 1"
                     /codon_start=1
                     /product="KLTH0F03476p"
                     /protein_id="XP_002554362.1"
                     /db_xref="GeneID:8292554"
                     /db_xref="GOA:C5DKC4"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:C5DKC4"
                     /translation="MEDLLKVTNIVVGIASNLTTRDYLTFQQLNKNVYYTHLVGPNDS
                     EFWCKKLLRIGLTKASDKDEVQMMLQQGNAIDVLSKLQVFTTSTAKAVFIELHRCYQG
                     FVDKLYHSDFKKFFSPEYSSPLAQAKIIMNLSLYAKGDINDYTYYHKVQENWGIFKEL
                     FINTAIKEMDLSFSQQDFGSAAEFIEVLLICHEENTAIDFFKSKNDFDSEVDLPQQLF
                     PPESSETSNEVLHLTLEKIKIFLNSKIELADTLFDDKYPIILDYLESVIANSIADYLG
                     SQVIDDLQSPGAYSTISFMPQLFKYVNEELIDGLAESKNGGPRLKEIVREFFNLYLEP
                     KIMNYLDTTVQEFGQKIELTLLNFQKETTLKEQEQNEQIYSDLRDKASKQQQLIDQKN
                     NFLTSFTKIFKITNNNRTAEEERLQMAYNLNVMNNNLQNIQVLVSLDLCYKVVQDCKF
                     CIENMRTFLIINNIADVVKSKCQEVFKTLVTTLANEHFRPGFFKAIQILEQYDPNQLK
                     NVELEFEALGSHVEPLIKFTELVNTGDIVLQMISIFYKNELIQTNIMDRNKDFLNDVV
                     QVKKNFETMIDDYVANGLNVGINKLMDEVLFVFSSLQLPDDYNPDPTQVAKKEIKPSK
                     AAAKNVELLRNHCFLLTGATDKGTIDIFQQEVGERFFNEIVKNIKKNLISSDGAVFLI
                     CDLNYYYDFIANVLKQKQIVPLFAGLKTVGQLYLVSGKDSKELGKMICDLGRFQGIFS
                     QEEIYELVQRRTDWVRVRKDVEKVMYGLGVSDCIII"
     gene            <304634..>305827
                     /locus_tag="KLTH0F03498g"
                     /db_xref="GeneID:8292555"
     mRNA            <304634..>305827
                     /locus_tag="KLTH0F03498g"
                     /product="KLTH0F03498p"
                     /transcript_id="XM_002554317.1"
                     /db_xref="GeneID:8292555"
     CDS             304634..305827
                     /locus_tag="KLTH0F03498g"
                     /note="similar to uniprot|P32524 Saccharomyces cerevisiae
                     YJL203W PRP21 Subunit of the SF3a splicing factor complex
                     required for spliceosome assembly"
                     /codon_start=1
                     /product="KLTH0F03498p"
                     /protein_id="XP_002554363.1"
                     /db_xref="GeneID:8292555"
                     /db_xref="GOA:C5DKC5"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR022030"
                     /db_xref="UniProtKB/TrEMBL:C5DKC5"
                     /translation="MDTLKPMEMKESNKEIPAAGEAVGPGDFELKKTIEKTASFVARN
                     GTEFEEKLDKAKFPFIDEQNAHYPYYKRFLKSFKTTEQDEISERRPINLPTPSIPYPF
                     VFSTFDRHIPRRDLEIIKVTALFCVVNEETRYLETLKEQCSKNELLAFLDPDHALNAT
                     FTHFINQYKQVARKDFGKLVELNEDRKLAVLERSFQRAEFEEYSHKMEAEQKRSHEHF
                     KLKFSAYDWENFELLGTIDFRNLDEENYSEPLDFDVIRQKSLQKNQGTKTFEGILALS
                     SLPQKGTNETDNGEATVKAKKKNKMKIRAAGETRLKKNKSQTQRTESEERLIECPITH
                     RMVPEASFDRHIQVLLSDPNYSRERQEYEAKNNITNLTLESVHQNIKRLSKAPPTQAA
                     KKQKF"
     gene            306248..306336
                     /locus_tag="KLTH0F03520r"
                     /db_xref="GeneID:8292556"
     tRNA            join(306248..306284,306301..306336)
                     /locus_tag="KLTH0F03520r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (TTT) cove"
                     /db_xref="GeneID:8292556"
     gene            <306546..>308315
                     /locus_tag="KLTH0F03542g"
                     /db_xref="GeneID:8292557"
     mRNA            <306546..>308315
                     /locus_tag="KLTH0F03542g"
                     /product="KLTH0F03542p"
                     /transcript_id="XM_002554318.1"
                     /db_xref="GeneID:8292557"
     CDS             306546..308315
                     /locus_tag="KLTH0F03542g"
                     /note="similar to uniprot|P32525 Saccharomyces cerevisiae
                     YJL201W ECM25 Non-essential protein of unknown function
                     promoter contains a consensus binding sequence for factor
                     Abf1p"
                     /codon_start=1
                     /product="KLTH0F03542p"
                     /protein_id="XP_002554364.1"
                     /db_xref="GeneID:8292557"
                     /db_xref="GOA:C5DKC6"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5DKC6"
                     /translation="MNSTVEVRLDNIFFQSYAKDPASGSAIYVFDSTYLPSADDVESR
                     EVYDLLIDEVMDRLVTKLPELPFSLVVFSSGFTQNNVSWIYGVKMFAKIPKSTRARLQ
                     KMLIVHESFFVRTVYQVLTNALNINPFKNKNNADAVIHHVANLTELAEYVDITRLRIS
                     LNVYLYDYQFNETISVPESYVAEGSSLANRQYRQLIFDKIFKRLQIDAPKHELVFQRP
                     GSYQKVNVLLGVIARNNYVDLSQWDIYSLATVFLHFIKGKTKPVLPIDLIPLPISDSF
                     EYTYNTFVSMMLYNGYYELTLYIFELFLTLVGNSEVTLHDYRTLSKCLTATLCKEKVS
                     LKTSDRLAIGYRYTRNVFMKFHDLRHEIEQKGALKAVEEPRTPRFTREAPKIPPPRKK
                     SPTKACRSTNSSKERIPPTKPPALPKRKGIPSSSTTSLPAADLRAEMSPSPQPMMSRS
                     EVSLDITEPRSPKLGATPNLRLGSNSSINVSMTSDPNVSPQLQPQLIPDEAVTFKSKP
                     EDDLFKLDQNMSSLLLDNNQKIQSLDKELKKKKQASNLGSERFSNSAYSDIKAENKVS
                     RLAALYEERLVGIRVMEDMRRNQ"
     gene            <309896..>314143
                     /locus_tag="KLTH0F03564g"
                     /db_xref="GeneID:8292558"
     mRNA            <309896..>314143
                     /locus_tag="KLTH0F03564g"
                     /product="KLTH0F03564p"
                     /transcript_id="XM_002554319.1"
                     /db_xref="GeneID:8292558"
     CDS             309896..314143
                     /locus_tag="KLTH0F03564g"
                     /note="weakly similar to uniprot|P25300 Saccharomyces
                     cerevisiae YCR038C BUD5 GTP/GDP exchange factor for Rsr1p
                     (Bud1p) required for both axial and bipolar budding
                     patterns mutants exhibit random budding in all cell types"
                     /codon_start=1
                     /product="KLTH0F03564p"
                     /protein_id="XP_002554365.1"
                     /db_xref="GeneID:8292558"
                     /db_xref="GOA:C5DKC7"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5DKC7"
                     /translation="MNFSTPQSFNCANNRVNRDSSVYDVTPTKPLSLSKSPHEEQLRS
                     ESNYFHRSSTSMATSNSNASFTTANSSEKLLKDYGLSTNFDFQEEGSQISESTSEQTP
                     IVAPTVTFDNPTPLIDGFGQEGESEPQSPDSFNFVERFSENQPGQHSTTGLGISIANS
                     STEENIRIDSFRNSSGLERNAELKRLSVLEPTVSPPQSSEKISKKLERKSIHEAYTKQ
                     PFHLPDSDRNTSIDLDDTINTKAESNTFQDSTLSHDYTYENDLIQKSPEHHAVERKHT
                     FKRSSELDLDSTSLAYLFIIAIHSFNSQSLKNEEDIAICLSFEKNDIAFVHTVDDSGW
                     GEVTLVRNQKRGWVPFNYFSDTVKAPQGLKEGQDPNLDSRRPLAKLFSSSAQFLLHPQ
                     DHPLPAGPGMTFSLEYINSIRDGVKFLLQTTDCVSRSNELVQNRPIVKKARKLLLADW
                     YNLMIKADSYKYTTIPNKIDTLKNLVFQVLRRGYAFYNTWNFEKQTFIREKEFGLIEP
                     LEKAPVSSYHEPKSSQTEKLKRVNAASQGFAMLPEAPFAVARLNEVHDLLFSYIGLIL
                     GRLDMVEHNPAACEVLESVVHQIIVLLRELLYISKCCSSIIQSRFKNTQRNETTLDQS
                     LDPLLSLVSELVSCIKIFVTQTMGENLDIVNSSSDAVSIKDEEYLYTEEGKRLITITS
                     RMTGLIATSIQGCHRYLNLIGDFCLGEERSYPDFESSKITPEGFVKRCSIGLSKKFSS
                     APSNKPVPSQTPKQGLRHPYFKKVYRYSTIRSGDNAMSLSTYGSQFLQDIVPDSTPLF
                     DNSSFDKYRIEEDSSSADLQREAINNREKMQDEIQFDDERKLIGASQRALVFLLTDEL
                     NQPGEFLVSTFLLNFRSFSSTIELIDALITRFDITDKSSKFERGLNNGQYSSRSSRLR
                     NRRRLVCRIFQVWMESYWDYQGDYGTLATIANFFNEGVSIHLPLEARNLLEIVAQVAD
                     RWMVSRKESLPFSSQIVQQPISIPSRSSMISIETSSSSKRSTIISVDENIMESYELTK
                     LPSAHTSSISIPLPPLNVGTSSLLSKRNLNDIERILKHYHSLTSRTILGSSSNELRDN
                     CDLENMIQKWSSLVNASGTFDKSSSLIHNDLNLVELNPLEVAKQLSLIESALFLAVRP
                     TELLNQNFIPKKKHLAASPDVERIVDFTNLLSNYIIESIVVPKISIKSRVKRLTTWLN
                     IALSALYFRNFNSLATIMTALQSHILSRLSTLWDNVSEKYLDLYHYLSKIVHPNKNYN
                     IYRTKLHKLATGFSPTENSFGKSQVATVPFFALFLQDLTFIHEGINDFRDPSSFRPNR
                     LINLDKYFRITKIISLMQFFQIGYDTDEKPNFLGSKRDSLFNFTGNTSVDTTRIKPVP
                     VLQEFIFCEFWRVNTLYGADADRGYKMSLALAPRSEL"
     gene            complement(<314283..>316646)
                     /locus_tag="KLTH0F03586g"
                     /db_xref="GeneID:8292559"
     mRNA            complement(<314283..>316646)
                     /locus_tag="KLTH0F03586g"
                     /product="KLTH0F03586p"
                     /transcript_id="XM_002554320.1"
                     /db_xref="GeneID:8292559"
     CDS             complement(314283..316646)
                     /locus_tag="KLTH0F03586g"
                     /note="highly similar to uniprot|P39533 Saccharomyces
                     cerevisiae YJL200C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F03586p"
                     /protein_id="XP_002554366.1"
                     /db_xref="GeneID:8292559"
                     /db_xref="GOA:C5DKC8"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:C5DKC8"
                     /translation="MLSARSVSRRHLATQVAANFANVPKEFQSRVPPYAKLIANLEKV
                     KAITNNSPLTLAEKILYSHLCDPEESIKSSDLRDIRGLEYLKLHPDRVAMQDASAQMA
                     LLQFMTTGLAQTAVPASIHCDHLIVGRDGESQDLSSSIATNKEVFDFLQSCADKYGIQ
                     FWGPGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPW
                     ELKAPKILGVKLTGSMQGWTSPKDVITKLAGILTVRGGTGYIVEYFGDGVKTLSCTGM
                     ATICNMGAEIGATTSTFPYQEAHSRYLKATGRSVMADAADVALNQYNFLKADSGAEYD
                     KVIEINLSELEPHVNGPFTPDLSTPISEFGAKCTKENWPQKISAGLIGSCTNSSYQDM
                     ARAADLVRQASQAGLKPRIPFFVTPGSEQIRATLEKDGLVKTFEDNGAIVLANACGPC
                     IGQWDRQDVMKTSKETNSIFTSFNRNFRARNDGNRNTMNFLTSPEMVTAMIYSGDAQF
                     NPMRDTIKLDDGSDFKFKAPSGDELPQTGFVSGRKEFYPPTDPTPDASVEIKVSPTSD
                     RLQLLEPFKPWDGKELKTNVLMKVEGKCTTDHISAAGVWLKYKGHLENISNNTLIGAQ
                     NKETGEVNKAYDFDGTAYGIPELMIKWKQEERPWTVVAEHNYGEGSAREHAALSPKFL
                     GGQILLVKSFARIHETNLKKQGMLPLTFANEEDYDRISSGDVLETVGLVEMIEKEGAN
                     GGLLDVKITKPSGESFVIKTKHTMSKDQVEFFKAGSAINYIGEVRRA"
     gene            complement(316816..316888)
                     /locus_tag="KLTH0F03608r"
                     /db_xref="GeneID:8292560"
     tRNA            complement(316816..316888)
                     /locus_tag="KLTH0F03608r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:8292560"
     gene            complement(<317294..>317590)
                     /locus_tag="KLTH0F03630g"
                     /db_xref="GeneID:8292561"
     mRNA            complement(<317294..>317590)
                     /locus_tag="KLTH0F03630g"
                     /product="KLTH0F03630p"
                     /transcript_id="XM_002554321.1"
                     /db_xref="GeneID:8292561"
     CDS             complement(317294..317590)
                     /locus_tag="KLTH0F03630g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F03630p"
                     /protein_id="XP_002554367.1"
                     /db_xref="GeneID:8292561"
                     /db_xref="UniProtKB/TrEMBL:C5DKC9"
                     /translation="MREISGSPRLSGPVGGRNWVLCEDDASPVWRTALELGAWAGMPA
                     SDVRLRHKNWGYAAPVQPRGWAEIVFEAIMVQTPPRVSFMVLCRIRISNLKIPY"
     gene            <318194..>320905
                     /locus_tag="KLTH0F03652g"
                     /db_xref="GeneID:8292562"
     mRNA            <318194..>320905
                     /locus_tag="KLTH0F03652g"
                     /product="KLTH0F03652p"
                     /transcript_id="XM_002554322.1"
                     /db_xref="GeneID:8292562"
     CDS             318194..320905
                     /locus_tag="KLTH0F03652g"
                     /note="similar to uniprot|P25360 Saccharomyces cerevisiae
                     YCR037C PHO87 Low-affinity inorganic phosphate (Pi)
                     transporter involved in activation of PHO pathway
                     expression is independent of Pi concentration and Pho4p
                     activity contains 12 membrane-spanning segments and
                     uniprot|P39535 Saccharomyces cerevisiae YJL198W PHO90"
                     /codon_start=1
                     /product="KLTH0F03652p"
                     /protein_id="XP_002554368.1"
                     /db_xref="GeneID:8292562"
                     /db_xref="GOA:C5DKD0"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:C5DKD0"
                     /translation="MKFSHSLKYNAVPDWQEHYLNYSQLKKLIYSLQAQDLQVVDEGG
                     RVDTERLNALEGSSKALKKLKGKFQLGRSGKNGKGRKAGEGDADAEGDVQVETFELSD
                     IKKKSAQNKLQALVDFDRRSSLSSDRTLFNPQDTFLSKLIDERSKIDDFYKKLEAQLY
                     GRFATVVSDLQKSGALVDTHSRPHGGDGDGGDHESFELRTQPEHQLRRRESLASKRTT
                     NDSLAPGRASQPEDDEEEDEEEEFDEHTHENTALLNYSDFNVKSQKKAIIKKNLIDLY
                     VDLVQLKSFIELNRIGFFKITKKFDKTLECNVRNELIESGEFFKDTYVFQPLTLEVLD
                     SKITKVIEFYAFITNADLALCKEELRSYLRDFIVWERNTVWKDMLGLESQNNTIASAG
                     RPNAKGDIGALESNTHLEYRTWNLPKPIKCRYFTWSCIKVPQLFFTLKALKLYIIIAC
                     TIILLAVPTFNDEAQHRCMALVACVAFLWASEALPLFVTALLVPLLVVLFRVMKSDGK
                     VMNAADASSTILAKMWSSTIMVLLAGFTLAAALSKYNIARVLASYLLTFAGTKPRNVL
                     LMIMGVCFFLSMWISNVAAPVLTYSLIQPVLKSLGYESPFAKAIVLGVALSANVGGMA
                     SPIASPQNIIAMDYLKDYNVGWGQFFAIALPSSFLAMLTIWLLLLCTFKINGTQLKKY
                     TPIKEKFTLKQYYIMVVTLATILLWCVLSKLENVFGSSGQIAVIPIVLFFGTGLLGTQ
                     DINNFPWAIVILAMGGIALGGAVSSSGLLTTIAGALQRRVMDFPLYAVMAIFGIVMLV
                     VGTFVSHTVSAIIIIPLMQEVGDKLPGAKSAPILVFACTLLSSCGMGLASSGFPNVTA
                     ISMTDEVGNRYLTVNNFITRGVPASFLAFICVITLGFGIMNSVLKGV"
     gene            <321662..>325258
                     /locus_tag="KLTH0F03674g"
                     /db_xref="GeneID:8292563"
     mRNA            <321662..>325258
                     /locus_tag="KLTH0F03674g"
                     /product="KLTH0F03674p"
                     /transcript_id="XM_002554323.1"
                     /db_xref="GeneID:8292563"
     CDS             321662..325258
                     /locus_tag="KLTH0F03674g"
                     /note="similar to uniprot|P39538 Saccharomyces cerevisiae
                     YJL197W UBP12 Ubiquitin-specific protease present in the
                     nucleus and cytoplasm that cleaves ubiquitin from
                     ubiquitinated proteins"
                     /codon_start=1
                     /product="KLTH0F03674p"
                     /protein_id="XP_002554369.1"
                     /db_xref="GeneID:8292563"
                     /db_xref="GOA:C5DKD1"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR006615"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DKD1"
                     /translation="MNDNLAPSNGMVADEGEKKLASVSKDDQLDIMESSSSNDQPDSV
                     KATPPGLPDQMADQSQMAEGGAKVDAIPSLVEQRQILSEIYTQAQAESREGDAVYVIP
                     SLWYNNFWDANITEKSRIGPIDTTSICNDFDNFLLADYNAHPYLSVPETVFKKLSEWY
                     GLSDPSNPVKTVLIKDEDGQLVTEYNRCCFRVHFLKDSVEKYNRFSGGVRAPLFFTMS
                     RLSSIEMVVQRCLQKFGEQEKLFDLKTHRFRIWQVQEPTSTTKSSFLATQYVLDPLTF
                     AEMPIKTRLQSKMFGCLIKNLKLPVIDLVVELKDVTTGDHWPSNHFYYNKLLPPRGTT
                     GLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIK
                     SLFDERSSSAFAFSPREFKSIIGQQNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEK
                     PFVEKPELSPDEDVNNREVIHRLASKTWDKHKLRNDSVILDLFVGLYKSTLTCPVCDK
                     TSVTFDPYSDLTLPLPVESIWTSKVRIFPNFSPPCILEVELPKGSTYQDLKNYVAEVA
                     NMNADDLIGAEIFNHAFYNNYESEGSSAKYLPIEDLISQSDVVAFYEVPRKPDDLVIP
                     VLNSVLEQGFKTARSFGFPFFIALSETELHCYGMIRKKLEQHYTNWSGGFLNFPIISN
                     DNEVPLDSLGLLKQKYHSVDLSKFKIDIENCSPETSVEEYFAIKVLSFRNTNNGLTEN
                     SMGNQIIWAPGHQVSLSSSQNMMTLMNNVMKDIYDYHTLAMTQKDEIEELATLSHPAD
                     DSKGHESNDEGTKKEETPSDMDVDLNENDSENFPKPDNEPEAEVDFQRPKFVKEFEAI
                     VCEWNDMSISEVFSDEREISWDKPAELKNEKLEEAKRQRQHEGERRISLFDCLKLFSK
                     PEVLSAADSWYCPTCREHRQATKQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFP
                     ICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGGLGGGHYTAFAKNPVDGKWYYFDDSRV
                     SETDPETSVSGAAYLLFYRRRVEGPDVGTQRLKNLLASSRQQHQLKLKEFNDRQVDFY
                     QENHSEPEEELDAQHNFLEASEAESKEGAQENEICNVASLEVGHANSSASCEENAGRR
                     KLRLLHKGYANSTANSSHPNSSATSSDSSDCSENISQKFYPAEGAPPTSPLL"
     gene            complement(<325326..>326318)
                     /locus_tag="KLTH0F03696g"
                     /db_xref="GeneID:8292564"
     mRNA            complement(<325326..>326318)
                     /locus_tag="KLTH0F03696g"
                     /product="KLTH0F03696p"
                     /transcript_id="XM_002554324.1"
                     /db_xref="GeneID:8292564"
     CDS             complement(325326..326318)
                     /locus_tag="KLTH0F03696g"
                     /note="similar to uniprot|P25332 Saccharomyces cerevisiae
                     YCR036W RBK1 Putative ribokinase"
                     /codon_start=1
                     /product="KLTH0F03696p"
                     /protein_id="XP_002554370.1"
                     /db_xref="GeneID:8292564"
                     /db_xref="GOA:C5DKD2"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DKD2"
                     /translation="MKVYVCGSLNYDLVTFTDRIPDAGETYRANKFETHAGGKGLNQT
                     IAVSKLLSADQGVKVSMIGHVGDDSFAGELIEILNRNGVDTRLVTALKGVNTGVATII
                     VEQRTGQNRILISEGANGHTKFDENHLEVMFPPESQGEGPFYVIFQNEIPGTISAMRW
                     LKQNRPESVIVYNPSPFKDVERGDWSLVDLLVVNEIEALQVLESGFGAAVMAEYKSKI
                     NVDFVAGYKEVAINLQSKLISGKSSSFVVITLGEKGCVFASEESQKAQFVEALRVENV
                     IDTTGAGDTFLGGVVSQLCTNHSLRDSVAFATKASSLSIQRSGAAESIPVHSEI"
     gene            <326533..>327672
                     /locus_tag="KLTH0F03718g"
                     /db_xref="GeneID:8292565"
     mRNA            <326533..>327672
                     /locus_tag="KLTH0F03718g"
                     /product="KLTH0F03718p"
                     /transcript_id="XM_002554325.1"
                     /db_xref="GeneID:8292565"
     CDS             326533..327672
                     /locus_tag="KLTH0F03718g"
                     /note="similar to uniprot|P25359 Saccharomyces cerevisiae
                     YCR035C RRP43 Ribosomal RNA Processing"
                     /codon_start=1
                     /product="KLTH0F03718p"
                     /protein_id="XP_002554371.1"
                     /db_xref="GeneID:8292565"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DKD3"
                     /translation="MTESLELRPITFHPDVLARIAPELSMQRHLSLGLRPSLRSFEEF
                     RNVEISDGGLSFASNADIDRKGNNILGSNVLKCGKTMVVTSITGGIVEENISGSRVDD
                     ESTESSNRADRLSRFAQVHPVVEVERGRVGAPTDEEMTLSQRLRDCVLHSGLIPKKAL
                     DVAVGIRSTDSEGISSILYPDEEENTISSGLKSRRKWSYVLYAKIQVFSRDGPLFEIC
                     WNSLIYALKTTQLPRAFVDERTADLKIPVSMRGRSATFRETFDIICDASKFQPLVLNE
                     ENVAFASNFAIIDVDPETELPKDEDEMQVDQGGSVLLADIQGEAEEASVFSTISIISS
                     DAGRLKHFKVIGGGLNASMEHLKKSLNLAKLRASDLSAKSSSGDR"
     gene            complement(<327788..>328816)
                     /locus_tag="KLTH0F03740g"
                     /db_xref="GeneID:8292566"
     mRNA            complement(<327788..>328816)
                     /locus_tag="KLTH0F03740g"
                     /product="KLTH0F03740p"
                     /transcript_id="XM_002554326.1"
                     /db_xref="GeneID:8292566"
     CDS             complement(327788..328816)
                     /locus_tag="KLTH0F03740g"
                     /note="similar to uniprot|P25358 Saccharomyces cerevisiae
                     YCR034W FEN1 Fatty acid elongase involved in sphingolipid
                     biosynthesis acts on fatty acids of up to 24 carbons in
                     length mutations have regulatory effects on 1 3-
                     beta-glucan synthase vacuolar ATPase and the secretory
                     pathway"
                     /codon_start=1
                     /product="KLTH0F03740p"
                     /protein_id="XP_002554372.1"
                     /db_xref="GeneID:8292566"
                     /db_xref="GOA:C5DKD4"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:C5DKD4"
                     /translation="MLSTAQTYANEMIQKYPVLEQFQPTLDRPFFNISLWENFDTAMR
                     YATNGKFIPSEFQFVPGKLPLSELPQVIAAITTYYVVIFGGRFLLQGSQPFQLNALFQ
                     LHNLFLTTLSLTLLVLMVEQLVPMIARNGLYYAICNIGAWTQPMVTLYYMNYITKYIE
                     FIDTVFLVLKHKNLRFLHTYHHGATALLCYTQLVGTTAISWVVISLNLGVHVVMYWYY
                     FLAARGIRVWWKEWVTRFQIMQFVLDIGFIYFAVYQKVSHLFFPQLPHCGDCVGSTTA
                     TFSGCAIISSYLFLFVAFYIEVYKRRGTKKSRIVKRVRGGVAAKVNEYVNVDVAHTST
                     PSPSPARK"
     gene            complement(<329069..>332716)
                     /locus_tag="KLTH0F03762g"
                     /db_xref="GeneID:8292567"
     mRNA            complement(<329069..>332716)
                     /locus_tag="KLTH0F03762g"
                     /product="KLTH0F03762p"
                     /transcript_id="XM_002554327.1"
                     /db_xref="GeneID:8292567"
     CDS             complement(329069..332716)
                     /locus_tag="KLTH0F03762g"
                     /note="some similarities with uniprot|P25357 Saccharomyces
                     cerevisiae YCR033W SNT1"
                     /codon_start=1
                     /product="KLTH0F03762p"
                     /protein_id="XP_002554373.1"
                     /db_xref="GeneID:8292567"
                     /db_xref="GOA:C5DKD5"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:C5DKD5"
                     /translation="MAPLNRVGEKKPYQYTNADPRHMPYSRTSGTLPAGSTARSAPSE
                     SAPPHSSGSVHRPSRYNPSSTSRPHTPFGTVHSKPRTGSRYNPEPGFVQSGSRGSSET
                     RRFPNSPNAPSSSRYSFQAAAPIPKASHHSYYNPQYSRRRPSSATDGYDPASHGYTAR
                     SKWKEPYGSASGAAYDGRMSPSNTSPVPPLSKPPYYNRYHGTTVHQNIHAQPYSSRYG
                     HYRKEHSSQDSSYTTSNKFPLYENEHSLGSSLINSVPQTSRKTEERVSNNHERIDLQK
                     TVNDDSVKREEPSSLNTTPSDTKSGQTDNADENNAESAPKEEEAVYNKPGKHDIIRKA
                     HSIEDFNEAHPSQPTSSSDDQGAAGSTDTYFAAKPVEKPSHLPSRHSSEAAQGYTQPL
                     NEVESCIFPLPEAETKLWELKNRDRESIVKNQKYLLKSPVTCLQEYPFMSQNILVHEQ
                     AVRPILVKSLSKLQDYERLRKLQLKWQFLKLDEKWTKNCQMLEAVSEEVKKVDHATTD
                     STEEESQFSKSKEKEEREQQSRASSRRRNRADFVDDNEIENVLLRIDPDYKHHQLAAK
                     IPPMIIDPVKKFAVKYKDVNNLVTDKNKWATRVLRDGIDTFTSAEHDLFVEGYLAYPK
                     RFGKISQFMGGLRKPQECVLHYYKTKKETNYKQLLVEKNKRRKINAGRRRREKDKEKT
                     SAAVPEQSGQEAEEMSERNDSNFTEKERTMDETEDEEVDQGAQIKEAAFGPAEKVEDT
                     SIVSTGSNVALPDGPRGLVQQQQEEVSAQDLSMENEEDTESKKRKIQEIEEVTNDLPN
                     LQPIAPAFASEDKDATDIDESRRPFKADDNEKVQARKKTKHSDGYHKSSYWSVKETNL
                     FPELLREYGTQWALISERLGTKSTTMVRNYFQRNADQMGWQALVESSNSESPENKLNT
                     QFGNSDATPGAYDTVPMQQAPTVSIFSQIHRDAATPMQLPIASVSAMDSFSQQSTPQG
                     LPPPRLPSIQLGLSTDQAERKPLLLSDSHSSNSAHAPEAMPSVHFAPSVAINNSSCPS
                     PATSSQAGISSRRSSIKNLLNNDDHTDSNSAWSKQRAVELPPIAFPEVNATAPVVVQE
                     LRSSNFTSDTAAPSPSSNLPPKQPSFLNSILNAASAPASQSPHVPTGTAPRTRYSVSS
                     ATRPILPPVGLSTATAPTPARPREFNFANDPLAALAAVASAPEALVSLIPQDGGASNS
                     STQQKPSNTGP"
     gene            <335081..>336580
                     /locus_tag="KLTH0F03784g"
                     /db_xref="GeneID:8292568"
     mRNA            <335081..>336580
                     /locus_tag="KLTH0F03784g"
                     /product="KLTH0F03784p"
                     /transcript_id="XM_002554328.1"
                     /db_xref="GeneID:8292568"
     CDS             335081..336580
                     /locus_tag="KLTH0F03784g"
                     /note="similar to uniprot|P09119 Saccharomyces cerevisiae
                     YJL194W CDC6 Essential ATP-binding protein required for
                     DNA replication component of the pre- replicative complex
                     (pre-RC) which requires ORC to associate with chromatin
                     and is in turn required for Mcm2- 7p DNA association
                     homologous to S. pombe Cdc18p"
                     /codon_start=1
                     /product="KLTH0F03784p"
                     /protein_id="XP_002554374.1"
                     /db_xref="GeneID:8292568"
                     /db_xref="GOA:C5DKD6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015163"
                     /db_xref="InterPro:IPR016314"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKD6"
                     /translation="MQTQMLESVVLGSRKRLAFEVCEDPVTVKRFQGLVTPPGSPVKK
                     CKTKEVSTLGSPIRLHFGASSVYSRTKAALQRCADVSQQGTVNLGACLPTRGEQYDRI
                     MAFLNSVVGSGHGDSLYITGPPGTGKTAQLDLVVREKFQTLVLEAPQLQQDYALRNTS
                     FFTTKSGHHESVAIVSINCIAVNSAESIFAKIYHSCSGDSARTKVRNADDLQKFMQAH
                     PQTTFIVILDEMDKLVTSTLQDANATKHIFDLFLMAKLPHLKFVLIGIANSLDMKDRF
                     LSRLNLKHELMPQTVTFTPYTAEQMFEIVMQKLKSLDFDPIIQPIAIRFAAKKCSGNT
                     GDLRKVFDILRSSIEVLELDSIKNRHTLNETTAKVTLAHVAKVFSTLHNNFSTKSRIS
                     KLNMQQRLVLCSLVHRERSDVFQTQTSLDEAYDYYSKLLNRKDSISPLKRDEFFEICN
                     ALETCGVVNIVQGKSSGKTKHIVKFIKANVDKKEFEDEISKLASLKTYL"
     gene            complement(<336740..>343105)
                     /locus_tag="KLTH0F03806g"
                     /db_xref="GeneID:8292569"
     mRNA            complement(<336740..>343105)
                     /locus_tag="KLTH0F03806g"
                     /product="KLTH0F03806p"
                     /transcript_id="XM_002554329.1"
                     /db_xref="GeneID:8292569"
     CDS             complement(336740..343105)
                     /locus_tag="KLTH0F03806g"
                     /note="similar to uniprot|P25356 Saccharomyces cerevisiae
                     YCR032W BPH1"
                     /codon_start=1
                     /product="KLTH0F03806p"
                     /protein_id="XP_002554375.1"
                     /db_xref="GeneID:8292569"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR023362"
                     /db_xref="UniProtKB/TrEMBL:C5DKD7"
                     /translation="MSSRADVLASLLSEVLFLNTVDDSLDGDVDEAPLSETMKSILQG
                     IGSAGAETKSTAVSEYVYDQLSTQFVNVGEAEDNFNIESEGKWDEIFSIDFQEAELEF
                     AVTVYILLNLSYVSLINKQKMGRLSTLKPAITRILEKDPPEHIALPVSELYAQILSTN
                     CNAFDLEKAYRDARRNPKTFLKILNTLGNELSEPQSQSYLYFENIYRQFEIKPARPRI
                     CIQLWVSFNNVTSNRILSINDNLFIEIKQSVLCVSNHEFILAMFEGFEFASDVHYGIT
                     LNVSTDVLSLFVDGDMVEKIALPLALEENIRALELGSMISSFKVYKFWLWSEQLYETS
                     IKLTDRFSIRQIDKTEFQADEKALFPGLDEYVTHEVLSLVELPGLTAGLFKQHIKQLN
                     SGTLIAYINPHETIQSLKSPTNAEFSINLCGAEGESIVKCLYYKTSSLVACFQTVEFA
                     SIVLEMIHSCSDLKNLYGVIEHFIILMRCSSLEKMFIRSFGYDFLGLLLVKDVLPRLH
                     STLSIPFLTLFFEFCGWNTVDPTASIMKNTSAYANLILNFELWISVDRVADEEPAVEM
                     VRFLIFQLGEMLQNSKFATFNARQCKKLKVLESLTCHQHLVYTKSPDQNFLDCLHKEL
                     VGIFRALIKPLSQVEISGLFQFAYYEVKKDLERSAAVIMNSIMLVLADWIEAGDSSAV
                     EMFFNAIPIKIVLLIIECGGSISVVAPSLSIIITFLQANANSYKRFVRSNGFRILFDI
                     LKDQSLEDYEELVAATLTGVLTGSHQFRSGPLSNLSWKDITVIEGAVASDVHCLILDL
                     IEWAVLNDVKARSPAYIEEMVTSYSILLTELQQNCPETVLFDPQQSPFMGKVVEVILT
                     LDKPQNAGTYAAASQQMMSLLSDVLFFRLLHSPPLEFSNLTLCLIKGKKIKEADDYVE
                     QFYWQSPFVHTLTRLESFIPAFDALFQQSKNIIPNLTCLLEQLTGSPAFYQLGIDNYV
                     RLHKIILSCYESTLKETSHNQDNSIKNALELCEIKTLFALFSYHDSEKPSASSEEITA
                     FVEATLFHQSVLLGTEHTRPLLDVEKSAFLLASLASLLDASNSFQAQSNVMNCVRIIT
                     LHRLEDITAMAHLIDRGNKNLVQRVLSSSISTSDENLLDKLTSWEVRSCFKSYAASQL
                     KKYHKRDTQTVISSDGLKRSEDFSSIFKRREFALEKRLHEISLIRGMFQRDGNNTRNK
                     IVISEDKKLLNFVNDREDELLLFYQHFSQLKNSVRSLSRVRGNEITEVEWTLDSMEDS
                     NRMRKRLIPKPILVKTPSLTSSEAQTDKNSTHVESDVARYERRDSSAISFEVINELEA
                     ISIDSLETHVKNRKVLKILEQGDTIMRIWNCSNVIGLRVHEGVLIMGNEYLYFMGGYF
                     YSFKDCNVVELQDAPTEARDPAVELITKGNNNDFCDFPTHEVQRWKLSHISFVSKRPF
                     LLRDSAIELSFENGTNCFFTFQNKNWRDDAYRPLEKCERPSTMDTLLSDALLEVSAKS
                     HDINVRNGLSQHTLSRKVVSVFSNTKASLSFEALKKWQNGQISNFYYLIIVNTLAGRT
                     FNDITQYPVFPWVIADYRSDELDLTNPSTFRDLSKPMGAQSEDRLNQFVERYNALSSF
                     ADQDPPFHYGTHYSSAMIVSSYLMRLAPFVDSYLLLQGGKFGHADRLFNSVERAWCSA
                     SRENTTDVRELTPEFFYLPDFLRNLNNYDLGTLQSGQKVGDVSLPPWAKGDPKLFVEK
                     NREALESPYVSEHLHQWIDLIFGYKQKGEEAVRAANVFNRLSYPGSVNLNEIDDENER
                     MAVTGIIHNFGQTPLQIFQNPHPKKCSHELPNVSKNQWNVLTLSQATSVQPGHDVHIT
                     RIQKDDKITGKIVYKGRPFWQRALSDEPCSFVDACGLLSFTVNGRAYRHGHHCSVTYV
                     ESFKDDQFFTSDECGLMKHWQYKQSRGKEGLAEISQYTGHLSPIKKIVVSSEYNLLLS
                     LDVSGKLFSWDVLSSQLLRCIAANAKDIAVSNRTGSVAFADSDNVITVCDINGSAYAK
                     LPFEVLVTSVGFLEAEPTDNHLFSKAKDLLGVGTCRGNIEIVELQQGGPWKIKKIGEL
                     VSKTDSPITCVQMSVESTKGESHSEADSHAKYQVLAGNEEGVVFVWN"
     gene            complement(<343452..>344264)
                     /locus_tag="KLTH0F03828g"
                     /db_xref="GeneID:8292570"
     mRNA            complement(<343452..>344264)
                     /locus_tag="KLTH0F03828g"
                     /product="KLTH0F03828p"
                     /transcript_id="XM_002554330.1"
                     /db_xref="GeneID:8292570"
     CDS             complement(343452..344264)
                     /locus_tag="KLTH0F03828g"
                     /note="similar to uniprot|P39543 Saccharomyces cerevisiae
                     YJL192C SOP4 suppressor of pma1-7"
                     /codon_start=1
                     /product="KLTH0F03828p"
                     /protein_id="XP_002554376.1"
                     /db_xref="GeneID:8292570"
                     /db_xref="UniProtKB/TrEMBL:C5DKD8"
                     /translation="MTFYELSLVRGTKRVQAGTRRLFWTRRFDMLLLLFCLISGLCSS
                     TLAATVSGRLDVSPLNITRKEVAHSSFKLLQVGNFTGPAYYSQTTVRDVHGNFKFEGV
                     PEPKDANSSTYFVLQPSSLDYNLKPGRILVQLVRDPEDPQKIVTKAFKNSFGRENFPS
                     PEILYPEKLAEVAADPCITFSLVNAAPFREYITERNAGILKSGPVASILNSKFKMAAV
                     ITAVLMLLFPYLLEKFDSETAQAIKDDRLEKQKRKYADQKRVGEQAQRLEKK"
     gene            <344707..>345742
                     /locus_tag="KLTH0F03850g"
                     /db_xref="GeneID:8292571"
     mRNA            join(<344707..344713,345336..>345742)
                     /locus_tag="KLTH0F03850g"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_002554331.1"
                     /db_xref="GeneID:8292571"
     CDS             join(344707..344713,345336..345742)
                     /locus_tag="KLTH0F03850g"
                     /note="highly similar to uniprot|P06367 Saccharomyces
                     cerevisiae YCR031C RPS14A ribosomal protein 59 (rp59) of
                     the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_002554377.1"
                     /db_xref="GeneID:8292571"
                     /db_xref="GOA:C5DKD9"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:C5DKD9"
                     /translation="MIHLVQARDNSQVFGVARIYASFNDTFVHVTDLSGRETISRVTG
                     GMKVKADRDESSPYAAMLAAQDVAAKCKEVGITALHVKIRATGGTKTKTPGPGGQAAL
                     RALARSGMRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            complement(<346042..>346434)
                     /locus_tag="KLTH0F03872g"
                     /db_xref="GeneID:8292572"
     mRNA            complement(<346042..>346434)
                     /locus_tag="KLTH0F03872g"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_002554332.1"
                     /db_xref="GeneID:8292572"
     CDS             complement(346042..346434)
                     /locus_tag="KLTH0F03872g"
                     /note="highly similar to uniprot|Q3E7Y3 Saccharomyces
                     cerevisiae YLR367W RPS22B and highly simila to
                     uniprot|P0C0W1 Saccharomyces cerevisiae YJL190C RPS22A
                     Proteins component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_002554378.1"
                     /db_xref="GeneID:8292572"
                     /db_xref="GOA:C5DFA2"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:C5DFA2"
                     /translation="MARASVLADALNSINNAEKTGKRQVLIRPSSKVIIKYLQVMQKH
                     GYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKFNDIEKWTENLLPARQFGYI
                     ILTTSAGIMDHEEARRKHVAGKILGFVY"
     gene            complement(347811..347922)
                     /gene="SNR65"
                     /locus_tag="KLTH0F03894r"
                     /db_xref="GeneID:8292573"
     ncRNA           complement(347811..347922)
                     /ncRNA_class="snoRNA"
                     /gene="SNR65"
                     /locus_tag="KLTH0F03894r"
                     /product="snR65"
                     /note="C/D snoRNA monocistronic SNR65"
                     /transcript_id="XR_002432200.1"
                     /db_xref="GeneID:8292573"
     gene            complement(<348177..>350282)
                     /locus_tag="KLTH0F03916g"
                     /db_xref="GeneID:8293300"
     mRNA            complement(<348177..>350282)
                     /locus_tag="KLTH0F03916g"
                     /product="KLTH0F03916p"
                     /transcript_id="XM_002554333.1"
                     /db_xref="GeneID:8293300"
     CDS             complement(348177..350282)
                     /locus_tag="KLTH0F03916g"
                     /note="some similarities with uniprot|P32944 Saccharomyces
                     cerevisiae YJL187C SWE1 Protein kinase that regulates the
                     G2/M transition by inhibition of Cdc28p kinase activity
                     localizes to the nucleus and to the daughter side of the
                     mother-bud neck homolog of S. pombe Wee1p potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0F03916p"
                     /protein_id="XP_002554379.1"
                     /db_xref="GeneID:8293300"
                     /db_xref="GOA:C5DKE1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKE1"
                     /translation="MSRSSNSYNSGAPGGSPVSPARLERLERFERLERRPEMLDSSDG
                     GPNNLRFVGSQPPVRPATRPSPGLTRSARTLNLMQIPAINDYMDSWSPFEEQPERPAT
                     LKRSASKSELSPFVNDPAILRKWRYKQPPDPALRAADVAANATAEAAAAKHRKTLDQQ
                     AFSGAVPDQTAFASSGLVSKTKSHLMPQKITTPDTPVKKSPLAKNTSVSSIMDSPVHS
                     HTSITVPFGSSQASPLGSASSRFESSNISSSFLPSAKTKRAHASKMFSNTVLTSTLQQ
                     FTDDLYGNDDDDSFLSDCVPSTAPTITFSADPSSPSRTPTKAPFAIKQPSPFMTSRPR
                     RSINAKISRPTSPSVKQFQTSPDSHLSTKFLNVGSIGSGQFSTVYQVTFQPTNTKYAV
                     KSMRPDKFNTTARILQEIEILSTISESKLDEEGKEYVLDFISSWKYQGYFYVMTEYCE
                     NGDLDTFLKKQIINKNSRLEDWRIWKIIVELSLALRFVHDSCQIAHLDLKPANVLITF
                     EGSLKLADFGMAAKLPVGQTELENEGDREYIAPEIISDCIYDFRADIFSLGLMIVEIA
                     ANVVLPSNGNAWHKLRSGDLSDAGKLSSTEIHSDSLFSTGNTNTELTNLESCEEVNKL
                     DFLVDHSSRIPAWVPKFLIDGVSLERMVRRMIDPNYKNRPTAEEILHSEECEYVEMTR
                     KAGAIIQEDDFGPKPDFST"
     gene            <351536..>353224
                     /locus_tag="KLTH0F03938g"
                     /db_xref="GeneID:8292574"
     mRNA            <351536..>353224
                     /locus_tag="KLTH0F03938g"
                     /product="KLTH0F03938p"
                     /transcript_id="XM_002554334.1"
                     /db_xref="GeneID:8292574"
     CDS             351536..353224
                     /locus_tag="KLTH0F03938g"
                     /note="similar to uniprot|P46982 Saccharomyces cerevisiae
                     YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible for
                     addition of the second alpha-1 2-linked mannose of the
                     branches on the mannan backbone of oligosaccharides
                     localizes to an early Golgi compartment"
                     /codon_start=1
                     /product="KLTH0F03938p"
                     /protein_id="XP_002554380.1"
                     /db_xref="GeneID:8292574"
                     /db_xref="GOA:C5DKE2"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DKE2"
                     /translation="MHIWRRKVVLCCCVLLALAYALFAATARKSLDTPSLRERVYSDV
                     FDALLQYRPVRPPKDRQAAVRQAGCEMKGVGVNRGDAVDAMLYENLDRCYRPTKAQFE
                     GLQAPHSAFLTQLRTTFAYEADSPVFERLFPRERGFVTVGGGRFSLLAYSMLRALRAR
                     GSKLPAEVVIPPQDAAGEEHFCNEVLPELNARCVFFEDALPRALVETWDFERYQIKAV
                     ALLLSSFKKIVFIDADDFPIQNLDSLFDSEVLREHGLVLWPDLWRRATAPVFYRLANI
                     DVDLRRRVRNMGDNLSPASRYTDPDQDPEQLQKIAPFHDFAGTVPDPTTESGQMVIDK
                     VRHFQTLLLALYYNVYGPEWYYSLFSQGTAGEGDKETFATAAHVLGLPFYQVKNKLAF
                     DGYFHPNGDGFRGVALYQHDCVEDYLLYCRARDIIKENQDSFSAYKPDYDPEPDFYKS
                     LMAPEGHPEIPVMFAHASFHKFDPWQLYHEKVYLDNDGAHFRSFHNIKRIGNFDIELF
                     VFEGLQKAICSDNPIRFKYLEDKFIHADWPKVCQYVEDRVKYLQDTHDPAVGLV"
     repeat_region   354554..354970
                     /rpt_type=long_terminal_repeat
     gene            <355886..>356347
                     /locus_tag="KLTH0F03982g"
                     /db_xref="GeneID:8292576"
     mRNA            <355886..>356347
                     /locus_tag="KLTH0F03982g"
                     /product="KLTH0F03982p"
                     /transcript_id="XM_002554335.1"
                     /db_xref="GeneID:8292576"
     CDS             355886..356347
                     /locus_tag="KLTH0F03982g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F03982p"
                     /protein_id="XP_002554381.1"
                     /db_xref="GeneID:8292576"
                     /db_xref="UniProtKB/TrEMBL:C5DKE3"
                     /translation="MRAGSLNLSAVISFMDTIGIAEASSSGDVDVVTRLLQTPISDLE
                     SAERELVTDGFTFANKDATVQDVLVLFQTDTPVNVEKGLVFFNLQGDVIGKTYLDTSQ
                     FPSNFITPFEEAQAQAIHMDGDDAYPDVNQKLLFEHGTALLKAIRQHTGLS"
     gene            <357095..>357349
                     /locus_tag="KLTH0F04004g"
                     /db_xref="GeneID:8292577"
     mRNA            <357095..>357349
                     /locus_tag="KLTH0F04004g"
                     /product="KLTH0F04004p"
                     /transcript_id="XM_002554336.1"
                     /db_xref="GeneID:8292577"
     CDS             357095..357349
                     /locus_tag="KLTH0F04004g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F04004p"
                     /protein_id="XP_002554382.1"
                     /db_xref="GeneID:8292577"
                     /db_xref="UniProtKB/TrEMBL:C5DKE4"
                     /translation="MLYKVSIDQHTLDYAGNETIDDTDLWLNRLDRHGVATRLWVAQD
                     MLDIESAEVVAGSKGTNFFSWISRRYTVVGSRITNAMCVL"
     gene            <357616..>358641
                     /locus_tag="KLTH0F04026g"
                     /db_xref="GeneID:8292578"
     mRNA            <357616..>358641
                     /locus_tag="KLTH0F04026g"
                     /product="KLTH0F04026p"
                     /transcript_id="XM_002554337.1"
                     /db_xref="GeneID:8292578"
     CDS             357616..358641
                     /locus_tag="KLTH0F04026g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|Q12068 Saccharomyces
                     cerevisiae YOL151W GRE2 NADPH-dependent methylglyoxal
                     reductase"
                     /codon_start=1
                     /product="KLTH0F04026p"
                     /protein_id="XP_002554383.1"
                     /db_xref="GeneID:8292578"
                     /db_xref="GOA:C5DKE5"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DKE5"
                     /translation="MPVLVTGCTGFIAQYIVRDLLEQNYEVIGTVRSKEKGDTIERLF
                     NNDPSLTLEVVEDIAAPDAFDNVFEKYGSKIKVILHTASPFHFNATDYENEMLKPALH
                     GTRSVLESIKKYGSKTVERVVVTSSIAAIKDMEKVANADFVYTEESWNPITWEESKLN
                     SQNAYRGSKKFAEKAAWDFWEENKNIVKFELTTVNPSMIFGPQLFDENAKGVLNTSAE
                     VINSFLKSGPDADISALKNDFVDVRDVSKAHLLAFQKTDTVGKRLGLSSGQFNGQDLA
                     RILNERFPQLQGTIPQVSGDGANKTEPYAKFDNSNTKEILGFPFRGLEETLSDTVAQI
                     LKAQGGV"
     gene            <359492..>361243
                     /locus_tag="KLTH0F04048g"
                     /db_xref="GeneID:8292579"
     mRNA            <359492..>361243
                     /locus_tag="KLTH0F04048g"
                     /product="KLTH0F04048p"
                     /transcript_id="XM_002554338.1"
                     /db_xref="GeneID:8292579"
     CDS             359492..361243
                     /locus_tag="KLTH0F04048g"
                     /note="weakly similar to uniprot|P15380 Saccharomyces
                     cerevisiae YOR348C PUT4 proline-specific permease (also
                     capable of transporting alanine and glycine) putative
                     proline-specific permease"
                     /codon_start=1
                     /product="KLTH0F04048p"
                     /protein_id="XP_002554384.1"
                     /db_xref="GeneID:8292579"
                     /db_xref="GOA:C5DKE6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DKE6"
                     /translation="MVKTPQMQELPLSPYASKVAIDNSHSRPNYGHSADSWNNEKSAY
                     QVDQIIDVEDASMELIEGQEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGP
                     APLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFY
                     AMSMIAPSEITATAILIQYWTDANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIK
                     LFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHLVPGNTGKFLACWTAIIK
                     SGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSR
                     LLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHS
                     MAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGF
                     VDWMLVCVVYLRFRKVIEHANLTDKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVA
                     DNWNVSDFFACYTTLGLAAVLYIGAAIYYKTIKLRDLDEVAAEIIPKIAMADEEEKGE
                     VPIVPKNWLEKVWYFLV"
     gene            <363875..>365299
                     /locus_tag="KLTH0F04070g"
                     /db_xref="GeneID:8292580"
     mRNA            <363875..>365299
                     /locus_tag="KLTH0F04070g"
                     /product="KLTH0F04070p"
                     /transcript_id="XM_002554339.1"
                     /db_xref="GeneID:8292580"
     CDS             363875..365299
                     /locus_tag="KLTH0F04070g"
                     /note="weakly similar to uniprot|P18544 Saccharomyces
                     cerevisiae YOL140W ARG8 Acetylornithine aminotransferase
                     catalyzes the fourth step in the biosynthesis of the
                     arginine precursor ornithine"
                     /codon_start=1
                     /product="KLTH0F04070p"
                     /protein_id="XP_002554385.1"
                     /db_xref="GeneID:8292580"
                     /db_xref="GOA:C5DKE7"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DKE7"
                     /translation="MTVSSAKSISKPSYNFQGTVDQTGPQVVGGKGVRIDVEKEGKVH
                     ENVLDAITGAAVGALGWGDEDALDIINKAARTSTYSYPCLISNKPSEALAKYYIDHSP
                     EGAFSAALWCTSGSESNENALRIIRQYWLERGLPNKIKLMSRESSYHGFTLGAQSISW
                     NPRVEPYAPYLMDREKINIQIPAAYTYRFKKDDETEEDYAKRLVDATEKKILENDPNT
                     IAALTVETLPGSSLGTTPPPKGYLKGLRDLCNKYDIIFHLDEVMCGTGRSNPNGNFNC
                     WENYLAPTDAPDIQTVGKTLGSGYVTIAGILIGPKIRSAYVEGSKSIHGGNTYSSHAF
                     NCAVSLGIMQKLKNEKLTANIFKMGNLMGEKLSQILLSEDNIAGDVRGIGGFWSVEFV
                     KDRATKEPFDLSLNIAGRFKAICFENNLNVMGMPGNPDGSCGDRCLLAPSFIITEKDV
                     DEIVEIMAKSVLQLSSDLRKEGAW"
     gene            <366691..>369255
                     /locus_tag="KLTH0F04092g"
                     /db_xref="GeneID:8292581"
     mRNA            <366691..>369255
                     /locus_tag="KLTH0F04092g"
                     /product="KLTH0F04092p"
                     /transcript_id="XM_002554340.1"
                     /db_xref="GeneID:8292581"
     CDS             366691..369255
                     /locus_tag="KLTH0F04092g"
                     /note="similar to uniprot|P25623 Saccharomyces cerevisiae
                     YCR030C SYP1 Protein with a potential role in actin
                     cytoskeletal organization overexpression suppresses a pfy1
                     (profilin) null mutation"
                     /codon_start=1
                     /product="KLTH0F04092p"
                     /protein_id="XP_002554386.1"
                     /db_xref="GeneID:8292581"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DKE8"
                     /translation="MEGERTKYANSILVSKGPLEATEIIRLRLSQAKLINKNFYLLFR
                     ELSEMKRNYAQQLRKVIAENEHLEKMLARDMLENRVLTAEELRNFQFDSLGPLKQMWA
                     GVFDALKLELQTSTDLYHTLDRDVIANLKDFTEKDPRWNQSRHLHSSLSKIAVDIERS
                     GRESGASEKKNLQEASSQWDSQAADLFELFESTDYHRLLCLKNCLLTYQSGLGDYLAQ
                     NTQKSEEVMAQILGFDPEREIDRFARDASSYNFRFKAPAFPVDEAPSSASHKKEPRSA
                     KNGHNALGGIANRLSSSGTVVKHDLMKSEFSDSSNNSSLKQKKSSNKLKSKMGSIFGR
                     NKLKSKKSDRLQDNVIAESETSSVRTDDSGTRTRGSSTPAPSPLKDTVNKSGLTSESR
                     NGSSAERPPRLTSAATASTLSIHQPPLKPQQREKPPPAEATPVGPAASTDALTANDAA
                     KTVPPLHVQAPHGAQIPVQAPAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAPAPP
                     PSRKTGPALQSTAPREPHGSVPAPATVNRRDVQSKLFTDLSQADIDAQQNRRLSSLSS
                     QMTGELKALNPQSTGSSLTHSVSIGQSIFHHSELTSFGLNASVAEVINATYKDGVLAS
                     SQLIGEVALNYLADDQELPIDINLKMNNFNSFEKVIVNQAFIEQVQPEIYKINPRFIQ
                     SRTLGAFKYSLADPVAPLVIHPALRFEDHQASVVLTLKIAPNVDSFVQELTLDDLIVF
                     VSIEGASATSALSKPQGSFSKEKKRITWRFSEPVTIKKGGEERLIARFMTDGRAHESS
                     KGVGAKFTIKSYQFGSALDMESQEVDADDPFAANAGWKPVTTKRTLVAGNYMGLSQ"
     gene            complement(<369389..>370267)
                     /locus_tag="KLTH0F04114g"
                     /db_xref="GeneID:8292582"
     mRNA            complement(<369389..>370267)
                     /locus_tag="KLTH0F04114g"
                     /product="KLTH0F04114p"
                     /transcript_id="XM_002554341.1"
                     /db_xref="GeneID:8292582"
     CDS             complement(369389..370267)
                     /locus_tag="KLTH0F04114g"
                     /note="weakly similar to uniprot|P46983 Saccharomyces
                     cerevisiae YJL185C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F04114p"
                     /protein_id="XP_002554387.1"
                     /db_xref="GeneID:8292582"
                     /db_xref="UniProtKB/TrEMBL:C5DKE9"
                     /translation="MAFNSYHRRGSRSAAHATLANQNFDEVEELLSRNVNALDIHILN
                     APLQHEQDAVSEDSRLFTNEVKSEEFAILSTSSERDANRELELVGDLLGAAAFEKPEL
                     EGAAELAVSKSQRIDDWCLQNGLRNQTFQAPANRKIQDIIEAWGVVDDSPPTRMLRPF
                     RQSEPSHKHPENYTAHLLDLMSPPQRLRLRKFVEQMMPLLKRQLTTRFQAYRFKSVPS
                     AFINRDLQLHCSLQGELLLEPQSANDLVGSMNSDHNESSRCSSPSSISKASENVRSWH
                     SWNMVSRSDADHIPSY"
     gene            <370788..>371225
                     /locus_tag="KLTH0F04136g"
                     /db_xref="GeneID:8292583"
     mRNA            join(<370788..371026,371090..>371225)
                     /locus_tag="KLTH0F04136g"
                     /product="KLTH0F04136p"
                     /transcript_id="XM_002554342.1"
                     /db_xref="GeneID:8292583"
     CDS             join(370788..371026,371090..371225)
                     /locus_tag="KLTH0F04136g"
                     /note="similar to uniprot|P32445 Saccharomyces cerevisiae
                     YCR028C-A RIM1 Single-stranded DNA-binding protein that is
                     essential for mitochondrial genome maintenance
                     Single-stranded zinc finger DNA-binding protein"
                     /codon_start=1
                     /product="KLTH0F04136p"
                     /protein_id="XP_002554388.1"
                     /db_xref="GeneID:8292583"
                     /db_xref="GOA:C5DKF0"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR011344"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DKF0"
                     /translation="MLRQQVRSLHATARRYNFSKMTIVGRIGSDFTEYTSANNNKYLK
                     YSVASQPRRDGPTNWYNVTVFNEPQINFLTHYVRKGALVYVEADAANYSFEREDGSKG
                     TTLSLVQSMFKRASKDAAQSVP"
     gene            <371760..>372158
                     /locus_tag="KLTH0F04158g"
                     /db_xref="GeneID:8292584"
     mRNA            <371760..>372158
                     /locus_tag="KLTH0F04158g"
                     /product="KLTH0F04158p"
                     /transcript_id="XM_002554343.1"
                     /db_xref="GeneID:8292584"
     CDS             371760..372158
                     /locus_tag="KLTH0F04158g"
                     /note="similar to uniprot|P46984 Saccharomyces cerevisiae
                     YJL184W GON7 Protein of unknown function proposed to be
                     involved in the transfer of mannosylphosphate groups onto
                     N-linked oligosaccharides also proposed to be involved in
                     responding to osmotic stress"
                     /codon_start=1
                     /product="KLTH0F04158p"
                     /protein_id="XP_002554389.1"
                     /db_xref="GeneID:8292584"
                     /db_xref="InterPro:IPR014849"
                     /db_xref="UniProtKB/TrEMBL:C5DKF1"
                     /translation="MPSPFAIYKSPNSEPREFRVDPARDRYNTTNGTTTGPSAYVLQA
                     GQVDRDKPSEPKCNEQGEFTELSILRMALTGLQDDINEYLTQQMEVAKNKKLKQDDEQ
                     RISGEINKLLDGGDDDDDDDDDQGSSSKKA"
     gene            <372429..>373916
                     /locus_tag="KLTH0F04180g"
                     /db_xref="GeneID:8292585"
     mRNA            <372429..>373916
                     /locus_tag="KLTH0F04180g"
                     /product="KLTH0F04180p"
                     /transcript_id="XM_002554344.1"
                     /db_xref="GeneID:8292585"
     CDS             372429..373916
                     /locus_tag="KLTH0F04180g"
                     /note="similar to uniprot|P25621 Saccharomyces cerevisiae
                     YCR028C FEN2 Plasma membrane H -pantothenate symporter
                     confers sensitivity to the antifungal agent fenpropimorph"
                     /codon_start=1
                     /product="KLTH0F04180p"
                     /protein_id="XP_002554390.1"
                     /db_xref="GeneID:8292585"
                     /db_xref="GOA:C5DKF2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DKF2"
                     /translation="MKQSLQDGHEDQEELSSRHSMAPVNERRLLFKIDVFVLSFVCLQ
                     YWINYVDRVGFANAYVSGMKGDLELEGDQFNLINTCFTVGYILGMIPNNLILLMVQPR
                     IWLSFCTLAWGVLTLSMYKVTSFQQCCAIRFFQAVFESCTFSGTHLILGSWYKEKELT
                     IRTAIFTSSGLIGSIFSGFMQVAIHKSLDGRRGLSGWRWLFIIDFLITIPVAIYGFVF
                     FPTTPDHMNRTRRGLRLFSEEELQFARRRLPARNESTRLDWSVFKRVLGRWHWWLFSF
                     VWILGGENISLASNSTFALWLQAQNYSLSQKNHYPMGIFAVGVVATCGAAVYLDKVRR
                     SKHWHVAVFIGVIMCVVAVMIRARPTHPAVLFTAQYIGGVCYAGQAVFFAWANIVCRD
                     DLQERAVVLASMNMFSGAVNAWWSLVFYAATMAPRYERGCYALIATSIASGLVSVLIR
                     WLQVRETKQKLDHISENLNYAGANAVPEVIEPDSIELKELEEERV"
     gene            <374123..>375367
                     /locus_tag="KLTH0F04202g"
                     /db_xref="GeneID:8292586"
     mRNA            <374123..>375367
                     /locus_tag="KLTH0F04202g"
                     /product="KLTH0F04202p"
                     /transcript_id="XM_002554345.1"
                     /db_xref="GeneID:8292586"
     CDS             374123..375367
                     /locus_tag="KLTH0F04202g"
                     /note="similar to uniprot|P46985 Saccharomyces cerevisiae
                     YJL183W MNN11 Subunit of a Golgi mannosyltransferase
                     complex that also contains Anp1p Mnn9p Mnn10p and Hoc1p
                     and mediates elongation of the polysaccharide mannan
                     backbone has homology to Mnn10p"
                     /codon_start=1
                     /product="KLTH0F04202p"
                     /protein_id="XP_002554391.1"
                     /db_xref="GeneID:8292586"
                     /db_xref="GOA:C5DKF3"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:C5DKF3"
                     /translation="MALKPKLKPMSTSNSLQKRSMQFKNVFVDSKKRRKQAFTLSVFV
                     GIALVLYLVSGLFGRGRPTVNKYPPVHGHYINEIATTKPLIFPAVENAAQLKEMNMRS
                     LHILRIDMDGNKKYVLKETDQPITEKERKQMTDPHEIIKRDYLDHGKLVFRKGTDSPE
                     VVIVTLVDFDNYDPQTLIKVVQNRVNYAQRHRYGVYVRWAQEFIPLLEKQNLKESYEY
                     LKPMIMRAAFHAFPRAKYFWFLDQDALIMRMDLSLQNHLLDPKILQLAILKNVPVVKD
                     SNIKTYNHFLPGNAEIIFPQTNGGYLDSSSFIAASGMYSKAMFDYLSDPLVRDFPWQN
                     FAHCVSHALQWHPSILAKTALIVPKTIASVYDPAKKADEKPGVDAFHYTAGDLVASFY
                     GCKDRGSCIKDIDTFYDKVQTS"
     gene            complement(<378401..>379354)
                     /locus_tag="KLTH0F04246g"
                     /db_xref="GeneID:8292587"
     mRNA            complement(<378401..>379354)
                     /locus_tag="KLTH0F04246g"
                     /product="KLTH0F04246p"
                     /transcript_id="XM_002554346.1"
                     /db_xref="GeneID:8292587"
     CDS             complement(378401..379354)
                     /locus_tag="KLTH0F04246g"
                     /note="similar to uniprot|P22135 Saccharomyces cerevisiae
                     YJL180C ATP12 Molecular chaperone required for the
                     assembly of alpha and beta subunits into the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="KLTH0F04246p"
                     /protein_id="XP_002554392.1"
                     /db_xref="GeneID:8292587"
                     /db_xref="GOA:C5DKF4"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="InterPro:IPR023335"
                     /db_xref="UniProtKB/TrEMBL:C5DKF4"
                     /translation="MLRHATFRSLRSAHLCSVRAYARATSLGIDSSVENNLQTETNRA
                     SKTLQKFWNDVSVKECDTHLTVMLDNKPLRTPLGNALSVSKDRKLLALLLQNEWSSMS
                     SLAIKPHSLPITSIVSRCIDLEYTAKPGSDPELVAKIGGDRSVISESLLRYLDTDTLM
                     CLSPRAEYEGALRAAQDELYLPVISQVEKFLSRFAQDPVKLQILDADVHGLKGNLQDK
                     NTKEAALAYLNSLSMWDFAVFEKAVLTTKSFLCGLLLLHNKSQNPSSDMKVTMEKIAQ
                     FATLETIYQVERWGEVEDTHDVDKRDVRRNINAASIVAFKE"
     gene            <379441..>379851
                     /locus_tag="KLTH0F04268g"
                     /db_xref="GeneID:8292588"
     mRNA            <379441..>379851
                     /locus_tag="KLTH0F04268g"
                     /product="KLTH0F04268p"
                     /transcript_id="XM_002554347.1"
                     /db_xref="GeneID:8292588"
     CDS             379441..379851
                     /locus_tag="KLTH0F04268g"
                     /note="highly similar to uniprot|P46988 Saccharomyces
                     cerevisiae YJL179W PFD1 Subunit of heterohexameric
                     prefoldin which binds cytosolic chaperonin and transfers
                     target proteins to it involved in the biogenesis of actin
                     and of alpha- and gamma-tubulin"
                     /codon_start=1
                     /product="KLTH0F04268p"
                     /protein_id="XP_002554393.1"
                     /db_xref="GeneID:8292588"
                     /db_xref="GOA:C5DKF5"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:C5DKF5"
                     /translation="MNVNYDIQHWLDNTIKRSSAPRAPRMSQNIVQEMAAALRSSKAQ
                     LEVVNMQLAQLDRQKKLAQLTTKELESYPVKKVWRSCGKAFVLQDRTKYTADLESDEK
                     LVEEQAKALKIKQNYLQTTVENTVESMRRVIQQT"
     gene            complement(<379953..>380819)
                     /locus_tag="KLTH0F04290g"
                     /db_xref="GeneID:8292589"
     mRNA            complement(<379953..>380819)
                     /locus_tag="KLTH0F04290g"
                     /product="KLTH0F04290p"
                     /transcript_id="XM_002554348.1"
                     /db_xref="GeneID:8292589"
     CDS             complement(379953..380819)
                     /locus_tag="KLTH0F04290g"
                     /note="weakly similar to uniprot|P46989 Saccharomyces
                     cerevisiae YJL178C ATG27 Type II membrane protein that
                     binds phosphatidylinositol 3-phosphate required for the
                     cytoplasm-to-vacuole targeting (Cvt) pathway"
                     /codon_start=1
                     /product="KLTH0F04290p"
                     /protein_id="XP_002554394.1"
                     /db_xref="GeneID:8292589"
                     /db_xref="InterPro:IPR018939"
                     /db_xref="UniProtKB/TrEMBL:C5DKF6"
                     /translation="MKLSRQAFAAALFAQLALGFKCSQHDILKKYNVDKNDITHTSSR
                     ETPPSTTEEQWWINICQENTSPAPENCQKNDLLCGKTVVTLPDDRNNKLLTQLIDFTE
                     SVSQSASVNDKNELVVDLKNAKWGPNSIDAELTFVCTSPNDASSVSSVTWQDQRVLIA
                     IKGSAGCLKGEKDGGNGDDNGHDGGDNGNDDDGNRKDGDGGDRKPHKRGSSLGSWFVW
                     LVTYALLFALIYLLATSYMSTRGGNFREFREEFVERSTGLAASLPQFAKEVVSRVIGR
                     GSSSQRGGYSAV"
     gene            <382022..>382666
                     /locus_tag="KLTH0F04312g"
                     /db_xref="GeneID:8292590"
     mRNA            join(<382022..382330,382421..>382666)
                     /locus_tag="KLTH0F04312g"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_002554349.1"
                     /db_xref="GeneID:8292590"
     CDS             join(382022..382330,382421..382666)
                     /locus_tag="KLTH0F04312g"
                     /note="highly similar to uniprot|P46990 Saccharomyces
                     cerevisiae YJL177W"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_002554395.1"
                     /db_xref="GeneID:8292590"
                     /db_xref="GOA:C5DKF7"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:C5DKF7"
                     /translation="MARYGATSTNPAKSAAARGSYLRVSFKNTRETAQAINGWGLERA
                     QKYLDQVLDHQRAIPFRRFNSSIGRTGQGKEFGVTKARWPAKSVKFVQDLLQNAAANA
                     EAKGLDSTKLFVSHIQVNKAPKQRRRTFRAHGRINKYESSPSHIELVLTEKEEAVEKA
                     EEKKVVRLSSRQRGRLAAQKRITA"
     gene            complement(<382773..>384677)
                     /locus_tag="KLTH0F04334g"
                     /db_xref="GeneID:8292591"
     mRNA            complement(<382773..>384677)
                     /locus_tag="KLTH0F04334g"
                     /product="KLTH0F04334p"
                     /transcript_id="XM_002554350.1"
                     /db_xref="GeneID:8292591"
     CDS             complement(382773..384677)
                     /locus_tag="KLTH0F04334g"
                     /note="similar to uniprot|P34237 Saccharomyces cerevisiae
                     YKL179C"
                     /codon_start=1
                     /product="KLTH0F04334p"
                     /protein_id="XP_002554396.1"
                     /db_xref="GeneID:8292591"
                     /db_xref="GOA:C5DKF8"
                     /db_xref="InterPro:IPR012955"
                     /db_xref="UniProtKB/TrEMBL:C5DKF8"
                     /translation="MSDSVFKHAVELWSKANLPELQRQLDESVLTMKELETKSLNSRK
                     TLASETKQFKRLNEEQKLAQVNKVIKQYQQEVDSLTSRSKFSEEVLLNLYAKLSETPD
                     PQPLLEASSQQSHSEEEIAGLKNTIIELEHKVSKHADYDKIRARLLDLEQNSAKTLSK
                     RLSAKEQELNSKWQEKERNWSEREKDLVKQLEIARDTNKVLEGKLSQSADGDEDHDIH
                     GRYSAEHDLLLQEVQSSQVRIMDLERRNEELSGSLAKATSQEEQDSEAKAKSLKINEL
                     ESENALLSASLERERNLLKSNVTDREGRIEKLEQQLAALQDDLYKKTRKLEVYADYDS
                     IKKELTALKKIEFGASDDENAGVDSTLLNANKKLQSNLAELRAKFSGMEKERAGLQHE
                     VKSLNDKISGLEKLNARLELDLEKVDSVSMITDTASMMSGATRQMNRVGTSARPGGKL
                     SPTSSIVGIPEDEEMPISSGNARILPIVTQQRDRLRQKTTELEKKLRQTSLNQGNLRT
                     EVESLKNDNAKLYERIRFLSSYGSGSNLQIEDDSRYSKSYDESLHPLADFKQKELSRY
                     QKKSISPMEKVLLSFAGIVLANKTSRMLFMCYCLGLHGLVMVMIFYVASFSGSMSGGT
                     VGVRTAGAGM"
     gene            complement(<384963..>387518)
                     /locus_tag="KLTH0F04356g"
                     /db_xref="GeneID:8292592"
     mRNA            complement(<384963..>387518)
                     /locus_tag="KLTH0F04356g"
                     /product="KLTH0F04356p"
                     /transcript_id="XM_002554351.1"
                     /db_xref="GeneID:8292592"
     CDS             complement(384963..387518)
                     /locus_tag="KLTH0F04356g"
                     /note="some similarities with uniprot|P32591 Saccharomyces
                     cerevisiae YJL176C SWI3 transcription factor"
                     /codon_start=1
                     /product="KLTH0F04356p"
                     /protein_id="XP_002554397.1"
                     /db_xref="GeneID:8292592"
                     /db_xref="GOA:C5DKF9"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:C5DKF9"
                     /translation="MSVEQTNSPYAHSLQHESATESGDAHDAALFGDADEDATQQGPQ
                     GDDITGTADKGAEENPEAVLMSPTAADVLSQSRGLEAESRETAAHEPHQELEESAAPV
                     EQSDMGGPVEASDHAEAGKQQEPSLVPDVSEQLGLPEQQDIEKQQGSDVQQETAALPA
                     SSAQAESNEASASVRGNESIEQLGHGEELKLGNGAEKFGLSGAPDIALQTTHQTQDQV
                     PQTEQSFPAENPVQAEPLQAEQRVQVEQRVQSEQPVQLEQPVKMKQPVEMDQPVEMDQ
                     PVEMDHPVQMQQPVQAEQPVPAKQPIQAEQLAQAAQPVQTEQPVKQENAIKEETSLQH
                     EQQLHAESSPLPQNNGTAAQLQEMGPEAPSRLVVPQSHEIVIPSYARWFHLQKIHSIE
                     KQSLPEFFTNRIPSKTPQVYVKYRNFMVNSYRLNPNEYFTATAARRNLCGDAGAILRL
                     HKFLTKWGLINYQVDAKAKPKQVEPPFTGEYATKHDAPRGLFPFESYKPAIQIPDLSR
                     LKKLMHQIDPPASSTKSALAAVSPSPGDSSDKKRSLEDGDETPVKPKLQRPNVLEMVD
                     RDWDEESVKKLLEGIQKFQTDWLRVAQYVGNKTPEQCILRFLQLPIEDAYLQSQSGEE
                     LGPLKYAPHLPFSKADNPVMSTIAFLAGLVDPKTVKKMTSRAIDSVKQERETLSAEGD
                     NYVKEGSEIALASIGLRSHVFATNEERQMTALAHDMVQTQMKKINLKLKLLGTMEKSL
                     EMEKKALQKQQEDVFIQRLSLAKHSQTLTAKIQQCLDDHDDKEKLQAHLNAIKEMQAH
                     PARISIGKSQSSSKSAVNGSSQEQAFSSTSDLNEPFVKPVSVDAPQSYRYWSG"
     gene            <388891..>389817
                     /locus_tag="KLTH0F04378g"
                     /db_xref="GeneID:8292593"
     mRNA            <388891..>389817
                     /locus_tag="KLTH0F04378g"
                     /product="KLTH0F04378p"
                     /transcript_id="XM_002554352.1"
                     /db_xref="GeneID:8292593"
     CDS             388891..389817
                     /locus_tag="KLTH0F04378g"
                     /note="similar to uniprot|P39005 Saccharomyces cerevisiae
                     YJL174W KRE9 Glycoprotein involved in cell wall
                     beta-glucan assembly null mutation leads to severe growth
                     defects aberrant multibudded morphology and mating
                     defects"
                     /codon_start=1
                     /product="KLTH0F04378p"
                     /protein_id="XP_002554398.1"
                     /db_xref="GeneID:8292593"
                     /db_xref="GOA:C5DKG0"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /db_xref="UniProtKB/TrEMBL:C5DKG0"
                     /translation="MYSSVRTRLALLWTLVVSLTLVAADVAIVSPGQGDKFTASGSSV
                     SITVQWNEDDVTPLLKNVLNYNILLCYGTNDKFTCPETTTNTVKPSDLASGTEGSYSY
                     AAKFDASAVGNGQYFIQVFAQFSKDAKQYTIHYTPRFTLSSMSGTLTPSVTTTSQPAT
                     QVMYATGTTTTTDDGFDVSSLSTVPYTQQTYRTRFAPMQMQPGSTITATTWTRRFPTS
                     AVTYYSTLRNWKSLEQLSTITPGWSYTISSDFNYATPMPFPSQNGGWYNPKSRQSLST
                     RIRNLKYATQGVTTSASADSSGSGSASTLTSS"
     gene            complement(<389870..>390220)
                     /locus_tag="KLTH0F04400g"
                     /db_xref="GeneID:8292594"
     mRNA            complement(<389870..>390220)
                     /locus_tag="KLTH0F04400g"
                     /product="KLTH0F04400p"
                     /transcript_id="XM_002554353.1"
                     /db_xref="GeneID:8292594"
     CDS             complement(389870..390220)
                     /locus_tag="KLTH0F04400g"
                     /note="similar to uniprot|P26755 Saccharomyces cerevisiae
                     YJL173C RFA3 Subunit of heterotrimeric Replication Factor
                     A (RF-A) which is a highly conserved single-stranded DNA
                     binding protein involved in DNA replication repair and
                     recombination"
                     /codon_start=1
                     /product="KLTH0F04400p"
                     /protein_id="XP_002554399.1"
                     /db_xref="GeneID:8292594"
                     /db_xref="GOA:C5DKG1"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="UniProtKB/TrEMBL:C5DKG1"
                     /translation="MATSTPRVDPQQIGQLSSPVFRIIGQVTAQPQPTQIIVASPTTG
                     GEMISLTNVQTSSNVNYELQAWYELVCRANDFGDAGFLVLDSVKCVFPPGESISVAGV
                     VALQQLSSKFTEIM"
     gene            <390590..>392308
                     /locus_tag="KLTH0F04422g"
                     /db_xref="GeneID:8292595"
     mRNA            <390590..>392308
                     /locus_tag="KLTH0F04422g"
                     /product="KLTH0F04422p"
                     /transcript_id="XM_002554354.1"
                     /db_xref="GeneID:8292595"
     CDS             390590..392308
                     /locus_tag="KLTH0F04422g"
                     /note="similar to uniprot|P27614 Saccharomyces cerevisiae
                     YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
                     induced under low-nitrogen conditions"
                     /codon_start=1
                     /product="KLTH0F04422p"
                     /protein_id="XP_002554400.1"
                     /db_xref="GeneID:8292595"
                     /db_xref="GOA:C5DKG2"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:C5DKG2"
                     /translation="MQGGYDKLPGSSTGRFGQGLKKSAMLAAGTLAFAAIAWRTTGDG
                     SLGMFQAQETPKCGRIEPLRPRFNKSIEMIFEDAKFREESLAKLSGAVRIPTEIQDVN
                     PQPADDLDYYKEFFRFHEYLKQTFPLVHKHLKLEKVNHVNLLYTWEGSDASLEPMMLT
                     AHQDVVPVNPDTVDQWTFPPFSGHYDNTTDYVWGRGTGDCKNLLIGELEAIELLLKDG
                     FKPRRSVIVALGFDEESSGILGANTLGDFLYERYGDNGIYSVVDEGGGVIQLGKKVFV
                     AAPITAEKGYVDIEVTVNGVGGHSSVPPDHTTIGVAANMISLLEANPFEPTFTPKNPI
                     YGLLTCAAEHGDNLPSSVRKAILQAPHDEKQKEKMVSFFSTDKRLRDLMRTSQAVDII
                     RGGIKANALPEVTTFLVNHRIDVNSSVSQTVERDLALIKTVAEKFNYGLFLAGEEIIP
                     PTKFGFIDVEPQKSLEPAPISPTVGSPTWDLFAGTIQDVFQNGHFKYDPDTEFYVSTG
                     LVSGNTDTKYYWRLTKNIYRFLGLVMEADIMRTIHSVNEHIRMSGHLSTVAFVYEYIV
                     NVNEQA"
     gene            complement(<393714..>395123)
                     /locus_tag="KLTH0F04444g"
                     /db_xref="GeneID:8292596"
     mRNA            complement(<393714..>395123)
                     /locus_tag="KLTH0F04444g"
                     /product="KLTH0F04444p"
                     /transcript_id="XM_002554355.1"
                     /db_xref="GeneID:8292596"
     CDS             complement(393714..395123)
                     /locus_tag="KLTH0F04444g"
                     /note="similar to uniprot|P06783 Saccharomyces cerevisiae
                     YKL178C STE3 Cell surface a factor receptor transcribed in
                     alpha cells and required for mating by alpha cells couples
                     to MAP kinase cascade to mediate pheromone response ligand
                     bound receptors undergo endocytosis and recycling to the
                     plasma membrane"
                     /codon_start=1
                     /product="KLTH0F04444p"
                     /protein_id="XP_002554401.1"
                     /db_xref="GeneID:8292596"
                     /db_xref="GOA:C5DKG3"
                     /db_xref="InterPro:IPR001499"
                     /db_xref="UniProtKB/TrEMBL:C5DKG3"
                     /translation="MSYSSVIIGLGSVALALLFPPLAWHSKTRNTPAIIMIVWLILMD
                     IKLIVDASIWGGSDFAGKWAGYGWCDLTTKLQIGANVGISCTVANIAYNLHAILRADA
                     VLPEPDSRRKICTDLGISLVTPILVMGLTYLVQVFRYGIFRYNGCQSMLSPSWLTVVT
                     YTLWMFIWSFVGFVYAILLLYVFYRKRKDVKDILHCTSSGLNIARFSRLLLFCVLIIL
                     VMFPFSLYAFASELQNLTGAYNYQMVHDSSLWSTIMRIDVAKPLYSVWLYILMSYLVF
                     VIFGLGTDAVGMYGSAARVLGLGPLLDKCKQCCRRRRSENTTKVVSYFFAEHDAFKGA
                     DGMGSASDGSSTLKPGVGYSDGSSIEMSDSAPSSPSHFIIDYLLPNEKSRREKRRRNG
                     TGGDLESLSYHDHPANPISFEEEVPLSVQRTKSGLVSHVSYRSASEFGNTSGELGTGN
                     SEEGVSPESPHPVFSSSAG"
     gene            complement(<395584..>396768)
                     /locus_tag="KLTH0F04466g"
                     /db_xref="GeneID:8292597"
     mRNA            complement(<395584..>396768)
                     /locus_tag="KLTH0F04466g"
                     /product="KLTH0F04466p"
                     /transcript_id="XM_002554356.1"
                     /db_xref="GeneID:8292597"
     CDS             complement(395584..396768)
                     /locus_tag="KLTH0F04466g"
                     /note="similar to uniprot|P46992 Saccharomyces cerevisiae
                     YJL171C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F04466p"
                     /protein_id="XP_002554402.1"
                     /db_xref="GeneID:8292597"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:C5DKG4"
                     /translation="MLFQGIVLATAGFCQLAAAAQAFQKVEFTNVGFNGSFTPVKSIK
                     NPDKDSCSCTVDDAEWFTGSNAPISAGVSVHFRGPLTLHKFAFYNSSEFSIGDNRTSA
                     DWNRVAYYDASSQTADNVTFLTNAGTDSPVLGKALTFATSNGTGASSSASVLAENTLL
                     SSDDEFSIFSNITCPKSGTGKSCGVYRSGITAYHGFSGVTKMFLFEFEMPTETQSNSS
                     SFSYYDMPAIWLLNEHIPRTSQYPTDANCSCWASGCGEFDIFEVMNGTERNHLYSTFH
                     TFQGIEDLGTGIQASGYISRDTSSTMKGGVVFDSQGNTVVFVSNSTTFNETITPETLN
                     GLVENFSSDESYSTQLASISATLPSTTSKSNAFSLFEKRAGNLWFYFFTFITSVAHTL
                     LI"
     gene            complement(<397034..>397621)
                     /locus_tag="KLTH0F04488g"
                     /db_xref="GeneID:8292598"
     mRNA            complement(<397034..>397621)
                     /locus_tag="KLTH0F04488g"
                     /product="KLTH0F04488p"
                     /transcript_id="XM_002554357.1"
                     /db_xref="GeneID:8292598"
     CDS             complement(397034..397621)
                     /locus_tag="KLTH0F04488g"
                     /note="weakly similar to uniprot|P46993 Saccharomyces
                     cerevisiae YJL170C ASG7 Protein that regulates signaling
                     from a G protein beta subunit Ste4p and its relocalization
                     within the cell specific to a-cells and induced by
                     alpha-factor"
                     /codon_start=1
                     /product="KLTH0F04488p"
                     /protein_id="XP_002554403.1"
                     /db_xref="GeneID:8292598"
                     /db_xref="UniProtKB/TrEMBL:C5DKG5"
                     /translation="MARLASPLTVVEYALPPFERQTKSYVCECDSCRICVEYRFLLPR
                     LFFGGFILPTCWILNIALFVYMQEIVEHAVKFPQLAPEDFPTLFELEMYQKRVPIAPE
                     KIRHQRAAENAGSEETKPGQAPVTNLAATDPLGKLLLDSRLEFLTVVSGDVLASHAEN
                     RYYFQSWLWRTAFSLTGYILLLTFVIVALRKSQNP"
     gene            complement(<398063..>400123)
                     /locus_tag="KLTH0F04510g"
                     /db_xref="GeneID:8292599"
     mRNA            complement(<398063..>400123)
                     /locus_tag="KLTH0F04510g"
                     /product="KLTH0F04510p"
                     /transcript_id="XM_002554358.1"
                     /db_xref="GeneID:8292599"
     CDS             complement(398063..400123)
                     /locus_tag="KLTH0F04510g"
                     /note="similar to uniprot|P46995 Saccharomyces cerevisiae
                     YJL168C SET2 Histone methyltransferase with a role in
                     transcriptional elongation methylates a lysine residue of
                     histone H3 associates with the C-terminal domain of Rpo21p
                     histone methylation activity is regulated by
                     phosphorylation status of Rpo21p"
                     /codon_start=1
                     /product="KLTH0F04510p"
                     /protein_id="XP_002554404.1"
                     /db_xref="GeneID:8292599"
                     /db_xref="GOA:C5DKG6"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR025788"
                     /db_xref="UniProtKB/TrEMBL:C5DKG6"
                     /translation="MVSSSTASSTRSQTPDDKHKLFFDYADKTQEALSTFTELKKCSY
                     ASKELGNSNSHDFIECDCYEEFQDGVNHACGEDSDCINRLTLIECVNDLCGSCGNDCR
                     NQRFQKREYADIAVFQTQKKGYGVRAQKDIEAHEFIYEYIGEVIAEDEFRDRMIDYDH
                     RGLKHFYFMMLQTGEFIDATVKGSLARFCNHSCNPNAYVNKWAVAGKLRMGIFANRKI
                     LKGEEITFDYNVDRYGATAQPCYCDEPNCLGFLGGKTQTDAASLLPQNYADALGVRPS
                     IEKKWIKLMKANGEKILKSEVNNINVEFVKSLDLSPCESLDDVSKVMSVLLQADDNLI
                     IRRLMERILLTKDQTMHYQIIKLHGYRCFNKLLGIFEDDSEIQLEILEYLNCLPKTTK
                     NGIISSQIDKKVEELKEKPELTQVSDELLAKWRSFETYKRITKKDISESSHKKMDLRR
                     LRLPPGWEIIHENGKPVYYNAQQQTKLHHPPNGVTKTFGGSQPSRPSTPLDSPSNGAI
                     SSKKRPLDAEEYEKKKKQRIEFQRKELERLKNEELQQLKDKLELEDQKKTELEKIIAE
                     ANQQKELEKQQKFKEQQEEEQKRQKKLQQSKGDYMLHKWNRFFAGFVPNLVRHYEKDL
                     GKDHIKECARDIVKTLSSKELKKDPKKSPPPEPSKEKKAKVREFTKVYMEKFSQKYAQ
                     RKKK"
     gene            complement(<400336..>402342)
                     /locus_tag="KLTH0F04532g"
                     /db_xref="GeneID:8292600"
     mRNA            complement(<400336..>402342)
                     /locus_tag="KLTH0F04532g"
                     /product="KLTH0F04532p"
                     /transcript_id="XM_002554359.1"
                     /db_xref="GeneID:8292600"
     CDS             complement(400336..402342)
                     /locus_tag="KLTH0F04532g"
                     /note="weakly similar to uniprot|P34239 Saccharomyces
                     cerevisiae YKL176C LST4 Protein possibly involved in a
                     post-Golgi secretory pathway required for the transport of
                     nitrogen-regulated amino acid permease Gap1p from the
                     Golgi to the cell surface"
                     /codon_start=1
                     /product="KLTH0F04532p"
                     /protein_id="XP_002554405.1"
                     /db_xref="GeneID:8292600"
                     /db_xref="UniProtKB/TrEMBL:C5DKG7"
                     /translation="MLGRLLAKNMLYESSSTADETSVPYVPHVSDETKQKLYGTKHLE
                     MQASSAHRFRVVVAQELGQMMSRHNYQVVLDYATSRGSGMNHISVSDLKEYIFGSPVR
                     AKTRHKCDKFRVVAGAGVVLVTRVFYPSQRDTRLAICLSLPESFLSALSEIWTHIGRW
                     LDECQALLLAILSNDSLVSLPRDLRAHDPQITESIIQSIHTLIVPLVSSHTDIPRLLL
                     YPSSSRQFVLSWFKDVFHWLDIKDGHRLRFLPVLFAKIAQDFAAELRANECSRIIIIS
                     GNMVVANKLIFLISALLGPRYSGRIDISDDTPQLGHSERQKPLKDERQSLDNKYFSTI
                     TGKGWEIPNKKTPNSSTSLSSDETSAQVIQPSSIRSSSSSLQYLSSSLSSVYGSYGSW
                     FSKRIGMQSPSAKTNESSEQSYFQHHNGSSTSLHQVALNHNRVTPLPSPSINEYEEFP
                     WCSSPSSPRTDNTQQGWPAHTEPSFQNVDIKRTCNRITNAKDLDQAFESICQFDSDSF
                     KAETSAPSEGHAQVLEVELEIDSHSSYSELLPKYTSFLPNFVPWFQLQAVPVTSDAER
                     KVLNAMKADLHTREYSRTLLISLRSREIKDIVVEKDHFLTKNVLRTKRVFSSGKCSSM
                     SPKFQQQVLQCEQNIKKAMSVWEDVENVADKMEILQKIFEDIRS"
     gene            <403607..>404902
                     /locus_tag="KLTH0F04554g"
                     /db_xref="GeneID:8292601"
     mRNA            <403607..>404902
                     /locus_tag="KLTH0F04554g"
                     /product="KLTH0F04554p"
                     /transcript_id="XM_002554360.1"
                     /db_xref="GeneID:8292601"
     CDS             403607..404902
                     /locus_tag="KLTH0F04554g"
                     /note="similar to uniprot|P34240 Saccharomyces cerevisiae
                     YKL175W ZRT3 Vacuolar membrane zinc transporter transports
                     zinc from storage in the vacuole to the cytoplasm when
                     needed transcription is induced under conditions of zinc
                     deficiency"
                     /codon_start=1
                     /product="KLTH0F04554p"
                     /protein_id="XP_002554406.1"
                     /db_xref="GeneID:8292601"
                     /db_xref="GOA:C5DKG8"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:C5DKG8"
                     /translation="MTPSLFIEEIPRWARFTAISSLLCIAGSLCVPAIAALSRNKSGV
                     NSRLLNYGLSVSAGSMITTSLYKMLPRGEDDKRVVFVGFFAGVVVSFLLNFVVHAYTS
                     ESLVHCGHASDNGEGSGAENVQDHARRHSEHEHNSEAEPLTSSARPALRNARSIIDLI
                     SKKDPNSGDCYGSMSCAPAGQSPSGQAEVTCQADNTTKAVVCPENGIGYDLENLALYR
                     EHFMKGNSHKHSHSSGSDSSNSSPNASVHSSEHHHHHLATPFSKLLSIGIQTCLVITL
                     HKFPEGFIVFFTNNNDSDSKSFGFSIFLSLAMHNFIEGFAMTLPLYAAFRTKWYAILT
                     ASVLGGGSQPLGALIGYFIFKNTGAKELHINLLLSITSGFLFVIGLMMFQTAVGFSDS
                     HHHHNDQERSPDETHSLATVCLKWCCFGVLLILGSGLFA"
     gene            complement(<404994..>406643)
                     /locus_tag="KLTH0F04576g"
                     /db_xref="GeneID:8292602"
     mRNA            complement(<404994..>406643)
                     /locus_tag="KLTH0F04576g"
                     /product="KLTH0F04576p"
                     /transcript_id="XM_002554361.1"
                     /db_xref="GeneID:8292602"
     CDS             complement(404994..406643)
                     /locus_tag="KLTH0F04576g"
                     /note="similar to uniprot|P36029 Saccharomyces cerevisiae
                     YKL174C TPO5 Protein involved in excretion of putrescine
                     and spermidine putative polyamine transporter in the Golgi
                     or post-Golgi vesicles"
                     /codon_start=1
                     /product="KLTH0F04576p"
                     /protein_id="XP_002554407.1"
                     /db_xref="GeneID:8292602"
                     /db_xref="GOA:C5DKG9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DKG9"
                     /translation="MLESVRTRKPFRDGFQLLPQSVWANWGSIIQDADEEEEEVQRFK
                     YEQQLDRSFLSKSSVIGLGFGLMSPVLGMSTTMSIGLLNGGPLTIVIGFLINGIATWL
                     CSLSLGEIVSRFPIELHGGSAMLARQKFKLACSWFTGWLMLLGNWTMSTSITFAGAQL
                     LVSLVTMTNDKLIGENYIVVTTVLAFYLIVTIVGLINLKFAGFIETVNKVCVYWIVYA
                     VIFIDILLLLFHSGKYRSLKYALAHFDNSFSGYSSAALSFIIGFQQSSFTLQGFSMLP
                     ALADEVKESERDIPKGMSTAVLTSTVTGVVFLLPIMLILPDTQTIINNPKVMPIALIF
                     TQSTHSIFVSLFLVIMILGNLLFSGIGSVTTSSRAVYSMSRDMALPYSEFWSYVDPSS
                     KHRVPKNSILLSMGISYLLGLLALLSTAAFNAFMGAAVLCLCSATCIPLVLVLISRRR
                     ALRGSPIKVRYRLGWFVNIASILWLVFTMVVICIPPQVPVTFSSMNYAFVVYLLFLAA
                     ITVLYFRWGRYNFKTPLISEDSRTDDTASASFVLQDANLPK"
     gene            <406984..>409862
                     /locus_tag="KLTH0F04598g"
                     /db_xref="GeneID:8292603"
     mRNA            join(<406984..407006,407069..>409862)
                     /locus_tag="KLTH0F04598g"
                     /product="KLTH0F04598p"
                     /transcript_id="XM_002554362.1"
                     /db_xref="GeneID:8292603"
     CDS             join(406984..407006,407069..409862)
                     /locus_tag="KLTH0F04598g"
                     /note="similar to uniprot|P36048 Saccharomyces cerevisiae
                     YKL173W SNU114 involved in splicing U5 snRNP- specific
                     protein related to EF-2"
                     /codon_start=1
                     /product="KLTH0F04598p"
                     /protein_id="XP_002554408.1"
                     /db_xref="GeneID:8292603"
                     /db_xref="GOA:C5DKH0"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKH0"
                     /translation="MDEELYDEFGNLIGGEAEDSDTQDESLVQEEESSALQIAEANPS
                     TEIVHRETLATAFPDDVEILVETEDHQATTTPLVEPAEINVKKQALYTESIKHLPRVN
                     YDRDYFSTLHEIPERTMNVTILGPLHSGKTSLVDLLILQAHKKLPGTSKNVREGWKPL
                     KYMDNTKLEIERGISYKLNGFSFLATDLQQKSVALTVLDCPGHVNFIDEVAVSLAASD
                     TCVIVVDVVEGVTSIVQQLIKQCEKHGLPIVFVLNKVDRLILELKLPPQDAYLKLANI
                     VNQINSFSNGSYSPEQGNVLFSSAKLGFTFSIEEFVLYYYSKQLGMDKLEGFLKRMWG
                     NIYFQDGRFSKVTNQSGLTTFSEFILIPLYKIFTHSLSNDPENLAVILKREFRVTLPR
                     EYFKIDPQPLLRKVLGLIFRDQAGFVGSVTSFGSFACEAAPLKKKFFDVAANENDTLA
                     HVLKLMDYCGDVWALVRVYQGVLNKHAMIKVLDGGLPPEDDAPEVEIQDIALMGGRYV
                     FPVEKAHEGQIVLVKGIDQYITKSGTLASSTSTIFPPIDYINDPVFKVVLQVLHPQEL
                     PLMLEGLKKVNKFYPGMFTCVEESGENVILGTGELYLDCLLYDLRTNYARIEIQVSSP
                     LVKFSETCVGESFASIPVSGASGHLELSIAAQPLERELAEDLASGALAESEIQNKRQL
                     SKKLREKYSWDSLAARNVWSLRSSNVLVDDTLPDETDKERLAEAKHSICQGFEWATRE
                     GPLAEEPIRGVHFRLLSVSMGDDVRAGQLIPLVRKACYVAMLTATPALLEPIYEACVL
                     VHDDAADVVEELFSKRRGARVYNRVKIPATPLIELRGQIPVIDSIGFETDLRLATNGT
                     GMCQLQFWNKIWRKVPGDVMDEDAVIPKLKPAPRDSMSRDFVMKTRRRKGLSSEGYAT
                     QDGPSLARYIEPELFQKLKDNNLV"
     gene            <410119..>411339
                     /locus_tag="KLTH0F04620g"
                     /db_xref="GeneID:8292604"
     mRNA            <410119..>411339
                     /locus_tag="KLTH0F04620g"
                     /product="KLTH0F04620p"
                     /transcript_id="XM_002554363.1"
                     /db_xref="GeneID:8292604"
     CDS             410119..411339
                     /locus_tag="KLTH0F04620g"
                     /note="highly similar to uniprot|P36049 Saccharomyces
                     cerevisiae YKL172W EBP2 Essential protein required for the
                     maturation of 25S rRNA and 60S ribosomal subunit assembly
                     localizes to the nucleolus"
                     /codon_start=1
                     /product="KLTH0F04620p"
                     /protein_id="XP_002554409.1"
                     /db_xref="GeneID:8292604"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:C5DKH1"
                     /translation="MAGFKLKELLKHQKQIEKEDKKEAVKKDRKSKELEKLNDEPVVV
                     SHEDAVEDQKVATADEKVADKPQEEYQSQALSRKERRKLKKQQKKSHPTEDENNDSEE
                     EEEGEGDEENSSKRLQLDKLEMSEPEDEEEEDEENEDQEAQSEDEEEKDVPLSDVEFD
                     SDADVVPFQKVTVNNSNAIKHALERVQLPWKKHSFQEHQSITSEGNTDETIKDIYDDT
                     QRELALYKQSLDAVLQARQKLKTLKVPFKRPLDYFAEMVKSDEHMDKLKSKLVSEASD
                     RKAREDARKQRQLKKFGKQVQVATLQSRQKEKRETLEKIKSLKKKRKHNEIDDSAFDV
                     GIEEAATEKGYDKRQKPNGKRLAKDAKYGKGGMKRFKRKNDAQSSSDITGFSSNKMKG
                     KPSRPGKSRRAKRF"
     gene            <411628..>412683
                     /locus_tag="KLTH0F04642g"
                     /db_xref="GeneID:8292605"
     mRNA            <411628..>412683
                     /locus_tag="KLTH0F04642g"
                     /product="KLTH0F04642p"
                     /transcript_id="XM_002554364.1"
                     /db_xref="GeneID:8292605"
     CDS             411628..412683
                     /locus_tag="KLTH0F04642g"
                     /note="highly similar to uniprot|P08524 Saccharomyces
                     cerevisiae YJL167W ERG20 Farnesyl pyrophosphate
                     synthetase, has both dimethylallyltranstransferase and
                     geranyltranstransferase activities; catalyzes the
                     formation of C15 farnesyl pyrophosphate units for
                     isoprenoid and sterol biosynthesis"
                     /codon_start=1
                     /product="KLTH0F04642p"
                     /protein_id="XP_002554410.1"
                     /db_xref="GeneID:8292605"
                     /db_xref="GOA:C5DKH2"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:C5DKH2"
                     /translation="MSKEDKRNKFLSVFPKLVDELKSILTGYGMTADAVQWYENSLNY
                     NTPGGKLNRGLSVVDSYAILKGKKSYEELSEEEYFKLATLGWCIELLQAYFLVADDMM
                     DKSITRRGQPCWYRVEEVGEIAINDAFMLEGAIYCLLKNHFKQDSYYVELLELFHDVT
                     FQTELGQLLDLITAPEDNVDLDKFSLDRHSFIVRFKTAYYSFYLPVALAMHAAGISDA
                     RDLKQAQDVLIPLGEYFQIQDDYLDCFGKPEDIGKIGTDIQDNKCSWVVNTALKLCSP
                     EQRKVLDENYGRKDAQCEQKCRKIFEDLRIDERYHEYEEKIAEDLRALIARADESRGF
                     KRDVLTAFLGKVYKRQK"
     gene            <412976..>413260
                     /locus_tag="KLTH0F04664g"
                     /db_xref="GeneID:8292606"
     mRNA            <412976..>413260
                     /locus_tag="KLTH0F04664g"
                     /product="KLTH0F04664p"
                     /transcript_id="XM_002554365.1"
                     /db_xref="GeneID:8292606"
     CDS             412976..413260
                     /locus_tag="KLTH0F04664g"
                     /note="highly similar to uniprot|P08525 Saccharomyces
                     cerevisiae YJL166W QCR8 Ubiquinol cytochrome-c reductase
                     subunit 8"
                     /codon_start=1
                     /product="KLTH0F04664p"
                     /protein_id="XP_002554411.1"
                     /db_xref="GeneID:8292606"
                     /db_xref="GOA:C5DKH3"
                     /db_xref="InterPro:IPR004205"
                     /db_xref="UniProtKB/TrEMBL:C5DKH3"
                     /translation="MGGPTAKTFLGWWGSLGGPTQKGITSYAVSPYAQKPLAGIYHNA
                     VFNTFRRVKAQALYLVIPAGLYWMWWVNCRDYNEYLYTKAGKEELDRVNV"
     gene            <413669..>416209
                     /locus_tag="KLTH0F04686g"
                     /db_xref="GeneID:8292607"
     mRNA            <413669..>416209
                     /locus_tag="KLTH0F04686g"
                     /product="KLTH0F04686p"
                     /transcript_id="XM_002554366.1"
                     /db_xref="GeneID:8292607"
     CDS             413669..416209
                     /locus_tag="KLTH0F04686g"
                     /note="weakly similar to uniprot|P36003 Saccharomyces
                     cerevisiae YKL171W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F04686p"
                     /protein_id="XP_002554412.1"
                     /db_xref="GeneID:8292607"
                     /db_xref="GOA:C5DKH4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKH4"
                     /translation="MAHTYDLNYVTNQRRQLDGGTPVFQSQNDSSETFKKSFEGTDDN
                     KNSLGAEPSQAGSEESEGIYFKPDLMHKENQQPRPRGALIRVYSENERSNFNESTGAR
                     LYDDLRYRPMHYDGSGSPPKSSAVDIVPKSKRRHSSSWDEDRMTASSRRCPIDVIGDM
                     QDEYIPDLDFSTAFSRWQSDDNLHDQLLGEVQPQGLSRMHCYNDWAGYETDLSRSSSA
                     SSSSIVFRSAHAKVAPIPLPRAGLPSASPNRAAHNQMSSVFGGLSHASQLSYPRNRPV
                     PMLNTAPGGSYRSLKRRKSGLEAESPSSPVVVTPGTTLSYASSNDVRFTNDEWKNVIA
                     QLPDNFLSLPYSQRKRILQDKFPDINYKSMMTMLKRYYLNSGKSSSQLQDNKSRRGSL
                     ASQFLSSFTPSSTLKSNDKGNVVMGYTLGKIIGFGAWGMIRECYKNAAEDEDGDNVAV
                     KAFKIVKFRNNTLVKEQVLKEVHMWSKLKHPNILPLIDWKLDEDYAMYCLTEKISGGT
                     LYDLVNSWGEASQSKIALSQRRKLTAELGTQIVEALKFMHAKRIIHGDVKLENCLLEE
                     REPGKECRWHVVLCDFGMSSEFEDSAESNRRDGGGNKTPREHAHKGQLAPLRDRPLVF
                     RSASNLTLKSGKFHRSLKGDNMPHGNHPLGVSSFPRHYGPSLTSANISGRFPAKEKSP
                     ASESNLQALTFTATSTNGSATTDKDGVPPKLSNATNARDPHSHIGSLPYAAPELLEPT
                     PPPLAPSADIWALGVTLYTMLLGKLLFKHDYEPRLRAMIAAAKYDTKSLDEICVTEAN
                     PPCPELLKAVKGCLIKDVAQRWELDAIEIALTQCVKTSTQLEEATVHK"
     gene            <416514..>416930
                     /locus_tag="KLTH0F04708g"
                     /db_xref="GeneID:8292608"
     mRNA            <416514..>416930
                     /locus_tag="KLTH0F04708g"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="XM_002554367.1"
                     /db_xref="GeneID:8292608"
     CDS             416514..416930
                     /locus_tag="KLTH0F04708g"
                     /note="highly similar to uniprot|P35996 Saccharomyces
                     cerevisiae YKL170W MRPL38 Mitochondrial ribosomal protein
                     of the large subunit appears as two protein spots (YmL34
                     and YmL38) on two-dimensional SDS gels"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="XP_002554413.1"
                     /db_xref="GeneID:8292608"
                     /db_xref="GOA:C5DKH5"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:C5DKH5"
                     /translation="MIYLKSMLKVIDNSGAQLAECIKVLRKGSPKSPGKVGDKIVCVV
                     QKARPLTQNITGTSNNNRVKKGDIVHAVVVRTKQKNTVRADGSAVSFGDNACVLINKN
                     SGEPLGTRIMANDGCVSRELRDKGYNKICSLASRVM"
     gene            complement(<417013..>419133)
                     /locus_tag="KLTH0F04730g"
                     /db_xref="GeneID:8292609"
     mRNA            complement(<417013..>419133)
                     /locus_tag="KLTH0F04730g"
                     /product="KLTH0F04730p"
                     /transcript_id="XM_002554368.1"
                     /db_xref="GeneID:8292609"
     CDS             complement(417013..419133)
                     /locus_tag="KLTH0F04730g"
                     /note="some similarities with uniprot|P38970 Saccharomyces
                     cerevisiae YJL165C HAL5 Putative protein kinase
                     overexpression increases sodium and lithium tolerance
                     whereas gene disruption increases cation and low pH
                     sensitivity and impairs potassium uptake suggesting a role
                     in regulation of Trk1p and/or Trk2p transporters"
                     /codon_start=1
                     /product="KLTH0F04730p"
                     /protein_id="XP_002554414.1"
                     /db_xref="GeneID:8292609"
                     /db_xref="GOA:C5DKH6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DKH6"
                     /translation="MAMPKTSHGENSAGESELKRSRSLSNSIKTLFKSTSPSRKTTGP
                     AEAHGGPKSGDKLMKLAKGKELELGEKRREAALPARGADTPPLASPAPAYRPHNAPGP
                     KGVKGHILSHDFGKLSLSRHNNAANGGENSNGSQESIISEEGSVPKPDHQRKSSGKRS
                     PNAESGTEGSDRELYDPERLEEESSIDNELSRDPNHVRRVKSLQRQKSGTSAASRSRS
                     MSLSSRYRARSPTHTASPLDEHFESECKCVLSTEKFKLYEDGHHEHTLKVTPIVLETH
                     DDDGKGKSMFSLSGFFKGHKEDEKLESALSLLPRANFDFRKRLSRILDEELNDSSSEP
                     EDEQQKKVPKPVNPNAAIGTEELRLINKISRKIHDGGGKETSVEGAMAKKNYTLFQKY
                     GKPVDIIGQGAYGVVKVCCIDISSLEDERSLDETYSNGQKLFYAVKELKPKNDEAREK
                     FGTRLTSEFIIGHSLSQRGNSTQKAHPNILKMLDLMQTNDGFVEVLEFCPSGDLYSLL
                     SSTSKKGLHPLEADCFMKQLLHGVQYMHDHGIAHCDLKPENILFGPNGTLKICDFGTS
                     CVFQTAWEKQVHFQTGAVGSEPYVAPEEFIAEREYDPRLVDCWSCGVIYCTMVLGHYL
                     WKIPLVDKDSVYRSFVEEVRANREFVAFEELKHVNAEVNRCRKLCLYAVFQWNPDKRT
                     SIEKLLHSNWMKRTRCCVNYKTMK"
     gene            complement(<419404..>421263)
                     /locus_tag="KLTH0F04752g"
                     /db_xref="GeneID:8292610"
     mRNA            complement(<419404..>421263)
                     /locus_tag="KLTH0F04752g"
                     /product="KLTH0F04752p"
                     /transcript_id="XM_002554369.1"
                     /db_xref="GeneID:8292610"
     CDS             complement(419404..421263)
                     /locus_tag="KLTH0F04752g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F04752p"
                     /protein_id="XP_002554415.1"
                     /db_xref="GeneID:8292610"
                     /db_xref="InterPro:IPR007300"
                     /db_xref="UniProtKB/TrEMBL:C5DKH7"
                     /translation="MMSGWTKHWSVFAQFARANRAQLFKTYCLVPIGIILTLCILYGV
                     DRLIKNVIKVTFPSSVAVMLINFAFMCILSSWRRPYAEYYVRVIDVPLSWSLRWMNLF
                     FTPAFVTLPLSEWISFKEAMLIVAVFVIGYLSTFVFLAYITILGQKLFGSRRFISLFV
                     RQEELENGMEVGSRFTKISRSRASSGSEGQPSADSDVRSFRAVNSDTASDLNVLSDIA
                     SNSGLSPPRSRATSTAPSAVNESIPLQSPVGASQSSAEYQTHARDRRGNRGFLRSPER
                     INVRTPEPTYSARRMSEVAVDDKGTSPLICQRAITRQFSQHIDYMFSINMWDNHLHHI
                     LYGLGFLATIFAYYFSWYVMPFQFFTAVCAFMIIVDFPFNINPGIKKFLHPVICSVAL
                     TWIVMLVSVMIKHHKVSYFLRELKDYKTGRTYLHLFDNDQFAYHVWPGAGDIFSTCMD
                     VSIVGLSMPMYTHRLDLKRHFLSLIPPILLLCAASLTLYPLICSRIGISSDRSIGFVG
                     RSITLALGTPTIQNLDGSVTIMAVTTVISGIIGVLSGGPMLDLLRVPEDDYVTRGVTL
                     GCDCGAIATAYLLGVDRRAAAISTLSFVLFGAFMVILSAVGVIKVFVQNLAQV"
     gene            complement(<421673..>422068)
                     /locus_tag="KLTH0F04774g"
                     /db_xref="GeneID:8292611"
     mRNA            complement(<421673..>422068)
                     /locus_tag="KLTH0F04774g"
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /transcript_id="XM_002554370.1"
                     /db_xref="GeneID:8292611"
     CDS             complement(421673..422068)
                     /locus_tag="KLTH0F04774g"
                     /note="similar to uniprot|P32388 Saccharomyces cerevisiae
                     YKL167C MRP49 Mitochondrial ribosomal protein of the large
                     subunit not essential for mitochondrial translation"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /protein_id="XP_002554416.1"
                     /db_xref="GeneID:8292611"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DKH8"
                     /translation="MSRVARQLKFLNKISSSTLEPQVVLNSQKYAGLNLTFQYQNHNG
                     HMGARKFWHEYMPTLQFYNPGLQFQVTRVKNEDKNNAGVPCVLQTIGKDGSVLETLDM
                     RDKQHSEIMQEFLEKADYEKVPESDIVRV"
     gene            complement(<423222..>424898)
                     /locus_tag="KLTH0F04796g"
                     /db_xref="GeneID:8292612"
     mRNA            complement(<423222..>424898)
                     /locus_tag="KLTH0F04796g"
                     /product="KLTH0F04796p"
                     /transcript_id="XM_002554371.1"
                     /db_xref="GeneID:8292612"
     CDS             complement(423222..424898)
                     /locus_tag="KLTH0F04796g"
                     /note="similar to gnl|GLV|DEHA0E00440g Debaryomyces
                     hansenii DEHA0E00440g"
                     /codon_start=1
                     /product="KLTH0F04796p"
                     /protein_id="XP_002554417.1"
                     /db_xref="GeneID:8292612"
                     /db_xref="GOA:C5DKH9"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:C5DKH9"
                     /translation="MSQAAALSYHEPNIIVILILASFLIILNIVGRALDSLLYCGLLG
                     QIFIGVAWGLPGGKWLSLPFQQSVVQLGYLGLILLVYEGGLSTDFRAMKANFMLSTFL
                     ALTGVIAPIGMSFVLMSLSHATPLQSFAAGASLCSTSLGTTLTVLKISGLKQSRLGVV
                     LTCAAMLDDVVGLVMAQIISNLGGSGSINPVIIIRPILVSFAFAVVVPLVCVFLIKPL
                     ACRMQHCHLKKVRFFPTTVQMTFLAHTLILFGFVVGSSYAGTSNLYAAYLAGACIGWY
                     DNEVNRGAFVERTSATLANSNKGYFSPKKIGQMLALAPQAEAFSKSSKHPHSDFETPK
                     LPPSAAIRCSGTDDLNDNVEEENTEDKQLNPNDTVTGSETSISTSNLRSGHVSGLHIW
                     EAYYEVPLSTVLKPFFFASIGFSIPISEMFDGNIIWKGIVYAILMTLGKFICGAWLLR
                     SICFKRFANDVESGGHIWGFPKARSLIPPSIMGYAMVARGEIGFLISALAESRGIFTP
                     EQYYIVTWGIVLCTIVGPLMVGLLTSKVRKIRDSKELAASAEHDPMGIWA"
     gene            complement(<425861..>426169)
                     /locus_tag="KLTH0F04818g"
                     /db_xref="GeneID:8292613"
     mRNA            complement(<425861..>426169)
                     /locus_tag="KLTH0F04818g"
                     /product="KLTH0F04818p"
                     /transcript_id="XM_002554372.1"
                     /db_xref="GeneID:8292613"
     CDS             complement(425861..426169)
                     /locus_tag="KLTH0F04818g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F04818p"
                     /protein_id="XP_002554418.1"
                     /db_xref="GeneID:8292613"
                     /db_xref="UniProtKB/TrEMBL:C5DKI0"
                     /translation="MKATQDKTFNTLPHEVQFNAQFQILVTPALEPRSVMREDKIFES
                     AGVQLKCLDRAQEYKLKITPTLARSRFLFKKVMYFYKRVNWIQIYSHIKVKRGDSVVI
                     "
     gene            complement(<427194..>428339)
                     /locus_tag="KLTH0F04840g"
                     /db_xref="GeneID:8292614"
     mRNA            complement(<427194..>428339)
                     /locus_tag="KLTH0F04840g"
                     /product="KLTH0F04840p"
                     /transcript_id="XM_002554373.1"
                     /db_xref="GeneID:8292614"
     CDS             complement(427194..428339)
                     /locus_tag="KLTH0F04840g"
                     /note="highly similar to uniprot|P05986 Saccharomyces
                     cerevisiae YKL166C TPK3 and highly similar to
                     uniprot|P06244 Saccharomyces cerevisiae YJL164C TPK1"
                     /codon_start=1
                     /product="KLTH0F04840p"
                     /protein_id="XP_002554419.1"
                     /db_xref="GeneID:8292614"
                     /db_xref="GOA:C5DKI1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKI1"
                     /translation="MSQSEQRMRETLQELPSGLLGSGSVPETQQQSLPETQQQSSLGQ
                     QAVEAKNAQKTELQGRQTSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVL
                     KKRTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDAEQVFMIMDYIEGGELFSLL
                     RKSQRFPNPVAKFYAAEVCLALEYLHAHEIIYRDLKPENVLLDKNGHVKITDFGFAKY
                     VPDVTFTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYE
                     NILNAQLQFPPFFHADVQDLLSQLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLL
                     CRNIETPYEPPVHAGQGDTSQYDRYPEEENSYGAEGDDPHHDLFAEF"
     gene            complement(<428886..>430730)
                     /locus_tag="KLTH0F04862g"
                     /db_xref="GeneID:8292615"
     mRNA            complement(<428886..>430730)
                     /locus_tag="KLTH0F04862g"
                     /product="KLTH0F04862p"
                     /transcript_id="XM_002554374.1"
                     /db_xref="GeneID:8292615"
     CDS             complement(428886..430730)
                     /locus_tag="KLTH0F04862g"
                     /note="similar to uniprot|P46996 Saccharomyces cerevisiae
                     YJL163C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F04862p"
                     /protein_id="XP_002554420.1"
                     /db_xref="GeneID:8292615"
                     /db_xref="GOA:C5DKI2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DKI2"
                     /translation="MTENLPAGEQEPNEGSPLLHQNPLGPDLEGLRGVDATNAELEFV
                     VESTGVALVEEAMGNGSSPQGAPSNGPETEEARWLRESKLKHSKLAWYYRPSLSLLCF
                     TVALMSLAETMVASPSIILTTQKVCQGISPGSPDSPEEARCDMPKAQSTFSSIQSAQM
                     LIQGIVGTLLAGKLGELSDRFGRKPIFQYVGCVRLVSLLAIVYTILPSTPYSKWKIIL
                     ANSIQALSGGLMLTIANGNSYITDCTEPKDRTIAISMLMSTIYACIGTGPLIGSAAIK
                     LSNGNNYMPFVIAVMFITFFTIFTTIFLTESRHVNALRQSQTKFRDRRRSFESVLTNT
                     SSVSVTRHGRYQALKFLDLLSPLKKMWLPPSVHGSLIPRYTVLILVALDVLFIISTTG
                     MVVPLVLFATYKYRWDSVHLGYFISFIGIGRAMVLLILSPLFLHVLKKMYTRLDNSVD
                     AIDLMSLRTAMFSVVISIAAILLWDDTRGLVLLVFAVFQNLSAFFSPTLQATLVKYCS
                     KSSLGELFGAIALVRSATMLVFPPILLLVYAHTNTTKPKIFMTVPLLASILAFILTFM
                     LHIVTDSELLRRPSQASLAPSSQPAHTNKGSKDQRMSTSRTSRKPSSI"
     gene            complement(<431251..>434019)
                     /locus_tag="KLTH0F04884g"
                     /db_xref="GeneID:8292616"
     mRNA            complement(<431251..>434019)
                     /locus_tag="KLTH0F04884g"
                     /product="KLTH0F04884p"
                     /transcript_id="XM_002554375.1"
                     /db_xref="GeneID:8292616"
     CDS             complement(431251..434019)
                     /locus_tag="KLTH0F04884g"
                     /note="highly similar to uniprot|P36051 Saccharomyces
                     cerevisiae YKL165C MCD4 Protein involved in
                     glycosylphosphatidylinositol (GPI) anchor synthesis
                     multimembrane-spanning protein that localizes to the
                     endoplasmic reticulum highly conserved among eukaryotes"
                     /codon_start=1
                     /product="KLTH0F04884p"
                     /protein_id="XP_002554421.1"
                     /db_xref="GeneID:8292616"
                     /db_xref="GOA:C5DKI3"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR007070"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR017852"
                     /db_xref="UniProtKB/TrEMBL:C5DKI3"
                     /translation="MWSKQRLTFVVVGILFHFVYLWSIFDIYFVSPLVHGMQTYRSTD
                     APPAKRLFLIVGDGLRADTTFDKITHPTTGETAHLAPFLRSLVLNNATYGVSHTRMPT
                     ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILPMFKDGAS
                     DPNKVDAWMYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQPGNVFFL
                     HLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFTADHGMSA
                     FGSHGDGHPNNTRTPLIAWGAGLNRPVLNKAPIYDNYTEGWDLANIQRNDVKQADIAS
                     LMTYLIGADYPANSVGELPLSYIDGSEENKLKALYSNAKAILEQYLVKEQEIELSQFQ
                     YKPYHKFVEKPASQYLDEIEQLIERISAGDESLESPAIKLTEELMSVTLEGLHYLTTY
                     NWQFTRTIVTFGFVGWITYSFIIFLRLFILTKEYELKTTITNLAIFGALSLVLNYVLH
                     YQRSPFNFYMYLMFPLFFWSQIFKSRVILGDGLGEFFEGITLPKKLGILAAVLAIYES
                     IVYGFFSRWIFTVSFVVLGFYPLACGIKDVRTNILWLATSLSISVFTLFDAVKVESLK
                     QINAASALIVLSACWGIYHLRQDIKAHTSKVLVIQVVLIVAMVAITNKSVISLQNREG
                     LPRDSQIGGWIVFALSLAVMPIFHYLEPSNDYRVRMLIIYLTFAPAFIILTISFESFF
                     YFLFTAYIVQWIEIESGIKENSAKNASSHNWLQLLRVSVIGFFLMQVAFFSTGNIASI
                     SSFSLDSVYRLMPIFDPFPMGALLVLKLILPYITLSSGLGILNLKLRFKDYSISSLII
                     CTSDILSLQFFYLLKTEGSWLDIGVSISNYCLAILSSLIMLLLEFISHVLLRNVSLSR
                     ADKVKKTQ"
     gene            complement(<434195..>435967)
                     /locus_tag="KLTH0F04906g"
                     /db_xref="GeneID:8292617"
     mRNA            complement(<434195..>435967)
                     /locus_tag="KLTH0F04906g"
                     /product="KLTH0F04906p"
                     /transcript_id="XM_002554376.1"
                     /db_xref="GeneID:8292617"
     CDS             complement(434195..435967)
                     /locus_tag="KLTH0F04906g"
                     /note="weakly similar to uniprot|P46997 Saccharomyces
                     cerevisiae YJL162C JJJ2 Protein that may function as a
                     cochaperone as suggested by the presence of a DnaJ-like
                     domain"
                     /codon_start=1
                     /product="KLTH0F04906p"
                     /protein_id="XP_002554422.1"
                     /db_xref="GeneID:8292617"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5DKI4"
                     /translation="MISEDMWVDETTHYSVLGLKSDASESQIKKAYRRIAMAIHPDKN
                     KSASAAEMFKLVSHAQSVLIDKELRRTYNRSLISKGLYTYVPKKTKLSALVAATASSV
                     SETSNSSPRKTNVPQSARASAPNPTTPSRDKIRPSTAFSRKSKPYEQQPYGFGVDSDV
                     HGSPFASQDKPFNAKSYQHQRPSNNHTTTDAKLGSSTFSSRFPSSVPDLDIPHSADED
                     PSTPFSEGKRTKLPKKDTQEFIPDPPGSPFPSNFHRHYARTSHNDKQQNRRSTSPVKS
                     QPTPTTDTLQGLKDILDKFKNPKVNKTSIDEPISLEEHERNSGSAKEADKLSQTQAER
                     GTESHDGAPGSTSSPKMEDSSATVRSTLPQEKARKRPIVGLKAEVFKTKEKDDIRLTE
                     LENVLPKDDEFFDMRKVSDTLDNVRIKRLKTERAHSPEVDMMEDSHSSPLFPYEIGAE
                     TLSRPVNETLPRIYKPELVSATELGINEAIVDLSLPALPALQINVLDKQQVLQTIQVI
                     KNFNLHANKIKRRLLDTLSRRSTADDLFNERLVRVENANILLQAKAYDLRIAEKLQEL
                     QNRQRIVAESFATLMGSIYASKKR"
     gene            complement(436684..436757)
                     /locus_tag="KLTH0F04928r"
                     /db_xref="GeneID:8292618"
     tRNA            complement(436684..436757)
                     /locus_tag="KLTH0F04928r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:8292618"
     gene            complement(436911..436982)
                     /locus_tag="KLTH0F04950r"
                     /db_xref="GeneID:8292619"
     tRNA            complement(436911..436982)
                     /locus_tag="KLTH0F04950r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=73.79"
                     /db_xref="GeneID:8292619"
     gene            <437256..>437774
                     /locus_tag="KLTH0F04972g"
                     /db_xref="GeneID:8292620"
     mRNA            <437256..>437774
                     /locus_tag="KLTH0F04972g"
                     /product="KLTH0F04972p"
                     /transcript_id="XM_002554377.1"
                     /db_xref="GeneID:8292620"
     CDS             437256..437774
                     /locus_tag="KLTH0F04972g"
                     /note="similar to uniprot|P46998 Saccharomyces cerevisiae
                     YJL161W FMP33 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0F04972p"
                     /protein_id="XP_002554423.1"
                     /db_xref="GeneID:8292620"
                     /db_xref="UniProtKB/TrEMBL:C5DKI5"
                     /translation="MKPSDSGSHVDGDSRPKTGLHSENLSRETSGNSRVKAKPQYVPF
                     KASKSNVFSNVVINSLFGLGLYYLYRDYQEDKRASAKARGTVTIVHDRASDSQAKGGQ
                     VRGSGLLPKMSYKDLSFVTVGFGFLLQLANMAHVSFGKRSPLYRASILSVALYPPFAY
                     YMYSMRDQKVAK"
     gene            complement(<438107..>439237)
                     /locus_tag="KLTH0F04994g"
                     /db_xref="GeneID:8292621"
     mRNA            complement(<438107..>439237)
                     /locus_tag="KLTH0F04994g"
                     /product="KLTH0F04994p"
                     /transcript_id="XM_002554378.1"
                     /db_xref="GeneID:8292621"
     CDS             complement(438107..439237)
                     /locus_tag="KLTH0F04994g"
                     /note="similar to uniprot|Q03178 Saccharomyces cerevisiae
                     YKL164C PIR1 Protein containing tandem internal repeats"
                     /codon_start=1
                     /product="KLTH0F04994p"
                     /protein_id="XP_002554424.1"
                     /db_xref="GeneID:8292621"
                     /db_xref="GOA:C5DKI6"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DKI6"
                     /translation="MQYKSTILAAAALASSASAAVTASEPWTTLTPTATFKSGATSYS
                     ETFGIAVVPVTSSVSTLSAATASKTDHAKRDAISQIGDGQIQATTSATATPSKKSSAA
                     AISQIGDGQIQATTSTAPAKKSSAAAISQIGDGQIQATTSTAPAKKSSAAAISQIGDG
                     QIQATTSTASAKKSSAAAISQIGDGQIQATTSTASAKSSAAAISQIGDGQIQATTTTL
                     KPSSAAAISQIGDGQIQATSANSTVSAASQISDGQIQASSTSSISPASSSDASEFVSS
                     VSCKTDGTLEMTLEGGILRDGKGRVGSIVANRQFQFDGPPPQAGAIYAAGWSITPEGN
                     LAIGEHDTFYQCLSGNFYNLYDESIGAQCSQVHLEVIELIDC"
     gene            <440672..>441877
                     /locus_tag="KLTH0F05016g"
                     /db_xref="GeneID:8292622"
     mRNA            <440672..>441877
                     /locus_tag="KLTH0F05016g"
                     /product="KLTH0F05016p"
                     /transcript_id="XM_002554379.1"
                     /db_xref="GeneID:8292622"
     CDS             440672..441877
                     /locus_tag="KLTH0F05016g"
                     /note="similar to uniprot|Q03178 Saccharomyces cerevisiae
                     YKL164C PIR1 Protein containing tandem internal repeats"
                     /codon_start=1
                     /product="KLTH0F05016p"
                     /protein_id="XP_002554425.1"
                     /db_xref="GeneID:8292622"
                     /db_xref="GOA:C5DKI7"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DKI7"
                     /translation="MQYKSTILAAAALATSASAAVTASEPWTTLTPTATFKSGATSYS
                     ETFGIAVVPLSSSVSTVSASTSAAHAKRDAISQIGDGQIQATTSTTAAPSKKTSAAAI
                     SQIGDGQIQATTSTASAKKSSAAAISQIGDGQIQATTSTAPAKKTSAAAISQIGDGQI
                     QATTSTASAKSSAAAISQIGDGQIQATTSTAAAKKSSAAAISQIGDGQIQATTSTAAA
                     KSSAAAISQIGDGQIQATTTTLKPSSAAAISQISDGQIQASTTTNSTETATAASQVSD
                     GQVQATTSASSSPASSSDASSFIDSVSCKADGTLEMTLEGGILKDGKGRIGSIVANRQ
                     FQFDGPPPQAGAIYAAGWTITPEGNLAIGETDTFYQCLSGNFYNLYDESIGAQCSPVH
                     LEVIELVDC"
     gene            complement(442348..442419)
                     /locus_tag="KLTH0F05038r"
                     /db_xref="GeneID:8292623"
     tRNA            complement(442348..442419)
                     /locus_tag="KLTH0F05038r"
                     /product="tRNA-Cys"
                     /note="tRNA-Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:8292623"
     gene            complement(<442756..>443496)
                     /locus_tag="KLTH0F05060g"
                     /db_xref="GeneID:8292624"
     mRNA            complement(<442756..>443496)
                     /locus_tag="KLTH0F05060g"
                     /product="KLTH0F05060p"
                     /transcript_id="XM_002554380.1"
                     /db_xref="GeneID:8292624"
     CDS             complement(442756..443496)
                     /locus_tag="KLTH0F05060g"
                     /note="similar to uniprot|P47001 Saccharomyces cerevisiae
                     YJL158C CIS3 cik1 suppressor Protein with homology to
                     Hsp150p and Pir1p Pir2p and Pir3p"
                     /codon_start=1
                     /product="KLTH0F05060p"
                     /protein_id="XP_002554426.1"
                     /db_xref="GeneID:8292624"
                     /db_xref="GOA:C5DKI8"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DKI8"
                     /translation="MQIRNIIASAIASSCVVSAEEVNSSSWTTLTPSKTYQGGATDYA
                     DSFGIAVKPVSGTSVTASAASATGKSKRDAVSQIGDGQIQGTTSTALPVSTVSTPEPE
                     STAAASQVSDGQIQATTSTASKETTTLSSASASASSDVDDDIKVVSCKVNGTLEMTLS
                     NSILKDGKGRIGAIVANRQFQFDGPPPQAGSIYAAGWSITTDGNLAIGETEVFYQCLS
                     GTFYNLYDESIGAQCSPVHLEVVKLIDC"
     gene            complement(<444440..>447688)
                     /locus_tag="KLTH0F05082g"
                     /db_xref="GeneID:8292625"
     mRNA            complement(<444440..>447688)
                     /locus_tag="KLTH0F05082g"
                     /product="KLTH0F05082p"
                     /transcript_id="XM_002554381.1"
                     /db_xref="GeneID:8292625"
     CDS             complement(444440..447688)
                     /locus_tag="KLTH0F05082g"
                     /note="weakly similar to uniprot|P21268 Saccharomyces
                     cerevisiae YJL157C FAR1 Cyclin-dependent kinase inhibitor
                     that mediates cell cycle arrest in response to pheromone
                     also forms a complex with Cdc24p Ste4p and Ste18p that may
                     specify the direction of polarized growth during mating
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0F05082p"
                     /protein_id="XP_002554427.1"
                     /db_xref="GeneID:8292625"
                     /db_xref="GOA:C5DKI9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DKI9"
                     /translation="MQATTPISETRLKKVHTPPSRGSSSPSSLRSTKKKSGGVMNRVN
                     LKFRALSSSSLPSPSRLAPEERPRIVHASSQRVPTENDHYFWPSNLPAAKPMTNTRKR
                     RNTPAPLTLSQITPHATPQKQHGIKDATPKLESPMDFRHSTNSSTDNASWVTASTFNP
                     RRRLNFELQGNFESPLDDSLTIERSSRSPWEDLYPDSESPTYASQLRSNMSKLSGPKN
                     YTSNKCSICSEDLMFTLSGEKLIELSCNHQCHFNCYLVTFEALLPKSSFPQCRICTTA
                     SKPKSEDVMSEITAKILTSEAQGNDKTFMEQGGKQQRAIFERSDGNDVRPQTIFPITQ
                     NTPKENIYLQDLRTPREQLIKSAQVSCEGFKDHFSTQSTPRSKFSKFSSSDSFRTPSS
                     TSQSEWHRSDFELDRPHVNIIPQLSKFSIKENSRQAIAQYVMSTYTPKHPAIAKGVED
                     YKNLIRKEVQSHVQSGFDYKPEMGALETFDILCYSEDEEVWVNVNAFLFSECLVFVQE
                     DNLVGHILKNQISEMHQLDSHTLILNLKSKSLPEIFLCCPDDPSITRKWTYYLRQVYL
                     TRGGEHVPLSQLTSNNWNFLPQKLIKKVRIPSETGFEDNDLSGTFALQEKTKLKLILC
                     VSVVNCHPELHTNNEHLLSLKAKIKQTVDSLSSQDLLGLVLVGRDGCGNVGAFGTFFG
                     MVGKDWDGWEDIIESLEVYDNNAVFANDSWELNAMLQTSRKLMCTVEQDESFLQQLVI
                     IGNDYPGNMPRTIEDDFQVARLQSNVSLSLQKFRFSVHQYFTCNSRLLLSDIIEGYFY
                     NVKCEGLNTLEEIRPDSLVQQLRKKAAKSFAVTLGTLDPNLAQFHAVERNGQLCKLPG
                     LCTEVTMEIGALAPGEARNLIFEIEIDVQNLKHLLKNTSASNQPALLHYNATWHNGSR
                     RLVFSGCSLGCEFKLGNVSTALPPTDALRDPPQSGHDANDECEILEVMLAPPLSASRD
                     SLFATRHVELIAIETLRSALAQFPYHTHVLLNQLVPMIFCISRSCVCNDASYHTRVST
                     VKPLPQLVEQLCADIQEIAARSVSGNGADRALSRWEMARMTAALACGTYGAP"
     gene            complement(<448219..>450258)
                     /locus_tag="KLTH0F05104g"
                     /db_xref="GeneID:8292626"
     mRNA            complement(<448219..>450258)
                     /locus_tag="KLTH0F05104g"
                     /product="KLTH0F05104p"
                     /transcript_id="XM_002554382.1"
                     /db_xref="GeneID:8292626"
     CDS             complement(448219..450258)
                     /locus_tag="KLTH0F05104g"
                     /note="similar to uniprot|P47002 Saccharomyces cerevisiae
                     YJL156C SSY5 Component of the SPS plasma membrane amino
                     acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
                     external amino acid concentration and transmits
                     intracellular signals that result in regulation of
                     expression of amino acid permease genes"
                     /codon_start=1
                     /product="KLTH0F05104p"
                     /protein_id="XP_002554428.1"
                     /db_xref="GeneID:8292626"
                     /db_xref="GOA:C5DKJ0"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR012985"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ0"
                     /translation="MAKKLFGIGRKKTEAKDTKSGDASPSSTAPSSCIDEDVMDTTGS
                     SKFDDSSSRVTSSIQSSSIFSKGRLTHGTGASSTLTGGSQDKKSGDTSNVGKPLRVLD
                     FGRGTSLNPVFEEEDSTGLNSIDEHSSRPSKSSQRSGTSLNKEKTMITAAQLDRELKQ
                     LDENLAGLMDDIHQNVTNISKAVIQAVEYFKEFLPDTLSPKVPFRVSVSKSGYLRRIT
                     KVVLHFVDNLLVSDVFNNSRAIITKRFITFLKKLNISTTEDNIENHALPHARNFCIGA
                     DCELPNKGKLSLIIDKIAAKDSACISDQEGAFIAPILRGISKGSAVLTVMFGLPDPQQ
                     EHYDMIKALYSLFPDIHFYCVKNYITPCAEVAIPPSLTPQPMESKTTTSFHPPYRLLP
                     DANSPPISMSLSSHENKKISGTLGGYIYPQIDENNAALSQFAGSTFAITCAHVALAES
                     QDYPYVSVPSTVLQNQYKKAIIDESQRYAKDSPERAAFEEELIRIDQNLKWQDENKFG
                     QVVWGERAVVNSKLSDFAIIKTNSELNCTNFLGDDVATMAGPFLRFQNLYVKDKVLKL
                     KPGSEVFKIGATTKYTSGQFSGSKLVYWADGKIQSSEFVVASPNPLFASGGDSGAWIL
                     TKLTGKLGLGVVGMLHSYDGEQRQFGLFSPIGDIFQRLNQVTGVTWDICRPPNAK"
     gene            complement(<450521..>451813)
                     /locus_tag="KLTH0F05126g"
                     /db_xref="GeneID:8292627"
     mRNA            complement(<450521..>451813)
                     /locus_tag="KLTH0F05126g"
                     /product="KLTH0F05126p"
                     /transcript_id="XM_002554383.1"
                     /db_xref="GeneID:8292627"
     CDS             complement(450521..451813)
                     /locus_tag="KLTH0F05126g"
                     /note="highly similar to uniprot|P32604 Saccharomyces
                     cerevisiae YJL155C FBP26 Fructose-2 6-bisphosphatase
                     required for glucose metabolism"
                     /codon_start=1
                     /product="KLTH0F05126p"
                     /protein_id="XP_002554429.1"
                     /db_xref="GeneID:8292627"
                     /db_xref="GOA:C5DKJ1"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ1"
                     /translation="MVGLPARGKSFISQKIVRYLSWLSIKSKCFNVGSYRRQGAPRPS
                     AGFFDASNKEAYRIREQAVAQAVEDMMNWFSDEEGVVAILDATNSTKERRKWILRLCR
                     ENSIEPMFLESWCDDKDLVLRNIADVKTSSPDYKGIDPDVATADFLERIANYEQVYQP
                     LDTTDDRDLTFVRMINIAQQVIINKVETYLESRIVFYVMNLHIKPRYIWLSRHGESIY
                     NIEKKIGGDSSLSERGLKYAKKLPELVRESAGDRDLTVWTSTLIRTQETAQHLPYKQL
                     QWKALDELDAGECDGMTYEEIEEKFPEDFKARDEDKYEYRYRGGESYRDVVIRLEPII
                     MELERQENILIITHQAVLRCIYAYFMNVPQEESPWMSIPLHTLIRLEPRAYATHVTKI
                     KADIPAVSTYKGKGTSRVGESESDNDKSLHVLSSLNSK"
     gene            complement(<452835..>455408)
                     /locus_tag="KLTH0F05148g"
                     /db_xref="GeneID:8292628"
     mRNA            complement(<452835..>455408)
                     /locus_tag="KLTH0F05148g"
                     /product="KLTH0F05148p"
                     /transcript_id="XM_002554384.1"
                     /db_xref="GeneID:8292628"
     CDS             complement(452835..455408)
                     /locus_tag="KLTH0F05148g"
                     /note="similar to uniprot|P34110 Saccharomyces cerevisiae
                     YJL154C VPS35 Protein involved in vacuolar sorting
                     retromer complex component"
                     /codon_start=1
                     /product="KLTH0F05148p"
                     /protein_id="XP_002554430.1"
                     /db_xref="GeneID:8292628"
                     /db_xref="GOA:C5DKJ2"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ2"
                     /translation="MSYAENIEQAISNCRQQTVLMQRCLSQGKLMDALKHTSIMLTEL
                     RSPTLSPKQYYELYILIYDSLSILSSYFVECHPKKHHLADLYELVQYAGNILPRLYLM
                     ITVGSSYLQSSDAPREEILKDMIEMCKGVQNPIRGLFLRYYLSQRTKPFFETEDPEAK
                     RANISLIVANFIEMNKLWVRLQHQGPLREREQRTRERKELKILVGTNLVRLSQIVESD
                     FAMYRDEILPLVLEQVVQCRDIVSQEYLLDVICQVFPDEFHLGTLSELLSTTLKLSPA
                     APVNEVVLTLVERLNGYIDRQEHPGPDELAKKLESLDISSESQNVFFVFWKFLNQLNE
                     ERPDLSLQEFAPIIKGILKLTLRWYPDNLSNVDVLLKFMYEKCKESGQTVPEDYDYLF
                     QELLLANDLRHDPRFFYQVLTKCESYQKLFRVQNKGLQKFCVNEILDAITHADLRISS
                     ETELQKILGVCEVMIEVGAEKASSSLILDEDDGTDAEKWSLNADQEKLAKIAHLCYNK
                     SIEKHTELLIACREWFQKGDKNAKYLYPAVICNIWKLIRKCQLMIKRKPQRREKMSTT
                     IKQLFKLASRTINELYNTCEGGCLDLLYKLNLQTASLADQLELGDIAYDFFSQAFTIF
                     EESLSDSRTQFQAIVNMAQTLQKTRSLYAESSYDTLITRCTLHGSKLLKKQDQCRAVY
                     TCSHLWWATEISLLGEEEGVTDNFFREGKRVLECLQRSLRVADSIMDNVQSCQLMVEI
                     LNRCCYYFVHGDENSTHVGTKYINGLIELIKTNLKSLKMEANQGEDSGERFFIGTDGS
                     YIHQSPVNSVSAVYNKPPTSKGNNLASVPIEFFQRTLQYIEDQKDVDERFKAISVGST
                     S"
     gene            <456433..>457476
                     /locus_tag="KLTH0F05170g"
                     /db_xref="GeneID:8292629"
     mRNA            <456433..>457476
                     /locus_tag="KLTH0F05170g"
                     /product="KLTH0F05170p"
                     /transcript_id="XM_002554385.1"
                     /db_xref="GeneID:8292629"
     CDS             456433..457476
                     /locus_tag="KLTH0F05170g"
                     /note="similar to uniprot|P00431 Saccharomyces cerevisiae
                     YKR066C CCP1 Mitochondrial cytochrome-c peroxidase
                     degrades reactive oxygen species in mitochondria involved
                     in the response to oxidative stress"
                     /codon_start=1
                     /product="KLTH0F05170p"
                     /protein_id="XP_002554431.1"
                     /db_xref="GeneID:8292629"
                     /db_xref="GOA:C5DKJ3"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019793"
                     /db_xref="InterPro:IPR019794"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ3"
                     /translation="MSAFGATFTRTFNKRSLALLAGVTAAAGSAVAFQNYQSSNNGNG
                     FGRSSKLWGTLSAGTALHVAEAQKKPEDYQKVYNAIALKLRDEDEYDNYIGYGPVLVR
                     LAWHISGTWEKDDNSGGSFGGTYRFKKEMDDPSNKGLQNGFKFLKSIHEKFPWISHGD
                     LFTLAGVTAIQEMQGPKIPWRAGRVDQKEDTTPDNGRLPDASRDANYVRNFFKRMNFD
                     DREVVALLGAHALGKTHYKNSGFEGPWGAATNVFSNEYYVNLLNEKWKKVKNDEGNIQ
                     YDSDKGYMMLPTDMALVQDPKYLKIVKEYANNQDTFFNDFTKVFTKLIQNGIEFPKEI
                     KATTFKTLDEQDI"
     gene            <458025..>458612
                     /locus_tag="KLTH0F05192g"
                     /db_xref="GeneID:8292630"
     mRNA            <458025..>458612
                     /locus_tag="KLTH0F05192g"
                     /product="KLTH0F05192p"
                     /transcript_id="XM_002554386.1"
                     /db_xref="GeneID:8292630"
     CDS             458025..458612
                     /locus_tag="KLTH0F05192g"
                     /note="similar to uniprot|P36147 Saccharomyces cerevisiae
                     YKR065C FMP18 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0F05192p"
                     /protein_id="XP_002554432.1"
                     /db_xref="GeneID:8292630"
                     /db_xref="InterPro:IPR013875"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ4"
                     /translation="MLSARVIAYTRPAAKLASRNLSTVQPRFSEQSKSTDAKNEAQTN
                     GLFTWTDFFQLRKQERRINLGSSIVTAFLSTNASWAYLSTMQIDPMQTIMGFDPLVVV
                     SAALMASGAFGYLLGPIFGTTVFKMKQKTNLANYNKKTKDFLRHVITNRVDSSSQSFS
                     NPVPDYYGEKIGSVAEYRQWLRDCHAFRRKAKEFL"
     gene            complement(<458955..>459335)
                     /locus_tag="KLTH0F05214g"
                     /db_xref="GeneID:8292631"
     mRNA            complement(<458955..>459335)
                     /locus_tag="KLTH0F05214g"
                     /product="KLTH0F05214p"
                     /transcript_id="XM_002554387.1"
                     /db_xref="GeneID:8292631"
     CDS             complement(458955..459335)
                     /locus_tag="KLTH0F05214g"
                     /note="similar to uniprot|P14359 Saccharomyces cerevisiae
                     YJL151C SNA3 Integral membrane protein localized to
                     vacuolar intralumenal vesicles computational analysis of
                     large-scale protein-protein interaction data suggests a
                     possible role in either cell wall synthesis or
                     protein-vacuolar targeting"
                     /codon_start=1
                     /product="KLTH0F05214p"
                     /protein_id="XP_002554433.1"
                     /db_xref="GeneID:8292631"
                     /db_xref="GOA:C5DKJ5"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ5"
                     /translation="MSEIYSFNKDDLILAVLAFFIPPLPVLIRRGLRKDFWINFLLCF
                     FLGFPAMFHALYVIHKSSREHPLNRGDSETDLEAQAHLTAPEASKDSEQEEAREIDEV
                     PPAYNQVPTGTPAAHAATDNKIQH"
     gene            <460572..>462356
                     /locus_tag="KLTH0F05236g"
                     /db_xref="GeneID:8292632"
     mRNA            <460572..>462356
                     /locus_tag="KLTH0F05236g"
                     /product="KLTH0F05236p"
                     /transcript_id="XM_002554388.1"
                     /db_xref="GeneID:8292632"
     CDS             460572..462356
                     /locus_tag="KLTH0F05236g"
                     /note="similar to uniprot|P47005 Saccharomyces cerevisiae
                     YJL149W"
                     /codon_start=1
                     /product="KLTH0F05236p"
                     /protein_id="XP_002554434.1"
                     /db_xref="GeneID:8292632"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ6"
                     /translation="MTRAQEDLAEYGSLLNKLPTALLQEVLSHLSQQDRVNACLVNRK
                     FNEIATKLVYRRIYLNDSNVVRSDIMNVAVNWTLLYVPNRLPEESARSVANRKLRILI
                     RTLRSSKRAVNCVEWVRINWDLNPLYQKNLLSIVCNESASLLRLENVTDPSCNDIIAN
                     GRVSSTKLTSFDMAPPSPNAGSEVEPAYIPNLKKYLTQRISSHITFMNLFMDPLVLFT
                     YLYPLRDKLQVVDLKLHWRIEFFPQEHFVHKISERPLTQLSDVFDPRSLKVLTIVSWH
                     ECLLPNELSMIKQLKEFTSIEDLSLISIEQESLPLIGLFSSLTGLKRLKTDFIEELSP
                     QSTRPELFLTILHNCRDLEFLDMRFEGLDAPIINVENGEFQISQKCHCSRCMHVFDSI
                     IRQKLFLFPEDYLVAGIQDVTTKDIFRMMRFNCLLPYSKACDYYPSVRTYPMDIESFV
                     LLMNSSLRLYRASRCQLIRDPVVPLDTGDLVDSEDDDEDTNMILPHKPLTKQDVLDCY
                     HALIHHQRRTYIALLSQFPKLRFLVLNDVATVVINEDDERILQPVFYNNGFVSNLKGW
                     TDNGKSQRDSRVFMEKSALYESMKRLEV"
     gene            complement(<462417..>464825)
                     /locus_tag="KLTH0F05258g"
                     /db_xref="GeneID:8292633"
     mRNA            complement(<462417..>464825)
                     /locus_tag="KLTH0F05258g"
                     /product="KLTH0F05258p"
                     /transcript_id="XM_002554389.1"
                     /db_xref="GeneID:8292633"
     CDS             complement(462417..464825)
                     /locus_tag="KLTH0F05258g"
                     /note="weakly similar to uniprot|P36023 Saccharomyces
                     cerevisiae YKR064W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F05258p"
                     /protein_id="XP_002554435.1"
                     /db_xref="GeneID:8292633"
                     /db_xref="GOA:C5DKJ7"
                     /db_xref="InterPro:IPR001138"
                     /translation="MEQDRASDVPPAKKRRRPTVVCTNCKRRKSKCDRLKPVCGNCLR
                     LGDETTCAYGLEPAGEARKPGVSRLVAQCFEMVRSTQPTLIDLQPNGVLIQCKRSCTS
                     YIAPLTPSAAKQRDPYLQALGLVCQLKRTMRAADPAPKKEGTAEATSRGSLPNSMRYI
                     ESIEQNSPEQPASLASRHKNMCRQLFTKFGKYRRNHTSSTEDDLKALPSRVPAKKVFF
                     RHIWPYFWSHLSGLCPIFDEAQLEKSLKRVYDRFSPDTHSKLDVEDYACFSIVLLITC
                     LVQLSLKFAQDYTEENTNSESSIVMGIDTSKFISMVNGCISRKKGDRKCSLLRLQSLL
                     LLRFYYWCAPDDGDGDYLQHSNMLMGKIVAACYSMGIEWQCVRDPEEFVNNFNLCLGL
                     MPLEAEYDASDYKKIWTTVLHWDRKLSLLTGQRCLIGNSIKLPTPGHESPSCALLKFD
                     SLILKICDMISNDPRRVDATAVIRLLETLRQSLKKDTRENIVNPALGFEWGMVIALLE
                     LTITHAHMVHSEKTESPDEFCDCIQGLFEKVLQITKICEQYLYSQEGLDPSARFYTNK
                     IVDIAFSSISAIFPSLILRSGRSIEPHTKTTLLNFYRDILSASFNTIGVEYYSCFRRM
                     FPSKLVFRTLSAAGDEDPWTRILEFIVSSDYNKEFALLQRSGIFKQFFKSYEKTGNVE
                     SAASLWSAYYAPNDLYSFDLDVKSFGLQMPFSHSNRYNDYDVFEAFFNNAKTLFLAKV
                     PNLPALNGTALGQGAFNYFDYSLLQGIENFDSADFLDFFEPGGSEALVELESQESPSN
                     HDIC"
     gene            <464952..>466367
                     /locus_tag="KLTH0F05280g"
                     /db_xref="GeneID:8292634"
     mRNA            <464952..>466367
                     /locus_tag="KLTH0F05280g"
                     /product="KLTH0F05280p"
                     /transcript_id="XM_002554390.1"
                     /db_xref="GeneID:8292634"
     CDS             464952..466367
                     /locus_tag="KLTH0F05280g"
                     /note="weakly similar to uniprot|P36146 Saccharomyces
                     cerevisiae YKR063C LAS1 Essential nuclear protein possibly
                     involved in bud formation and morphogenesis mutants
                     require the SSD1-v allele for viability"
                     /codon_start=1
                     /product="KLTH0F05280p"
                     /protein_id="XP_002554436.1"
                     /db_xref="GeneID:8292634"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ8"
                     /translation="MVAHRLSHRAHQLMAQHEPRIVPWRYKSDLDGLKRAFYPKKFGT
                     ADRRREAVVKVRCWNTRGPYVPHTVESTAHLAETKMLDEQALLSGIPLQLSYTMAMIR
                     FVNGLLDPTQQSQFAIPLHTLAERMGLPSWFVELRHCGTHERELPSLDMLRLASESAL
                     EWLWEHYWDADEEPAQEEEEQEQTPDVSAETVERVLRKASSIANLLTANGNMWKTQRV
                     SSSFTGEQDPQQKRQKRAEKPEERLERFVLAAKDAWRSVKARPDVFVGALMRNYRSRQ
                     GPVLELLADRIQPFGFELCRWVCENYDAAIKQGHSPLRARFDAARLRALLGQVCDTTL
                     DLKKVLAHWDRWAEMLRAHPNYVALKLLEGCEQQLQNAADKLRKRHAREVDELRALAQ
                     RLRACVVSSEFNMYQLAQPQPQDASPAESAPTVPQAQPVPSANDILNDLAQLKKTAQH
                     RRAIRAWDPAPDWTPRPFGTV"
     gene            complement(466422..466588)
                     /gene="SNR128"
                     /locus_tag="KLTH0F05302r"
                     /db_xref="GeneID:8292635"
     ncRNA           complement(466422..466588)
                     /ncRNA_class="snoRNA"
                     /gene="SNR128"
                     /locus_tag="KLTH0F05302r"
                     /product="snR1228"
                     /note="C/D snoRNA polycistronic Cluster 5 SNR128 (U14
                     RNA)"
                     /transcript_id="XR_002432201.1"
                     /db_xref="GeneID:8292635"
     gene            complement(466733..466963)
                     /gene="SNR190"
                     /locus_tag="KLTH0F05324r"
                     /db_xref="GeneID:8293293"
     ncRNA           complement(466733..466963)
                     /ncRNA_class="snoRNA"
                     /gene="SNR190"
                     /locus_tag="KLTH0F05324r"
                     /product="snR190"
                     /note="C/D snoRNA polycistronic Cluster 5 SNR190"
                     /transcript_id="XR_002432202.1"
                     /db_xref="GeneID:8293293"
     gene            <467382..>467897
                     /locus_tag="KLTH0F05346g"
                     /db_xref="GeneID:8293295"
     mRNA            <467382..>467897
                     /locus_tag="KLTH0F05346g"
                     /product="KLTH0F05346p"
                     /transcript_id="XM_002554391.1"
                     /db_xref="GeneID:8293295"
     CDS             467382..467897
                     /locus_tag="KLTH0F05346g"
                     /note="weakly similar to uniprot|P47006 Saccharomyces
                     cerevisiae YJL148W RPA34 RNA polymerase I subunit A34.5"
                     /codon_start=1
                     /product="KLTH0F05346p"
                     /protein_id="XP_002554437.1"
                     /db_xref="GeneID:8293295"
                     /db_xref="InterPro:IPR013240"
                     /db_xref="UniProtKB/TrEMBL:C5DKJ9"
                     /translation="MAEANGGLETSGYKKCKDLGDFQAEGKEVWLIRAPRKLDLSKVK
                     SLPVDFTGKGKAAFEKQGLTFEVREDSHEDGSGLSVLVPADKQTLVSGAGVSRVFTIS
                     ETVDLEQQAKDRKRRAPEPEPESGSVEADAEQQTPKKHKKDKKDKKDKKDKKEKKDKK
                     DKKDKKHKHKA"
     gene            complement(<468018..>468833)
                     /locus_tag="KLTH0F05368g"
                     /db_xref="GeneID:8292636"
     mRNA            complement(<468018..>468833)
                     /locus_tag="KLTH0F05368g"
                     /product="KLTH0F05368p"
                     /transcript_id="XM_002554392.1"
                     /db_xref="GeneID:8292636"
     CDS             complement(468018..468833)
                     /locus_tag="KLTH0F05368g"
                     /note="some similarities with uniprot|P36145 Saccharomyces
                     cerevisiae YKR062W TFA2 TFIIE small subunit involved in
                     RNA polymerase II transcription initiation"
                     /codon_start=1
                     /product="KLTH0F05368p"
                     /protein_id="XP_002554438.1"
                     /db_xref="GeneID:8292636"
                     /db_xref="GOA:C5DKK0"
                     /db_xref="InterPro:IPR003166"
                     /db_xref="InterPro:IPR016656"
                     /db_xref="UniProtKB/TrEMBL:C5DKK0"
                     /translation="MSNNDSLLANLNAFKSKVKAGPAPGGPRSTENEVKKREFKREES
                     PVPKKVKKTSGGTPEQSLKGTHLSTKLLLATEYIQERGEAVPIEQIESYLSLSSENNV
                     IPLLKNINKIKFDPKHNTLQYVSIYDVHSAEELLQLLRSQVTFKGISCKELKDGWPQC
                     TEVIDELESKNRVLVLRTKKDNQPRFVWYNFGGSLGGVDEDFVKMWENCKLPQRGELP
                     RKLQDLGLKPASVDPATVKRGSSRVEVKKRKQRKGKITNTHMAGILKDYSDRL"
     gene            complement(<469335..>470432)
                     /locus_tag="KLTH0F05390g"
                     /db_xref="GeneID:8292637"
     mRNA            complement(<469335..>470432)
                     /locus_tag="KLTH0F05390g"
                     /product="KLTH0F05390p"
                     /transcript_id="XM_002554393.1"
                     /db_xref="GeneID:8292637"
     CDS             complement(469335..470432)
                     /locus_tag="KLTH0F05390g"
                     /note="weakly similar to uniprot|P47007 Saccharomyces
                     cerevisiae YJL147C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F05390p"
                     /protein_id="XP_002554439.1"
                     /db_xref="GeneID:8292637"
                     /db_xref="UniProtKB/TrEMBL:C5DKK1"
                     /translation="MKRTFATTLSHLTKQKPADLRSTLKFLTQAGKGTTLTSLFENGK
                     TEASHIKHIVDVLNNDLPDVELNKKRVDAHYDILMSRLKHVVEKSISGDDLSGARTAP
                     GTSSQLSFQEKFARCHTSESLYSLLLELQVAHKLSRVAMAKIVMNRNFTHLKQVSENL
                     PGFSHEVELAVMVGYRLRDADLNEIYKTYSSRWTDEWHNLTRIAQNLVWKSDHRLGGI
                     AAVTRRMHEIKDWSSADIISLYQALYSVAHQLPVASSAELTKVQQLFVAALRALSRAV
                     PTSEQAKKNCFAVVRASLENKLSAESSNSSEAGASVFQYRFMRRLDDLLQLSARDARL
                     GPDVGTAIQGVLDSLHREEEQARSQMVLKFI"
     gene            <470606..>471733
                     /locus_tag="KLTH0F05412g"
                     /db_xref="GeneID:8292638"
     mRNA            <470606..>471733
                     /locus_tag="KLTH0F05412g"
                     /product="KLTH0F05412p"
                     /transcript_id="XM_002554394.1"
                     /db_xref="GeneID:8292638"
     CDS             470606..471733
                     /locus_tag="KLTH0F05412g"
                     /note="weakly similar to uniprot|P46958 Saccharomyces
                     cerevisiae YJL146W IDS2 Protein involved in modulation of
                     Ime2p activity during meiosis appears to act indirectly to
                     promote Ime2p-mediated late meiotic functions found in
                     growing cells and degraded during sporulation"
                     /codon_start=1
                     /product="KLTH0F05412p"
                     /protein_id="XP_002554440.1"
                     /db_xref="GeneID:8292638"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DKK2"
                     /translation="MDLPDDLASAVRKSWSESAQPLSVLQGTDSPISTPRGTPKSSGR
                     GSIPTSMDEPTVDYQLLKHHYAISDDGRRPSMQEDLMDVLQEMEFSNEQRPQAMRRGS
                     IEEVSKIRQWLNPRSSFSGASTNEASTENTGATKCWVTTIETQDDFLPILVLNYSFKK
                     SCSRYKLIVLYTEQTEMVASRLRDYGVETRRASDIAPILFSPQNQMGTADSRLSRWTM
                     LFPFVSLTNDFELVCYLSPRALVLSNIDELLDSDAVAAEIDNETCVLLSNHMGARPTI
                     MVLRPNKEIDACIREYMTVYLNAQNNGKWAKLQAADGSSVLRELFEDSWGLVAADFCH
                     SGPGHIQPNAKIVECTTTQPWNLSYNDEASVLWRRAWSELI"
     gene            <472035..>472892
                     /locus_tag="KLTH0F05434g"
                     /db_xref="GeneID:8292639"
     mRNA            <472035..>472892
                     /locus_tag="KLTH0F05434g"
                     /product="KLTH0F05434p"
                     /transcript_id="XM_002554395.1"
                     /db_xref="GeneID:8292639"
     CDS             472035..472892
                     /locus_tag="KLTH0F05434g"
                     /note="similar to uniprot|P47008 Saccharomyces cerevisiae
                     YJL145W SFH5 putative phosphatidylinositol transfer
                     protein"
                     /codon_start=1
                     /product="KLTH0F05434p"
                     /protein_id="XP_002554441.1"
                     /db_xref="GeneID:8292639"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:C5DKK3"
                     /translation="MKFASDLEKKTFEKLVEQLPSLIEKKCQGYDEMYGYKLLPGEHY
                     DESIAHALVYKYCKAYKFQYDEVASNLCSTLNWRREFDPLSAAFSERHDETLNNVGLL
                     TKYDDEQSNRKVVTWNLYGELSKQKQVFADVNKFLRYRVGLMERSIGLLDFKDETNDY
                     VAQVHDYDGVSMWRMDPDIKKCTKQVIAVFQKHYPEMLSAKFFINVPSLLTWVYDVVK
                     RFVNEETRRKFVVLNDGTKLGQYLPAAPSKLYGGNSKQTLEEQNVLEVKPTPYALYLF
                     EQKVGADVE"
     gene            complement(<474006..>475148)
                     /locus_tag="KLTH0F05456g"
                     /db_xref="GeneID:8292640"
     mRNA            complement(<474006..>475148)
                     /locus_tag="KLTH0F05456g"
                     /product="KLTH0F05456p"
                     /transcript_id="XM_002554396.1"
                     /db_xref="GeneID:8292640"
     CDS             complement(474006..475148)
                     /locus_tag="KLTH0F05456g"
                     /note="highly similar to uniprot|P32451 Saccharomyces
                     cerevisiae YGR286C BIO2 Biotin synthase catalyzes the
                     conversion of dethiobiotin to biotin which is the last
                     step of the biotin biosynthesis pathway complements E.
                     coli bioB mutant"
                     /codon_start=1
                     /product="KLTH0F05456p"
                     /protein_id="XP_002554442.1"
                     /db_xref="GeneID:8292640"
                     /db_xref="GOA:C5DKK4"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024177"
                     /db_xref="UniProtKB/TrEMBL:C5DKK4"
                     /translation="MLALRRSISTSSSGGLKGAAAAATAAARAPQTSALQFALSLEQP
                     SHEWSKEQLREIYHTPLLELVHSAQLQHRRWHDPTKVQLCTLMNIKSGGCSEDCKYCA
                     QSSRYSTGVKAEKLVSVDAVLKEAEEAKQNGSTRFCLGAAWRDMNGRKSGLRKISEMV
                     TKVNEMGLETCVTLGMVNEDQAKQLKDAGLTAYNHNIDTSREHYPKVITSRSYDDRLN
                     TIKNVQSAGIKACTGGILGLGETEEDHIGFVHTLANMTPHPESLPINRLVAIKGTPME
                     EDLQKKGAKKLQFDEILRTVATARLTMPRAIIRLAAGRYTMKETEQFLCFLAGCNAIF
                     TGKKMLTTMCNGWDEDKAMLSKWGLEPMQSFDYDAEKRSASAVDSA"
     gene            <475684..>476040
                     /locus_tag="KLTH0F05478g"
                     /db_xref="GeneID:8292641"
     mRNA            <475684..>476040
                     /locus_tag="KLTH0F05478g"
                     /product="KLTH0F05478p"
                     /transcript_id="XM_002554397.1"
                     /db_xref="GeneID:8292641"
     CDS             475684..476040
                     /locus_tag="KLTH0F05478g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F05478p"
                     /protein_id="XP_002554443.1"
                     /db_xref="GeneID:8292641"
                     /db_xref="UniProtKB/TrEMBL:C5DKK5"
                     /translation="MRSHNGSRTLPQRTVHKAPRIRKHRSARSQTHRQMHYAPEQPRQ
                     GVLVDERFGDVLPQQPAGVFFLVEVHTDSPGLTPHEIVEPGAEREGSRVELEAEEVLG
                     TGAGADEDEDVEMRDA"
     gene            <476328..>476804
                     /locus_tag="KLTH0F05500g"
                     /db_xref="GeneID:8292642"
     mRNA            <476328..>476804
                     /locus_tag="KLTH0F05500g"
                     /product="KLTH0F05500p"
                     /transcript_id="XM_002554398.1"
                     /db_xref="GeneID:8292642"
     CDS             476328..476804
                     /locus_tag="KLTH0F05500g"
                     /note="highly similar to uniprot|P39515 Saccharomyces
                     cerevisiae YJL143W TIM17 Mitochondrial inner membrane
                     protein involved in protein import 16.5 kDa inner membrane
                     protein required for import of mitochondrial precursor
                     proteins"
                     /codon_start=1
                     /product="KLTH0F05500p"
                     /protein_id="XP_002554444.1"
                     /db_xref="GeneID:8292642"
                     /db_xref="GOA:C5DKK6"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005678"
                     /db_xref="UniProtKB/TrEMBL:C5DKK6"
                     /translation="MSADHSRDPCPVVILSDFGGAFAMGVIGGCVWHGIKGFRNSPMG
                     ERHLGAVSAIKARAPVVGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGLFTGGSL
                     AIRGGWRHTRNSAIMCGCLLGVMEGVGLMFQRYAAWQAKPMAPPLPEPQQATPLGA"
     gene            complement(<477035..>478975)
                     /locus_tag="KLTH0F05522g"
                     /db_xref="GeneID:8292643"
     mRNA            complement(<477035..>478975)
                     /locus_tag="KLTH0F05522g"
                     /product="KLTH0F05522p"
                     /transcript_id="XM_002554399.1"
                     /db_xref="GeneID:8292643"
     CDS             complement(477035..478975)
                     /locus_tag="KLTH0F05522g"
                     /note="similar to uniprot|P14680 Saccharomyces cerevisiae
                     YJL141C YAK1 Serine-threonine protein kinase that is part
                     of a glucose-sensing system involved in growth control in
                     response to glucose availability translocates from the
                     cytoplasm to the nucleus and phosphorylates Pop2p in
                     response to a glucose signal"
                     /codon_start=1
                     /product="KLTH0F05522p"
                     /protein_id="XP_002554445.1"
                     /db_xref="GeneID:8292643"
                     /db_xref="GOA:C5DKK7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKK7"
                     /translation="MPESDKSIWNPAFLNNAQKQQGAPSYGFKNPWHDVSGATGKRNS
                     MQFNQHLPTTYEEAPQHGSASENGFRRRNSSLIVPPPRAAGPAPDAYMYGMQFVPQQG
                     YPGNSQELHRRQSVAVAPQHSFAQPALPADMSMHAPMSPFHRKLSSYPATAGSVLPPP
                     VKQMRRQDEMIPVVLPQMHKVNARQDMRPTINATPKYRRASLDSRTVSPLVALTKSLT
                     TTYTLCSPEFSYQTSKNPKRVLTKPSEGKNNNGHDNINSDYILYVNDVLGTEQNRKYL
                     VLDILGQGTFGQVVKCQNMLTKEILAVKVVKSKSEYLNQSITEAKILELLNSKIDPLG
                     EHHFLRMHETFVHRNHLCLVFELLSSNLYELLKQNQFHGLSISLIRSFARQLLDSLSV
                     LKDNKLIHCDLKPENILLVSLDRPELKVIDFGSACEETRTLYTYIQSRFYRAPEVILG
                     IPYSTGIDMWSLGCIIAELFLGIPIFPGSSEFNQITRVVDTLGLPPAWMLDMGRNTSN
                     FMIKDEAGGKTWKVKSVEEYNMDFGSDEQPGKQYFKWRKLDDIIQNYRISKKIAGAPA
                     LVEKERQERVCLTHFLHGLLNINPLERWTPTQAAMHPFITQQPFSGEWFPPGSTPRRT
                     AKTPVLQERSTTSEIDKLHIAD"
     gene            <479908..>480501
                     /locus_tag="KLTH0F05544g"
                     /db_xref="GeneID:8292644"
     mRNA            <479908..>480501
                     /locus_tag="KLTH0F05544g"
                     /product="KLTH0F05544p"
                     /transcript_id="XM_002554400.1"
                     /db_xref="GeneID:8292644"
     CDS             479908..480501
                     /locus_tag="KLTH0F05544g"
                     /note="similar to uniprot|P20433 Saccharomyces cerevisiae
                     YJL140W RPB4 RNA polymerase II subunit B32 forms two
                     subunit dissociable complex with Rpb7p dispensable under
                     some environmental conditions involved in export of mRNA
                     to cytoplasm under stress conditions"
                     /codon_start=1
                     /product="KLTH0F05544p"
                     /protein_id="XP_002554446.1"
                     /db_xref="GeneID:8292644"
                     /db_xref="GOA:C5DKK8"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:C5DKK8"
                     /translation="MNVSTSTFSTKRRGLKKVEEEENAATLQLGEEFQLVQVNHQGQE
                     EELIALNLSEARLVIKESLEMRKKLFKHWNKQEDSMEADDDVDENSHAQTQEKELQNI
                     DKLLETTTGGNNQALKQTMVYLTNFSRFKDQETVTAVTQLLQSTNLHPFEIAQLGSLS
                     CEDADEAKTLIPSLGNKISDEDLERILKELSNLETLY"
     gene            complement(<480552..>481823)
                     /locus_tag="KLTH0F05566g"
                     /db_xref="GeneID:8292645"
     mRNA            complement(<480552..>481823)
                     /locus_tag="KLTH0F05566g"
                     /product="KLTH0F05566p"
                     /transcript_id="XM_002554401.1"
                     /db_xref="GeneID:8292645"
     CDS             complement(480552..481823)
                     /locus_tag="KLTH0F05566g"
                     /note="similar to uniprot|P33550 Saccharomyces cerevisiae
                     YKR061W KTR2 Mannosyltransferase involved in N- linked
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family"
                     /codon_start=1
                     /product="KLTH0F05566p"
                     /protein_id="XP_002554447.1"
                     /db_xref="GeneID:8292645"
                     /db_xref="GOA:C5DKK9"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DKK9"
                     /translation="MRKVLTWGGIFASSALAAYLLSIAYAIFSTSFSHHQREKSYFEA
                     SGKVLHMFDERRKFDIYVGQPKLSSNTYVNDLTIDYSRDEPSKKPRENATLLMLVRNR
                     ELEGALQSMRSLEDRFNRKYHYDWTFLNDVPFDQAFIEATTAMASGKTSYGLIPSSDW
                     DRPSNINETEFESCLQLMEEKKVLYGGSRSYRNMCRFNSGFFFRQEILDKYDYYFRVE
                     PDVEYFCDFPYDPFKVMRTQGKKYGFVMSLHEYEDTIPTLWDAVEEFITDYPELIDME
                     TNAFSFITDDGVIGRVMPIIQSNSMYNLCHFWSNFEIGDLSFFRSDAYLKYFEVLDSK
                     GGFYYERWGDAPVHTIAAALLLRKEEIIHFDELGYHHLPFMTCPTSRNLRLQQRCICD
                     PDIEENIDITSYSCLTRWWKSGDGKHFMKHI"
     gene            complement(<482054..>482866)
                     /locus_tag="KLTH0F05588g"
                     /db_xref="GeneID:8292646"
     mRNA            complement(<482054..>482866)
                     /locus_tag="KLTH0F05588g"
                     /product="KLTH0F05588p"
                     /transcript_id="XM_002554402.1"
                     /db_xref="GeneID:8292646"
     CDS             complement(482054..482866)
                     /locus_tag="KLTH0F05588g"
                     /note="similar to uniprot|P36144 Saccharomyces cerevisiae
                     YKR060W UTP30 Possible U3 snoRNP protein involved in
                     maturation of pre-18S rRNA based on computational analysis
                     of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="KLTH0F05588p"
                     /protein_id="XP_002554448.1"
                     /db_xref="GeneID:8292646"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:C5DKL0"
                     /translation="MAVPVVSKSGLAAEALQSLVKRCSEDPKLANDTNIHIVINTEKP
                     IGIKNDYVPRIIPLTSCKMHKPSDLRILLITKDPSTLYRKTLTKDPSTADLFKTILSV
                     RNLKGKYRGSRLSKLFREYDLVVADYRVHHLLPQILGSAFFHSNKKLPFMVKMSQAVK
                     AKREKLPEECDAAYVRAQLRSICKNTFYVPNVDNCLSVKIGEVGVHTVDEMVHNIDDI
                     VRFLTDKSKKPQGGVIRGDISAIFVKTSNSVSLPIYKAEKKSEVHEEEELRL"
     gene            complement(<483243..>484433)
                     /locus_tag="KLTH0F05610g"
                     /db_xref="GeneID:8292647"
     mRNA            complement(<483243..>484433)
                     /locus_tag="KLTH0F05610g"
                     /product="KLTH0F05610p"
                     /transcript_id="XM_002554403.1"
                     /db_xref="GeneID:8292647"
     CDS             complement(483243..484433)
                     /locus_tag="KLTH0F05610g"
                     /note="highly similar to uniprot|P10081 Saccharomyces
                     cerevisiae YKR059W TIF1 and highly similar to
                     uniprot|P10081 Saccharomyces cerevisiae YJL138C
                     TIF2translation initiation factor eIF4A"
                     /codon_start=1
                     /product="KLTH0F05610p"
                     /protein_id="XP_002554449.1"
                     /db_xref="GeneID:8292647"
                     /db_xref="GOA:C5DKL1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKL1"
                     /translation="MSEGITDIEESQIQTNYDKVVYKFDDLNLKEELLRGIYGYGFVD
                     PSAIQQRAILPITEGHDVLAQAQSGTGKTGTFSIAALQKIDPKIKAPQALMLAPTREL
                     ALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEALRDGAQIVVGTPGRVFDMIERRRF
                     RTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVLLSATMPQDVLEVTTKFMR
                     NPIRILVKKDELTLEGIKQFFINVEEEDYKYDCLSDLYDSISVTQAVIFCNTRRKVEE
                     LTQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVI
                     NYDLPTNKENYIHRIGRGGRFGRKGIAINFVTNKDVGAMRELERFYSTQIEELPANIS
                     ELFD"
     gene            complement(<484673..>486163)
                     /locus_tag="KLTH0F05632g"
                     /db_xref="GeneID:8292648"
     mRNA            complement(<484673..>486163)
                     /locus_tag="KLTH0F05632g"
                     /product="KLTH0F05632p"
                     /transcript_id="XM_002554404.1"
                     /db_xref="GeneID:8292648"
     CDS             complement(484673..486163)
                     /locus_tag="KLTH0F05632g"
                     /note="weakly similar to uniprot|P47011 Saccharomyces
                     cerevisiae YJL137C"
                     /codon_start=1
                     /product="KLTH0F05632p"
                     /protein_id="XP_002554450.1"
                     /db_xref="GeneID:8292648"
                     /db_xref="GOA:C5DKL2"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DKL2"
                     /translation="MQEPRNRCGVITLMYSWAYLPGVLALGHQLQRALENSGHGFRTC
                     VLVAKGLLEQKDASKQILLSVLESLYQEVIAVDPASTCSDSLLKLNKGNLELLHRPEL
                     AFTFMKLELWRLQQFERVVYLDCDTLLVSDAFWDILDVTKNQKRNEVGAVPDCGWPDM
                     FNSGVLTIVPDLEIYAELAEYVMSTISVDGADQGVLNQYFNPNCRFGSRQSTIGGENG
                     WIRLPFTYNVTVPNAGYQNAPAVHFFRSQIKLVHFIGRDKPWITRSQASDRTNDSYRD
                     KWWQVYNEFLRKQTSEEPLGPVADHPGDAIQTGSDASKVSVKNPGTPPRPLIACQEAL
                     ETSQQAPRTFPAAAEGTGQAPEPNTAAPLNPQARKEIPLSAPAIQPVTDADRGAHIQA
                     ALNALLGTSPTRALTEDPSTDPSETTGSNAHQELTPSAWDATKSPPPRDGPAEAPNFS
                     FDTDYHWSESATLLEDDLPKLKLGPKPVFPWELYPDAPEVQRVFPD"
     gene            complement(<486339..>486966)
                     /locus_tag="KLTH0F05654g"
                     /db_xref="GeneID:8292649"
     mRNA            complement(join(<486339..486578,486943..>486966))
                     /locus_tag="KLTH0F05654g"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_002554405.1"
                     /db_xref="GeneID:8292649"
     CDS             complement(join(486339..486578,486943..486966))
                     /locus_tag="KLTH0F05654g"
                     /note="highly similar to uniprot|P05760 Saccharomyces
                     cerevisiae YJL136C RPS21B and highly similar to
                     uniprot|P05760 Saccharomyces cerevisiae YKR057W RPS21A,
                     Protein components of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_002554451.1"
                     /db_xref="GeneID:8292649"
                     /db_xref="GOA:C5DKL3"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /db_xref="UniProtKB/TrEMBL:C5DKL3"
                     /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHASVQINIAKVDEEGR
                     AIPGEFITYALSGYVRARGEADDSLNRLAQNDGLLKNVWSYSR"
     gene            complement(<487620..>489413)
                     /locus_tag="KLTH0F05676g"
                     /db_xref="GeneID:8292650"
     mRNA            complement(<487620..>489413)
                     /locus_tag="KLTH0F05676g"
                     /product="KLTH0F05676p"
                     /transcript_id="XM_002554406.1"
                     /db_xref="GeneID:8292650"
     CDS             complement(487620..489413)
                     /locus_tag="KLTH0F05676g"
                     /note="similar to uniprot|P33753 Saccharomyces cerevisiae
                     YKR056W TRM2 tRNA methyltransferase 5- methylates the
                     uridine residue at position 54 of tRNAs and may also have
                     a role in tRNA stabilization or maturation previously
                     thought to be an endo-exonuclease"
                     /codon_start=1
                     /product="KLTH0F05676p"
                     /protein_id="XP_002554452.1"
                     /db_xref="GeneID:8292650"
                     /db_xref="GOA:C5DKL4"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DKL4"
                     /translation="MPSGSFNILKACGRSAFASISTWKKTIAVCRTMSSDAVTIASPT
                     EKATDLKRRVSDDGPVVVKKQNKPKKVKLRRYKPKKVDETSPLGVLQHEIDGLLAEKG
                     LTREQIINDMVAVLNHKDSSDIPMSSHYHREVANVSVLKIGSSGDGLALIPNSVETSK
                     MQVVIIPFALPGDVVKIRVFKTHPHYVESDLLEVEQKSPQRKDELIGCKYFGKCAGCQ
                     FQFLPYEEQLNLKRETVANAYKYFAPRLLENGLLPKIGETVASPKIFDYRTKLTPHFD
                     MPKKVHKLEERPPLGFGQKGRPTWRNIDAGGSRSILDIEECVIGTKILNEGMENERKK
                     FERDFKGYKRGATILLRENTRVLDSQKPVEEQLGDGSVNPDTGKTSFLEVTEDKPLAK
                     TCVTNSRQVVTEYINGYTFEFSAGEFFQNNNSILPKVTEYVCSNLQIPGSKPEDPHYL
                     VDAYCGSGLFSITASKGVDKVIGVEVSADSVSFAEANAKANGVENCKFVVGKAECIFA
                     SIDTPCDRTSVILDPPRKGCDDIFLKQLSEYNPARIVYISCNVHSQARDMQYFLQETE
                     KGKQYKVESLRGFDFFPQTHHVESVCVLTRV"
     gene            complement(<489561..>490376)
                     /locus_tag="KLTH0F05698g"
                     /db_xref="GeneID:8292651"
     mRNA            complement(<489561..>490376)
                     /locus_tag="KLTH0F05698g"
                     /product="KLTH0F05698p"
                     /transcript_id="XM_002554407.1"
                     /db_xref="GeneID:8292651"
     CDS             complement(489561..490376)
                     /locus_tag="KLTH0F05698g"
                     /note="similar to uniprot|Q00246 Saccharomyces cerevisiae
                     YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
                     subfamily of Ras-like proteins likely to be involved in
                     the establishment of cell polarity"
                     /codon_start=1
                     /product="KLTH0F05698p"
                     /protein_id="XP_002554453.1"
                     /db_xref="GeneID:8292651"
                     /db_xref="GOA:C5DKL5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKL5"
                     /translation="MASPSKRLSLSPKKMAQFSSSSNEPDSSSQGPYLQTKLPTPLAR
                     TLSEVPSYERIKRSQTAADHHLKFVVVGDGAVGKTCLLISYTQGSFPEEYVPTVFENY
                     VTKMKGPGNAVIELALWDTAGQEEYNRLRPLSYTDVDLLMVCYSVDSKTSLHNVQELW
                     IPEVRHFCPDTPIMLVGLKSDLYALDNLEKLVDPKDAELFAQQMGLMGHYQCSAKYRN
                     NIDELFNVAITTLLYDSIQERRGKSMVNLFKTKRSTGALGPMAKRRKHACYVL"
     gene            <490598..>502924
                     /locus_tag="KLTH0F05720g"
                     /db_xref="GeneID:8292652"
     mRNA            <490598..>502924
                     /locus_tag="KLTH0F05720g"
                     /product="KLTH0F05720p"
                     /transcript_id="XM_002554408.1"
                     /db_xref="GeneID:8292652"
     CDS             490598..502924
                     /locus_tag="KLTH0F05720g"
                     /note="similar to uniprot|P36022 Saccharomyces cerevisiae
                     YKR054C DYN1 Cytoplasmic heavy chain dynein microtubule
                     motor protein required for anaphase spindle elongation
                     involved in spindle assembly chromosome movement and
                     spindle orientation during cell division targeted to
                     microtubule tips by Pac1p"
                     /codon_start=1
                     /product="KLTH0F05720p"
                     /protein_id="XP_002554454.1"
                     /db_xref="GeneID:8292652"
                     /db_xref="GOA:C5DKL6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKL6"
                     /translation="MDLTNGNAVSSSDQLVEEAIRYCYKVSSALLTGAEGFTFEKFQE
                     LNSSAIKDFAVNRSSSVLYLIADPSENVKASSSPDVGNSEPDLLNDAHNRNVLALIKS
                     QPTLSLENALESQILVLSMAQGLEMKAFNQVMALGVTSLIECALGPQQLMNTDNGSLQ
                     NMRLKIDEFFSSMKNVESWAVAPNLLLSGDRLIKDIVNRGATIENFEEFLPDTQFADS
                     VFLNSLQRIVNGWIHSAESFSNSMRSIDDGDAKDEVSFWQKLEQGLLSIQDQLQSSEA
                     KITVEILKNSRRPQAAFSLLASSTVPERLKKVKSYNQFLCELPMKKLQTAVSLPTLDG
                     LIDAFATAFKRLRTSLFPISRAQALTEQICVEVICKIKKLVPQLASLPFGEYESKTKA
                     LEGFLSRWDELIESATLIMREVTRRRSEKYVPIKIASKTDLLRHRLSGIKKLRSTYEE
                     LSLDLENPDMLKYKAEVPFVYEPLKTTDCLSCSTEQWYALESTCNQRLGILENKILNA
                     LLFKLHLCESTNEMFTLLEKFRPLLSRPRLRKGIQQYHGGLLKAVVGELSNLKQKLLD
                     CNGDSNAAALNDLPPVSSSLMRIKLLKKRVSTILSKLTLLLGRDWSSSEDGLHLHSEC
                     KSILEGLNEDTIVSEWYSKASCSEALLQEPIFKVLKNGGGYAIFVNSNREFRDLFKEV
                     RNLCWMGYDLPSSLFKASTVLRDLYPITIEFMELLDTFIQITNLVNERPALNALLGSL
                     IKRSWVALKHCINENWKAISESEIAATTAAVLDFDENPASLSIFRSLVNEIITRFNSL
                     ESLERSLTSFLNSIDLTKFSEPSLRNWITQIVSLKSSITSLEKGNYTCFETYLEAQIE
                     ESVLNLTRLALKPENLPKTKHEVTIDSNGVLLEPSLESTKTRWLEHIQNTLNISFTLK
                     AYYEDDKGEPVGQKTKRLDEFKIQVQRYAMSASKEVESLLQSACILLRSLNIYKVLWR
                     PKEQIIWHQRRNDILYCFDLYSDFMKERSKVKSMGMRVKLSDSLTISLKDFQAKIESC
                     YEDWNKELLSELECQYEKQSLEFHSTLSNYRKLLESNSISVESCSLDELYEICSTIEN
                     LNKSWSHKEELLSTLHSVHILMRENNQSSLSEVIQGDQLDLDMKLLKQILEKRQAWLA
                     ERKFIIASRIEMWNDKLLKSASSFREEWQICKPVSQDLKPENALEILELKEHAVSLES
                     KNLEMVNKISLFLSIPVKQGFSLIDVTADIAAYKIAWDAISIRWASLKLYLNTPWAQS
                     DLNNLKIELQRLADEQHENEGSLANQVVFKAFSENIQGILNSIKLLNALKDKCMKPRH
                     WKILFQEAGGSSPSRDDIDGMSFLLEDVLSLKQGLNEGFVSEVIKNAKSEEVVEQSLE
                     DIESRWRYTKFLSAHHAGNFVIVKNWDTLMQSITDDTNTLTAMKNSSHYKVFEQRSVS
                     WEIKFNELALILNSWAESQRLWLHLYGALGDSASSSNFLRSESARFEMITSEFSSIAS
                     TVLQSDLVLDVLHIMDLSRSLRNILESLKRVVGALNGYLESQRERFPRLYFLGNEDLL
                     QLMGASQNLYQASHHLGKIYGGVSSLKFEDKEIFGVSSPEGETLEFLEPILLSKYPEM
                     QEWVAQIGIQIKSSIMSSTENCLEKLKVSGVQELSQLFEQHVFQALLLSFQIRWTSII
                     EDAISQDEISPKLNEIQTVFNKLNSLLKDTKSFLRRRKIESLIVECIHYLSLSEELRA
                     FDVAGRKNIWNSIPKYYHNASEYDMFQRITVSIGNNKFSHGLEYIGVPERLIYTPLMR
                     NCFVAMAHALAQNLGGSPFGPAGTGKTETIKALGQNLGRFVLVFNCDESFEFQSLGRL
                     LLGIGQVGAWGCFDEFNRLEESIMSAVSTQIETIQDALARKQEKFVLLGKTVYLDDSA
                     GIFITMNRGYKGRRELPDNLRKKFRQFSMKSPDYTIIADVILTTLGFENAKNMAKKIC
                     NFLTEMECLCSQQRHYDFGLRAMKGILRNCRVLKNKHGGTDQDILLESLHQMLSPRLV
                     KSDEDAFCKTMSALFPNTHLNYNDNDFREGVEKVCQFGNKTPTDLFVKKCNQLFQIQN
                     SQQAIILSGPPGTGKTTIWNSTLDCMELADGIKNKVFLIDLKVLAKEQLYGCLDPVTF
                     EWTDGVFTSIIRKVAQDQIEKHNETRIWIIFDGDLDPEYVETINSVLDDNKVLTLPNG
                     ERFKIPDNLRLIFEVDDLDIATPATISRCAVIVIDRPVCSPSEMLPALLVEKLHDMQI
                     ASRLPMSFLDAFCEISYDVLGQKLHDLHDFAKTLPNAMDTSLLGSLDNLVSLTCSQLF
                     QKSESVQKLSKSSFSNFAKCLLCINIVWAITGACNEDDRSTFEQYMRTGLGIEDLASN
                     DSLSLTDYEAKAGEPKLRPLSMSMPQITLEPHEVILPDLMIPTVDTMKHERLILDLLY
                     ARKSPILCGPPGSGKTMTIFNALKNSKKFDLIGLTFSKETTVASFLDTLKHHTTITET
                     AKGILLKPKSLSKDLVVFCDEINLPEADEYGAQPVILLLRQLLEKKGYWDVSSHRWVS
                     LERIHVAGACNPPDNGSRKALSERFTRHTSVISIDYPGKNSLLHIYEVFFKAVLKLAP
                     ELRGYSKEFAHASVQLYYSCKERFSSTVYSHYIYSPRELTRLIKGLYYILTNSSIRAL
                     SQLIECWVYECLRLYSDRLVCDEDKKAFDKIIIEITTEYFPNQIENYYEIRDNLLCNW
                     VSLEYEKTDRRELSFFVRERLKTFNEEELESTLIVHDSMLDHMVRIDRALKQDQGHCI
                     LVGPSRSGKRSLTRFVSWMNGIEVIPLTLHRNFHISDFDKFLRNILSRCTAGGQKILL
                     LIDDSSILESSFIERMNTLLANSDVPGLFEAEERTKLIADLSQKAEEIGLLLDEDEEL
                     YSWFTQLISRNLHVVFSINDPNSESATNVINSPALFNRCVLNWMGEWSDQTLAQVGTK
                     IIEWMPLSSSLDGSDPEMLSKSGTATPLSKKIVDVAILFFKNFQVLNLGRQATPGQFL
                     DQLKTFQDIYSRKLSELEKSQRFIATGLDTMKESVLRIRELNELFSEKEKELRSKEQQ
                     GRKTLDNMLSTQNEAERRHEATVEIRKILSAQEKELSSQRARIMSDLASIEPQVLEAQ
                     RGVNNIKKQHMTEIRSMFNPPNNVKLTLEAVCLVLGYHSKEWRDIQSFVRKDEFISSI
                     VQYDTEMMMNATIRDFIKKEYLMKPGFNFEAVNHASKACGPLFQWVVAQVEYSTILNT
                     ISPLKNDVAKIEKEMLQTKARLLASEDMISDYRDLMESSKREYSNIIRETEAIKAELS
                     AVEHKVSRSRKLLDSLASENERWSSSTVTFKELRQNIVGDCLLSSLFISYCGAKDRKT
                     RLELIRSWKKHLGELSVSYDQNYTFCNHLVDFQERSRWFSNGLPDDYTCIENFYILFN
                     SLHYPFVVDPELKVFHALRRHFGNTIAMTSFLDSGFVKKLENTLRFGGCIIIQDGEFY
                     DPIISKLIAKEFRKTGGKETIQIGDRDIDIDPNFFMVIFTRDASWSIPLFLRARMSIV
                     DFTVDKNSIEPQALEIALECQKPELHEKRKALAQLNGEYKLRLSCLEKELLEALNSSP
                     NSVLENESLITTLEQLKTQSNEIQGRILETKGVIEEVEQAVNEFRALSQHAFRLYSIV
                     EHLPSLHWAYQVTVNCFLNCFRSIFNHDKGCESKNTNQLLRSFYRRIFEVLSPGLLDD
                     DKLALGVMLLVSYFEPAEPSAFCEILSQLMSSIRTSPKSPTLNIPLDFESAEVKTYTQ
                     NLIEGFEDFDIYHRLQAAVEFLPPAESYQLKEFVKEWDYVPIVIVCERGTDSTYRVSQ
                     LAQELSRELSIVSLGSSESTSMAENALSHCAKEGHWLLIQNLQMSPDWVKSVLTKRLE
                     LLASDTNKSSSFRVFMTCELEGRAPPPPLIQTSWKVVHESEKGILQSARDVWGTISRP
                     GTIRPPEKLFCRFLLAWFHALLVENSRLHPLGFTKKYDFNDSDFAAGIAYLDGFFDCL
                     SSSHNSIKPADISWIELQFNIATIIYGGKIDDEKDILRCIELAAGLFNERAFEPDFEI
                     APGLLAPQNRQEWTSIQEWLVQCRPPENWSQWLQLAENVELERRELHAANVASSVIQI
                     LKGL"
     gene            <503094..>504317
                     /locus_tag="KLTH0F05742g"
                     /db_xref="GeneID:8292653"
     mRNA            <503094..>504317
                     /locus_tag="KLTH0F05742g"
                     /product="KLTH0F05742p"
                     /transcript_id="XM_002554409.1"
                     /db_xref="GeneID:8292653"
     CDS             503094..504317
                     /locus_tag="KLTH0F05742g"
                     /note="similar to uniprot|P47013 Saccharomyces cerevisiae
                     YJL134W LCB3 Long-chain base-1-phosphate phosphatase
                     regulates ceramide and long-chain base phosphates levels
                     involved in incorporation of exogenous long chain bases in
                     sphingolipids"
                     /codon_start=1
                     /product="KLTH0F05742p"
                     /protein_id="XP_002554455.1"
                     /db_xref="GeneID:8292653"
                     /db_xref="GOA:C5DKL7"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5DKL7"
                     /translation="MTRQRALSVSSEASLDSKIEVTTYKEKHAFADPGNHSRDHFKRR
                     MSPVRFAMRDWLLQFTKHQSEGLYKLQCKFRCPALDKYFAYTSLMGSHMFYVIMVPMP
                     RWLGFSVMCRDLVYILGYSIYLSGFLKDYWCLPRPKSPPLTRVALSPYTTKEYGAPSS
                     HTANATGVTLLLLWYVYRLENASISWKLAAIAGALFYYFTLTLGRIYCGMHGLLDIVS
                     GALIGALCFFVRWAAVTYTHIDTANIQEWGWWFPVASVSLGLVLLFNHAKPVDHCPCF
                     EDSVAFVGVISGLESSDWLLWHVGRSADLHIPYSWSEFGVLLTLRRIAVGVLMVLIWK
                     SVVGKTLIYKLLNLVWEDDRGRYKLEHIDNPSEEVPLFTGRSRTELLGRFLIYAGVAG
                     TVALASPPLFRLLGV"
     gene            complement(<504717..>504995)
                     /locus_tag="KLTH0F05764g"
                     /db_xref="GeneID:8292654"
     mRNA            complement(<504717..>504995)
                     /locus_tag="KLTH0F05764g"
                     /product="KLTH0F05764p"
                     /transcript_id="XM_002554410.1"
                     /db_xref="GeneID:8292654"
     CDS             complement(504717..504995)
                     /locus_tag="KLTH0F05764g"
                     /note="some similarities with uniprot|Q3E7A3 Saccharomyces
                     cerevisiae YJL133C-A"
                     /codon_start=1
                     /product="KLTH0F05764p"
                     /protein_id="XP_002554456.1"
                     /db_xref="GeneID:8292654"
                     /db_xref="UniProtKB/TrEMBL:C5DKL8"
                     /translation="MLRLPQATTLVKSAPALMPTARNSAPSVSRIARRLHSCDDACVP
                     NDAENAGTGARVLRNPVAGNTFSSFKEYREIARTYGPIHASRGSHPSR"
     gene            <506028..>506951
                     /locus_tag="KLTH0F05786g"
                     /db_xref="GeneID:8292655"
     mRNA            <506028..>506951
                     /locus_tag="KLTH0F05786g"
                     /product="KLTH0F05786p"
                     /transcript_id="XM_002554411.1"
                     /db_xref="GeneID:8292655"
     CDS             506028..506951
                     /locus_tag="KLTH0F05786g"
                     /note="highly similar to uniprot|P23500 Saccharomyces
                     cerevisiae YKR052C Mitochondrial iron transporter of the
                     mitochondrial carrier family (MCF), very similar to and
                     functionally redundant with Mrs3p; functions under
                     low-iron conditions; may transport other cations in
                     addition to iron"
                     /codon_start=1
                     /product="KLTH0F05786p"
                     /protein_id="XP_002554457.1"
                     /db_xref="GeneID:8292655"
                     /db_xref="GOA:C5DKL9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DKL9"
                     /translation="MEMDEEIDYEALPSSAPLTHQLAAGAFAGIMEHSIMFPIDAIKT
                     RMQAISATVGSSNAAPKLPSNIMQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFA
                     TYEMCKGYLIDPQDFQTHQPLKTAASGVAATIAADMLMNPFDTIKQRMQLRTFSNDRM
                     WAVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFVIYESSTKLMNPNNSYNPLIHCL
                     CGGLSGATCAAITTPLDCIKTVLQIRGSESVVHPLFRSADTFSKAASAIFKIYGWSGF
                     WRGLKPRIISNMPATAISWTAYECAKHFLFR"
     gene            complement(<509026..>510267)
                     /locus_tag="KLTH0F05808g"
                     /db_xref="GeneID:8292656"
     mRNA            complement(<509026..>510267)
                     /locus_tag="KLTH0F05808g"
                     /product="KLTH0F05808p"
                     /transcript_id="XM_002554412.1"
                     /db_xref="GeneID:8292656"
     CDS             complement(509026..510267)
                     /locus_tag="KLTH0F05808g"
                     /note="similar to uniprot|P36142 Saccharomyces cerevisiae
                     YKR051W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F05808p"
                     /protein_id="XP_002554458.1"
                     /db_xref="GeneID:8292656"
                     /db_xref="InterPro:IPR005178"
                     /db_xref="UniProtKB/TrEMBL:C5DKM0"
                     /translation="MNYYIPRWWFLLCVLSSVVSITISAFSISQQLLNYRKPYEQRLV
                     IRIQLMVPLFCVTCLLACVIPQWSEVWINPIREIYEAFVIYTFFSLLTLILGGERKII
                     TELSMGKPPMRHPIPVLGSFISAVDMSDPNDFLSIKRGILQYVWIKPFYCLGNIICMK
                     YEWKREFWSLFWTIVYNVSASLSLYNLALFWKCLYGDLQKYNPWSKFLCVKLIIFASY
                     WQEILISVLSKYGVIRHDSDVDYGYVYQNAVLCVEMIGFAIGHLYAFIWTTYDSKRIP
                     EGARLRFYSAVKDCFGFGDLIWDFRVTFLGNLYSYRNFNSAEAVVAHLDARSRLNRLQ
                     AGLRYTDGGRENYWVNEGDQSPASSRYGSVGEDDSWTEISPTGFVPEDPNYPVKWDVD
                     AHKYSRDIERLRQNTRRAYPG"
     gene            <510405..>512597
                     /locus_tag="KLTH0F05830g"
                     /db_xref="GeneID:8292657"
     mRNA            <510405..>512597
                     /locus_tag="KLTH0F05830g"
                     /product="KLTH0F05830p"
                     /transcript_id="XM_002554413.1"
                     /db_xref="GeneID:8292657"
     CDS             510405..512597
                     /locus_tag="KLTH0F05830g"
                     /note="similar to uniprot|P47014 Saccharomyces cerevisiae
                     YJL132W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F05830p"
                     /protein_id="XP_002554459.1"
                     /db_xref="GeneID:8292657"
                     /db_xref="InterPro:IPR013519"
                     /db_xref="InterPro:IPR029002"
                     /db_xref="UniProtKB/TrEMBL:C5DKM1"
                     /translation="MLRALAFALLLQFLGIANGAGVGVHITLLARTKVPNNLNSFSAV
                     MKAGVFFPDALYSCNSRKDWHEFAEYTHWPAFLVQGAKLWRERYSKNQNSEKSLRLKS
                     FLTGVFVHQVADAPWHSLVDGYRNHGLVKALASLEFDNDFQKAHDYIDTMGDFLMLGQ
                     VLRDATDNWSYYLGGDWELPDKFDIMELVHRSGLKTIKFWELKACVERGNIALASEVY
                     SIMKRRREILSVANEISPRARELMQDHWLGGESNIVAMTNRCLSSFLVLFEEPNEMNI
                     NPEQLLEVCGNLPRVHEAEKHYLKRRSFDDMLLVSPLASLSLFGFDIAIGKFQKDEVC
                     LAVSAPLEDGEGSVYVIPWRDVSGSIDKLSERPVTRFYGARVHRLTLGESDFLVVSAS
                     GDNAVHIYYEGFKVLTIVDDHNWERHQLTVSSIADIDGDGIPELLLAGSHYGINETGL
                     VQIVDGRDISSLLQRRQYSKVSLQSLGTISLKAPVSQTFQNYGASVIASSLWNSNAFL
                     YVSCQGLGVVFVYCSSSLHQNALPRYYIINEHVIRQEEDIPLDLKVKPSSDHGMFGKT
                     ICSWNYHDTNYIAISQHLQNKVYIFREQDGFLEFYVALLLDLSSEAADISSTVGFGRS
                     IDYDETTGILYLSSPGFLDGDGAIWKATMSEITSTVETWKLDRLIITVSRNLVTINKS
                     QKGKGIPGFGDTIRIGPDGKLIVGSPRFGYGDFDERQLTGNIAILRLK"
     gene            complement(<512684..>513820)
                     /locus_tag="KLTH0F05852g"
                     /db_xref="GeneID:8292658"
     mRNA            complement(<512684..>513820)
                     /locus_tag="KLTH0F05852g"
                     /product="KLTH0F05852p"
                     /transcript_id="XM_002554414.1"
                     /db_xref="GeneID:8292658"
     CDS             complement(512684..513820)
                     /locus_tag="KLTH0F05852g"
                     /note="similar to uniprot|P47015 Saccharomyces cerevisiae
                     YJL131C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F05852p"
                     /protein_id="XP_002554460.1"
                     /db_xref="GeneID:8292658"
                     /db_xref="GOA:C5DKM2"
                     /db_xref="InterPro:IPR029427"
                     /translation="MKLIASVLNPVHNFDARSTAMLSLLTFKNCFLSNGRVLIFQLKP
                     CRKLQTTRFVLAESVASNNDILFNATASMRKNKDAAKLMTDRIHYVSPAKRKQTRTPS
                     TGHQNRKRTTLKWNTGSERAQAAANFTLRQVFKMNERGVVKVVNQTTNKLEETSILIW
                     AGELDLQKHGLAIVDVEQRGTFSIPLVKLVESKTALKKYSDELAKQKEEELTRLGFSS
                     KRTGRKNENDSNEDNLKQIKVSWQISDADLNKQKANEIISQLKKGYKVFLYMNGKDAL
                     NKSNWAEDITDEEPAHTRKHSDRELERRQHIVEQLQVIVNEFSLSPTVEGSIETRLIM
                     KLSPKPVASKKEDRMALKEQRKRERQEKLERKLEKKKLRNSENY"
     gene            complement(<514124..>520786)
                     /locus_tag="KLTH0F05874g"
                     /db_xref="GeneID:8292659"
     mRNA            complement(<514124..>520786)
                     /locus_tag="KLTH0F05874g"
                     /product="KLTH0F05874p"
                     /transcript_id="XM_002554415.1"
                     /db_xref="GeneID:8292659"
     CDS             complement(514124..520786)
                     /locus_tag="KLTH0F05874g"
                     /note="highly similar to uniprot|P07259 Saccharomyces
                     cerevisiae YJL130C URA2 Multifunctional carbamoylphosphate
                     synthetase (CPSase)-aspartate transcarbamylase (ATCase)
                     that catalyzes the two first reactions of the pyrimidine
                     pathway; carbamoyl-phophate synthetase, aspartate
                     transcarbamylase, and glutamine amidotransferase"
                     /codon_start=1
                     /product="KLTH0F05874p"
                     /protein_id="XP_002554461.1"
                     /db_xref="GeneID:8292659"
                     /db_xref="GOA:C5DKM3"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DKM3"
                     /translation="MSIITPTGPIAPPMESTGDRLVTLELQDGVAVQGYSFGAPKSAA
                     GELVFQTGMVGYPESVTDPSYEGQILVITFPLVGNYGVPDRNLQDELVESLPRYFESS
                     RIHIAGLVIAHYTDQYSHWLANSSLAAWLKEEGIPAVYGIDTRALTKHLRDSGSMLGR
                     LALQKSGSDFVRATSAEWRDSFEIPDWVDPNVQNLVAKVSTSEPHLYTPPSDFDVSNL
                     QKGPDGKTLRILAIDVGMKFNQIRCFVKRGVELLVVPWDYDFTKEQYDGLFISNGPGD
                     PSVLSDLNVKLTKVLESKKTPVFGICLGHQLLARASGASTLKLKFGNRGHNIPCTSTI
                     SGKCYITSQNHGFAVDVDTLTTGWKPLFVNANDGSNEGIYHTELPYFSVQFHPESTPG
                     PRDTEFLFDVFIQSVKQFKHTGQIKPVEFPGGKLEDNLAAHPRVEAKKVLVLGSGGLS
                     IGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFVRKV
                     ILHERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTPIDTVITTEDRELFSNAMD
                     EINEKCAKSKAASTVEEALEAVKEIGFPVICRSAFALGGLGSGFANNEKELVDLCNVA
                     FASSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQT
                     LSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKA
                     TGYPLAYTAAKLGLNIPLNEVKNSVTQSTCACFEPSLDYCVVKMPRWDLKKFNRVSTA
                     LSSSMKSVGEVMSIGRTFEEAIQKAIRSTEYVNLGFNETDMDIDIDYELSHPTDERIF
                     AIANAFSNLNYSVEKVWQLSNIDKWFLTKLYDLVAFAKKIESYGAKENLPPLVLKQAK
                     QLGFDDRQIAKFINSNEVAIRRLRKECGITPFVKQIDTVAAEFPAHTNYLYMTYNAAT
                     HDLSFNDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRKNNIKSIMVNYNPETVSTDY
                     DEADRLYFETISLERILDIYEIETSAGVVVSMGGQTSNNIAMSLHRENVKILGTTPEM
                     IDSAENRYKFSRMLDQIGVDQPAWKELTSIDEAEKFADAVSYPVLVRPSYVLSGAAMN
                     TVYSKDDLASYLNQAVEVSREYPVVITKYIENAKEIEMDAVAKNGELIMHVVSEHVEN
                     AGVHSGDATLIVPPQDLDPETVERIVVATAKIGKALKITGPFNIQFIAKNNEIKVIEC
                     NVRASRSFPFISKVVNVNLIEMATKAIMGLPVTPYPTEKLPEDYVAIKVPQFSFPRLA
                     GADPVLGVEMASTGEVATFGHSKYEAYLKSLLSTGFKLPKKNVLLSIGSFKEKQEMLP
                     SVKKLYNMGYKLFATAGTADFISEHGIPVQYLEVLNEGDDEKSEYSLTQHLANNKIDL
                     YINLPSANRFRRPASYVSKGYQTRRMAVDYSVPLVTNVKCAKLLIEAISRNLNLEVSE
                     RDAQTSHRTVTIPGLINISAYMPHISNVVQGPEEMKEITRLSAESGFTYSQIMPKSTR
                     GPVITNEQSIKVANSVAQESAYTDFGFTVAATAHNVGETAQCANDANALFLPHRELTG
                     KVSIVAEHLKNWPVEKQIIAEAKTSDLASVILLASLQNRPIHITGVSNRDDLSLIMTV
                     KEKQDKVTCDINIHALFVSQDDYPEALFLPTIEDQEFFWRNLDAIDAFSIGALPTLLA
                     QITGNEVVTGIGIKEALPLLLSAVNNGRLTIDDIVERLHDNPASIFNIPEQNAEVEID
                     LDFAFRHTKRWSPYTKGGLRGGVERVLVDGETIVLSGDLVAAEAEGKLVSSSSTKILT
                     PAHPSVEPTPFAGTKKRFSFSNEKRSSFTGFSDDEDSLVDQPLEQRLMSSRPPKELAA
                     PGAIQSLIRGNNPFLRRNILSVNQFKRSDFHALFAVAQELRSAVERDGILDLMKGRLL
                     TTIFYEPSTRTSSSFIAAMERLGGRTVNINTTSSSVKKGETLQDTIRTLACYSDAIVL
                     RHPDEMSAHTAAKYSPVPILNGGNGSREHPTQAFLDLFTIREELGTVNGITVTFMGDL
                     KYGRPVHSLCRLLRHYQVRINLVSPSELRLPQALRTELANAGMLGVESETLTPEIISK
                     SDVLYCTRVQQERFEKREEYEKLKDVYIVDNKILSHAKDQMVVMHPLPRVNEIREEVD
                     YDHRAAYFRQMRYGLFVRMALLAMVMGIDL"
     gene            complement(<521903..>525343)
                     /locus_tag="KLTH0F05896g"
                     /db_xref="GeneID:8292660"
     mRNA            complement(<521903..>525343)
                     /locus_tag="KLTH0F05896g"
                     /product="KLTH0F05896p"
                     /transcript_id="XM_002554416.1"
                     /db_xref="GeneID:8292660"
     CDS             complement(521903..525343)
                     /locus_tag="KLTH0F05896g"
                     /note="similar to uniprot|P12685 Saccharomyces cerevisiae
                     YJL129C TRK1 Component of the Trk1p-Trk2p potassium
                     transport system 180 kDa high affinity potassium
                     transporter"
                     /codon_start=1
                     /product="KLTH0F05896p"
                     /protein_id="XP_002554462.1"
                     /db_xref="GeneID:8292660"
                     /db_xref="GOA:C5DKM4"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /db_xref="UniProtKB/TrEMBL:C5DKM4"
                     /translation="MQAWKTLSRRPTLASINITYHKTIGHRLRDIIEYVGNVTHPFVK
                     HIFPNFIAVHYFYIITLSIIGSILIYPIKNFAYIDILFMATGAATQGGLNTINVNDMT
                     LYQQIVLYLICCLATPIWIHGVLAFVRLYWFERYFDGIRDWSKKNFKVRRTKTLIQRE
                     MTRTATEAQRRHKTAGRANNDFQSKLFSGQMIKREEQGGVKENYEMNSLKDAPTGGSE
                     HKDPHTSSSTGTTKSDQEDSPAIKFGDMPKPHKSPKKPADIEMFSGRRRSEDITPADM
                     FRSIAMLQNRHNEEEEEHDGPALVIRGPAERRQGSDPSWASVPHSGNIEETKDKDSRK
                     PATHSINSPSSAARSPSFHKEADYSPTQWSSQNESRPRTPSSIQFNIGMVPSSKPGNP
                     QYHSSNRKKLNTRIMKKLTPRNRLRKRLRKTASNTDEDGNDADFEQDSLTSGTDHDQD
                     EESLASFGLSSQHSSQAPNMEKVQSTLAVPSGDATGGSKFYKRSLTMEAPGNSDWDVL
                     TKSPSFQKMIYNKWKDERRRKKGVIHSAYRRPSLAHSTSELDSGFNLGHDARTMTDEA
                     LFGNNHDEEYFGTTFEEPTDRPRLKRMSTNYLSWQPKIGRNSTFVGMNEIQRAELGGV
                     EYRAIKLLCKLLLLYYIGFHVMGMVMLLPWITQMKHYAKLVREDGVAPAWWGFFTAMS
                     SFNDLGLTLTPDSMVSFNKAIYPLIVMMWFIIIGNTGFPVFLRFIIWVMFKLSPELSL
                     IKESLGFLLDHPRRCFTLLFPSAPTWWLLFILVTLNAIDLILFIVLDLNSQVVEGLTS
                     GFKVLNGLFQAVSTRTAGFTILNLSKLHPSIQVSYMLMMYVSVLPLAISIRRTNVYEE
                     QSLGIYDNGGDDAHHKDSSSDSQSEDERNLEKSAKSFIGAHLRRQLSFDLWFLFLGLF
                     IICISEGGKIQDTNKPDFTVFQVLFEIVSAYGTVGLSLGYPNTDQSFSGQFNTFSKVI
                     IIGMLIRGRHRGLPYSLDRAIILPSQSLERRDQLQDLKQEQHTTEAKDPIVDYLRRQS
                     RSAKGQLRSLLSRRKRPTSDESVPLRSFSNHENLRQPSASNVSNLSPAPRSSPRSQSL
                     SQGDAETYGGEESSSISSDFQDMAASGSSIGPRNEEVPHFSDEPPTALEGPRAFEPNT
                     "
     gene            complement(<525566..>527254)
                     /locus_tag="KLTH0F05918g"
                     /db_xref="GeneID:8292661"
     mRNA            complement(<525566..>527254)
                     /locus_tag="KLTH0F05918g"
                     /product="KLTH0F05918p"
                     /transcript_id="XM_002554417.1"
                     /db_xref="GeneID:8292661"
     CDS             complement(525566..527254)
                     /locus_tag="KLTH0F05918g"
                     /note="some similarities with uniprot|P08018 Saccharomyces
                     cerevisiae YJL128C PBS2 MAP kinase kinase that plays a
                     pivotal role in the osmosensing signal- transduction
                     pathway activated under severe osmotic stress"
                     /codon_start=1
                     /product="KLTH0F05918p"
                     /protein_id="XP_002554463.1"
                     /db_xref="GeneID:8292661"
                     /db_xref="GOA:C5DKM5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKM5"
                     /translation="MGGLEPSNGDHEIKRTGSTSSNYSNINANLHARVKAFQEQRQLK
                     RNGSVGSGHGSVSSQSGKTEGGGEPQNIDKIVNKPLPPLPPSKESGQVLSPIRRAPRP
                     PALSAAGPGGGAAKPSLSARRGLKLPAGGMSLKMKPPAPQEFAGAPSNRNPAVATPGV
                     ATAQNGRRSNPGSLVNGVQTTSTSSRQQRDTEGTTPSQQQLQQQQSRSGSNGLFTNFS
                     KYVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHK
                     PTNVIMAMKEVRLELDESKFTQILMELEVLHKCQSPFIVDFYGAFFIEGAVYMCMEYM
                     DGGSLDKSYDSEYLGGIDEPQLAHITYAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQ
                     GTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDKATYTVQSDIWSLGLSIL
                     EMAIGSYPYPVETFDNIFSQLSAIVDSPPPKLPQDRFSPVAQDFVNMCLQKVPERRRN
                     YAALLEHPWLKRYSNIEVNMSEYITNRLEKKRLITEEKGSEPVKNIPALHKGGL"
     gene            <529968..>531923
                     /locus_tag="KLTH0F05940g"
                     /db_xref="GeneID:8292662"
     mRNA            <529968..>531923
                     /locus_tag="KLTH0F05940g"
                     /product="KLTH0F05940p"
                     /transcript_id="XM_002554418.1"
                     /db_xref="GeneID:8292662"
     CDS             529968..531923
                     /locus_tag="KLTH0F05940g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F05940p"
                     /protein_id="XP_002554464.1"
                     /db_xref="GeneID:8292662"
                     /db_xref="InterPro:IPR021102"
                     /db_xref="UniProtKB/TrEMBL:C5DKM6"
                     /translation="MGRKGTDMATEKELERPGVQDLQGNAASDPNFDYEKQGLARKNK
                     GGSRPWKHRRNIAVIVCLLLVNLFLRFDKNTMFGAKVHGDLSSPQNRVQHSFEVTVEK
                     LPSTDPVFTQHLLSSSFGDSWGKPAKAHFEPYNGGKYDKIILELVTNVTGRQFDRLLH
                     VFIDDINVWRSSTVEPWGNRTIVSEAIKDISQYRALFDRESLEITLQLDNLVTHRLTG
                     VFNVELRAHYYQTSNDTDVSKPSLREKLLQYFTSPANLITPLVSHFSRTPLFYYPRAS
                     QGNPRWSRSLPELEESSNISRAMIEIFASGNAAEEFWYTNVLDRFTNRFRKSGHELLG
                     HGPFRAIKIYLTNSEKEILVDSVVPTPIIFTGFIPPLWRPCVGMNAFDLESYKVDLTP
                     FLSLIEGESWELQLEVVSSASSNFKPTVGENWIISGNVFVWNNTLDATQPSFTNSSML
                     PSSFDVFVNDSKPDELIQNVSAKNGVLVESTITLDGVEYQLHQTVESTFTSNQKYLEN
                     GDVEKTFVDLSKERKWVFRKADKDLFEFTDRTGWDFVGSVKTFTSEKDSSQLTYAADV
                     ARSLERHITLQEKDSVGHQVGNDNVLLSLAGSQVGQANYTLSSNGNYGSGNSVHSVCV
                     ERAWPYEDNYERTVVVADNEVVLDDYK"
     gene            complement(<531962..>533626)
                     /locus_tag="KLTH0F05962g"
                     /db_xref="GeneID:8292663"
     mRNA            complement(<531962..>533626)
                     /locus_tag="KLTH0F05962g"
                     /product="KLTH0F05962p"
                     /transcript_id="XM_002554419.1"
                     /db_xref="GeneID:8292663"
     CDS             complement(531962..533626)
                     /locus_tag="KLTH0F05962g"
                     /note="similar to uniprot|P35208 Saccharomyces cerevisiae
                     YJL127C SPT10 Putative histone acetylase required for
                     transcriptional regulation at core promoters functions at
                     or near the TATA box"
                     /codon_start=1
                     /product="KLTH0F05962p"
                     /protein_id="XP_002554465.1"
                     /db_xref="GeneID:8292663"
                     /db_xref="GOA:C5DKM7"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DKM7"
                     /translation="MDSNEGPEELRMTHLQPQSILLKDGETTATMYPIPAYAEQLPAG
                     LLAFLLDEFNMEIEKGDSLPYYEPLTLEGFNETWFHRDGLVCVMVLGEIPELDYSKSE
                     EAGNGSTASDDPQAEVTRHTSQYIRRKERRNLNLNIQWEKQCLGAFNLRPAYPGRSSH
                     VVTATFLVNAGIRGKGIGRTLVECFLSWAPQMGFTSSVFPLVYGTNVGVRRILETLSF
                     RRVGKLPESAILKGCDVPVDSFIYAKEFTHVSKSIDLLNEPNKHFAKYERLRYYLETG
                     KYPDYCDRNEKARLRASSKYHSVQNGKLMRQGREVVYDPEKQLEVAFEVHQVSHQGIN
                     KVTTKIAERYHWKGIKTTVARIVAACPLCKTQHQDDLGIVVEAGSPQQQAHMIVPSGG
                     DVDHSSQLSRVTAAVIGSLQEPGTDMERTPVDEEPRKRSKPTIHRIKFSGSRDPQIST
                     QEVLDNEHSMNNFSEYARHQQKSKRRYLDVAMSANMSRSATLPGSDIPSGPATVEIDE
                     QDDTHMVDDALLDLEDNVMAAVEAVRSEQKSKDDQYGHESNVQQFY"
     gene            <533877..>534935
                     /locus_tag="KLTH0F05984g"
                     /db_xref="GeneID:8292664"
     mRNA            <533877..>534935
                     /locus_tag="KLTH0F05984g"
                     /product="KLTH0F05984p"
                     /transcript_id="XM_002554420.1"
                     /db_xref="GeneID:8292664"
     CDS             533877..534935
                     /locus_tag="KLTH0F05984g"
                     /note="similar to uniprot|P47016 Saccharomyces cerevisiae
                     YJL126W"
                     /codon_start=1
                     /product="KLTH0F05984p"
                     /protein_id="XP_002554466.1"
                     /db_xref="GeneID:8292664"
                     /db_xref="GOA:C5DKM8"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:C5DKM8"
                     /translation="MLKPTFKFLKTEQWTRCLFKSQKRLAPAWDLLSAPKYNRRFFYS
                     SSSRCQESMNRIAIGQMCSSSSLDQNLGVVKTLIDQALASDAKVIFFPEAADYISRSA
                     SHSLELAEKSPAFVEGLQKAIPELCSKHQKRIDVSIGVHLPATSSDKSQHDTRLRNCL
                     LYITHEGKIRQEYQKLHLFDVEVPNGPILKESQAVQPGRAIPDVLDTPVGKLGSAICF
                     DVRFPELALKLRSKGAEILCFPSAFTMKTGEAHWQLLACARALDTQCYVIMPGQQGEH
                     EVGIDPSKPGESPLKRVSWGHSMVVGPWGKVVAAADPANNEPQLLLADLDLDAQKKIR
                     RDMPLWEQRRRDVFGDFV"
     gene            complement(<534961..>536163)
                     /locus_tag="KLTH0F06006g"
                     /db_xref="GeneID:8292665"
     mRNA            complement(<534961..>536163)
                     /locus_tag="KLTH0F06006g"
                     /product="KLTH0F06006p"
                     /transcript_id="XM_002554421.1"
                     /db_xref="GeneID:8292665"
     CDS             complement(534961..536163)
                     /locus_tag="KLTH0F06006g"
                     /note="highly similar to uniprot|P46959 Saccharomyces
                     cerevisiae YJL125C GCD14 Subunit of tRNA
                     (1-methyladenosine) methyltransferase with Gcd10p required
                     for the modification of the adenine at position 58 in
                     tRNAs especially tRNAi-Met first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="KLTH0F06006p"
                     /protein_id="XP_002554467.1"
                     /db_xref="GeneID:8292665"
                     /db_xref="GOA:C5DKM9"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DKM9"
                     /translation="MSHFSEYKDLIQVGDLALVWISRDNIKPVTITAGETFNTRYGSF
                     PHDDMIGKPYGSQIAVRTKGSNRFGFIHVLQPTPELWTISLPHRTQIVYTPDSSYIMQ
                     RLQCSPHSRVIEAGTGSGSFSHAFARSAGHLFSYEFHEVRYEQAKKEFEEHGLFRDGN
                     VTITHRDVCHDGFTIKNTDKTTFFDGKSAEEAQQPACIGADVIFLDLPAPWDAIPNLD
                     CVISQNSKTSMCCFSPCIEQVDKTLEALEKHGWTEVEMVEIQGRQYESRRQMVRHLDD
                     ALQRLRDVRERKQVGVERRKRMFNKIISDQEEPYEERPETPKTQFNPFGKGSRVKEGD
                     SNYSWKEVSKVESEIKSHTSYLTFASKIVHKARNEELVQSIIEEHKDVTPESTLPGKK
                     DKKQSVNK"
     gene            complement(<537096..>537578)
                     /locus_tag="KLTH0F06028g"
                     /db_xref="GeneID:8292666"
     mRNA            complement(<537096..>537578)
                     /locus_tag="KLTH0F06028g"
                     /product="KLTH0F06028p"
                     /transcript_id="XM_002554422.1"
                     /db_xref="GeneID:8292666"
     CDS             complement(537096..537578)
                     /locus_tag="KLTH0F06028g"
                     /note="similar to uniprot|P47017 Saccharomyces cerevisiae
                     YJL124C LSM1 Component of small nuclear ribonucleoprotein
                     complexes involved in mRNA decapping and decay"
                     /codon_start=1
                     /product="KLTH0F06028p"
                     /protein_id="XP_002554468.1"
                     /db_xref="GeneID:8292666"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5DKN0"
                     /translation="MSEMKSAPSGASKISEGEADLYLDQYNFTTTAAIVGSVDRKIFV
                     LLRDGRMLFGILRTFDQYANLILQHCVERIYITEENKYAECGRGVFMVRGENVVMLGE
                     VDIDREDQPLSQMERISFEEASAVKKQRDDARCELESKKGKTMAQHGLIYEFHKSDIY
                     "
     gene            <538194..>538580
                     /locus_tag="KLTH0F06050g"
                     /db_xref="GeneID:8292667"
     mRNA            <538194..>538580
                     /locus_tag="KLTH0F06050g"
                     /product="KLTH0F06050p"
                     /transcript_id="XM_002554423.1"
                     /db_xref="GeneID:8292667"
     CDS             538194..538580
                     /locus_tag="KLTH0F06050g"
                     /note="similar to uniprot|P36141 Saccharomyces cerevisiae
                     YKR049C FMP46 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0F06050p"
                     /protein_id="XP_002554469.1"
                     /db_xref="GeneID:8292667"
                     /db_xref="GOA:C5DKN1"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR012882"
                     /db_xref="UniProtKB/TrEMBL:C5DKN1"
                     /translation="MSLFRSLQHQPRVITLFTHDVASKPSVLIMQQLRGDQSDKFNIE
                     VHTKFPTLDQLQYMQGINSAALQAQVATLSELMRRDSSYETFGKDLKECAKSGIWNPR
                     TSLWVDWEKKRMGNDASSVKALLEKL"
     gene            complement(<538668..>540104)
                     /locus_tag="KLTH0F06072g"
                     /db_xref="GeneID:8292668"
     mRNA            complement(<538668..>540104)
                     /locus_tag="KLTH0F06072g"
                     /product="KLTH0F06072p"
                     /transcript_id="XM_002554424.1"
                     /db_xref="GeneID:8292668"
     CDS             complement(538668..540104)
                     /locus_tag="KLTH0F06072g"
                     /note="similar to uniprot|P47018 Saccharomyces cerevisiae
                     YJL123C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06072p"
                     /protein_id="XP_002554470.1"
                     /db_xref="GeneID:8292668"
                     /db_xref="InterPro:IPR018814"
                     /db_xref="UniProtKB/TrEMBL:C5DKN2"
                     /translation="MKELVRNTYPSATRAAMSGRNSTEADDVLEFLESLPESSKTSGG
                     SGAENSGKEPKKDTEILDFLDELEQSNLSLKKDKKAGQAEENAQEGEGDSVAQTSTAS
                     KEPAAAEKPAAAEKPVAAEEPAAVEDPASSKASQPKETAASVSQADAEIIQSEPETTS
                     DPITSFSNWWSSSGSATVNSFFSKTAEQATHLKDRLAQEQHGIASKLQGTSLGSKINT
                     ATLSTLAKNLSRIVVGDTDEVLRIHLVHDLVNYPLLSYHVEQQFDNVLSSQVQSGVRI
                     FVDEWDHPIEGNDRVQDGKRHLNMFTGKVSDGEKLAFANLNNAIKLFTEAKDELAKQR
                     FETVSAEEGEKELAISDVFISILPISVPEKHKNPEIATTDSSHPGNFAFTIVLKDISN
                     DFTSITRSQGFPQRWADWLEGTSELKSKQDAIQDRESKRDAVERTDSADDAEGIDPSD
                     WVKEWVEDGLSLAFGVVAQNYVIDRMGF"
     gene            <540625..>541110
                     /locus_tag="KLTH0F06094g"
                     /db_xref="GeneID:8292669"
     mRNA            <540625..>541110
                     /locus_tag="KLTH0F06094g"
                     /product="KLTH0F06094p"
                     /transcript_id="XM_002554425.1"
                     /db_xref="GeneID:8292669"
     CDS             540625..541110
                     /locus_tag="KLTH0F06094g"
                     /note="similar to uniprot|P47019 Saccharomyces cerevisiae
                     YJL122W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06094p"
                     /protein_id="XP_002554471.1"
                     /db_xref="GeneID:8292669"
                     /db_xref="GOA:C5DKN3"
                     /db_xref="InterPro:IPR015218"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:C5DKN3"
                     /translation="MPSKNSINRPKQQMNLNRKVHSLAKKRDARERAGLLQPARSHET
                     SKSGQPKSVPIDLYKGEQSSAGPVTTKTLSKKRAKKIERNMRYAEQRKLLVDVQKKAE
                     DGMEVDGEVAASIAGSDAAKKSQFARVKDAFFRAMEDTASSGLVLENGAGTTLGGRFF
                     P"
     gene            complement(<541186..>541896)
                     /locus_tag="KLTH0F06116g"
                     /db_xref="GeneID:8292670"
     mRNA            complement(<541186..>541896)
                     /locus_tag="KLTH0F06116g"
                     /product="KLTH0F06116p"
                     /transcript_id="XM_002554426.1"
                     /db_xref="GeneID:8292670"
     CDS             complement(541186..541896)
                     /locus_tag="KLTH0F06116g"
                     /note="highly similar to uniprot|P46969 Saccharomyces
                     cerevisiae YJL121C RPE1 D-ribulose-5-Phosphate
                     3-epimerase"
                     /codon_start=1
                     /product="KLTH0F06116p"
                     /protein_id="XP_002554472.1"
                     /db_xref="GeneID:8292670"
                     /db_xref="GOA:C5DKN4"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /db_xref="UniProtKB/TrEMBL:C5DKN4"
                     /translation="MVKPIVAPSILASDFANLECSCHKVINAGADWLHIDVMDGHFVP
                     NITLGQPIVASLRKAVPRVQDTTATKPKAFFDCHMMVESPEKWVADFAKCGADQFTFH
                     YEATKDPLALVKLIKSHNIRAACAIKPGTPVDVLYELGPHLDMALVMTVEPGFGGQKF
                     MIEMMPKVEALRAKFPNMDIQVDGGLGKDTIPHAAKAGANVIVAGTSVFTAADPADVI
                     SFMKGQVAENLETRGLLE"
     gene            complement(542069..542154)
                     /locus_tag="KLTH0F06138r"
                     /db_xref="GeneID:8292671"
     tRNA            complement(join(542069..542104,542116..542154))
                     /locus_tag="KLTH0F06138r"
                     /product="tRNA-Tyr"
                     /note="tRNA-Tyr (GTA) cove"
                     /db_xref="GeneID:8292671"
     gene            <542483..>543781
                     /locus_tag="KLTH0F06160g"
                     /db_xref="GeneID:8292672"
     mRNA            <542483..>543781
                     /locus_tag="KLTH0F06160g"
                     /product="KLTH0F06160p"
                     /transcript_id="XM_002554427.1"
                     /db_xref="GeneID:8292672"
     CDS             542483..543781
                     /locus_tag="KLTH0F06160g"
                     /note="similar to uniprot|P25293 Saccharomyces cerevisiae
                     YKR048C NAP1 Protein that interacts with mitotic cyclin
                     Clb2p required for the regulation of microtubule dynamics
                     during mitosis controls bud morphogenesis involved in the
                     transport of H2A and H2B histones to the nucleus"
                     /codon_start=1
                     /product="KLTH0F06160p"
                     /protein_id="XP_002554473.1"
                     /db_xref="GeneID:8292672"
                     /db_xref="GOA:C5DKN5"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:C5DKN5"
                     /translation="MSKPIKTTSSKIDAAPTPHNTPSSVLGSSYLKNGNPARNIPQTI
                     NEEEINSALANNPQLLASIQDKLGDLVGQDSGYVASLPGAVRDRIYALKKLQRDLFEM
                     EKEFQLEMFALEEKYLKKYAPVHQRRFEIVTGKQEPTAQEIEAGKDEGDQLDTLAEEP
                     EEDEEGADNAAEDLKGIPSFWLTAFENLPIMSQTVTSADAEVLEFLTDVKLEYLTEGK
                     PGFKLVFEFDPENPFFSNSQLVKTYYYQSELGYSGDFIYDHAEGCKIDWTDNESNVTI
                     SVEKRKQRNKTTKQVRTIEKITPVESFFNFFDPPKLPAKAKDASGSGDENEDDDEDEE
                     DDEEVAELESRLALDYAIGEEFKDKLIPRAVDWFTGAAIEFEYDADQPDDEEFDSELD
                     DDEEDDDEDDDEDGDDDGSENDFASAAPGTKEQPPECKQN"
     gene            <544018..>544980
                     /locus_tag="KLTH0F06182g"
                     /db_xref="GeneID:8292673"
     mRNA            <544018..>544980
                     /locus_tag="KLTH0F06182g"
                     /product="KLTH0F06182p"
                     /transcript_id="XM_002554428.1"
                     /db_xref="GeneID:8292673"
     CDS             544018..544980
                     /locus_tag="KLTH0F06182g"
                     /note="similar to uniprot|P36139 Saccharomyces cerevisiae
                     YKR046C PET10 Protein of unknown function that co-purifies
                     with lipid particles expression pattern suggests a role in
                     respiratory growth computational analysis of large-scale
                     protein-protein interaction data suggests a role in
                     ATP/ADP exchange"
                     /codon_start=1
                     /product="KLTH0F06182p"
                     /protein_id="XP_002554474.1"
                     /db_xref="GeneID:8292673"
                     /db_xref="UniProtKB/TrEMBL:C5DKN6"
                     /translation="MSSQNSVKVVVDRDSVSKFASCQSATLNHLNKYDKLRDAAGYVL
                     SYSAVSSTLSAVLTVLYRAKLATVDSPKAPQLVRGTYHAGVSALRRLDELFNVLVLRE
                     GLDEFMAQYRTHSGKPGFWVLLYVVDYIANVSNLVLKQLVVKPLKLRQRTSGPAELAH
                     EMETNGVSGAGHTEPENLPHIKELAGTTRSLSHELQSKLNSDYIEPARTKLQQEYIEP
                     TKDKINGTREFMTEKYGEFIKPKYNAAYQTVSEKYEGNLNKSESVPRAIVSTGVDLGN
                     MTLGKLKNGVATGVDKIEPKAREVAQEINDTAASVAESTESLAK"
     gene            complement(<545288..>545989)
                     /locus_tag="KLTH0F06204g"
                     /db_xref="GeneID:8292674"
     mRNA            complement(<545288..>545989)
                     /locus_tag="KLTH0F06204g"
                     /product="KLTH0F06204p"
                     /transcript_id="XM_002554429.1"
                     /db_xref="GeneID:8292674"
     CDS             complement(545288..545989)
                     /locus_tag="KLTH0F06204g"
                     /note="similar to uniprot|Q12012 Saccharomyces cerevisiae
                     YOR289W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06204p"
                     /protein_id="XP_002554475.1"
                     /db_xref="GeneID:8292674"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR023473"
                     /db_xref="InterPro:IPR027485"
                     /db_xref="UniProtKB/TrEMBL:C5DKN7"
                     /translation="MGEEPEELRSSPFAFYAFYQLHQHLKATPVSRLSFQDILRQLYP
                     DYVMKPGKEKEKTSLFITWEKQGASGREDFQLRGCIGTFARPPLLKGIERYSLIAALQ
                     DDRFPPIRKGEFPRLKCSCNILHNFTTIYKRSKPDGDIFDWEIGVHGIELKFEDPGTG
                     RILSATFLPEVMPEQGWDKQETFQALIEKAGYYRDIGQLIDSYDEYFVEVLRYEGDKS
                     AIAYEEFSRQLEQVI"
     gene            <546103..>546733
                     /locus_tag="KLTH0F06226g"
                     /db_xref="GeneID:8292675"
     mRNA            join(<546103..546136,546192..>546733)
                     /locus_tag="KLTH0F06226g"
                     /product="KLTH0F06226p"
                     /transcript_id="XM_002554430.1"
                     /db_xref="GeneID:8292675"
     CDS             join(546103..546136,546192..546733)
                     /locus_tag="KLTH0F06226g"
                     /note="weakly similar to uniprot|P36138 Saccharomyces
                     cerevisiae YKR045C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06226p"
                     /protein_id="XP_002554476.1"
                     /db_xref="GeneID:8292675"
                     /db_xref="UniProtKB/TrEMBL:C5DKN8"
                     /translation="MSESHHDNAFQERKRKLSVWVKRIIQPNREQAQTQQHQRTQRQE
                     RRRPQQFAVAHSKPHSKRRSVKGGLASAELTTPQAKREPLARSVAWGDPIYKEAIPHL
                     PRLEFDHIQDNASTAPLVSHCSSSAKSSVFSDVTSLQSTRATVSSSKTFDTNASTVGI
                     PSASILDRARHTNPAQGAPSVFSAATTQHTT"
     gene            <547112..>548017
                     /locus_tag="KLTH0F06248g"
                     /db_xref="GeneID:8292676"
     mRNA            <547112..>548017
                     /locus_tag="KLTH0F06248g"
                     /product="KLTH0F06248p"
                     /transcript_id="XM_002554431.1"
                     /db_xref="GeneID:8292676"
     CDS             547112..548017
                     /locus_tag="KLTH0F06248g"
                     /note="similar to uniprot|P46956 Saccharomyces cerevisiae
                     YJL117W PHO86 Protein specifically required for packaging
                     of the high-affinity phosphate transporter Pho84p into
                     COPII coated vesicles for transport to the plasma membrane
                     transcription and localization are regulated by phosphate
                     levels"
                     /codon_start=1
                     /product="KLTH0F06248p"
                     /protein_id="XP_002554477.1"
                     /db_xref="GeneID:8292676"
                     /db_xref="InterPro:IPR024297"
                     /db_xref="UniProtKB/TrEMBL:C5DKN9"
                     /translation="MAKKTQPQMVEQMDASLHEPINKDAPLTIYGSKLKPELATAALN
                     LSIDFLKQQQSLANQHVMWHRKTLGTAFLCAFVYLAPRATFPKGSKSVMGTVVQFVLM
                     NKAQLVYFAVVTILAASFIFTFLARFTEDLFKRKISQVVDTNGVAVFGVDLTELVKGD
                     IKDKSKLDNTQVIVYRETPIALASVVENSLMSSNDALVMGVSTIGSRRVYLQSGIIED
                     LLDWALIRTKNIQKTGKFEAGNSMKLLVEVYSFDKVIKKTLKSKGFSLIKAVKLEESR
                     LLGGLFGVKKELWGVQFHFDSKKQK"
     gene            complement(<548173..>549417)
                     /locus_tag="KLTH0F06270g"
                     /db_xref="GeneID:8292677"
     mRNA            complement(<548173..>549417)
                     /locus_tag="KLTH0F06270g"
                     /product="KLTH0F06270p"
                     /transcript_id="XM_002554432.1"
                     /db_xref="GeneID:8292677"
     CDS             complement(548173..549417)
                     /locus_tag="KLTH0F06270g"
                     /note="similar to uniprot|P36137 Saccharomyces cerevisiae
                     YKR044W UIP5 Protein of unknown function"
                     /codon_start=1
                     /product="KLTH0F06270p"
                     /protein_id="XP_002554478.1"
                     /db_xref="GeneID:8292677"
                     /db_xref="GOA:C5DKP0"
                     /db_xref="InterPro:IPR001220"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DKP0"
                     /translation="MRGWRAWTQAALIALVFLGFRLVFKPSQNAEMRSGPFPLWRTRV
                     QREPNADASLSIPLLDKINNFWLVDGATQIRNFGNIRLTSRGQLGQYGVVVSNGAGDN
                     VLDDFETVVSFKIHNTGVSSQFMGDGMVVAISPEKDYIQQNMMSSYGRSQYEHNSGGI
                     IGNDRGLMGLPRNLPGLAVVIDTYKNDPKTRLKPPFMSVLLNMDPRKHHYSAATDGTE
                     STGHNLCPLIKLKRSLMSGKDTKLRIIYLESIGFLKVDIKYPDSNEWIELYQQDSNLY
                     LPKNRVTGQRYIAIGALTGQATQTVEIQGVETSEFHWDEHEEEGFDYAKEMQYFLAQE
                     YGERVKIGEDDYGKWLQVKRQGGTDQDPVARNKSKHSTLYYMAKISFVMFFLYGLSLS
                     IRISIKRAVRLRRKKSQASILG"
     gene            549676..549784
                     /locus_tag="KLTH0F06292r"
                     /db_xref="GeneID:8292678"
     tRNA            join(549676..549711,549749..549784)
                     /locus_tag="KLTH0F06292r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove"
                     /db_xref="GeneID:8292678"
     gene            <550148..>550963
                     /locus_tag="KLTH0F06314g"
                     /db_xref="GeneID:8292679"
     mRNA            <550148..>550963
                     /locus_tag="KLTH0F06314g"
                     /product="KLTH0F06314p"
                     /transcript_id="XM_002554433.1"
                     /db_xref="GeneID:8292679"
     CDS             550148..550963
                     /locus_tag="KLTH0F06314g"
                     /note="highly similar to uniprot|P36136 Saccharomyces
                     cerevisiae YKR043C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06314p"
                     /protein_id="XP_002554479.1"
                     /db_xref="GeneID:8292679"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DKP1"
                     /translation="MPKAPTPRCIIVRHGQTEWSKSGQYTGSTDLPLTEYGVGQMKRT
                     SECIFRNKFIDPNSITYIFTSPRTRARQTVDLILASLTQEQRERIRVVVDEDLREWEY
                     GDYEGLLTSQIVELRKSRGLDRERPWNIWRDGCENGESTEQFGLRLSRAIARIQNLHR
                     QHQAQGIASDIMVFAHGHALRYFAGLWLKHGEEKPCDGKKPVPATYQDETVPYVALKT
                     YRHLVDNPSFLLDAGGIGVLSYAHHNIDEPALALAGAFVCPPEEESQHGATES"
     gene            <551107..>552114
                     /locus_tag="KLTH0F06336g"
                     /db_xref="GeneID:8292680"
     mRNA            <551107..>552114
                     /locus_tag="KLTH0F06336g"
                     /product="KLTH0F06336p"
                     /transcript_id="XM_002554434.1"
                     /db_xref="GeneID:8292680"
     CDS             551107..552114
                     /locus_tag="KLTH0F06336g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F06336p"
                     /protein_id="XP_002554480.1"
                     /db_xref="GeneID:8292680"
                     /db_xref="UniProtKB/TrEMBL:C5DKP2"
                     /translation="MLDHFPTELQLRLLACNPQLAFVSRGWYRLNNLFYRDLCVQLRP
                     ESYWKGLATWICAYVKSLDPDRKDARLINRGFMRDTGGEFVEFMCDSWQILYSVLFAS
                     PRFFGMDSARMEIEDSSNSVSEYCCPMELVGGREYECSVWFRKRSTLNKFGAVRVVCE
                     ADAPREAGAAGLVGGAGAVLLARDLPVSIDNWCESAGMYSFAAGKIRVPPELGHVQDA
                     RMRVWITSPTSVEMVAVDLRPYQRGKQWLFLSTPQQGIFSAEEQRLSKARMGWAMERT
                     GNEEAPAAGAGAGAPAEDFRVVYRFPREQGKALKVRSVRYPWLGQGAVTRTLDRVRNI
                     T"
     gene            complement(<552396..>553481)
                     /locus_tag="KLTH0F06358g"
                     /db_xref="GeneID:8292681"
     mRNA            complement(<552396..>553481)
                     /locus_tag="KLTH0F06358g"
                     /product="KLTH0F06358p"
                     /transcript_id="XM_002554435.1"
                     /db_xref="GeneID:8292681"
     CDS             complement(552396..553481)
                     /locus_tag="KLTH0F06358g"
                     /note="some similarities with uniprot|P36135 Saccharomyces
                     cerevisiae YKR042W UTH1 Youth involved in determining
                     yeast longevity involved in cell growth"
                     /codon_start=1
                     /product="KLTH0F06358p"
                     /protein_id="XP_002554481.1"
                     /db_xref="GeneID:8292681"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:C5DKP3"
                     /translation="MLSKIILASLAAAPVLAAPAGAHHHARRDAVTTVVQYVTAGGSS
                     APAASSAVSSAASSPAASSSKASSSGSSSPSSSSASPSSSSSSSSGISGDLSAFSGPS
                     SKFQDGTVRCSDFPSGQGVIPLSWVGFGGWASIMSDDGSTADSCQDGYYCSYACQPGM
                     SKTQWPSQQPSDGRSVGGLECRNGYLYRTNSDSEYLCEWGQDSAYAVNNKGQDIAMCR
                     TDYPGSENMVIPTVVGAGSSQPVSVVKEDSYYKWGGKKTSAQYYVNNAGVGVEDGCVW
                     GTDGSGVGNWAPVVLGSGYTDGKTYLSIIPNPNNSDAPNFNVKIEAADGASVSGECKY
                     EDGKYSGSGSDGCTVTVTSGTANFVFY"
     gene            554685..554756
                     /locus_tag="KLTH0F06402r"
                     /db_xref="GeneID:8292682"
     tRNA            554685..554756
                     /locus_tag="KLTH0F06402r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=69.96"
                     /db_xref="GeneID:8292682"
     gene            <554948..>556126
                     /locus_tag="KLTH0F06380g"
                     /db_xref="GeneID:8292684"
     mRNA            <554948..>556126
                     /locus_tag="KLTH0F06380g"
                     /product="KLTH0F06380p"
                     /transcript_id="XM_002554436.1"
                     /db_xref="GeneID:8292684"
     CDS             554948..556126
                     /locus_tag="KLTH0F06380g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F06380p"
                     /protein_id="XP_002554482.1"
                     /db_xref="GeneID:8292684"
                     /db_xref="GOA:C5DKP4"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="UniProtKB/TrEMBL:C5DKP4"
                     /translation="MVGASIILAVGVAVGVVSSATQSVGLTLQRKASVAHAASHGRRS
                     LYRSGTWQLGFALFLLANIVGSTVQIATLPLIVLAPLQSCGLLFNSLAAHYLLKERST
                     WLTVAATLLVILGGMVVGVVGVSASSSMDTVTHSLTQLVRLAHQRLFLRWFALTNAAV
                     VLLLAATSCYAHALPAVVKGVVYGCCSGTWSAHSLLMAKSVSDVVSHAVLQGTADLRT
                     LGFWLLVLAFVSLALAQLFLLNKGLRHLSTSVLYPLVFCVYNLINIFNGLAFYHPPDT
                     PLARVLAVMLPGAASLVLGVVLLSRDQYNMFQHENTAAASDPSRRTSTLSYTSLRPQS
                     MDLSSLQSTPLSADDSDAFYISLPQATRKDKYGSVNSSKRNSRRVLSYEQEGILTQMV
                     "
     gene            <556413..>557303
                     /locus_tag="KLTH0F06424g"
                     /db_xref="GeneID:8292683"
     mRNA            <556413..>557303
                     /locus_tag="KLTH0F06424g"
                     /product="KLTH0F06424p"
                     /transcript_id="XM_002554437.1"
                     /db_xref="GeneID:8292683"
     CDS             556413..557303
                     /locus_tag="KLTH0F06424g"
                     /note="some similarities with uniprot|P32447 Saccharomyces
                     cerevisiae YJL115W ASF1 Nucleosome assembly factor
                     involved in chromatin assembly after DNA replication anti-
                     silencing protein that causes derepression of silent loci
                     when overexpressed"
                     /codon_start=1
                     /product="KLTH0F06424p"
                     /protein_id="XP_002554483.1"
                     /db_xref="GeneID:8292683"
                     /db_xref="GOA:C5DKP5"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /db_xref="UniProtKB/TrEMBL:C5DKP5"
                     /translation="MSIVSLLGINVLNNPAKFTDPYEFEITFECLEPLKNDLEWKLTY
                     VGSSRSLEHDQELDSILVGPVPVGVNKFLFTADPPSPELIPASELVSVTVILLSCSYD
                     GREFVRVGYYVNNEYDNEELRENPPAKVQVDQVVRNILAEKPRVTRFNIIWDNEQGEE
                     YPPEQPELEEEEEDDEDEEQEEDDEDDNDIEEEDDEEEKAPGYESKEASESKDEKEEG
                     PEAKKRKLKAEDEDEDEAEEIDLEEDDEEEEEEDGDAPEEDGEEEREGALEEERENTV
                     ETAPTPQDTSAAAAASDPEP"
     gene            complement(<557340..>558164)
                     /locus_tag="KLTH0F06446g"
                     /db_xref="GeneID:8292685"
     mRNA            complement(<557340..>558164)
                     /locus_tag="KLTH0F06446g"
                     /product="KLTH0F06446p"
                     /transcript_id="XM_002554438.1"
                     /db_xref="GeneID:8292685"
     CDS             complement(557340..558164)
                     /locus_tag="KLTH0F06446g"
                     /note="similar to uniprot|P36134 Saccharomyces cerevisiae
                     YKR041W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06446p"
                     /protein_id="XP_002554484.1"
                     /db_xref="GeneID:8292685"
                     /db_xref="UniProtKB/TrEMBL:C5DKP6"
                     /translation="MAFSQDYLSTSESSDEDEFKYFKPVYVRRRAARPDVPLEEKGKN
                     AACSGSAKAGDCQKNPATQDPRPRPGPYKLKAPGTNAFSGKEELIALERERIPQECSR
                     SQQEVKPQTRITEPTYEYGNPINGYKFVGSRSDYEKFTRAAESSSPSGGADDTNYIDS
                     RIFDRASMHSKRSSHPDDIAVYWARELGATRAPLPGAPLVQEVTIQSIDKASLADFLG
                     RSALSLRLPLREVLKQQRVVWHPDKVFRGSARANPNDAEKVTRIFQVINSLWEENQ"
     gene            <559256..>561769
                     /locus_tag="KLTH0F06468g"
                     /db_xref="GeneID:8292686"
     mRNA            <559256..>561769
                     /locus_tag="KLTH0F06468g"
                     /product="KLTH0F06468p"
                     /transcript_id="XM_002554439.1"
                     /db_xref="GeneID:8292686"
     CDS             559256..561769
                     /locus_tag="KLTH0F06468g"
                     /note="similar to uniprot|P54199 Saccharomyces cerevisiae
                     YDL028C MPS1 Dual-specificity kinase required for spindle
                     pole body (SPB) duplication and spindle checkpoint
                     function substrates include SPB proteins Spc42p Spc110p
                     and Spc98p mitotic exit network protein Mob1p and
                     checkpoint protein Mad1p"
                     /codon_start=1
                     /product="KLTH0F06468p"
                     /protein_id="XP_002554485.1"
                     /db_xref="GeneID:8292686"
                     /db_xref="GOA:C5DKP7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKP7"
                     /translation="MSSYTVRSSVPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGP
                     PKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAVREFSSSNT
                     NNSVAGPYSTFHSEEHSDSTMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRV
                     KSMQQTLRDELSLRSSKRRNRRFVSSRFNLLGPAKRASSNTGTPNHSELADESNVSQQ
                     EANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQ
                     YLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLTSASLSNSPLLK
                     HVDLIKREQSIPKRQPRRKISDHATNNDSKAWSSPVSSSKGLKTAPSRDGTSPRASEM
                     YENIERPERDTFGSIRRREALSNININSNYHQLQNKRTKYSTENLEEARGIHRPPFEH
                     SVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIPLKPPATSGDSYNRRKPTIY
                     VNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALKRVSFDEFDDSSIEGFKGEIELLK
                     KLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMGLDVEFVRFHSQEMLK
                     CVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMA
                     PEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIM
                     NPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFVKPIAVTHFF
                     IRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL"
     gene            complement(<561947..>563213)
                     /locus_tag="KLTH0F06490g"
                     /db_xref="GeneID:8292687"
     mRNA            complement(join(<561947..563100,563192..>563213))
                     /locus_tag="KLTH0F06490g"
                     /product="KLTH0F06490p"
                     /transcript_id="XM_002554440.1"
                     /db_xref="GeneID:8292687"
     CDS             complement(join(561947..563100,563192..563213))
                     /locus_tag="KLTH0F06490g"
                     /note="highly similar to uniprot|P32381 Saccharomyces
                     cerevisiae YDL029W ARP2 Essential component of the Arp2/3
                     complex which is a highly conserved actin nucleation
                     center required for the motility and integrity of actin
                     patches involved in endocytosis and membrane growth and
                     polarity"
                     /codon_start=1
                     /product="KLTH0F06490p"
                     /protein_id="XP_002554486.1"
                     /db_xref="GeneID:8292687"
                     /db_xref="GOA:C5DKP8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:C5DKP8"
                     /translation="MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER
                     ANVVTPLKDIMIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTS
                     GGKVMLTEPPMNPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK
                     LSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPG
                     VGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPS
                     RLEKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWQEMGPSAMSKFGPR"
     gene            complement(<563724..>564836)
                     /locus_tag="KLTH0F06512g"
                     /db_xref="GeneID:8292688"
     mRNA            complement(<563724..>564836)
                     /locus_tag="KLTH0F06512g"
                     /product="KLTH0F06512p"
                     /transcript_id="XM_002554441.1"
                     /db_xref="GeneID:8292688"
     CDS             complement(563724..564836)
                     /locus_tag="KLTH0F06512g"
                     /note="weakly similar to uniprot|Q7LHC7 Saccharomyces
                     cerevisiae YDL027C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06512p"
                     /protein_id="XP_002554487.1"
                     /db_xref="GeneID:8292688"
                     /db_xref="UniProtKB/TrEMBL:C5DKP9"
                     /translation="MLPSLGIRSGHRPFALRNLNLLTSANWPKNKGICSVIQIAKFPR
                     QANIANFPSLASQQFLIQKRSFHRDAILRSPFQNGRFPGEGKSPFKLYTFPPLLGIVA
                     LIGTIALLLVVLPLVFTFLFPLIIAGIAVFQFKRWQNTTLLGQLHRCLLATKMSINYK
                     TVWGLQTQMFESLLGSDGFAAGSFRGVMDEIRSQKIDAANSKRRADEALAFLDRRVLE
                     AFKNNELGLRDFFLGSDASTWVKKGYDLSLATDTPRIRGQSINNSLVMTISYPLYLLS
                     SSQERKLIAYVAIGVLDDSMAGQTGSFKFVEELASQNKECPMVISIRPARSLYAKQFV
                     LKDYGEARGKPTSAYYVRTADDGHREFTYRDADHNI"
     gene            complement(<565211..>566611)
                     /locus_tag="KLTH0F06534g"
                     /db_xref="GeneID:8292689"
     mRNA            complement(<565211..>566611)
                     /locus_tag="KLTH0F06534g"
                     /product="KLTH0F06534p"
                     /transcript_id="XM_002554442.1"
                     /db_xref="GeneID:8292689"
     CDS             complement(565211..566611)
                     /locus_tag="KLTH0F06534g"
                     /note="similar to uniprot|Q99186 Saccharomyces cerevisiae
                     YOL062C APM4 Clathrin associated protein medium subunit"
                     /codon_start=1
                     /product="KLTH0F06534p"
                     /protein_id="XP_002554488.1"
                     /db_xref="GeneID:8292689"
                     /db_xref="GOA:C5DKQ0"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ0"
                     /translation="MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS
                     PVLTLGSTTFHHVKSPGNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKE
                     DFMTCYELLDIVLEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPV
                     AQFLRARSSSSNLHDSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILK
                     SYVDGTVEATTHLSGMPVCRFGLNDSLSVSTPFGDNESPTTNKKAIPKAAAGSVMLED
                     CKFHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDY
                     RVTIKSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGL
                     TENSLSATAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMV
                     KWIKYLSKSGAYEVRY"
     gene            <566940..>568337
                     /locus_tag="KLTH0F06556g"
                     /db_xref="GeneID:8292690"
     mRNA            <566940..>568337
                     /locus_tag="KLTH0F06556g"
                     /product="KLTH0F06556p"
                     /transcript_id="XM_002554443.1"
                     /db_xref="GeneID:8292690"
     CDS             566940..568337
                     /locus_tag="KLTH0F06556g"
                     /note="similar to uniprot|Q12265 Saccharomyces cerevisiae
                     YOL061W PRS5 5-phospho-ribosyl-1(alpha)- pyrophosphate
                     synthetase involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="KLTH0F06556p"
                     /protein_id="XP_002554489.1"
                     /db_xref="GeneID:8292690"
                     /db_xref="GOA:C5DKQ1"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ1"
                     /translation="MNNILVFGGSSHPSLVNEICANLGIKASETKLGKFSNGETSISI
                     GESVREKDVYVIQSGCGHVNDNFMELLILLNACKTASASRVTAVMPYFCYSRQPDIPY
                     TAKGAPLISKPKESYTFESFPGTPVPSVLTTLKPASPTGPDALNEVIEIQESTTQVLE
                     QPTPRKLDDGDVHKSPSFSRIPMVPEGKDNSTEVGWLFNANNAGYKLWVAQSGTLIAN
                     LLTTAGADHVITMDLHDAQFQGFFDIPVDNLYCKPLAQNYIQYNIPDYKEAVIVSPDA
                     GGAKRAASIADALELSFALIHKEKRSQLPKGPPDASLTSGGGASISNKPLISTPSSLA
                     LSSQDIKYSSSKYIQTTMLVGDVRNKTCIIVDDLVDTSYTITRAAKLLKDQGATKVYA
                     MITHGVFSGDALNRVAQSAIDKIIVTNTVPQEKTVKYLGRDRVHVLDVSRIFGESIRR
                     IHNGESISMLFEYGW"
     gene            complement(<568519..>570309)
                     /locus_tag="KLTH0F06578g"
                     /db_xref="GeneID:8292691"
     mRNA            complement(<568519..>570309)
                     /locus_tag="KLTH0F06578g"
                     /product="KLTH0F06578p"
                     /transcript_id="XM_002554444.1"
                     /db_xref="GeneID:8292691"
     CDS             complement(568519..570309)
                     /locus_tag="KLTH0F06578g"
                     /note="similar to uniprot|Q12100 Saccharomyces cerevisiae
                     YDL025C Protein of unknown function potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="KLTH0F06578p"
                     /protein_id="XP_002554490.1"
                     /db_xref="GeneID:8292691"
                     /db_xref="GOA:C5DKQ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ2"
                     /translation="MPRQEHLSATPSANEASSIKSNGSTSSLTSHFFGKKHGFGLGKL
                     FKGNSHSSNNESGKELLGSILSPKHSNSSTKSQDSYQRLRSAVPMMDHPQLSHAEAKH
                     LHNPHNYVSFGPSKNNSAYSSQTHVANSVSPSAPHMHPAQIMQRQIEEQQRRNTPPKL
                     AHEKPKRKVLHLKRFFKKIHGEDASPQKAQTPVAVSGPDSKSTAKTLYEADSARELIE
                     KYGIPGKMIGEGASGSVSVVKSMDGKLFAVKRFRARGTKESQIEYSKKVTAEFCIGST
                     LHHCNIIETLDLLQEGPNFLVVMEYCPYDFFTLVMSDLMTKHEIACYFKQICNGVAYL
                     HKTGLAHRDLKLDNCVVTSQGILKLIDFGSAVVFQYPYEQEILNARGIVGSDPYLAPE
                     LLTYPSYDPRPVDVWSVAIMFYCMTLRRFPWKAPRDKYQSFRLFCEETDNEKDPTRGA
                     YRLLKLLPRHSRHIIGQMLQLDPRKRILMNEVMADPWVVSIESCELDDKGELKSAAKS
                     HKHHLITEEELTELNLQRKEEARLAKLHKEAGESTDVPEVLGKEAAAVPEKDGHPQNV
                     GVSTHLDDGTAASQKPTGENVTQAVEAKTT"
     gene            complement(<570612..>572798)
                     /locus_tag="KLTH0F06600g"
                     /db_xref="GeneID:8292692"
     mRNA            complement(<570612..>572798)
                     /locus_tag="KLTH0F06600g"
                     /product="KLTH0F06600p"
                     /transcript_id="XM_002554445.1"
                     /db_xref="GeneID:8292692"
     CDS             complement(570612..572798)
                     /locus_tag="KLTH0F06600g"
                     /note="similar to uniprot|Q12296 Saccharomyces cerevisiae
                     YOL060C"
                     /codon_start=1
                     /product="KLTH0F06600p"
                     /protein_id="XP_002554491.1"
                     /db_xref="GeneID:8292692"
                     /db_xref="GOA:C5DKQ3"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ3"
                     /translation="MSLHTHAFRSKDFMASAEVFTSTVPAQAPRVELHRFMASPGTLL
                     SVRRTVWLFSLIHAISGRPIAHVAENDEIQEARFATFLSISVLLVLLGGVFAGLTLGL
                     MGQDEVYLKVISTSGTPREQRAATKVLNLISKGKHWLLVTLLLSNVITNETLPIVLDR
                     CLGGGWQAVVSSTVLIVIFGEVIPQSICVRYGLEVGAFFCPFVLVLMYAMYPVAYPVA
                     LLLDWILGEDHGTMYKKSGLKTLVTLHRTMGVDRLTNDEVTIISAVLDLKEKKVSEIM
                     TPIVNVFTMSADATLDEKTVGEIFNSGFSRIPIHLPGEKNNFIGMLLVRVLISYDPDD
                     CLPVSHFPLATLPETSPDTSCLNILNYFQEGKSHMCVVSQEPGSSSGALGVLTLEDVI
                     EELIGEEIVDESDVFVDIHQRIMREQPGPLSKRHITSYLHSLYKVTQRHSVDNTGENS
                     PLLEESPDPVQKPKVAHHVSGVVPSNLASNPLHTQNPHVKVKRQIDIPGHHLKLSSPG
                     YGGTDVSPKSTRSGSINSAQHSDTSILREHLGAAKKAMAHTLETGESTQAVTSKQSTP
                     AEDVGNLSTISHENAASTSNSTSDRQPSEPASETQLISSSYRPSIKGIVESVVTVKGV
                     PKTIIAPAKDWDESQGVVINESNNVHESGGSGDDNMAHSLSSRPSKSRRGSIFSLFRQ
                     GSSDGGSSASIRGRSAQASSSSDRVEPETLLSDEAYSLRNTSPRTR"
     gene            <573968..>575260
                     /locus_tag="KLTH0F06622g"
                     /db_xref="GeneID:8292693"
     mRNA            <573968..>575260
                     /locus_tag="KLTH0F06622g"
                     /product="KLTH0F06622p"
                     /transcript_id="XM_002554446.1"
                     /db_xref="GeneID:8292693"
     CDS             573968..575260
                     /locus_tag="KLTH0F06622g"
                     /note="uniprot|Q7ZA45 GPD Glycerol-3-phosphate
                     dehydrogenase [NAD+] (EC 1.1.1.8)"
                     /codon_start=1
                     /product="KLTH0F06622p"
                     /protein_id="XP_002554492.1"
                     /db_xref="GeneID:8292693"
                     /db_xref="GOA:C5DKQ4"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ4"
                     /translation="MFSISRITRTSSFTTQFRALYRFKHSARKLQSIPFSIYKKMSAA
                     DRLNQTHDILSESVQAVENPFKVTVIGSGNWGTTISKVVAENAALRPHLFVKRVDMWV
                     FEETVDGQKLTEIINTKHQNVKYLPNIDLPENLVANPDLVSAVKDADILVFNIPHQFL
                     PRIVSQLQGNIKKDARAISCLKGFDVSKDGVKLLSTYVTEKLGITCGALSGANLAPEV
                     AKENWSETTVAYELPKDFKGEGKDVDHAVLKALFHRPYFHVNVIDDVAGISVAGALKN
                     VVALGCGFVEGLGWGNNASAAIQRVGLGEIIKFGQMFFPDSRVETYYQESAGVADLIT
                     TCSGGRNVRVATHMAKTGKSAEECEKELLNGQSAQGIHTCKEVHEWLAECGKTDEFVL
                     FEAVYQIVYENAPMDTLPDMIEDLQGVNIPKEEGEHSE"
     gene            <578425..>579681
                     /locus_tag="KLTH0F06644g"
                     /db_xref="GeneID:8292694"
     mRNA            <578425..>579681
                     /locus_tag="KLTH0F06644g"
                     /product="KLTH0F06644p"
                     /transcript_id="XM_002554447.1"
                     /db_xref="GeneID:8292694"
     CDS             578425..579681
                     /locus_tag="KLTH0F06644g"
                     /note="highly similar to uniprot|P22768 Saccharomyces
                     cerevisiae YOL058W ARG1 Arginosuccinate synthetase
                     catalyzes the formation of L-argininosuccinate from
                     citrulline and L-aspartate in the arginine biosynthesis
                     pathway potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0F06644p"
                     /protein_id="XP_002554493.1"
                     /db_xref="GeneID:8292694"
                     /db_xref="GOA:C5DKQ5"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ5"
                     /translation="MSKGKVCLAYSGGLDTSIILAWLLEEGYEVVAFMANVGQEEDFD
                     AAEKKAMAIGATKYVCVDCREDFVKDVLFPAVQVNAVYEDVYLMGTSLARPVIAKAQI
                     DVAEAEGCFAVAHGCTGKGNDQIRFELGFYALKPDVKVIAPWRDPAFFERFAGRKDLL
                     DYAAEKGIPVTQTKAKPWSTDENQAHISYEAGILEDPDTTPPKGMWKLIVDPQDAPDK
                     PEDLTIVFEKGIPVKISFTEDGEAKEVTKPLDVFLTASNLARRNGVGRIDIVEDRYIN
                     LKSRGCYEQAPLTVLRRAHVDLEGLVLDKEVRHLRDQFVTPTYSRLMYNGSYFTPEFD
                     FIKSMIAPSQTHVNGQVRLRLYKGNVIVLGRSSETENLYDPTESSMDELTGFLPTDTT
                     GFIAIQAIRVKKYGEAKKAKGEKLTL"
     gene            <579926..>582085
                     /locus_tag="KLTH0F06666g"
                     /db_xref="GeneID:8292695"
     mRNA            <579926..>582085
                     /locus_tag="KLTH0F06666g"
                     /product="KLTH0F06666p"
                     /transcript_id="XM_002554448.1"
                     /db_xref="GeneID:8292695"
     CDS             579926..582085
                     /locus_tag="KLTH0F06666g"
                     /note="similar to uniprot|Q08225 Saccharomyces cerevisiae
                     YOL057W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F06666p"
                     /protein_id="XP_002554494.1"
                     /db_xref="GeneID:8292695"
                     /db_xref="GOA:C5DKQ6"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ6"
                     /translation="MLRTLKSGLSRALRSAKGTKPYSKSSIMAKSTYLADHKAPLVML
                     SAKDFFAQLSRDEKFYAHYMSKASHAGSRVVLRQVSHESESIYDLIKTIHEKLKGTYP
                     EGEETDLYLEYVSQFLSNLGNYKSFGDFKFVPRCSESFIMGLLELAGIDKNSKPSNKS
                     CPYKTWADVVSKGIFHVDEKCALLGFPSEGHCSSYYFGDVSPEDMRLLKDEVFGHLKI
                     LPENTRIKKLSSNNFEILVASKVSNYTLPEYPKSPVKLSNGAEVIFVFGDHSREMGLI
                     ADYLRKARDYAANDTQKSMLDAYIKHFETGSSHAHKDSQKLWVKDLSPVIETNVGFIE
                     TYREPSGIIGEFESLVAIQNKERTQKFATMVQNAGKFISLLPWDKEFEKPKFQPPDFT
                     SLEVLTFAGSGIPAGINIPNYDDVRLNIGFKNVSLGNILSSSLGSKMPITFVTDDDRK
                     ILEKFQSDSFEVQVGIHELLGHGSGKLLSELDDGTFNFDKENPPLGLEGKPVTTYYKK
                     GETWGSKFGQLAGAFEECRAEVIAMYLITNRELLEIFGFKTQEDQDNIIYAGYLQMAR
                     AGLLALEFWDPSTKKWGQPHMQARFSIMKTFLKHSGDKGFLTLSHSEPDFSDLKIHLN
                     RSMIENVGRNAVRDYLTHLHIYKSSGDVEQGSKYFVERSTVDPELAQFRSIVIEKKLP
                     RRQFIQANTVIEKGDVSLKEYDETSVGMLQSYLEREV"
     gene            <583833..>584738
                     /locus_tag="KLTH0F06688g"
                     /db_xref="GeneID:8292696"
     mRNA            <583833..>584738
                     /locus_tag="KLTH0F06688g"
                     /product="KLTH0F06688p"
                     /transcript_id="XM_002554449.1"
                     /db_xref="GeneID:8292696"
     CDS             583833..584738
                     /locus_tag="KLTH0F06688g"
                     /note="similar to uniprot|Q12326 Saccharomyces cerevisiae
                     YOL056W GPM3 and to YDL021W uniprot|Q12008 Saccharomyces
                     cerevisiae YDL021W GPM2, Homologs of Gpm1p
                     phosphoglycerate mutase which converts 3-phosphoglycerate
                     to 2-phosphoglycerate in glycolysis"
                     /codon_start=1
                     /product="KLTH0F06688p"
                     /protein_id="XP_002554495.1"
                     /db_xref="GeneID:8292696"
                     /db_xref="GOA:C5DKQ7"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ7"
                     /translation="MTGSDTYKLFVLRHGQSELNHENIFCGWIDAGLTEKGKAQAKNA
                     AALIKVHCMANSLEPPKIGYTSRLVRTQQTIEVMLEELNIKPNYRVVTKSTNVDKILR
                     EEWSREEALVLQTWRLNERHYGAWQGQRKPTILQEYGKEQYMFIRRDYNGRPPAADLS
                     REMVQEVDDKGSLTGYDFKEPNRRVKYNLEEHSGETLPNNESLSDVVERLDGFLNQII
                     LKNLDYCSSGLVVAHGSSVRSILKIIEGISDTDIKDVEIPNAIPLVIELDRHTKMFVR
                     KYYLDPELAKINAEKVRNEGFEKRD"
     gene            complement(<585209..>586648)
                     /locus_tag="KLTH0F06710g"
                     /db_xref="GeneID:8292697"
     mRNA            complement(<585209..>586648)
                     /locus_tag="KLTH0F06710g"
                     /product="KLTH0F06710p"
                     /transcript_id="XM_002554450.1"
                     /db_xref="GeneID:8292697"
     CDS             complement(585209..586648)
                     /locus_tag="KLTH0F06710g"
                     /note="some similarities with uniprot|Q03465 Saccharomyces
                     cerevisiae YDL020C RPN4 Transcription factor that
                     stimulates expression of proteasome genes Rpn4p levels are
                     in turn regulated by the 26S proteasome in a negative
                     feedback control mechanism RPN4 is transcriptionally
                     regulated by various stress responses"
                     /codon_start=1
                     /product="KLTH0F06710p"
                     /protein_id="XP_002554496.1"
                     /db_xref="GeneID:8292697"
                     /db_xref="GOA:C5DKQ8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ8"
                     /translation="MTTTTELNPLTRTLTDVLDDELYHIANRGQECVQTPKGWKNRSL
                     ENLMYAPDQSTAFGTGVTFDADHEFKDSMFSKYADPSLTTMSLDKPVDSRKTSPASLT
                     PVQATVSLNNVMNVNPFLARLPSNGQDVRISSPALFQGEDEDMLNSGESFPPDYYYED
                     NQKLFSWPLQESATMSQDAMSIFDREFDDDLSEDEDEDEDEELEAGDDQDQPKLEAGS
                     EYQLNDDDSLIFDRVRPGASFVDDDRNDFAVVDDEDDEDDEEIGFHNELQSAGCTEGK
                     HGEQDTFDEDVLYDRNNRKSSVVCSGEQYTTAPSSTRISRESSPEDTFTEAKCVTPSP
                     SSLSSTPSFTRKKKYPSRRKSSNATPSAPAIKKRISPLPSVTSSPGSGQEVHTCTLVN
                     PITNEPCSKKFSRPYDLIRHQKTIHASKKKVFRCVICIQQQGTEGYQKTFSRGDALSR
                     HVKVKHELTGAEAQKAIQFAKENVEFAGA"
     gene            complement(<586960..>588672)
                     /locus_tag="KLTH0F06732g"
                     /db_xref="GeneID:8292698"
     mRNA            complement(<586960..>588672)
                     /locus_tag="KLTH0F06732g"
                     /product="KLTH0F06732p"
                     /transcript_id="XM_002554451.1"
                     /db_xref="GeneID:8292698"
     CDS             complement(586960..588672)
                     /locus_tag="KLTH0F06732g"
                     /note="similar to uniprot|Q6B2F0 Saccharomyces cerevisiae
                     YOL055C THI20 Hydroxymethylpyrimidine phosphate kinase
                     involved in the last steps in thiamine biosynthesis member
                     of a gene family with THI21 and THI22 functionally
                     redundant with Thi21p"
                     /codon_start=1
                     /product="KLTH0F06732p"
                     /protein_id="XP_002554497.1"
                     /db_xref="GeneID:8292698"
                     /db_xref="GOA:C5DKQ9"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DKQ9"
                     /translation="MSRIVNSTGTREVTISNAPPYVALKKGERLPTVMTVATSDPSGG
                     AGIEADLKTFTAHRCYGLTGMAALTAQTPEGVYAIHEIPKEHFKLTLDSCLRDMRVDA
                     IKTGMLTKPAVEVLYETFSAMPADARPHLVVDPVLVATSGSTLVSDQSVIDFIKTLSP
                     LATLLTPNAYEAGRILGRESLELNSVEDLIDVACELQKTTLCPNVLLKGGHAPWVDSN
                     GQKRVTDVLRLGNKTVLYRSVFCTSENTHGTGCTLASAIASNLAHGEALQHAVFGGIQ
                     YVHNAIEIGCTVTQPHVKKNGPINHVYAIKQPLQEMVEDLSYSAHALRVDENRSNSTA
                     SSSNSLVSQIRDSGSFFEYLISDPRVKPHWETYTRHEFVRCVADGTLPRENFRFFLEQ
                     DYAYLDNYAQIHCIAASKAPTTEDFDKSVHIVSEIKTEMEKHREKMMRQFDISDMKHF
                     DQIKMGSALRNYARFFDDVARNGSWVHLCVALSPCLMGYGNALRNFKDKITVPKDDIY
                     HSWCEDYLAPWYVEAMDAGLILLDRVCQMSDDWDTLCKIYASVCKLETEFWDAALYYS
                     PENL"
     gene            <590569..>592872
                     /locus_tag="KLTH0F06754g"
                     /db_xref="GeneID:8292699"
     mRNA            <590569..>592872
                     /locus_tag="KLTH0F06754g"
                     /product="KLTH0F06754p"
                     /transcript_id="XM_002554452.1"
                     /db_xref="GeneID:8292699"
     CDS             590569..592872
                     /locus_tag="KLTH0F06754g"
                     /note="weakly similar to uniprot|P12630 Saccharomyces
                     cerevisiae YIL015W BAR1 Aspartyl protease secreted into
                     the periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="KLTH0F06754p"
                     /protein_id="XP_002554498.1"
                     /db_xref="GeneID:8292699"
                     /db_xref="GOA:C5DKR0"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DKR0"
                     /translation="MSFSVKSTMSVPCAMLALFLALFVPCVIASSGMGYVAIDFAKAK
                     GISYQDARVGARPAKLQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQQVTVLFDTG
                     SSDLWVSSNDNPYCSNGDSTESYANYRADLKSSSALTAAPTTTISGITIAPTIDCAQY
                     GTFNADRSTSLFANYSKPFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVAEISNS
                     TVGVLGVGLQGLESTVHYRSPNISSIYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGS
                     VLFGGVDHSKYTGGLYTLPLVNTYKDYGVKTPVQFDVTVQGIGIESEKACRQETFTTT
                     KIAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSDGDDTQFIFDFGGF
                     QIKSPLSNYILRTDDENICGLGLISSNQGTIFGDEFLASAYVVYDLENLELSLAQANW
                     NPGSPEIEKIVSEIPRAQRASQYWNTWVSDEENMAQVTRDIFTKTLACSPTNVNSTMP
                     ATNSSSFKTLNNSTTSTLTSHSDSSHTLGQNSFRTSVKPHVSSTRNGSIISSTNFATK
                     APSRTEQATYLFSSTSSVKASHLNHKSHKLAEASTKTPSCKTDKQTIISKARCESTIG
                     PVTRTACRSCSRASKHLTRPSIYTTVTATGTRLITEVATCHLCETEASRAENGKSVRE
                     ITAECSSKNLKNANAKNKEANTEVWLTNSTQIPIVTVSGPLQSISVSSSTSFEVQLVA
                     GSPNLATPKLSLGAFLFAILVGGALSF"
     gene            <594001..>595953
                     /locus_tag="KLTH0F06776g"
                     /db_xref="GeneID:8292700"
     mRNA            <594001..>595953
                     /locus_tag="KLTH0F06776g"
                     /product="KLTH0F06776p"
                     /transcript_id="XM_002554453.1"
                     /db_xref="GeneID:8292700"
     CDS             594001..595953
                     /locus_tag="KLTH0F06776g"
                     /note="similar to uniprot|Q04511 Saccharomyces cerevisiae
                     YML088W UFO1 F-box receptor protein subunit of the
                     Skp1-Cdc53-F-box receptor (SCF) E3 ubiquitin ligase
                     complex binds to phosphorylated Ho endonuclease allowing
                     its ubiquitylation by SCF and subsequent degradation"
                     /codon_start=1
                     /product="KLTH0F06776p"
                     /protein_id="XP_002554499.1"
                     /db_xref="GeneID:8292700"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DKR1"
                     /translation="MIDAVGSGTSLQSLPTEILINILSHLDEKDLYAVQATCKHFRDI
                     INDEELWKNLFVSRINTRLFPSFSRSLKFSVEYVERNRGLNEWRHNRAIKTRYTVATQ
                     NQYNQLEQMVFDYPRCACYSDGVIMLVQLHSRRRKDRLTYMPCTTPHGCSTMHFNINA
                     AVFGRFDGRVFGKLLTNKSHLCPVTEFNAMHRSCVTAITTAALEDSSEDWCVSGCESG
                     QVIWWREAKLQKSLQISNKPILRLALHKDWTVAVDSEHICIVQKMDTILRLDIPSNLR
                     RSPNQIQFFKVDFGGKLLVLGDTTEIYVISIDVDQDFGHTRSLRFENSVQNVFIDEAT
                     AKRTQDASIAGGDGCFMGILTADNSVHTVNIRTPGSNLSIQTKLTFIDEVHVAQINNL
                     VLVCAFSGSLGIFDAANGSELRVVRKTEKTPQFLGVSHGRMIVGSGNVLHFLQYAGLE
                     DKQKKTGSSQVTRGNKWNEVLHSQLDLYNEDENSRLQEQKRLEKLRRKFLGDVDDEET
                     QLRIALMESEAAAANFPFSAMKESSTEPDEELLRAIEESKLSFENSLASDEQGEDLEL
                     LRAIQQSREEEESRRTSRRSQRRMAPLGELVGSSSIEPQSNRQEQRANPVCLQSQASE
                     VSPDQHRHFEDEELELAKALSLSELN"
     gene            complement(<596017..>596943)
                     /locus_tag="KLTH0F06798g"
                     /db_xref="GeneID:8292701"
     mRNA            complement(<596017..>596943)
                     /locus_tag="KLTH0F06798g"
                     /product="KLTH0F06798p"
                     /transcript_id="XM_002554454.1"
                     /db_xref="GeneID:8292701"
     CDS             complement(596017..596943)
                     /locus_tag="KLTH0F06798g"
                     /note="similar to uniprot|Q12746 Saccharomyces cerevisiae
                     YML125C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0F06798p"
                     /protein_id="XP_002554500.1"
                     /db_xref="GeneID:8292701"
                     /db_xref="GOA:C5DKR2"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C5DKR2"
                     /translation="MSDKTKLLDEPIHGIYIPIGLLFVGLAIACFTIKDYTFLWILPF
                     AGLLIAARFTIAYRRKRSVFPNKWSSLELEDQTLISKNTAMYRFKMRTPLEALNFPVG
                     HHLAVRVPVDGKELVRYYTPVSPRYQPGHFDIIVKSYADGQVSKYFAGLKPGATVDFK
                     GPVGRFNYVTNSYKHIGMIAGGSGITPMLQILNEIITTPEDFTNVSLIYANETENDIL
                     LKDELDEIAEKYPNFEVNYVLNKPSSNWRGDVGYVTKEHMEKYLPPFSSDSRLVMSGR
                     PEMIRMLLDYAEELGWPRGIEKSKGDDQVFAF"
     gene            complement(<597192..>598775)
                     /locus_tag="KLTH0F06820g"
                     /db_xref="GeneID:8292702"
     mRNA            complement(<597192..>598775)
                     /locus_tag="KLTH0F06820g"
                     /product="KLTH0F06820p"
                     /transcript_id="XM_002554455.1"
                     /db_xref="GeneID:8292702"
     CDS             complement(597192..598775)
                     /locus_tag="KLTH0F06820g"
                     /note="highly similar to uniprot|P54783 Saccharomyces
                     cerevisiae YML086C ALO1 D-Arabinono-1 4-lactone oxidase
                     catalyzes the final step in biosynthesis of
                     D-erythroascorbic acid which is protective against
                     oxidative stress"
                     /codon_start=1
                     /product="KLTH0F06820p"
                     /protein_id="XP_002554501.1"
                     /db_xref="GeneID:8292702"
                     /db_xref="GOA:C5DKR3"
                     /db_xref="InterPro:IPR006093"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /db_xref="UniProtKB/TrEMBL:C5DKR3"
                     /translation="MDKILPGARSNFRFKNWAGIYSAKPQLYFQPSSIDDVVKIVNAA
                     RRLNKTIVTVGSGHSPSDMCVTNEWLMNLDRMNEVRGLVENKEQHYADVTVDAGLRIY
                     KLSEYLSERGYAIQNLGSISEQSVGGIISTGTHGSSPYHGLVSSQYVSLTIVNGLGEV
                     VNVDSENHPEIFRAAALSLGKIGIIVRATIRVVPTFKIRSTLEVVNFETILEQWDHIW
                     TSSEFIRCWWYPYTRKCILWRGTKSNDSFTKVRSSWWGTTVGRYFYEFLLWVSVKIYP
                     AFTPYVERFVFHRQYGKAETYGYGDIAVQNSIDGLNMDCLFSQFVDEWGCPLNNGPEV
                     LRSLDRSITQAAKNGDFYVHVPVEVRCSNTCLPEKIPDYSDRTEISPGAVYGNVLRPY
                     LDATPRGLHYAPLSDVSNNQLTLYINATIYRPFGVNTPIHKWFTLFENTMGAAGGKPH
                     WAKNFLGSTDMAAGPTKSQEAYKDYEMRGMATKISEWYGEDLLKFQEIRRQQDPENVF
                     LANKDWALKNGIVTPEEVI"
     gene            complement(<599443..>601012)
                     /locus_tag="KLTH0F06842g"
                     /db_xref="GeneID:8292703"
     mRNA            complement(join(<599443..600761,600988..>601012))
                     /locus_tag="KLTH0F06842g"
                     /product="KLTH0F06842p"
                     /transcript_id="XM_002554456.1"
                     /db_xref="GeneID:8292703"
     CDS             complement(join(599443..600761,600988..601012))
                     /locus_tag="KLTH0F06842g"
                     /note="highly similar to uniprot|P09733 Saccharomyces
                     cerevisiae YML085C TUB1 Alpha-tubulin associates with
                     beta-tubulin (Tub2p) to form tubulin dimer which
                     polymerizes to form microtubules"
                     /codon_start=1
                     /product="KLTH0F06842p"
                     /protein_id="XP_002554502.1"
                     /db_xref="GeneID:8292703"
                     /db_xref="GOA:C5DKR4"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:C5DKR4"
                     /translation="MREVISVNVGQAGCQIGNACWELYSLEHGIRPDGYLEEGLSKPR
                     GGEEGFSTFFNETGSGKFVPRAVYVDLEPNVIDEVRTGPYKDLFHPEQLISGKEDAAN
                     NYARGHYTVGRELLDDILDRIRKISDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSI
                     DYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKKNL
                     DISRPSFSNLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPI
                     QSKSKAHHESNAVSEITNACFEPGNQMVKCDPRTGKYMATCLLYRGDVVTRDVQNAVA
                     QVKNKRTVQLVDWCPTGFKIGICYEPPTATPQSQLSSVNRAVCMLSNTTAIADAWKRI
                     DRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYADEEEF"
     gene            complement(<601480..>603192)
                     /locus_tag="KLTH0F06864g"
                     /db_xref="GeneID:8292704"
     mRNA            complement(<601480..>603192)
                     /locus_tag="KLTH0F06864g"
                     /product="KLTH0F06864p"
                     /transcript_id="XM_002554457.1"
                     /db_xref="GeneID:8292704"
     CDS             complement(601480..603192)
                     /locus_tag="KLTH0F06864g"
                     /note="similar to uniprot|P25297 YML123C Saccharomyces
                     cerevisiae PHO84 High-affinity inorganic phosphate (Pi)
                     transporter and low-affinity manganese transporter"
                     /codon_start=1
                     /product="KLTH0F06864p"
                     /protein_id="XP_002554503.1"
                     /db_xref="GeneID:8292704"
                     /db_xref="GOA:C5DKR5"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DKR5"
                     /translation="MSIEKQEEHVVHKTAGGNAAFHNFINDFAHIEDPLERRRLALQK
                     IDEAAFGWYHVRAIMVAGVGFLTDSYDIFAINLGVSMLSYVFWKGDMPNSTSTLLKVS
                     TSVGTVIGQLGFGIMADVVGRKKIYGLELIIMIAATILQCTIGAAPGVSFVAVLTFYR
                     IIMGIGIGGDYPLSSIITSEFSTTKWRGAMMGAVFANQAFGQIAAGIVALILVAAYKS
                     ELIDANSGAECGAACIKACDQMWRILVGLGCFPGLIALYFRLTIPESPRYTLDVEHGI
                     NKASADIGKFTSGEHGNADPEEIARLERAPTAVEQFEIAPPKASFKDFCRHFGKWKYG
                     KILFGTAFSWFTVDVAFYGLNLNSATILQTIGYASSKNVYHKLYNSAVGNLILICAGS
                     LPGYWASVATMDIIGRKPIQLFGFFILTVLFCIIGFAYHKLSDHGLLGLYIVCQFFQQ
                     FGPNVTTFIIPGEVFPTRYRSSAHGISAASGKIGAIIAQTALGTLIDHNCARDGKPKN
                     CWLPHVMEIFALFMLCGIFSTLLIPETKRKTLEQICEEYHDEVDQGKYASGYSGASSH
                     TETV"
     gene            complement(<604652..>605977)
                     /locus_tag="KLTH0F06886g"
                     /db_xref="GeneID:8292705"
     mRNA            complement(<604652..>605977)
                     /locus_tag="KLTH0F06886g"
                     /product="KLTH0F06886p"
                     /transcript_id="XM_002554458.1"
                     /db_xref="GeneID:8292705"
     CDS             complement(604652..605977)
                     /locus_tag="KLTH0F06886g"
                     /note="highly similar to uniprot|P29704 Saccharomyces
                     cerevisiae YHR190W ERG9 Farnesyl-diphosphate farnesyl
                     transferase (squalene synthase) joins two farnesyl
                     pyrophosphate moieties to form squalene in the sterol
                     biosynthesis pathway"
                     /codon_start=1
                     /product="KLTH0F06886p"
                     /protein_id="XP_002554504.1"
                     /db_xref="GeneID:8292705"
                     /db_xref="GOA:C5DKR6"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:C5DKR6"
                     /translation="MGKLGDLISHPLELKAALKLKYIRKPLFSLNDTKETPELRRCYQ
                     LLTKTSRSFAAVIMELHPELRNAIMLFYLVLRALDTIEDDMTIDPKVKVPLLRDFDSK
                     LDLEDWSFNGNAPTEKDRCVLVEFPCILKELHKLKPEYQRVIKEITNKMGNGMASYIL
                     DENFNLNGVSTIKDYDLYCHYVAGLVGDGLTQLIVLANFGTPDLYNESAYLFESMGLF
                     LQKTNIIRDYAEDLEDGRSFWPREIWSLYADKLVDFSLPEHTQDGLHCISHLVLNALS
                     HVEDVLTFLSSVHEQSSFQFCAIPQVMAIATLALVFGNPEVLHKNVKIRKGTTCFLIL
                     KSRTLRGCVEIFQYYLRDIKKRLAVDDPNYLKINIQIARIEQFIEEMYQEQLPAGVKP
                     NETPIYKKVKERSAIDTEVAPAQMEEEYQFNMAITMVLTALAAVYFYVR"
     gene            complement(606265..606336)
                     /locus_tag="KLTH0F06908r"
                     /db_xref="GeneID:8292706"
     tRNA            complement(606265..606336)
                     /locus_tag="KLTH0F06908r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=67.56"
                     /db_xref="GeneID:8292706"
     gene            complement(<606927..>607508)
                     /locus_tag="KLTH0F06930g"
                     /db_xref="GeneID:8292707"
     mRNA            complement(<606927..>607508)
                     /locus_tag="KLTH0F06930g"
                     /product="KLTH0F06930p"
                     /transcript_id="XM_002554459.1"
                     /db_xref="GeneID:8292707"
     CDS             complement(606927..607508)
                     /locus_tag="KLTH0F06930g"
                     /note="weakly similar to uniprot|P38876 Saccharomyces
                     cerevisiae YHR189W PTH1 One of two (see also PTH2)
                     mitochondrially-localized peptidyl-tRNA hydrolases
                     dispensable for cell growth and for mitochondrial
                     respiration"
                     /codon_start=1
                     /product="KLTH0F06930p"
                     /protein_id="XP_002554505.1"
                     /db_xref="GeneID:8292707"
                     /db_xref="GOA:C5DKR7"
                     /db_xref="InterPro:IPR001328"
                     /db_xref="InterPro:IPR018171"
                     /db_xref="UniProtKB/TrEMBL:C5DKR7"
                     /translation="MITSKYTILRRSLSTCITGIGNPEPQYAMSRHNAGLLMLDLLKQ
                     QLQPERKAYVPCNANPKVKKCQIDRLLLLRADGDYINLSGRTVVPLWHKLGSNVKHVV
                     VHDELSLPVGKVQLRNPGASVRGHNGLKDIKTRYGDAFYRLAIGIGRPDDRDPNVVAN
                     YVLSRFPPHELAVIESDSLVLALRLLQKAGLSA"
     gene            <607612..>608511
                     /locus_tag="KLTH0F06952g"
                     /db_xref="GeneID:8292708"
     mRNA            <607612..>608511
                     /locus_tag="KLTH0F06952g"
                     /product="KLTH0F06952p"
                     /transcript_id="XM_002554460.1"
                     /db_xref="GeneID:8292708"
     CDS             607612..608511
                     /locus_tag="KLTH0F06952g"
                     /note="highly similar to uniprot|Q00582 Saccharomyces
                     cerevisiae YML121W GTR1 Cytoplasmic GTP binding protein
                     and negative regulator of the Ran/Tc4 GTPase cycle through
                     its homolog and binding partner Gtr2p involved in
                     phosphate transport and invasive growth human RagA and
                     RagB proteins are functional homologs"
                     /codon_start=1
                     /product="KLTH0F06952p"
                     /protein_id="XP_002554506.1"
                     /db_xref="GeneID:8292708"
                     /db_xref="GOA:C5DKR8"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKR8"
                     /translation="MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDV
                     EHSHLRFLGNMTLNLWDCGGQDVFMENYFSQQKDHIFQMVQVLIHVFDVESQEVIKDI
                     EIFTKALKQLKKYSPDAKIFVLLHKMDLVQRDKRQELFQIMMSKLQETSSAYGFPNLV
                     GFPTSIWDESLYKAWSQIICSLIPNMATYQSNLKKLKSVMGAREIILFEKTTFLVICS
                     SNTVSGELLDPKRFEKISNIMKNFKQSSMKLKSSFKTLVLNNTIYVSELSSNMMCFIV
                     LNHSDDPQDLILENIKKAKAHFQ"
     gene            complement(<608833..>610383)
                     /locus_tag="KLTH0F06974g"
                     /db_xref="GeneID:8292709"
     mRNA            complement(<608833..>610383)
                     /locus_tag="KLTH0F06974g"
                     /product="KLTH0F06974p"
                     /transcript_id="XM_002554461.1"
                     /db_xref="GeneID:8292709"
     CDS             complement(608833..610383)
                     /locus_tag="KLTH0F06974g"
                     /note="similar to uniprot|P32340 Saccharomyces cerevisiae
                     YML120C NDI1 NADH:ubiquinone oxidoreductase transfers
                     electrons from NADH to ubiquinone in the respiratory chain
                     but does not pump protons in contrast to the higher
                     eukaryotic multisubunit respiratory complex I which is
                     absent in S. cerevisiae"
                     /codon_start=1
                     /product="KLTH0F06974p"
                     /protein_id="XP_002554507.1"
                     /db_xref="GeneID:8292709"
                     /db_xref="GOA:C5DKR9"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C5DKR9"
                     /translation="MLSQFASRNAGRASALNAARRLARFASDSARVDGASGGGVSSFK
                     TNKIIENTLGNKPNVVILGSGWGAISLLQHIDSRSYNVTIVSPRNYFLFTPLLPSTPV
                     GTVDEKSIIEPVVNFALKKKGNVSYYEALATAINPERNTVSIKAVSTVAQLAQPDNHL
                     GLNQHDEAEIKYDYLVSAVGAEPNTFGIPGVEKHGNFLKEIPHSLEIRKRFLSNIEKA
                     NLLPKGDPERRRLLTIVVVGGGPTGVETAGELQDYIDQDLKRFMPSVAEEVQIHLVEA
                     LPVVLNMFERKLTSYAQDVLQKTRIKVHLRTAVARVEEDHLVAKTKAEDGATTEQTIP
                     YGTLIWATGNKALSIVTDLFKKIPAQNDSKRGLAVNQNLLVKGSNNIFAVGDNAFSGL
                     PPTAQVAHQQAEYLAKVLSKMAKSPNFHAELAQRKEKVDLFFEQKGIKPFNYTHYGAL
                     AYLGAEKAIANITYGKRSFYTGGGVLTFYVWRVTYAMMILSARSRFKVIADWLKLAFF
                     KRDCFKEL"
     gene            <612749..>614692
                     /locus_tag="KLTH0F06996g"
                     /db_xref="GeneID:8292710"
     mRNA            <612749..>614692
                     /locus_tag="KLTH0F06996g"
                     /product="KLTH0F06996p"
                     /transcript_id="XM_002554462.1"
                     /db_xref="GeneID:8292710"
     CDS             612749..614692
                     /locus_tag="KLTH0F06996g"
                     /note="highly similar to uniprot|P12398 Saccharomyces
                     cerevisiae YJR045C"
                     /codon_start=1
                     /product="KLTH0F06996p"
                     /protein_id="XP_002554508.1"
                     /db_xref="GeneID:8292710"
                     /db_xref="GOA:C5DKS0"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DKS0"
                     /translation="MLSAKSVLRNSANPLRSFVRMNSNKVQGQVIGIDLGTTNSAVAL
                     MEGKVPKIIENAEGARTTPSVVAFTKDGERLVGIPAKRQAVVNPENTLFATKRLIGRR
                     FEDIEVQRDIKQVPYKIVKHSNGDAWLEARGQTYSPAQIGGFVLNKMKETAEAYLGKN
                     VKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVVAVF
                     DLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIFLLREIVANFKKESGINLEND
                     RMAIQRIREAAEKAKIELSSTVSTEVNLPFITADASGPKHINMKFTRAQFESLTEPLV
                     KRTVDPVKKALKDASLATSDVSDVILVGGMSRMPKVVETVKSLFGKEPSKAVNPDEAV
                     AIGAAIQGAVLAGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPSKKSQIFSTA
                     AAGQTSVEIRVFQGERELVRDNKLIGNFTLSGIPPAPKGVPQIEVSFDIDADGIINVS
                     ARDKASNKDASITVAGSSGLSDSEIEQMVSDAEKYREQDEARKSAIESANKADQLAND
                     TESSLKEFEAKVDKAEAQKVKDQITSLREIVARVQSGEEVNADDLKTKTEELQTSSMK
                     LFEQMYKNDSSNNASSEGGEPKQ"
     gene            <615061..>615538
                     /locus_tag="KLTH0F07018g"
                     /db_xref="GeneID:8292711"
     mRNA            join(<615061..615181,615237..>615538)
                     /locus_tag="KLTH0F07018g"
                     /product="KLTH0F07018p"
                     /transcript_id="XM_002554463.1"
                     /db_xref="GeneID:8292711"
     CDS             join(615061..615181,615237..615538)
                     /locus_tag="KLTH0F07018g"
                     /note="highly similar to uniprot|P47111 Saccharomyces
                     cerevisiae YJR044C VPS55 Vacuolar Protein Sorting YJR044c"
                     /codon_start=1
                     /product="KLTH0F07018p"
                     /protein_id="XP_002554509.1"
                     /db_xref="GeneID:8292711"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:C5DKS1"
                     /translation="MGLKVSPLTRIISLSGFLALGFLLVILSCALFHNYYPLFDILIF
                     LIAPIPNALFSKRNFDSSEFMNESSKNVEDVGHFFTGLLVTSGLALPTVFYHCQIINH
                     YSCIMSTIGGIIIYLSIVVFSWFFNSGWDEEDDALFGY"
     gene            complement(615652..615723)
                     /locus_tag="KLTH0F07040r"
                     /db_xref="GeneID:8292712"
     tRNA            complement(615652..615723)
                     /locus_tag="KLTH0F07040r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=69.31"
                     /db_xref="GeneID:8292712"
     gene            <616169..>617032
                     /locus_tag="KLTH0F07062g"
                     /db_xref="GeneID:8292713"
     mRNA            <616169..>617032
                     /locus_tag="KLTH0F07062g"
                     /product="KLTH0F07062p"
                     /transcript_id="XM_002554464.1"
                     /db_xref="GeneID:8292713"
     CDS             616169..617032
                     /locus_tag="KLTH0F07062g"
                     /note="similar to uniprot|Q6Q5S5 Saccharomyces cerevisiae
                     YDR313C PIB1 RING-type ubiquitin ligase of the endosomal
                     and vacuolar membranes binds
                     phosphatidylinositol(3)-phosphate contains a FYVE finger
                     domain"
                     /codon_start=1
                     /product="KLTH0F07062p"
                     /protein_id="XP_002554510.1"
                     /db_xref="GeneID:8292713"
                     /db_xref="GOA:C5DKS2"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:C5DKS2"
                     /translation="MALIMPAPELVNSFAQWQADNLIHNCLNCQTKFSFLVRKHHCRC
                     CGGIFCANCSDNFLWYDKRKVKVVRRKDDTDGFEVPPYRTCNSCCENLTQMHLIQPRW
                     GDKLMRLQGSSMRTPQPQPAPVLPTSSSASSVQATELAKASGAAENTRDLDQESSRCP
                     ICNLDLFKLSEIDSAMHIQNCIERAESTQQHHDQSSPGESPAQRNRMLVYVIPPDQDT
                     PDPTSQGDPECPICFEEMKPGDKVGRLECLCVFHYDCIKSWFRKKSQKLKSTTGKSVS
                     KNFCPLHDAVF"
     gene            complement(<617226..>618536)
                     /locus_tag="KLTH0F07084g"
                     /db_xref="GeneID:8292714"
     mRNA            complement(<617226..>618536)
                     /locus_tag="KLTH0F07084g"
                     /product="KLTH0F07084p"
                     /transcript_id="XM_002554465.1"
                     /db_xref="GeneID:8292714"
     CDS             complement(617226..618536)
                     /locus_tag="KLTH0F07084g"
                     /note="similar to uniprot|Q12153 Saccharomyces cerevisiae
                     YDR312W SSF2 high copy suppressor of G beta subunit
                     temperature sensitive mutation possibly involved in
                     mating"
                     /codon_start=1
                     /product="KLTH0F07084p"
                     /protein_id="XP_002554511.1"
                     /db_xref="GeneID:8292714"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:C5DKS3"
                     /translation="MAKRRQKTRTHVKPDAEEQKKVPKSMVIRVGQTSMANHSLNQLV
                     KDFRQIMQPHTAIKLKERKSNKLKDFVVMCGPLGVSHLFIFTQSEKTGNVSLKVARTP
                     HGPTVTYQVMDYSLGKDIKRFMKRPKALGKEDSLSPPLLVLNGFGIKPVEGDSESVEK
                     ANVEKVVISMFQNIFPPLNPGKTQLNSIKRVFMINKDPETGEISMRHYAIDIREVDIS
                     RNLKRLYKSKSKLNKAVPNLHKKDDIASLILDHDVGAYTSESEVEDDSIVKVMEKNGK
                     SLKNAKSEASNNAQGSHQDAAEASAPRKKAIKLTEVGPRLTLKLVKIEEGICSGKVLH
                     HSYVKKTSAEIRALEKKHAQRMKLKEERRKEQEANLARKKEAKDAKKQRKLERRKQRE
                     QAGEPAEGQGSDADADSSDSSSSDEGAYSDVPEDLDSDLYSDIE"
     gene            <618637..>620214
                     /locus_tag="KLTH0F07106g"
                     /db_xref="GeneID:8292715"
     mRNA            <618637..>620214
                     /locus_tag="KLTH0F07106g"
                     /product="KLTH0F07106p"
                     /transcript_id="XM_002554466.1"
                     /db_xref="GeneID:8292715"
     CDS             618637..620214
                     /locus_tag="KLTH0F07106g"
                     /note="highly similar to uniprot|P38712 Saccharomyces
                     cerevisiae YHR065C RRP3 Required for maturation of the 35S
                     primary transcript of pre-rRNA and is required for
                     cleavages leading to mature 18S RNA RRP3 is a DEAD box
                     gene homologous to eIF-4a which encodes an RNA-dependent
                     ATPase possessing helicase activity which is not specific
                     for RNA"
                     /codon_start=1
                     /product="KLTH0F07106p"
                     /protein_id="XP_002554512.1"
                     /db_xref="GeneID:8292715"
                     /db_xref="GOA:C5DKS4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKS4"
                     /translation="MGERREKFRRVKSMRCDELSLSAIEQRRSQQEAKMAGKVTKTEH
                     KSSKQESSKGELKSLAEKIKKRALEKNQEASEKAPEGSEAEEEAEGVPNDSEQETEAA
                     HFESFSELNLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFA
                     IPILNQLWHDQQPYYACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQAR
                     DLMRKPHIIIATPGRLMDHLENTKGFSMRKLKFLVMDEADRLLDMEFGPVLDRILKII
                     PTQGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNT
                     FLIYLLNEFLGKTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFK
                     AGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS
                     QYDLELILRIEDVLGRKLPKENVDKGVILSLRDTVDKANGEVVMELNRRNKEKVARGK
                     GRRSRMHSRENMDKEEQ"
     gene            complement(<620327..>622192)
                     /locus_tag="KLTH0F07128g"
                     /db_xref="GeneID:8292716"
     mRNA            complement(<620327..>622192)
                     /locus_tag="KLTH0F07128g"
                     /product="KLTH0F07128p"
                     /transcript_id="XM_002554467.1"
                     /db_xref="GeneID:8292716"
     CDS             complement(620327..622192)
                     /locus_tag="KLTH0F07128g"
                     /note="similar to uniprot|P32776 Saccharomyces cerevisiae
                     YDR311W TFB1 Subunit of TFIIH and nucleotide excision
                     repair factor 3 complexes required for nucleotide excision
                     repair target for transcriptional activators"
                     /codon_start=1
                     /product="KLTH0F07128p"
                     /protein_id="XP_002554513.1"
                     /db_xref="GeneID:8292716"
                     /db_xref="GOA:C5DKS5"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013876"
                     /db_xref="InterPro:IPR027079"
                     /db_xref="UniProtKB/TrEMBL:C5DKS5"
                     /translation="MSHSGAAVFKKVSGILTIDEEASPAELLWRSTDGDKTHKVALNT
                     IDKLQATPASSEKMMLRLIGKANEAKKRKDADGNEVKAPLPSHVFSFNNRTVMDNIKE
                     TLQLIIARYKDEEVFEEKKRKESSLAPAPSEAAPLINTSTLDDSLSREKLLTNLKLQQ
                     SLLKENKGLMKTFQEAVINSGLPPDEFWSTRIPLLRAFALTTSQRTGPYNVLSTIKPV
                     ASSDNKVNVSVSREKIMTIFQTYPIVKKAYDDNVPKNFKEQEFWARFFSSKLFRKLRG
                     ERIMQSDRGDMIIDRYLTLDQEFDRKDDEMLQHPVKKLIDLDGNQYDDPERKGNKPDF
                     TMIPGVDVNGNTDGVVDILKGMNRLSQKMIKSLENEYSRTNLAADDADKEEREELLYS
                     DLEEEDEATYIEIKVKQRMAAVRETAGTEHKGERFKVGTKEISHQLNLLLDGLTKSID
                     LTKVANDDKKANNTANQNVIKAVKINAKQAKNTNFNAVVGANTGITTIESTKEIETPL
                     PGDLLESCRVLHGTCCEFLKHFYIHFQSGEARQAPTVKKLYGFLKQCPEKVNKLLNKV
                     QGSTDKQGETLASSCNAYLSSVLGSLNLAIEKYELAVAEANAANAANAASSAEVV"
     gene            <624084..>625706
                     /locus_tag="KLTH0F07150g"
                     /db_xref="GeneID:8292717"
     mRNA            <624084..>625706
                     /locus_tag="KLTH0F07150g"
                     /product="KLTH0F07150p"
                     /transcript_id="XM_002554468.1"
                     /db_xref="GeneID:8292717"
     CDS             624084..625706
                     /locus_tag="KLTH0F07150g"
                     /note="similar to uniprot|P38788 Saccharomyces cerevisiae
                     YHR064C SSZ1 DnaK homolog interacts with Zuo1p (DnaJ
                     homolog) to form a ribosome-associated complex (RAC) that
                     is bound to the ribosome via the Zuo1p subunit Hsp70
                     Protein"
                     /codon_start=1
                     /product="KLTH0F07150p"
                     /protein_id="XP_002554514.1"
                     /db_xref="GeneID:8292717"
                     /db_xref="GOA:C5DKS6"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:C5DKS6"
                     /translation="MSPIVGIAFGNTTSSIAYVNPKNDVDVIANPDGERTIPSVLSYV
                     GDDEYHGGQALQQLVRNPKNTIINFRDFLGLPFSECDVSRCTAGAPAVEIDGKVGFIV
                     SRGNGKEEKLTVDEVVSRHLNKLKLAAEDYIGQELSQTVISVPTNFTDAQKDALRAAA
                     KKVGLEIIQLINEPSAALLAHTEAYPFEDDVNVVVADFGGVRSDAAVIAVRNGIYTLL
                     ATSHDNNLGGENLDAELVEFFAKDFEKKNKSNPRKNAKSMAKLRVNSEITKKTLSNVT
                     TATISIDSLADGFDYHTSINRLRYELVANKVLSKFAQFIEAVITKAELDPLDIDAIVL
                     CGGSSFTPKLSSNLEFLLPESVAVLGPQSKNASNNPNELLAYGAALQAQLLSNYDAEE
                     LAQALEPVVINTQHLKKAIGLVDAEGNFVPVLLPETSFPVKKDLTLKNVKGDVLVGVY
                     EGDHHIKETVQEPAAKEESKAEDDDESDWSDEDDEPEVIREKHYTPGIKLMELGIKGA
                     QGLQLSFNVNREGVLRVAARDLKSGNIVKGEL"
     gene            <625852..>626976
                     /locus_tag="KLTH0F07172g"
                     /db_xref="GeneID:8292718"
     mRNA            <625852..>626976
                     /locus_tag="KLTH0F07172g"
                     /product="KLTH0F07172p"
                     /transcript_id="XM_002554469.1"
                     /db_xref="GeneID:8292718"
     CDS             625852..626976
                     /locus_tag="KLTH0F07172g"
                     /note="similar to uniprot|P38787 Saccharomyces cerevisiae
                     YHR063C PAN5 2-dehydropantoate 2-reductase part of the
                     pantothenic acid pathway structurally homologous to E.
                     coli panE"
                     /codon_start=1
                     /product="KLTH0F07172p"
                     /protein_id="XP_002554515.1"
                     /db_xref="GeneID:8292718"
                     /db_xref="GOA:C5DKS7"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DKS7"
                     /translation="MTQTRPKVFVLGFGSIGALLASCLQQQTQSVVVPLLRSRERLGD
                     FKKLSFKAGIRALYQKDKPISESVFENASCPELFPQDWRIDNLIITTKTYQTKEALAP
                     YMKYIHSDTNIILVQNGLGVFEVLNDEIFLDYKPNLFQGVISHGIFHDTGFTFNHAGF
                     GDMKVARLPSEGPGSIVQSNTLIADNAKNNELIRLMCSPGYAEALAVKHMTYQEMLLG
                     QLEKFLVNACMNPVTSIVDCINGEFKDCAAPIFSAIVTEALDILRVAYRPLFDYKPQS
                     DDYPTLDVASILDADRMLDFIIHVGCVVNKENSSSMRQDVVNVRETEIDYINGYIVTL
                     CEKLGLGPERCKVNQTIATLVKLRLELNRTRKLHGDKRAV"
     gene            <627776..>630565
                     /locus_tag="KLTH0F07194g"
                     /db_xref="GeneID:8292719"
     mRNA            <627776..>630565
                     /locus_tag="KLTH0F07194g"
                     /product="KLTH0F07194p"
                     /transcript_id="XM_002554470.1"
                     /db_xref="GeneID:8292719"
     CDS             627776..630565
                     /locus_tag="KLTH0F07194g"
                     /note="some similarities with uniprot|P46676 Saccharomyces
                     cerevisiae YDR310C SUM1 Suppresor of mar1-1 (sir2)
                     mutation nuclear protein involved in silencing"
                     /codon_start=1
                     /product="KLTH0F07194p"
                     /protein_id="XP_002554516.1"
                     /db_xref="GeneID:8292719"
                     /db_xref="GOA:C5DKS8"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="UniProtKB/TrEMBL:C5DKS8"
                     /translation="MELASPENSFEPLSTLKNEKHTNQADAGISTNNSSGAQLDNYKH
                     SGGQETESETGIRPAAGAVKDAHEGHGPEATELRPEQHPGETVASSEHVTVEKQPVLA
                     TYSESKNDNGSAAQRGPSDLHSIQSQVQLHSDAIAQLGKKVQQVETSVCSNDEDLNQV
                     LGNLTSATKSLAHNQSVLENKLEDLLRNQVNTDSSVNNLLEKLDQVSQFLNKAARNNT
                     LLASAPPQQIHRGPGRPPKTRNGLASAAAALSMTSKDTLPDSSVGIPRSKRIFQDSDS
                     ATSNEESGTTAVNRTATRSMPSSAPDQELPPVKKRGPGRPPKRRNHWAEKKREALAQS
                     ASQAGAGYQGDEQPQPLGKDNGESNPGGDGETEFSTFEEPKVEEESLPATPSDDGMQA
                     GPSSTRADELYGEQKTHRGRGRPSTKSSDKPPPLTQAQIKRQQELERRRDAREQMLVS
                     MKYSDRNKAKLFMESNKELLRAMREEERKKRMTAFSYDSAGPASNAMVGNTPSPKPPS
                     SSESRQHPAFLPVSQDSSAQSEHDVVMREEFRGNSSENFLESRPSSHEDGREGTPHSE
                     ATNEPTEEPMLASIAVSSSFNTPDPGVVPRKVGILSMLNEDVDDSGSSNKRQLPDIYK
                     GGFDPEFPNKREKLDDEEKRDFRSMIPMLPEKKDNRGRPANSSSSGDNSTALLLASPV
                     ELICRNGYFYRKSDREVPITTGTYLEFKFKSKEDDLIRLTMSQEDYAELTKQDRINAY
                     FLKPEIKEETEFASAILSKIVLTEKYVNSLEYFLMEFRWENRLVGLGLKLRESKRTWQ
                     RRKALFALFEFWRDKSREKRGFPEFTMMHAVKEMENYRIFINRSVSWFYNHITLLKMV
                     LFELCDNIDTQWREWMFPRGQPLPVLGGSITEDNFNEAIDEVLALDFLEDGTENRDIR
                     ASSMPNLPSDSATEN"
     gene            <631218..>632099
                     /locus_tag="KLTH0F07216g"
                     /db_xref="GeneID:8292720"
     mRNA            <631218..>632099
                     /locus_tag="KLTH0F07216g"
                     /product="KLTH0F07216p"
                     /transcript_id="XM_002554471.1"
                     /db_xref="GeneID:8292720"
     CDS             631218..632099
                     /locus_tag="KLTH0F07216g"
                     /note="similar to uniprot|P38786 Saccharomyces cerevisiae
                     YHR062C RPP1 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="KLTH0F07216p"
                     /protein_id="XP_002554517.1"
                     /db_xref="GeneID:8292720"
                     /db_xref="GOA:C5DKS9"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:C5DKS9"
                     /translation="MLVDLNVPWPQKTFGDTPTASQIQNVSSTLETLHTLGYTHVALN
                     FTVHHTDKFPSSPKELNPIKIDENFGGLMKATGLKIYSRITLIVDDPSKGQSLSKISQ
                     AFDIVAAMPVSERALTLATTNLDIDILTFQYKQRLPAYLKHKSICSCVARGVKLEIVY
                     ANALRDMQSRRQFIQNVKSVIRSSRSRGIVISSGAERPLECRNVLGVTSLIKFLGLDS
                     DKCSKAMTDLPALVLLNGRLRTKSYKQTVVVGGGSDTDIVNETETIDKEKLVKIVKRP
                     HSRAESESGSVAKKAKV"
     gene            <632361..>633017
                     /locus_tag="KLTH0F07238g"
                     /db_xref="GeneID:8292721"
     mRNA            <632361..>633017
                     /locus_tag="KLTH0F07238g"
                     /product="KLTH0F07238p"
                     /transcript_id="XM_002554472.1"
                     /db_xref="GeneID:8292721"
     CDS             632361..633017
                     /locus_tag="KLTH0F07238g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F07238p"
                     /protein_id="XP_002554518.1"
                     /db_xref="GeneID:8292721"
                     /db_xref="UniProtKB/TrEMBL:C5DKT0"
                     /translation="MAFERVRKLRKRVSEISVLKRGARAAVQKKPARDGYSRQSLNYS
                     VANLIEQAGSDYAKGETDMAIYRLTRVLSEIEKEAAESSGPSLIPLGVSEIQERPFRH
                     LLLRNEEDFVGYSGPWYEHPCKQPCEEPVPMTDADYSQGTIASCDVGVQDDLNYTIRD
                     ADSQVFEFSDMVERSFNLLTISGGILEDEATRLDEDAPNSTSADPEAPWKEDGYHHGL
                     "
     gene            <633250..>634383
                     /locus_tag="KLTH0F07260g"
                     /db_xref="GeneID:8292722"
     mRNA            <633250..>634383
                     /locus_tag="KLTH0F07260g"
                     /product="KLTH0F07260p"
                     /transcript_id="XM_002554473.1"
                     /db_xref="GeneID:8292722"
     CDS             633250..634383
                     /locus_tag="KLTH0F07260g"
                     /note="weakly similar to uniprot|Q06648 Saccharomyces
                     cerevisiae YDR309C GIC2 Protein of unknown function
                     involved in initiation of budding and cellular
                     polarization interacts with Cdc42p via the Cdc42/Rac-
                     interactive binding (CRIB) domain"
                     /codon_start=1
                     /product="KLTH0F07260p"
                     /protein_id="XP_002554519.1"
                     /db_xref="GeneID:8292722"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="UniProtKB/TrEMBL:C5DKT1"
                     /translation="MALQVNLPQMKSIWIDEDQEAEKLYGLQAQHLMDSDGEDHVDVV
                     LINSNKPLLNNKEKIELPPLLPAAYKPSHNKKQPLNKMHGSSTLKSKKKTGKLFSLFK
                     MKETRGSSSHAKISVPYNFQHISHADLKNVFEGEELACDVEASPALLNKAFVTESAPS
                     QQPLQARQRSAGSSLSALRRSSSIASSQYSSRSARIVSTSTMATSVGGDDSCRSLKKL
                     DHLEKMHLKHRYNKSDASSVSVEFLKNYDFPTVLEDSLVEIKTPEMCSKQHDKFTWES
                     PADTGALLETMIQAKCPMPPSASSRRKSDSQLVFSPISEQRASFLDTPRTRKSVDEVL
                     LCYHQQSENSSELQEPSEFSFSQRSSAANRNSVWDKDTETFEV"
     gene            complement(<634594..>635130)
                     /locus_tag="KLTH0F07282g"
                     /db_xref="GeneID:8292723"
     mRNA            complement(<634594..>635130)
                     /locus_tag="KLTH0F07282g"
                     /product="KLTH0F07282p"
                     /transcript_id="XM_002554474.1"
                     /db_xref="GeneID:8292723"
     CDS             complement(634594..635130)
                     /locus_tag="KLTH0F07282g"
                     /note="similar to uniprot|P38784 Saccharomyces cerevisiae
                     YHR060W VMA22 Protein involved in vacuolar H - ATPase
                     assembly or function required for the biogenesis of a
                     functional vacuolar ATPase (V-ATPase) but not part of the
                     final enzyme complex"
                     /codon_start=1
                     /product="KLTH0F07282p"
                     /protein_id="XP_002554520.1"
                     /db_xref="GeneID:8292723"
                     /db_xref="UniProtKB/TrEMBL:C5DKT2"
                     /translation="MSHVSKPGLSESNSVELLKQLEAYDFLLEQLQAGFSAGFYQLSR
                     ANYHNKDTIRGRYGSDYWDQTFKGTQFITAQGPKLARLPESQVLEILESEDESSSESD
                     EKDEVLRKRKEGQSSERKKAGLKKRLPDPLLMFGGALSIPSSLRQCQSSFKGSIESVI
                     ELANCRRRIEELISNTQD"
     gene            <635266..>635712
                     /locus_tag="KLTH0F07304g"
                     /db_xref="GeneID:8292724"
     mRNA            <635266..>635712
                     /locus_tag="KLTH0F07304g"
                     /product="KLTH0F07304p"
                     /transcript_id="XM_002554475.1"
                     /db_xref="GeneID:8292724"
     CDS             635266..635712
                     /locus_tag="KLTH0F07304g"
                     /note="similar to uniprot|P47822 Saccharomyces cerevisiae
                     YDR308C SRB7 RNA polymerase II holoenzyme component"
                     /codon_start=1
                     /product="KLTH0F07304p"
                     /protein_id="XP_002554521.1"
                     /db_xref="GeneID:8292724"
                     /db_xref="InterPro:IPR021384"
                     /db_xref="UniProtKB/TrEMBL:C5DKT3"
                     /translation="MADRLTQLQICLDQMMEQFCATLNYIDKNHDFEPARGEEKMTDL
                     QANIASKEEFENTMDELSTDLILKTRQITKLIDSLPGVDVSAEEQMHRIESLQNQLVK
                     MEDRKIEAIKEKEELQRKVEEMIFDFTVGIANARKPAPRSDHEEGP"
     gene            complement(<635723..>637696)
                     /locus_tag="KLTH0F07326g"
                     /db_xref="GeneID:8292725"
     mRNA            complement(<635723..>637696)
                     /locus_tag="KLTH0F07326g"
                     /product="KLTH0F07326p"
                     /transcript_id="XM_002554476.1"
                     /db_xref="GeneID:8292725"
     CDS             complement(635723..637696)
                     /locus_tag="KLTH0F07326g"
                     /note="weakly similar to uniprot|Q06644 Saccharomyces
                     cerevisiae YDR307W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F07326p"
                     /protein_id="XP_002554522.1"
                     /db_xref="GeneID:8292725"
                     /db_xref="GOA:C5DKT4"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DKT4"
                     /translation="MWPGVVKRGPFRPYISYDVPDPSYGAKIERVDVIYAVILGISFV
                     LKQLAAFDSSAQQTPMEKDLMESVNHFKEKNFFLMSFPPLVVEIIGLFASTTGSVSIA
                     LLRRANLAIAALTVSAFYLALRKSDIVRVVAMVAAAGLSHLPLFAEESLHLSLNVPQL
                     ALLSCCLLSWNSFKRSQAFSRGWYWSLTMLSTFLAFASSIKFVGVVTWSWFIILIIKQ
                     LWEIVGDVNISTCKILRHTAWRFAAVVFVPFAFLVSTYFLLISNSRGASLDHSSLVSP
                     YFKSWFLPQPMPQPDVVYYGSSILIRHAQSLGGYLHSHNHTYETGSQEQQVTLVDFSN
                     NGDNEWIIEPSDQNLNAEKQLEPVKNGAVIRLRHKSTGKLLRSSSAKAPVSEQDYDHE
                     VSCTGDNDYKGDSDESWRLRFERGKTPHDGLLCPFTIYFSLENEGQSCKLLSHDQRLP
                     DWGFGQQEVLCVDSASKERSLFFIDRSNLYKERGAYLTYPKQSKLKRLWNLSREYIKR
                     QYKYDYYLKNKDVTEGVSAENWIWNSFDSVTVNFIWFIPLGCVAMYVMTEITRWITWN
                     PWAAATPELESEKRCYLDSCLELSIGWFMHYQIFTWSKHQNLTLAQYLPSYLLSLLVA
                     AHTANYVWRHSKLGRLALVLFALSAGALTLQWA"
     gene            <638030..>639790
                     /locus_tag="KLTH0F07348g"
                     /db_xref="GeneID:8292726"
     mRNA            <638030..>639790
                     /locus_tag="KLTH0F07348g"
                     /product="KLTH0F07348p"
                     /transcript_id="XM_002554477.1"
                     /db_xref="GeneID:8292726"
     CDS             638030..639790
                     /locus_tag="KLTH0F07348g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F07348p"
                     /protein_id="XP_002554523.1"
                     /db_xref="GeneID:8292726"
                     /db_xref="UniProtKB/TrEMBL:C5DKT5"
                     /translation="MMKYAKVHLEPPPVSAEAAAEHSREFSDSYLERRLRTRHSSKKS
                     DSLFTRRALDYDGIKDSLLLYDDQHSDPRDTRAVKVPRRHMSGAKDCFECDSENPGCE
                     VNFNRGKQPWYYNNSEDSRSIAADNLERPNTINSVRIKQVIENATHSIKNTQQACLGI
                     RERLGKYQFTGQTPMPGAYTTDHEEQADTEHSPKTGLSRMTPEPAVRQVSEPIEYLPK
                     AIIVPLLAKAAFFLLAQCATSEDIGYSFTGTCQLLISPESTTLTLPQLDALVLQLAGI
                     WLATHSIPALTKAPWRFYQVAAQYWNSCLIGQDVPDLRRDGEFRELLELCERHERLSR
                     RLRRTSLVVLLVSPVVLTLGLLLIHKLAFFWVTSNSTETAHRPVYSSLMAVAFSPAQF
                     VILICCLWSQFFQDAFQHLELYVLAKHESFVQDTEFIADQLDRTCPSDTAGMDAGTKQ
                     SPLCNSPPRAAVKLEAIERSSATHPEGTLEPHAPLGPYALAAYESPLQHKEIAEPSFS
                     AIRPVSPAAVVAPPEPLAATSEPSKAQRVLRLPFYVLSLYLKVLRLVFKIAIYAMLLS
                     ISLIIGPQNRRELSRPEKTV"
     gene            639909..639981
                     /locus_tag="KLTH0F07370r"
                     /db_xref="GeneID:8292727"
     tRNA            639909..639981
                     /locus_tag="KLTH0F07370r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (CAC) cove score=75.70"
                     /db_xref="GeneID:8292727"
     gene            <640519..>641829
                     /locus_tag="KLTH0F07392g"
                     /db_xref="GeneID:8292728"
     mRNA            <640519..>641829
                     /locus_tag="KLTH0F07392g"
                     /product="KLTH0F07392p"
                     /transcript_id="XM_002554478.1"
                     /db_xref="GeneID:8292728"
     CDS             640519..641829
                     /locus_tag="KLTH0F07392g"
                     /note="similar to uniprot|Q06640 Saccharomyces cerevisiae
                     YDR306C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F07392p"
                     /protein_id="XP_002554524.1"
                     /db_xref="GeneID:8292728"
                     /db_xref="UniProtKB/TrEMBL:C5DKT6"
                     /translation="MANKRRPKKVIVPYRKYVGGQGFVSNRGASTESEDADNKIIKGS
                     RADGDVFHTPQGTYYYDVDTESVIQIKPPTPAPVARQVNAENSEDMALPWEIFELVLK
                     QCEQVEPQFLAVCWHWYAICVPLLYRIPKLSSGNFSKFVDAVVNNRKKRLGENVVELD
                     LSMIIQSGKNSYVSKLLRRCSPKLESFIAPQTSFGYAPLISLKSCRHLRYLDLGLVSE
                     TVQLGELFSAIKEFRSLTHLSFPRSSVDCKGFRDFEWPPNLQYLKLSGGITNEFVREI
                     TFPRTIKKLEFAFCPQIDEHSVYTVLAKIGDRLTHLHFHYPMPSLQGSSLDAVFRYCS
                     NLRVLQLPVDYCSKWAFSEYMLTPLPSPRPLRTLMLECSGNLGQAFKVHPDDITIALA
                     EDRLPNLRTLRVSSKLGWDLKGSDVNDLISCLEDQYADFRISYF"
     gene            <641893..>642525
                     /locus_tag="KLTH0F07414g"
                     /db_xref="GeneID:8292729"
     mRNA            join(<641893..641946,642031..>642525)
                     /locus_tag="KLTH0F07414g"
                     /product="KLTH0F07414p"
                     /transcript_id="XM_002554479.1"
                     /db_xref="GeneID:8292729"
     CDS             join(641893..641946,642031..642525)
                     /locus_tag="KLTH0F07414g"
                     /note="similar to uniprot|P49775 Saccharomyces cerevisiae
                     YDR305C"
                     /codon_start=1
                     /product="KLTH0F07414p"
                     /protein_id="XP_002554525.1"
                     /db_xref="GeneID:8292729"
                     /db_xref="GOA:C5DKT7"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:C5DKT7"
                     /translation="MTSAVYFSKFLVTKQVFYKSKHSYALVNLKPLVPGHVLVVPLKT
                     SVVNLADLSREENEDFFNTVQLIHRFIKHHYKADSLNIAIQDGPEAGQTVPHLHTHII
                     PRYRTNNVGDKIYEMIDNWSYESWEERRREYLSSGGREGRKQLAKPDDQRVESSEERM
                     EQEAVELSKELARFLENNPTLK"
     gene            complement(<642567..>642953)
                     /locus_tag="KLTH0F07436g"
                     /db_xref="GeneID:8292730"
     mRNA            complement(<642567..>642953)
                     /locus_tag="KLTH0F07436g"
                     /product="KLTH0F07436p"
                     /transcript_id="XM_002554480.1"
                     /db_xref="GeneID:8292730"
     CDS             complement(642567..642953)
                     /locus_tag="KLTH0F07436g"
                     /note="similar to uniprot|P38783 Saccharomyces cerevisiae
                     YHR059W FYV4 Protein of unknown function required for
                     survival upon exposure to K1 killer toxin"
                     /codon_start=1
                     /product="KLTH0F07436p"
                     /protein_id="XP_002554526.1"
                     /db_xref="GeneID:8292730"
                     /db_xref="InterPro:IPR019083"
                     /db_xref="UniProtKB/TrEMBL:C5DKT8"
                     /translation="MIGSACGRRLFSCSNVALRVNKASLRKIPAPNGELTDAGAFLSK
                     IGRKCEEFNETFENKWENLFHWDSKVLKEKGIPPQQRKYILSQVERLRKNEPIREIKE
                     GKKSFFGGERKRKETKAKLRAQERNA"
     gene            <643237..>644073
                     /locus_tag="KLTH0F07458g"
                     /db_xref="GeneID:8292731"
     mRNA            <643237..>644073
                     /locus_tag="KLTH0F07458g"
                     /product="KLTH0F07458p"
                     /transcript_id="XM_002554481.1"
                     /db_xref="GeneID:8292731"
     CDS             643237..644073
                     /locus_tag="KLTH0F07458g"
                     /note="some similarities with uniprot|P45976 Saccharomyces
                     cerevisiae YJR093C FIP1 Subunit of cleavage
                     polyadenylation factor"
                     /codon_start=1
                     /product="KLTH0F07458p"
                     /protein_id="XP_002554527.1"
                     /db_xref="GeneID:8292731"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:C5DKT9"
                     /translation="MNSSDEDERFLYGSDEEGAEAVSPSENKNKRPLTQPNDEEETKK
                     PKVDSTEDNAASSSSSDENSSENEESDEDSDVEFIIGVGADSSKLDSKKDSATAASGP
                     KPTTIAPPATNIGSAAVETEATAGLSTAAVDADAGTSAAPGTERLPAIDLNAVGKLGD
                     QPITDIDPEVLKEKPWRQPGANISDYFNYGFNEQTWMEYLHKQEKLRAEYNPHKMLMG
                     LLALQQQGKLNDSGSDSMGQENAPAAMAPPAFPMGMPPMFGGFPFPFPGMMNNMNPQQ
                     KK"
     gene            complement(<644172..>648410)
                     /locus_tag="KLTH0F07480g"
                     /db_xref="GeneID:8292732"
     mRNA            complement(<644172..>648410)
                     /locus_tag="KLTH0F07480g"
                     /product="KLTH0F07480p"
                     /transcript_id="XM_002554482.1"
                     /db_xref="GeneID:8292732"
     CDS             complement(644172..648410)
                     /locus_tag="KLTH0F07480g"
                     /note="weakly similar to uniprot|P47136 Saccharomyces
                     cerevisiae YJR092W BUD4 Protein involved in bud-site
                     selection and required for axial budding pattern localizes
                     with septins to bud neck in mitosis and may constitute an
                     axial landmark for next round of budding potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0F07480p"
                     /protein_id="XP_002554528.1"
                     /db_xref="GeneID:8292732"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="UniProtKB/TrEMBL:C5DKU0"
                     /translation="MVSALGVPAPLFTYCLFRLRIALDVNKRLSHGRCLERRYLNLAL
                     RFPHANSYFLSSQKGLALSIARLTSPRLHKMFLDQSATAQSASATVDSLLSEIEHEIP
                     IHAKRQIPLQEIGDDTMEEIVRYNTRSNSSAAAVDPDTEPLHSLLENGNRKSVMFSDD
                     FELHEYSAVDDAAAGSAPASPVVWDLAPLPQVRAGAGSARKTSLHLERDHSDTETDSE
                     DQSLNETFQLGHAELRANTVSNMDERLAHVYDNHHSSLNVPRLKEMVNDIDQQANFQT
                     TSEVHTQPLKITFESTRPLIDSSDDPQMLEFELQSRDSDDQAFTSAQHSPSKIPTTNT
                     IRINRLSTAEPLTASGRLSSGSSVDESETDLETTMRQDKFQLLRTSAPPDLSKPLNAH
                     SYHVSSRSLLSHNADNNSRAFSMATTADEFQSAKESISCDMSADESQSNYSVEDLQIS
                     TGMVREDDTLGSITQSMQSDIKHSHSLGASGADGYPPSLPPLNTSYVDRISKSGSTST
                     VKITSLQNLKGHISESDTERYDDEEAEQGKFSSSPGSDNENDEPIPFTRTSCHSSINR
                     SSSAHSLSNTSAKDIELTNNSAEPLQKAEQTEPQSARDNSSEAADTASMHSGASASGI
                     PNQLQDTRIVSNNFSKLFDEDAIFGDLEETSNDSIDITSSVKPSDYLSIWRSQEVNTK
                     SSPTISANSQFSQQSSGTAGSSISMHSNFKLKPRIISRSRICYPPPKSENAFKLRDIC
                     SVPQASGIGILDPLRLKPKVSREISVDLKLASVTQSPRELSHDALQESTCVSRDADAN
                     TDNSEEPASRETNILTVEKNQPEEPMTPVKEKRVASVNLSLPDISGDNFDVSKELGDV
                     LGTLNHDEMSLKQTSAGKNSDSLVYDIWDENNYQNGVELELDDQDEKQTKEIFNGGVL
                     TKLLSQDSKAVDEDGEQRPKGGLGLLRNTDSDVAVCRADSIKGLDVIRSASSDSVQHS
                     FEHFKQPHTPSPIKASHIDSPFKIVRARKLINNKVISPDSIAKTELSTEAASSEHDVS
                     ISGSNKTVVNEEREKESLFTADPALLEDLGKFYIFVKSIQKLRLEDIERHSPEVSLEL
                     DNGTHIVQTPWQPLKKEGIQVKQEFELIMKNEELGTTSQLVITVKCRYKRPQAELVEV
                     IERIPIKKKVPFGKTKYTTNKKYVQKKLDFDAWDLKFAQDGSFARCTVPLRSDVLKQT
                     SYTQKSYRFSLYNEWERQKNPSQQQAKLCELPRKPAYEVGEVTLEMCFLPRTSKHEKF
                     PKTLKLAQDVVDKYNEQQRINFQGYLWQEGGDIDCLLQKRYFVLKGTQLVAHHEITKK
                     PQALINLLKVVSVVGEGKITEDNIKKVRNFTDIVLFSECFKLIFENGEVINLDAESAE
                     LKSKWTELLTRVVELNKFHQPWVKHFSNNRAMDV"
     gene            648734..648833
                     /locus_tag="KLTH0F07502r"
                     /db_xref="GeneID:8292733"
     tRNA            join(648734..648770,648790..648833)
                     /locus_tag="KLTH0F07502r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAG) cove"
                     /db_xref="GeneID:8292733"
     gene            <649475..>652861
                     /locus_tag="KLTH0F07524g"
                     /db_xref="GeneID:8292734"
     mRNA            <649475..>652861
                     /locus_tag="KLTH0F07524g"
                     /product="KLTH0F07524p"
                     /transcript_id="XM_002554483.1"
                     /db_xref="GeneID:8292734"
     CDS             649475..652861
                     /locus_tag="KLTH0F07524g"
                     /note="similar to uniprot|P47135 Saccharomyces cerevisiae
                     YJR091C JSN1 Member of the Puf family of RNA- binding
                     proteins and to uniprot|Q12221 Saccharomyces cerevisiae
                     YPR042C PUF2 mRNA binding protein"
                     /codon_start=1
                     /product="KLTH0F07524p"
                     /protein_id="XP_002554529.1"
                     /db_xref="GeneID:8292734"
                     /db_xref="GOA:C5DKU1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DKU1"
                     /translation="MDKPKNPQKQSLTQIPEALDPGITLPLYEEELHASDAGQPQKLG
                     SYRVRAGRFSNTLSNLLPSISAKLHHSRKTTSGSSKHAPDAAVSGSSSESTSRSQVSL
                     SGQITPPAIAPVASVEVPADEASFFAPLPPRDSGDSFTFGSALHGVPSNTVSRTRNNT
                     VSSQVTSLSGMPQTAGSLWSTNTSPNEPHVMTSATALNGVPFTTASPLNEYSGNAYFD
                     MPSVATGNGNGAPTANANASSLTVPATSNGNIWGSRQRSHSNASSIYTDAPVYDNMGV
                     NRSRASTFGLGLEQPQFVHNNAPPARQHSPPTPAVTDDVDPRSINWVTTDPTVPAINQ
                     ISTLLPTNTVSISNVYSLQQQQPQLSNAINLTSTSLATLCMKFGNVISARTLKRINMA
                     LVEFDSVESAMRAKEALHGKEVSLVGAPSCVSFAKVLPMHQQSITSAQPLSSAASING
                     PQSLLQEQLYSGAVTLQQQGNISVPVLNGAANSQQSQQQHQHQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQHAHSHSHQQSSGSNFNPSSNSSSNHNSGNP
                     GAPTHASSEKEHCPFPLPPPSVSEYKQALEDTVNSFGTSHDSTQTQHVVENAIQCGGT
                     SDTADFGPLPDPLPNREFDAPKLREIRKAIDGNMMSDLEIEQLAVAMLDELPELCSDY
                     LGNTIVQKLFEHSSTVIKDIMLRQTNKYLTSMGVHKNGTWACQKIITMADTPRQKMLV
                     AKGVETYCTPLFNDQFGNYVIQCVLKFGFPWNNFIFEHIVSNFWTIAQNRYGARAVRA
                     CLEAHDIITREQLLVLSAMIVLYTEYLATNSNGALLVTWFLDTCTLPHRHSILASKLV
                     SNLAELCCHRLASLTVLKVLNYRGDEKAKRFILESIFGKKDSATIPQVLYQVLCDNNY
                     GPTFVYKVLSMSLLEGEVRVHVVQQVRKVLMNISTTQLHRRLMEEVGLGGGSSSSATL
                     LNVTGSSKHRSSLSHVFNVDNMGHMRNVSAGSAMSAGSRPRAQSNSGILPIPLPAPNG
                     AGIVGSNGQPPTQQLAVPNGYYNYPGVFPVTGNTSRGYSMTGDDLSSQFDMLSLQNNT
                     QISLPQLSMNNSNPHSNGNHNNHLKPGNSNNGSTYGAYGY"
     gene            <653440..>656745
                     /locus_tag="KLTH0F07546g"
                     /db_xref="GeneID:8292735"
     mRNA            <653440..>656745
                     /locus_tag="KLTH0F07546g"
                     /product="KLTH0F07546p"
                     /transcript_id="XM_002554484.1"
                     /db_xref="GeneID:8292735"
     CDS             653440..656745
                     /locus_tag="KLTH0F07546g"
                     /note="similar to uniprot|P24814 Saccharomyces cerevisiae
                     YJR090C GRR1 F-box protein component of the SCF
                     ubiquitin-ligase complex required for Cln1p and Cln2p
                     degradation involved in carbon catabolite repression
                     glucose-dependent divalent cation transport high-affinity
                     glucose transport and morphogenesis"
                     /codon_start=1
                     /product="KLTH0F07546p"
                     /protein_id="XP_002554530.1"
                     /db_xref="GeneID:8292735"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:C5DKU2"
                     /translation="MSSGLPASWFTPQLPARGGTGHQERERLNQEHRERISRISQNEH
                     ALRDAFQLRGEEWANVPNPMASSRETHRFTTRTSDTPSVIGDGGATHGDLKAVSEGAS
                     SEEDVQMSGTEEALNARLIQKFEEQAQGKLNECIKVIEGRRDVLLHSFESDNTLLQQL
                     QSGNREATDPDFISSINRLQRIRLRAIEMETLQLQRVKLYFKSRLSEFKVLVRNHMLA
                     KANGEHTENPLKVCKNMFKDLNPHLASGMKLALASKNDEPGQVSLMSLKDRLPHALYQ
                     APAASKKFPLRHLPSEILGLVLDRLSQKAEIVKLLSVCKSWAEIIVKLLYYRPHINKK
                     SQLDLFMNTMRKPASETVFNYRAMIKRLNFSFVGDYMTDEQLILFVGCPNLERLTLVF
                     CKHITSSSISAVLHGCKYLQSVDITGIKEVSDSIFNTLAFQCQRVQGFYVPQARDVSF
                     AALHTFVTHAPLLKRVKITANVNMNDDLVSLLATLCPLLVEVDITSSPNVHDESLVRL
                     FCQLTQLREFRITHNSNITDKLMKGLSQTVNHLPALRLVDLCDCENITDKSVELLVSL
                     APKLRNVFLGKCSRITDNSLVHLSRLGKNLQTIHFGHCFNLTDNGVRVLIQSCPRIQY
                     VDFACCTNLTNRTLYELADLTKLKRIGLVKCSQMTDEGLLNMMALRGRNDTLERVHLS
                     YCSNLTIYPIYELLMACPKLSHLSLTAVPSFLRSDITAFCRAAPSDFSENQRQIFCVF
                     SGKGVHKLRHYLMSLTAPTNGPQSNVREVLTNFIVLKNLIKDGEDLEAGLRRVANELN
                     QETPAILAATQSLTPLNALNNNDFAFQNINFERLDDVFFSLQRVPQDRILNEQDVDRL
                     FPLIDEGFCEDPDSEQFAGRDGCVAPEASEDLNCELAQMVRKFHDLQERVCDFEVNVA
                     SMVRVQFQFAGALLNEMTHIYFQMVDLNRCISQIQTRVYDMGDEKNLKGLTIWRIIWQ
                     EKFEHMLEKYELTTVVLRLYLRDNVAALTRQRELFLARQRATLEASDRQERDPESPLP
                     QTDIVAWNSDPDDRGNPWRRFEVPNEMRLIQFGLRGIPVPSNELPSVQTFFPNNIGPA
                     DTSPDEDEYLEDA"
     gene            complement(<656807..>659383)
                     /locus_tag="KLTH0F07568g"
                     /db_xref="GeneID:8292736"
     mRNA            complement(<656807..>659383)
                     /locus_tag="KLTH0F07568g"
                     /product="KLTH0F07568p"
                     /transcript_id="XM_002554485.1"
                     /db_xref="GeneID:8292736"
     CDS             complement(656807..659383)
                     /locus_tag="KLTH0F07568g"
                     /note="weakly similar to uniprot|P47134 Saccharomyces
                     cerevisiae YJR089W BIR1 Protein involved in cell cycle
                     regulation and chromosome segregation contains BIR
                     (Baculovirus Inhibitor of apoptosis Repeat) domain"
                     /codon_start=1
                     /product="KLTH0F07568p"
                     /protein_id="XP_002554531.1"
                     /db_xref="GeneID:8292736"
                     /db_xref="GOA:C5DKU3"
                     /db_xref="InterPro:IPR001370"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR020478"
                     /db_xref="UniProtKB/TrEMBL:C5DKU3"
                     /translation="MSSAFHRYRDRHESFCRVFNVQGKRCTWPYRVIPAKAMAQLGFE
                     YQPTFIGEALCRDYVSCCYCGLNTYNFHECRAKALTLTLSKVLEKHLKLSPGCLNSAL
                     KLVLMRSYYKAKPIDWSMEAPFSDPHSEDMISLRQWTFNEGWSHSEQPGLSAESMAKA
                     GLLRYDLGLPSSELQEDHNDTTYCVYCSKIIGSWEVGDDPIWEHFVCCNGGNCHFFET
                     MPNQLLLESLKAKLMNSSLSTDVNTPPSLDYYEMFGSLLKRFEEQTTVEESVIKRGRP
                     RSSHINELPHEPRKRGRPKKQRIVGEGDHENSTEGAPQSTEKEVVVKRKRGRPKKIID
                     ESSAEIKPKRPRGRPKKDAPIPITQSIELPKVSEDLLSQGDPEGTNILEPFADKEQSN
                     LSENLPKGSSSLNSDFAQREISAPPFAGKESSTSPRRRIKLRTNSKTPMLAEDELNES
                     DTNSTKSIIVNFKSRSPQKEDTARNPIIDDSFDAFSFSAHGNSEFIIPENAFQLHLNK
                     KGSSAEKFPSTPVKQALISEGSVEMKNPSGSHGKSSSGILDKIDMDVEISDSSDDSPG
                     RNSSKSEGSSPIHTPVHRTEESPGKSSFKGGKFSSAGLLSENASLPTVKPSSVSVNDG
                     EHPFFGVGLLENYASNTKGTNKVLQSPKATTVSSEQHFVNDRVPEKKTATFPIEQAPG
                     SQPFSIGSGSAALPIPNEESTTIFKETLGPEVTTTGEEHSLSKPTERDSGQTGNPSCL
                     EKSLNSIDEDRRVLSHYFHNLLRYINLNDASLANEADGDLSFFVKHMPEDEKRLSFAA
                     WLDEKVVALKEEFNRDYKLKIVKLEEQFQSAQTFVRNLDSEEALLGIAKEYNIDLLSP
                     SP"
     gene            complement(<659645..>660844)
                     /locus_tag="KLTH0F07590g"
                     /db_xref="GeneID:8292737"
     mRNA            complement(<659645..>660844)
                     /locus_tag="KLTH0F07590g"
                     /product="KLTH0F07590p"
                     /transcript_id="XM_002554486.1"
                     /db_xref="GeneID:8292737"
     CDS             complement(659645..660844)
                     /locus_tag="KLTH0F07590g"
                     /note="highly similar to uniprot|P38431 Saccharomyces
                     cerevisiae YPR041W TIF5 eIF5 mediates hydrolysis of
                     eIF2-GTP (SUI2 SUI3 GCD11) at start codons Translation
                     initiation factor eIF-5"
                     /codon_start=1
                     /product="KLTH0F07590p"
                     /protein_id="XP_002554532.1"
                     /db_xref="GeneID:8292737"
                     /db_xref="GOA:C5DKU4"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:C5DKU4"
                     /translation="MSINICRDNNDPFYRYKMPPLQAKVEGRGNGIKTAVLNVADVAR
                     ALNRPSPYIVKYFGFELGAQTSISVDKDRYLVNGSHEPAKLQDVLDGFINKFVLCGSC
                     KNPETEIVITKNDDLVRDCKACGKRTPMDLRHKLSSFILKNPPESMESNKKRKAATAS
                     ANIRGGGVSISDIAQGKSQSSAQAKAETEGDSDDDELARQINAAASSLQEIEVNNDDW
                     AVDMSEEAIRARAKELRAANGEDEEISKLEEYGEWILSQDEVPSDVELYKTAVKFELL
                     QEPKIACVLAQALFSEDIVEEVSEHTAFFKKLFISEEFENQFLGGIERFLGLEHKELI
                     PALPKILVQLYNNDIVSEEVIVKFGTKCSKKFVPKDVSKKVRRAAKPFITWLETAESE
                     DEDDDSE"
     gene            <661580..>662434
                     /locus_tag="KLTH0F07612g"
                     /db_xref="GeneID:8292738"
     mRNA            <661580..>662434
                     /locus_tag="KLTH0F07612g"
                     /product="KLTH0F07612p"
                     /transcript_id="XM_002554487.1"
                     /db_xref="GeneID:8292738"
     CDS             661580..662434
                     /locus_tag="KLTH0F07612g"
                     /note="similar to uniprot|P47133 Saccharomyces cerevisiae
                     YJR088C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F07612p"
                     /protein_id="XP_002554533.1"
                     /db_xref="GeneID:8292738"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DKU5"
                     /translation="MEILKDRYLTICSTKYYTAAPAHEVASLWDQLKTYLGAGDPTLS
                     ELDYMSLTHMLFDLSIYNGKDVEAETLFKTFRDRFGSSSPYLHVMQATLLQVNKGDRE
                     AEEFLTKLLKDALEYETDIIDYLLVSKKLLSIRRKSITKEEYLKQLLGLAEKFPVDGE
                     LWYAIAQEYASLGQFEQAAYSLEEVLCIAPFNYVAFAQLSEALYYRALREKKDKDSLL
                     QQSLSNALRSVELSENFVKGWAFVAVTSKELSKAKLLNLSKKKLREIMVGCNDTDKAT
                     AKKILENL"
     gene            complement(<662501..>663529)
                     /locus_tag="KLTH0F07634g"
                     /db_xref="GeneID:8292739"
     mRNA            complement(<662501..>663529)
                     /locus_tag="KLTH0F07634g"
                     /product="KLTH0F07634p"
                     /transcript_id="XM_002554488.1"
                     /db_xref="GeneID:8292739"
     CDS             complement(662501..663529)
                     /locus_tag="KLTH0F07634g"
                     /note="similar to uniprot|Q12199 Saccharomyces cerevisiae
                     YPR040W TIP41 Protein involved in regulation of the TOR
                     pathway"
                     /codon_start=1
                     /product="KLTH0F07634p"
                     /protein_id="XP_002554534.1"
                     /db_xref="GeneID:8292739"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:C5DKU6"
                     /translation="MDSKRTRGHGINTIQINQAREIHAQTVRARDPRAQPRPVLHAPA
                     INAPAPNRHICNNPNNPACAHCSAVIIPAPKATLPLEDTPSISIEDWTITTRKKPILN
                     SKELDEWDRTLGGLTMPEMIFGNSFVKIENKKHDWCLEFNALDALKAVKVEDSGIRVS
                     YANKWIKSKQAQQKSSELAESSLQIGQHYDWTYTTKYKGTIKSGTHNFTQDNSTALPL
                     DKLSRPDPILFYDDMILFEDELADNGISVVNVKIRVMNERALLLSRFFLRVDGVLFRV
                     YDTRVYVEFDENRVLREYKEHEADYKYVLSKNSGRHSRDPKAILRDSNWVAQQLPLVK
                     RECEVLQF"
     gene            <663648..>664253
                     /locus_tag="KLTH0F07656g"
                     /db_xref="GeneID:8292740"
     mRNA            <663648..>664253
                     /locus_tag="KLTH0F07656g"
                     /product="KLTH0F07656p"
                     /transcript_id="XM_002554489.1"
                     /db_xref="GeneID:8292740"
     CDS             663648..664253
                     /locus_tag="KLTH0F07656g"
                     /note="similar to uniprot|Q12284 Saccharomyces cerevisiae
                     YPR037C ERV2 Flavin-linked sulfhydryl oxidase localized to
                     the endoplasmic reticulum lumen involved in disulfide bond
                     formation within the ER"
                     /codon_start=1
                     /product="KLTH0F07656p"
                     /protein_id="XP_002554535.1"
                     /db_xref="GeneID:8292740"
                     /db_xref="GOA:C5DKU7"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:C5DKU7"
                     /translation="MIHRQRLVSILAAVSLLSLWFFFSSNKLSYSTPNDPVVDLDTNT
                     NTEHTDPQGQNKQAKLKFQSIMPSMPDQKAKQELGRASWKYFHTVLSRFPDEPTQEER
                     DKLAQFLQLYAELYPCGECSYHFVEMLKKWPPQTSSRTAAALWGCLMHNKVNVFLKKD
                     EYDCSKILEDYDCGCGGEDGKINDQLKMNKVSLQKEGKQGG"
     gene            complement(<664276..>664560)
                     /locus_tag="KLTH0F07678g"
                     /db_xref="GeneID:8292741"
     mRNA            complement(<664276..>664560)
                     /locus_tag="KLTH0F07678g"
                     /product="KLTH0F07678p"
                     /transcript_id="XM_002554490.1"
                     /db_xref="GeneID:8292741"
     CDS             complement(664276..664560)
                     /locus_tag="KLTH0F07678g"
                     /note="similar to uniprot|P18852 Saccharomyces cerevisiae
                     YJR086W STE18 G protein gamma subunit forms a dimer with
                     Ste4p to activate the mating signaling pathway forms a
                     heterotrimer with Gpa1p and Ste4p to dampen signaling
                     C-terminus is palmitoylated and farnesylated which are
                     required for normal signaling"
                     /codon_start=1
                     /product="KLTH0F07678p"
                     /protein_id="XP_002554536.1"
                     /db_xref="GeneID:8292741"
                     /db_xref="GOA:C5DKU8"
                     /db_xref="InterPro:IPR015898"
                     /db_xref="UniProtKB/TrEMBL:C5DKU8"
                     /translation="MGEQDLPLKIQYLKLKRINELNKKLKEELVRERITASNACLSII
                     DYATSHEDYALPEIWGYPAPGSNPHRANAQKIHKSARTGSSSDNGCCVIV"
     gene            <665501..>665818
                     /locus_tag="KLTH0F07700g"
                     /db_xref="GeneID:8292742"
     mRNA            <665501..>665818
                     /locus_tag="KLTH0F07700g"
                     /product="KLTH0F07700p"
                     /transcript_id="XM_002554491.1"
                     /db_xref="GeneID:8292742"
     CDS             665501..665818
                     /locus_tag="KLTH0F07700g"
                     /note="highly similar to uniprot|P47131 Saccharomyces
                     cerevisiae YJR085C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F07700p"
                     /protein_id="XP_002554537.1"
                     /db_xref="GeneID:8292742"
                     /db_xref="GOA:C5DKU9"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:C5DKU9"
                     /translation="MEHPAFTLAALTTMGGAMGYARKGSKPSLLAGLVFGGVYGYAGY
                     LLHKNADGGLEIALGASSLMLITGIARGVPSRFKKPVPLVLTILGGLGTFYYYRKYKE
                     FYP"
     gene            complement(<666717..>668060)
                     /locus_tag="KLTH0F07722g"
                     /db_xref="GeneID:8292743"
     mRNA            complement(<666717..>668060)
                     /locus_tag="KLTH0F07722g"
                     /product="KLTH0F07722p"
                     /transcript_id="XM_002554492.1"
                     /db_xref="GeneID:8292743"
     CDS             complement(666717..668060)
                     /locus_tag="KLTH0F07722g"
                     /note="similar to uniprot|P47130 Saccharomyces cerevisiae
                     YJR084W CSN12 Subunit of the Cop9 signalosome which is
                     required for deneddylation or removal of the
                     ubiquitin-like protein Rub1p from Cdc53p (cullin) involved
                     in adaptation to pheromone signaling"
                     /codon_start=1
                     /product="KLTH0F07722p"
                     /protein_id="XP_002554538.1"
                     /db_xref="GeneID:8292743"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:C5DKV0"
                     /translation="MILDILLLTFLTLSGIPMGLKKQRKRETMNSIVQCFEYRRSTQE
                     LLDFLRYDGPCPSSVFSLGRISNEKLVQLIQTTLALKQEFIENCGSATVSTKLFDLAN
                     EQLKLINRLSEGETVWITAPLHASAAQLLRVGTQLDKKASERRDLDKRKKKKLRGDLD
                     EERFLEKCVRTIHTSFKLCLNDRNPNTHDNKKWGVYFFTNLELSIYKRLQNRDMVRNL
                     VKVLESRAQELPTPENALQSHKAQLVTYYYYMAEFYGCQDSNFARGFEFARKAWLNSR
                     REGGSQEDMIVMLLIPFAMLAHKWYPDAQVLAARHPRVARLYAPVIQCLRNGDLKSFE
                     TWLEQNEAAMLRRNLYVALVLVRELVLLKLLKLSFRFYGSRSIVPLKLVTTALLKSRT
                     HKGVKNITDEQLDETECVLANLISKDYIKGYLSHSNRALVVSKTNAFPRLVHSGT"
     gene            <668134..>668955
                     /locus_tag="KLTH0F07744g"
                     /db_xref="GeneID:8292744"
     mRNA            <668134..>668955
                     /locus_tag="KLTH0F07744g"
                     /product="KLTH0F07744p"
                     /transcript_id="XM_002554493.1"
                     /db_xref="GeneID:8292744"
     CDS             668134..668955
                     /locus_tag="KLTH0F07744g"
                     /note="weakly similar to uniprot|P47129 Saccharomyces
                     cerevisiae YJR083C ACF4 Protein of unknown function
                     computational analysis of large-scale protein-protein
                     interaction data suggests a possible role in actin
                     cytoskeleton organization potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0F07744p"
                     /protein_id="XP_002554539.1"
                     /db_xref="GeneID:8292744"
                     /db_xref="UniProtKB/TrEMBL:C5DKV1"
                     /translation="MSSQRVISESTGLYKLSIVNKQKNSTGSEEEITEPTKPETPKKG
                     LPLSSPVRKGSKLESSPTRGGKVESDEPGSFSESLLYELAAKRRQVVELKQQLQHAEK
                     ELETLEQKCKRIGQAEKTPGSPERLHEITAKLQDTWRGVNSSPTVLKSKQSISNFFNA
                     KDQAFEAENPQPLPTNTKSSYSQMMASKLQNIRNQQTQSPFLKKLVSKWQDFSVNEAE
                     EEEFDNGRPTDKYYIKSKLDYDDDEEISSESELEMDKASTATDLDGGPVVSTFKR"
     gene            complement(<669046..>670443)
                     /locus_tag="KLTH0F07766g"
                     /db_xref="GeneID:8292745"
     mRNA            complement(<669046..>670443)
                     /locus_tag="KLTH0F07766g"
                     /product="KLTH0F07766p"
                     /transcript_id="XM_002554494.1"
                     /db_xref="GeneID:8292745"
     CDS             complement(669046..670443)
                     /locus_tag="KLTH0F07766g"
                     /note="similar to uniprot|P41807 Saccharomyces cerevisiae
                     YPR036W VMA13 vacuolar ATPase V1 domain subunit H (54
                     kDa)"
                     /codon_start=1
                     /product="KLTH0F07766p"
                     /protein_id="XP_002554540.1"
                     /db_xref="GeneID:8292745"
                     /db_xref="GOA:C5DKV2"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DKV2"
                     /translation="MTVQEHSKLLLDSTHFSDIRSAVRSRSVAWDALARSAEISGPDA
                     AVAKKLESALIKHTGVQISASECVPSAIHLLETAHNVDVQKAVHNLVAELLSSEEYAD
                     TTIEYFSKNPKAVVDLFNASLTGDDQTVLLSGFNIVSLLIQPELRNTDLVSKLLQHPR
                     FNAVLQNLDHMDTSYVCIRLLQEMCSVKEYRRVVWTAQASFVPTLFSVVNRALDSNAA
                     NRAVPTNSNNLGIQIQYYSLLTLWLLTFDHEIASELASKYLSDFLNLLKLVKVTIKEK
                     LSRLCIATILNCVSPHVKGHKALIRQLLLLGNALPILQSLSERKYSDDELRQDLATLK
                     ELLEQTYQELTSFDEYEAELDSKLLVWSPPHVDNGFWAENVDKFKEQDWKLFKKLVAI
                     LASPNNEASAKTTIQVALSDITHVVELLPESVDVLAKLNGKVLIMELLNHPDSKVKYE
                     ALKATQAFVAHTFSR"
     gene            complement(<671629..>672738)
                     /locus_tag="KLTH0F07788g"
                     /db_xref="GeneID:8292746"
     mRNA            complement(<671629..>672738)
                     /locus_tag="KLTH0F07788g"
                     /product="KLTH0F07788p"
                     /transcript_id="XM_002554495.1"
                     /db_xref="GeneID:8292746"
     CDS             complement(671629..672738)
                     /locus_tag="KLTH0F07788g"
                     /note="highly similar to uniprot|P32288 Saccharomyces
                     cerevisiae YPR035W GLN1 Glutamine synthetase (GS)
                     synthesizes glutamine from glutamate and ammonia with
                     Glt1p forms the secondary pathway for glutamate
                     biosynthesis from ammonia expression regulated by nitrogen
                     source and by amino acid limitation"
                     /codon_start=1
                     /product="KLTH0F07788p"
                     /protein_id="XP_002554541.1"
                     /db_xref="GeneID:8292746"
                     /db_xref="GOA:C5DKV3"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /db_xref="UniProtKB/TrEMBL:C5DKV3"
                     /translation="MSATIEKTAILAKYLDLDQRGAVIAEYVWIDGTGNIRSKGRTLP
                     RKINSLDELPEWNFDGSSTGQAPGHDSDIYLKPVAFYPDPFRKGDNILVLAECWNNDG
                     TPNKFNHRHEAAKLFEAHKDADIWFGLEQEYTLFDENDQVYGWPKGGYPAPQGPYYCG
                     VGTGKVYARDMIEAHYRACLFANLRISGINAEVMPSQWEFQVGPCTGISMGDELWMAR
                     YLLSRVAEEFGVKISLHPKPLKGDWNGAGCHTNVSTKEMRLPGGMKYIDDAIDKLSKR
                     HVEHIKLYGADNDLRLTGRHETASATTFSSGVANRGASVRIPRSVAKEGYGYFEDRRP
                     ASNIDPYLVTGIICETVCGAIDSADMTKEFERESS"
     gene            <674329..>676026
                     /locus_tag="KLTH0F07810g"
                     /db_xref="GeneID:8292747"
     mRNA            <674329..>676026
                     /locus_tag="KLTH0F07810g"
                     /product="KLTH0F07810p"
                     /transcript_id="XM_002554496.1"
                     /db_xref="GeneID:8292747"
     CDS             674329..676026
                     /locus_tag="KLTH0F07810g"
                     /note="weakly similar to uniprot|P36151 Saccharomyces
                     cerevisiae YKR070W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F07810p"
                     /protein_id="XP_002554542.1"
                     /db_xref="GeneID:8292747"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DKV4"
                     /translation="MSDKITEKLKAFSSKMTDGALGHSNEHAQHAGGDAYNTDSDADV
                     DPLQKSESDRVSQQVTEDQKAHAPGTHIERNADEKPRTKSFLESDGIDEMKPVTRKHR
                     VSSLSLSDQWRANQDLHPLTSMDNNEGTPSSRVPSRKASMVSRHSSVSRRASTVRTRQ
                     QIIDHERVASYAFAFDIDGVIVRGPETIPEARDALRMLNGENKYNIKVPYIFITNGGG
                     RSEKARCKDLSKRLNITVTKDQVIQGHTPMKDLVPIYKNVLVVGGVLDSCRKVAQDYG
                     FKNVYIPLDIMKWNPSVTPYYQLSEEENAVARDVDFSKVPIDAILVFADSRNWAADQQ
                     IILEILLSKNGVMGTVAKDPSDNKVGLYFAHSDFVWATDYGLSRYGMGALQVSIAALY
                     QEHTGRELQVTRFGKPQRGTFRFAEKVLSNWRRNTLTEHVEQLNLEDGETSDSAPSDS
                     EDEGTDTDGAVLEQTDKLVLDLPPASTVYFVGDTPESDIRFANSHDSSWYSILVKTGV
                     FQGNTTPKYQPKKICENVLEAVKFAIEREHQKELEEWNSSVVDAPVVDERTAKIGNR"
     gene            complement(<676464..>677492)
                     /locus_tag="KLTH0F07832g"
                     /db_xref="GeneID:8292748"
     mRNA            complement(<676464..>677492)
                     /locus_tag="KLTH0F07832g"
                     /product="KLTH0F07832p"
                     /transcript_id="XM_002554497.1"
                     /db_xref="GeneID:8292748"
     CDS             complement(676464..677492)
                     /locus_tag="KLTH0F07832g"
                     /note="similar to uniprot|Q7LIE3 Saccharomyces cerevisiae
                     YDR214W AHA1 Activator of Heat Shock Protein 90 ATPase"
                     /codon_start=1
                     /product="KLTH0F07832p"
                     /protein_id="XP_002554543.1"
                     /db_xref="GeneID:8292748"
                     /db_xref="GOA:C5DKV5"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:C5DKV5"
                     /translation="MAVHNPNNWHWVDKNCLDWARKYFNEHLVGLKTSERDGKQAEIT
                     SVSSMEGDCEVSQRKGKVISLFDLKLVMMVSGHVGDEKFEGSITVPEVAFDSEKDDYQ
                     FDVSIYKETGKLSEIKPVIKEELLPQLRDVFYGFGPELLKTHANDIQVPADQVNSQFT
                     KGNLQSGLASSGSKGKDPQVSSKTVTSKTEVATSSTSGAPKYNTTTLHLEPTFNVPAI
                     ELYQTFIDKQRIQAWSRSPLQSNSPKSVLEKGDEVTLFGGNITSKLVELEAGKRLVFE
                     WRLNDWRQGHYSRMAMEFHESKEYHETKLQVTWSGVPIGEEDKAKGNFMDYYVRSIKL
                     TFGFGAVL"
     gene            complement(<677647..>680013)
                     /locus_tag="KLTH0F07854g"
                     /db_xref="GeneID:8292749"
     mRNA            complement(<677647..>680013)
                     /locus_tag="KLTH0F07854g"
                     /product="KLTH0F07854p"
                     /transcript_id="XM_002554498.1"
                     /db_xref="GeneID:8292749"
     CDS             complement(677647..680013)
                     /locus_tag="KLTH0F07854g"
                     /note="some similarities with uniprot|Q12151 Saccharomyces
                     cerevisiae YDR213W UPC2 involved in sterol uptake zinc
                     finger transcription factor of the Zn(2)- Cys(6) binuclear
                     cluster domain type"
                     /codon_start=1
                     /product="KLTH0F07854p"
                     /protein_id="XP_002554544.1"
                     /db_xref="GeneID:8292749"
                     /db_xref="GOA:C5DKV6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DKV6"
                     /translation="MSSEGSDEDAMYRSHRRKEKVIELIEVDGKKVSKTSTGKRKFHK
                     KSKNGCDNCKRRRVKCDEDKPSCQKCINMKLECVYTPVASRKRKSSSSAHPPQQAVAP
                     KHEGSPSLVGTPGPGGSGVLQSKASTFAPTSRKPSIAVGDIQKHSQHPTPTSGPLGSQ
                     DNVLLPPLFPGANMQLQQQIQQQPQLLPQLMTLSNSEKFAGFDFPNSPPFQSTSMSLT
                     NSIGSIFAANKLPSNVLNNVINQQQQQQQQQQQQQQHSRQSQQVQPHLQQQHQPHLQQ
                     QHQQHQASPLSSLLHSHEMAQTLSKAGINLKQMAMFSTAGIGGVTYDIQEVLGMKPQG
                     NGDPHNKDGATTAEEVLATLQKQQQQMRNSHHEKEEQKLSDGQTQNGDTSGANLDPNT
                     AANLANNPTISPGAPMSPMAKSATAPMDTDDHTEFYTTKDTSGGTAGLSSKMMDKSNT
                     QDSTSTIESQPGTIARLVQLSNQGTLNLIDLKLFHHYCTEVWPTITSAGISGERIWSD
                     EIPQLAFDYPFLMHALLAFSATHLARKEPGLEQYVASHRLDALRLLRKAVLEISEDNT
                     DALVASALILIMDSLANASSSSSAVSESLAASSMSPSAWIFHVKGAATILTAVWPLTE
                     KSRFHNLISVDLSDLGDIINQDSGTVSELVCFDESIADLYPVEIDSPYLITLAYLDKL
                     HREKNQSDFILRVFAFPALLDKTFLALLMTGDLGAMRIMRCYYQLLRGFATEVKDKVW
                     FLEGITQVLPQDVDDYSGGGMHMMLDFLGGGLPSMTTTNLQPGLSDFM"
     gene            complement(<680690..>682369)
                     /locus_tag="KLTH0F07876g"
                     /db_xref="GeneID:8292750"
     mRNA            complement(<680690..>682369)
                     /locus_tag="KLTH0F07876g"
                     /product="KLTH0F07876p"
                     /transcript_id="XM_002554499.1"
                     /db_xref="GeneID:8292750"
     CDS             complement(680690..682369)
                     /locus_tag="KLTH0F07876g"
                     /note="highly similar to uniprot|P12612 Saccharomyces
                     cerevisiae YDR212W TCP1 tailless complex polypeptide 1
                     chaperonin subunit alpha"
                     /codon_start=1
                     /product="KLTH0F07876p"
                     /protein_id="XP_002554545.1"
                     /db_xref="GeneID:8292750"
                     /db_xref="GOA:C5DKV7"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DKV7"
                     /translation="MSSVLNNSRSDTLFLGGEKISGDDIRHQNVLAALAAANVVKSSL
                     GPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVV
                     IIASELLKRANSLVKNKIHPTTIITGFRVALREAIRYINEVLSIPVESLGKESMVNIA
                     KTSMSSKIIGSDSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNILKAHGKSARESVL
                     VQGYALNCTVASQAMPKRLDGGNIKIACLDINLQKARMAMGVQININDPEQLEEIRKR
                     EAGIVLERVQKIIAAGANVVLTTKGIDDLCLKEFVEAKVMAVRRCKKEDLRRIARATG
                     ATLISSMSNLEGDETFEPSSLGTCQEVVQAKFSDDECILIKGTSKHSSSSIVLRGAND
                     YSLDEMERSIHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAE
                     FAASLLVIPKTLAVNAAKDSSDLIAKLRSYHAASQQAQLDDTKRRNYRNYGLDLIKGK
                     VVDEVHSGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHAH"
     gene            complement(<684569..>685396)
                     /locus_tag="KLTH0F07898g"
                     /db_xref="GeneID:8292751"
     mRNA            complement(<684569..>685396)
                     /locus_tag="KLTH0F07898g"
                     /product="KLTH0F07898p"
                     /transcript_id="XM_002554500.1"
                     /db_xref="GeneID:8292751"
     CDS             complement(684569..685396)
                     /locus_tag="KLTH0F07898g"
                     /note="similar to uniprot|Q03193 Saccharomyces cerevisiae
                     YDR090C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F07898p"
                     /protein_id="XP_002554546.1"
                     /db_xref="GeneID:8292751"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5DKV8"
                     /translation="MISEKGATALAIVGTVCWCVQLIPQIIFNFRRKNCEGFPPSMMF
                     LWVVSGIPFAIYFMVTKGNVILQIQPHLFMVFSGISYAQCLYYPPVQWKWRKIALMLV
                     VLAALDVGMEIGFTLWLRPLYSRGTHWPSLIFGIVASVLLGLGLLPPYYELAKRQGRV
                     IGINFLFLFIDSLGAWLSIVSVILGNMDVMGIALYSVIAGLEIGIFLSHFIWCCRFKW
                     FRKGGFADEENQSNASEKDNNVELKMDSSSRDFQTERKSDETEAVVTTTAASENATQ"
     gene            complement(<687410..>687985)
                     /locus_tag="KLTH0F07920g"
                     /db_xref="GeneID:8292752"
     mRNA            complement(<687410..>687985)
                     /locus_tag="KLTH0F07920g"
                     /product="KLTH0F07920p"
                     /transcript_id="XM_002554501.1"
                     /db_xref="GeneID:8292752"
     CDS             complement(687410..687985)
                     /locus_tag="KLTH0F07920g"
                     /note="highly similar to uniprot|P19073 Saccharomyces
                     cerevisiae YLR229C CDC42 Small rho-like GTPase, essential
                     for establishment and maintenance of cell polarity;
                     mutants have defects in the organization of actin and
                     septins"
                     /codon_start=1
                     /product="KLTH0F07920p"
                     /protein_id="XP_002554547.1"
                     /db_xref="GeneID:8292752"
                     /db_xref="GOA:C5DKV9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKV9"
                     /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLIVGTQIDLRDDKVIIEKLQRQRLRPISAEQGERLARELRAIKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVIKKSKKCTIL"
     gene            complement(<688360..>690540)
                     /locus_tag="KLTH0F07942g"
                     /db_xref="GeneID:8292753"
     mRNA            complement(<688360..>690540)
                     /locus_tag="KLTH0F07942g"
                     /product="KLTH0F07942p"
                     /transcript_id="XM_002554502.1"
                     /db_xref="GeneID:8292753"
     CDS             complement(688360..690540)
                     /locus_tag="KLTH0F07942g"
                     /note="similar to uniprot|P32501 Saccharomyces cerevisiae
                     YDR211W GCD6 Catalytic epsilon subunit of the translation
                     initiation factor eIF2B the guanine-nucleotide exchange
                     factor for eIF2 activity subsequently regulated by
                     phosphorylated eIF2 first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="KLTH0F07942p"
                     /protein_id="XP_002554548.1"
                     /db_xref="GeneID:8292753"
                     /db_xref="GOA:C5DKW0"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DKW0"
                     /translation="MAGKKGKTPKKSVGGGKKPEVVQDERLQAIVLTDSFETRFMPLT
                     AVKPRCLLPLANVPLIEYTLEFLAKAGASEVYLVCASHADQVSAYIETSKWNMPWSPF
                     RVSTIMSLESRSVGDAMRDLDNRGVITGDFILVSGDLVTNMEFDKALEFHRKKKAEDK
                     DHIVTMCLSKASQFYRTRCHEPAAFILDKSNNRCLYYQDIPLASSKHKTSLAIDPELL
                     EDVDEFTLRNDLIDCHVDICSPLVPAIFQENFDYQYLRRDFVKGVLTSDLLKKSIYSF
                     ITDEYAARVESWQTYDAISQDFIARWCYPMVLNTNLLDDQTYSYESEHIYKEKDVVLA
                     QSCKIGKRTAIGSGSKIGEGTKIQNSVIGRNCYIGENIIIRDSFIWDNTVIGAKSLIE
                     HSLVASGVKIGSNVILNDGCVIGFNVMVDDNMEIPMGTRISETPVRKKATQFSDSASY
                     EDDETAKQDESTKVISPAYELVGTDGVGYVYDSDKAEDDDDASVIDVVTNSLTYKFDD
                     LYLSDDSISSTAGKRKKKRSMSTNSIYTDREGDDYEDDEEDEEDFAVEAIATVERAME
                     NNHDLDTALLELNTLRMSINVSYHEVRSATVVALLRRVYHFIATQTLGAKDAVQKVFS
                     QWGMMFQRQAFDQEEFVDLSNLLLEKVVAQGFEKPEFILFSALTCLYDLDILDEDAVY
                     TWWDQVSQEEKYSQAKTLTAKWIEWLKTADEESSEEESEESESE"
     gene            complement(690747..690877)
                     /locus_tag="KLTH0F07964r"
                     /db_xref="GeneID:8292754"
     tRNA            complement(join(690747..690782,690841..690877))
                     /locus_tag="KLTH0F07964r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (TAT) cove"
                     /db_xref="GeneID:8292754"
     gene            complement(<691369..>691605)
                     /locus_tag="KLTH0F07986g"
                     /db_xref="GeneID:8292755"
     mRNA            complement(<691369..>691605)
                     /locus_tag="KLTH0F07986g"
                     /product="KLTH0F07986p"
                     /transcript_id="XM_002554503.1"
                     /db_xref="GeneID:8292755"
     CDS             complement(691369..691605)
                     /locus_tag="KLTH0F07986g"
                     /note="similar to uniprot|Q03482 Saccharomyces cerevisiae
                     YDR210W hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F07986p"
                     /protein_id="XP_002554549.1"
                     /db_xref="GeneID:8292755"
                     /db_xref="UniProtKB/TrEMBL:C5DKW1"
                     /translation="MNHQGPPQQGYYQQGPPQQGYYQQGPPPMGPPQGGGYYQQQQQP
                     MYQQQPPREEGSGCCGWCMKALCCCCLFELLCGD"
     gene            complement(<691998..>694016)
                     /locus_tag="KLTH0F08008g"
                     /db_xref="GeneID:8292756"
     mRNA            complement(<691998..>694016)
                     /locus_tag="KLTH0F08008g"
                     /product="KLTH0F08008p"
                     /transcript_id="XM_002554504.1"
                     /db_xref="GeneID:8292756"
     CDS             complement(691998..694016)
                     /locus_tag="KLTH0F08008g"
                     /note="some similarities with uniprot|P38994 Saccharomyces
                     cerevisiae YDR208W MSS4 Phosphatidylinositol- 4-phosphate
                     5-kinase involved in actin cytoskeleton organization and
                     cell morphogenesis multicopy suppressor of stt4 mutation"
                     /codon_start=1
                     /product="KLTH0F08008p"
                     /protein_id="XP_002554550.1"
                     /db_xref="GeneID:8292756"
                     /db_xref="GOA:C5DKW2"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:C5DKW2"
                     /translation="MSLASQEFFPARDTSSDTPRSSQERRCYSSPTSVESYDKTKPQD
                     FKDAAMSPLCPLDGDRRDSSGAAEQPAPGPLRQVRPRGGSAVDDQDSIIDRRSVVENG
                     SFIQGLNDDDKVLLNSNTSRHKPSRRATQDSLRQFPFDSGKHAKIVPVADPEEESPGA
                     AASPADAVADADAELEELDNVATLRRSRPSRASSTRSFGTSNRPGAISDGSLKRSESA
                     TAEIKKMRESLLHKREMRKKQRNFLDDDRVLIGNKVSEGHVNFTIAYNMLTGIRVAVS
                     RCSGIMKPLTPRDFRMTKKLAFDFHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDP
                     ADYLMSLTSKYILSELNSPGKSGSFFYFSRDYKYIIKTIHHAEHQHLRRTLKEYYTHI
                     KENPDTLVSQFYGLHRVKMPISFKSKIKHRKIYFLVMNNLFPPHLEIHATFDLKGSTW
                     GRYTKVYNPPQNPDEEAHRPVLKDLNWLEEQRSILFGPVKKKKFLQQLERDVDLLARL
                     NIMDYSLLLGIHDMEKGNDLIDERNRLTMFNPSQPQLKEVRRKSVAEEQMRNKSKTAV
                     ERFFQQDEGGIRASDQFNNDLNTIYYVGIIDCLTNYSCIKKLETFWRGLNHDLNEISA
                     VPPRDYGSRFYDFMAASVNRTPVQRYKDNPKVKEFKDSPAPRKTTKEE"
     gene            <695704..>698982
                     /locus_tag="KLTH0F08030g"
                     /db_xref="GeneID:8292757"
     mRNA            <695704..>698982
                     /locus_tag="KLTH0F08030g"
                     /product="KLTH0F08030p"
                     /transcript_id="XM_002554505.1"
                     /db_xref="GeneID:8292757"
     CDS             695704..698982
                     /locus_tag="KLTH0F08030g"
                     /note="similar to uniprot|Q01896 Saccharomyces cerevisiae
                     YDR039C ENA2 P-type ATPase sodium pump involved in Na
                     efflux to allow salt tolerance likely not involved in Li
                     efflux"
                     /codon_start=1
                     /product="KLTH0F08030p"
                     /protein_id="XP_002554551.1"
                     /db_xref="GeneID:8292757"
                     /db_xref="GOA:C5DKW3"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006414"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DKW3"
                     /translation="MPASPQTVPPLSQEFHTLSVRDTVHVLKTDANNGLRASDAQERL
                     ATYGENTLGDDSAIDFKSILIHQVCNAMILVLFISMVITLAIRDWISGGVIAFVVFIN
                     VAIGSFQEYKASKTMNSLKSLSTPSAHVVRDGSDETIASQQLVPGDLCVVKAGDTVPA
                     DLRLVECVNFETDEALLTGESLPIAKDSSQVYPATEDTPVGDRLNLAFASSTVSKGRA
                     TGIVVKTALDTEIGKIAQSLKGDNSLISKDENKSFWGNAAVTLKTTIGSFLGTTTGTP
                     LHRKLSKLAVLLFFVAVVFAIVVMATQKFVVNKEVAIYAICVAVSMIPSSLVVVLTIT
                     MSVGAKIMATRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGRMIVKQAWIPSFGTVTV
                     SNSNDPFDPTDGNIELIPRFSPHEYNHNDTEDVGIITDFKNKFFADALPQELDSDLFM
                     NWLKTATLANIAHVYQDPETGDWKAHGDPTEIAIQVFAHKMDFPRTALTLENQSDSES
                     EVGSSTEKLPEQEAQYKHVAEFPFDSSVKRMSAVYDSLKENNRRHVFTKGAFERVLSC
                     CTKWLPDGHDEKNARSMTQEDKDQVLKNVETLSSEGLRVLAFATKSFDEAQAQELGSK
                     LTKDRDFVESELIFLGLVGIYDPPRPETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQ
                     EVGILPSNLYHYPKEVVESMVMTAAQFDQLTDEEIDNLLVLPLVIARCAPQTKVRMID
                     ALHRRDKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDDNFASILNA
                     VEEGRRMSDNIQKFVLQLLAENVAQALYLMIGLCFLDEQKLSVFPLSPVEVLWIIVVT
                     SCFPAMGLGLEKSAPDIMEKEPKNSKVGIFTWEIILDMLVYGTWMAACCLACFVTVIY
                     GKGNGQLGVDCNNSYSESCHYVFRGRAATFASMTWCALILAWEVIDMRRSFFKMQPET
                     DTPYTQWMKDIWSNQFLFWSVIFGFLSVFPVVYIPVINDDVFKHKGIGYEWGLAFAYT
                     VAFWIGAEVYKYFKRCYFKNKGKARNPENDLESKRVHDPFEKYNTAHSGSTTLQVTVG
                     DYKN"
     gene            complement(<699044..>700432)
                     /locus_tag="KLTH0F08052g"
                     /db_xref="GeneID:8292758"
     mRNA            complement(<699044..>700432)
                     /locus_tag="KLTH0F08052g"
                     /product="KLTH0F08052p"
                     /transcript_id="XM_002554506.1"
                     /db_xref="GeneID:8292758"
     CDS             complement(699044..700432)
                     /locus_tag="KLTH0F08052g"
                     /note="similar to uniprot|Q05979 Saccharomyces cerevisiae
                     YLR231C BNA5 Kynureninase required for biosynthesis of
                     nicotinic acid from tryptophan via kynurenine pathway"
                     /codon_start=1
                     /product="KLTH0F08052p"
                     /protein_id="XP_002554552.1"
                     /db_xref="GeneID:8292758"
                     /db_xref="GOA:C5DKW4"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010111"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DKW4"
                     /translation="MEKAVELDNQYPATHRDAMCIPTYESMGLRAPSANFSKFSPVTY
                     LCGNSLGCMPRATREAVNSELDAWADRAVESHFRHRGEPQGLTSWVDIDLPLSNLLPS
                     VVGGLESEVAVMGSLTANLNALLVAFYRPNSQKFKIICEKGAFPSDFYAFLNQCAIHG
                     VDPEEALVRLEPREGETYLRTDDIIKAISENSEQLALVCLPGIQYYTGQLFDMKKITL
                     YAHQFEDVVVGWDLAHAVGNVPLQLHDWGVDFACWCSYKYLNAGPGGIAGIFVHEKHA
                     QVASHTQEGYMPRLAGWWGNNRERRFQMKEVFEPISGALGFRQSNPSVIDVVALRSSL
                     EVIKDFGGIEALRERSLLLTGYLLKLLQNSPFYHESLTATPQSKPGFTIITPLDEDER
                     GAQLSLLFSPHHDDPKLDTMEQVFKYLNERGVIVDERRPDVIRIAPAPLYNTFQDVFR
                     TVDLLNKALQHV"
     gene            <701778..>703685
                     /locus_tag="KLTH0F08074g"
                     /db_xref="GeneID:8292759"
     mRNA            <701778..>703685
                     /locus_tag="KLTH0F08074g"
                     /product="KLTH0F08074p"
                     /transcript_id="XM_002554507.1"
                     /db_xref="GeneID:8292759"
     CDS             701778..703685
                     /locus_tag="KLTH0F08074g"
                     /note="some similarities with uniprot|P39001 Saccharomyces
                     cerevisiae YDR207C UME6 Regulator of both repression and
                     induction of early meiotic genes. Ume6p requires Ume4 for
                     mitotic repression and interacts with and requires Ime1p
                     and Rim11p for induction of meiosis- specific
                     transcription Ume6p is a C6 zinc finger URS1- binding
                     protein."
                     /codon_start=1
                     /product="KLTH0F08074p"
                     /protein_id="XP_002554553.1"
                     /db_xref="GeneID:8292759"
                     /db_xref="GOA:C5DKW5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DKW5"
                     /translation="MASEREPSDDPSVSPRSASPLKPASSAPGTPLAAVPPPQTSGLS
                     AHIDSTRTPPDSQLDTAKPTSAPQNTPADSPEPALGLPDSAGRAVEHGSQRPHSSLPP
                     PPIRGDRAGGGPPGEKIEAGKEEGVVKSDGKAAGAPDADVKSEGSGDSLDVTGNEEEK
                     VAGDDAGSGGTGSDAGADEDEDEAAAARRMQLPHISTLLAMSREQDARGGPASNAVLA
                     RRSVFATSASRCSSSDSGSARETGSGVPAPALAVPGKVLGARKVLTPNRLYFNSHRSA
                     TDPSASPDHNYKINISSLLNSRGEDVYTLRSQEDPSSSPVFAGLVDSEDAGVVAPPTS
                     QPRFINSKLDEVRSRVLLDPNSQSRPQPLPFAGAQWASRDDDSAAAGAAAAIITKMRS
                     SPYGAHDDSNSSSRPGSASFRQHMRPVIRINQREYESDDSDENAIIEDDTEDELHDDY
                     QRRGSNKISWNKSGMKKRVTRRQSAPSSNFKRRHSGYNDSAKRESRHSSTSSTSTVTS
                     LLSAAALLGKVPSATSQEQGGAGQPRHKTLSVNHEPFLTPSSPKEKPRRKNNSGSRSR
                     TGCWICRLRKKKCTEEKPSCHNCLRLNLECFYDHTKPDFISDTSKKNEKLEEIKKKTK
                     EAKRMAMRRKP"
     gene            complement(<703918..>706308)
                     /locus_tag="KLTH0F08096g"
                     /db_xref="GeneID:8292760"
     mRNA            complement(<703918..>706308)
                     /locus_tag="KLTH0F08096g"
                     /product="KLTH0F08096p"
                     /transcript_id="XM_002554508.1"
                     /db_xref="GeneID:8292760"
     CDS             complement(703918..706308)
                     /locus_tag="KLTH0F08096g"
                     /note="weakly similar to uniprot|Q03466 Saccharomyces
                     cerevisiae YDR206W"
                     /codon_start=1
                     /product="KLTH0F08096p"
                     /protein_id="XP_002554554.1"
                     /db_xref="GeneID:8292760"
                     /db_xref="InterPro:IPR018834"
                     /db_xref="InterPro:IPR019458"
                     /db_xref="UniProtKB/TrEMBL:C5DKW6"
                     /translation="MSSVEYSGPEGILNQFKKYQEQLAGILQAYSANQDDALLSGFLT
                     FAHSKCNKYFDEILLSDDGQGHAGEPVRGAEDMQLTMDCLWKSVHYPIFKWFQLWRQH
                     LVSVNVDQKPRYVELRKLNSKLTKFFKVIHKFYYGILEKVSSEFELFEILPHLFLQKL
                     NIQTKESPEKTVLRSDDQLAISVIILIHRSLLNLGSCHRYKSMCEKFKDTSQDLQFFK
                     KSMRYFNLATLVLPSVGEPYLQEGLIYVQARNFGFSTYSFARSALSRLPSAAGLPNFL
                     SSVCDPNSKIFTQVMIAFQDIFKQERDGRVVNREIIEIYFLVLFCANFAPALWSGETG
                     KCLLSGARLQHIREQYCQKTATRYAKNLPLILQNEILLIAGFDLLKTYNSANKDEKAT
                     QKVKNSFLGFSFDLISHFIDNVVVKEIENQQEWVYLAFVRVVNCWLMSNKAALQFAHR
                     DVRFCDAMMRLMNSVLKSPTLTRPPELNHRPRRPYFFEEDVSLRDFKSVKFTLSDFND
                     DEVFSAGNASGALIGMVDKRLSKKDEHKLRLEAVGVSGKRFLAKNACGIQFVDGQFMK
                     SAIKTKAGQSWAQKAKNTPQSTLKKSVSMRELEAKIQNESGPATWGYSGSSVPQAPAS
                     IKARPSTSFTERPLSRDVSTPSFTKQKAAGSESRSSLSERHQAMPAAVEPPLNMSPAA
                     GSTPNAAAPVMAQPMQYYPPHAPVSSPAIVQNAAPNTSQLFEAPFYPNVPLQMVNTPY
                     MQYWPQAYPLAAYNPMMPLPQNAGMNPPAPLAPQQGTAGLQAQSPAFMGNYAYPQY"
     gene            <706631..>708514
                     /locus_tag="KLTH0F08118g"
                     /db_xref="GeneID:8292761"
     mRNA            <706631..>708514
                     /locus_tag="KLTH0F08118g"
                     /product="KLTH0F08118p"
                     /transcript_id="XM_002554509.1"
                     /db_xref="GeneID:8292761"
     CDS             706631..708514
                     /locus_tag="KLTH0F08118g"
                     /note="similar to uniprot|P13099 Saccharomyces cerevisiae
                     YLR234W TOP3 DNA Topoisomerase III"
                     /codon_start=1
                     /product="KLTH0F08118p"
                     /protein_id="XP_002554555.1"
                     /db_xref="GeneID:8292761"
                     /db_xref="GOA:C5DKW7"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="InterPro:IPR023406"
                     /db_xref="UniProtKB/TrEMBL:C5DKW7"
                     /translation="MPRVVCVAEKNSIAKAVAGILSGGRCSRRDSPNKYIKNYDFTFS
                     FGFSGSSSVTMTSVAGHLTGLDLDQAHGWGKCPIPQVFDAPIVDTRTKDQQKIADNIK
                     KECRNADYLMIWTDCDREGEYIGWEIVQTAIQANQSLQANVYRAVFSHLESGHIMHAA
                     RNPKRLDQRAVDAVRTRMEVDLRSGVAFTRFLTELLGSTVGRDSGSKNDQRPIISYGT
                     CQFPTLGFVVDRFERIRKFVPEKFWFIQISIPNDSEKTVFQWERGHLFDRLAVAVIYE
                     LCLEASGNIAKVADLKSKPTTKWRPLPLTTVELQKNCSRFLKMSAKTSLDAAEKLYQK
                     GYISYPRTETDIFPPNMDLQALVQQQTNDRRWGEYAQNLLNGNGPNCFKWPRAGKNDD
                     KAHPPIHPIVSCGEGLDNENEKKVYEYVTRHFLACCSEDSKGHSTTMVLHWGPEAFTA
                     NGIVVLERNFLDVYLWMKWETTKQLPNLNVGQEVELLTYLMKDGQTSPPNQMTESELI
                     LLMDANGIGTDATIAEHIEKIQQRDYIKKKKVNKQTYLIPTTLGISLVHGFEAIGLED
                     SFAKPFLRREMELDLKLICSGNKNRADVVKDLINKYQNYYGLTSTKQVKLIETYTNIK
                     SVM"
     gene            complement(<708569..>710836)
                     /locus_tag="KLTH0F08140g"
                     /db_xref="GeneID:8292762"
     mRNA            complement(<708569..>710836)
                     /locus_tag="KLTH0F08140g"
                     /product="KLTH0F08140p"
                     /transcript_id="XM_002554510.1"
                     /db_xref="GeneID:8292762"
     CDS             complement(708569..710836)
                     /locus_tag="KLTH0F08140g"
                     /note="weakly similar to uniprot|Q03455 Saccharomyces
                     cerevisiae YDR205W MSC2 Member of the cation diffusion
                     facilitator family localizes to the endoplasmic reticulum
                     and nucleus mutations affect the cellular distribution of
                     zinc and also confer defects in meiotic recombination
                     between homologous chromatids"
                     /codon_start=1
                     /product="KLTH0F08140p"
                     /protein_id="XP_002554556.1"
                     /db_xref="GeneID:8292762"
                     /db_xref="GOA:C5DKW8"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:C5DKW8"
                     /translation="MSCYPRDVPHLTWPRGPVVHVTPSSSARPVSSLVFLDPPPCRLV
                     LLPPKTRATAPTPIPLPMPLDDLLPRIPLVLSYPTVLLSSNLIVCAGAGRDSTGGALL
                     EPLLRNVAAPLLCASAVASAGDYFGVLERPSAALGLAFVSFSLNSLLGHIQTSVLSAL
                     LLQLLAGFASLNWHYAVLPALSFAMDYAQGHGYYKTAASYLAIVLTLYLKLGRPGGRG
                     LSLGKRLRPLHLAILSIVIAALLNLAFADPFGYTPVFRQSGLDLQYAMIFVFLGCLFL
                     MFVSWKELCSDQSQQNALTLGRSHYIPPALGLTAMLLQYLAFNHLSSSISSDVLMLLF
                     VASSGVVSKINAVALPDVDHHAHNEDECVHKCKLEHSHENSHEHSHEHSHEHSHEHSH
                     DHSHAHTHSHSTQSAHGDGELKQGLFAQLATNKETRSIFSFLLLNTAFMFVQLLYSFR
                     SKSLGLLSDSLHMALDCMSLLLGLVAGVLSKNPANDTFPFALGYLETLAGFTNGVLLI
                     GIVSGILVEAVDRVFNPTVLLETNELLVVSFLGLVVNLLGLFAFDHGGHSHDGGNENM
                     RGIFLHIMADTLGSVGVVISTLLTKMFNLQIFDPIASIFIALLILMSSIPLIKSTTSS
                     ILLRLSDKENNALKSALNQISMTPGITGYTTPCFWPPSSSRAHGGHSHSHGHSHSHCD
                     EDAQSEKDSKKSLIGYIHIQYMEGENSTIIKKRAEKIMEGAGIKAWIQVEPKDSACWC
                     RTSSMAGMTAVSNIK"
     gene            <711372..>713132
                     /locus_tag="KLTH0F08162g"
                     /db_xref="GeneID:8292763"
     mRNA            <711372..>713132
                     /locus_tag="KLTH0F08162g"
                     /product="KLTH0F08162p"
                     /transcript_id="XM_002554511.1"
                     /db_xref="GeneID:8292763"
     CDS             711372..713132
                     /locus_tag="KLTH0F08162g"
                     /note="similar to uniprot|Q05998 YLR237W Saccharomyces
                     cerevisiae THI7 Plasma membrane transporter responsible
                     for the uptake of thiamine"
                     /codon_start=1
                     /product="KLTH0F08162p"
                     /protein_id="XP_002554557.1"
                     /db_xref="GeneID:8292763"
                     /db_xref="GOA:C5DKW9"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:C5DKW9"
                     /translation="MPSTQSRSGANRPGLLSRGLKMLEIPVKDRQTLTVLRNPDILPI
                     PAEDCTWSFFSYLAYWGVISFSVGTWVSANAALDVGLSYAETIGTFIVGDAVTIVFTL
                     ANSYHGLDWRVGYTLSQRFVFGIYGSGLGILVRILMSIVNYGSNAWLGGLCVNMILDS
                     FSHHYVHLPNTLTHKVAMSTKELIGFVLFHVITAFFYLMKPKSMNYFLIWSCVATCFG
                     MMGMVIYLTKINGGVGSAFRESETTIHGSDRAWMWVYMVSYWFGSVSPGSTNQSDYSR
                     FASNKTGLYLGVIVALLVPTTVVPVFGVIGASTTSQLYGDAIWTPMDIFNYWLKENYS
                     AGARAASFFCGVAFTASQISYTISNCGFASGMDLSGVLPQYINIFRGAIFTALVSVAV
                     QPWNFYNKDSNTFLSVMSSFGVVMTPIISVMIADNFLVRKRKYSVSQAFVLKGEYYYT
                     LGTNWRAMAAFVCGMAPGLPGIAAEANANIMAKMDRGIVNFFYADSFTSFAISFFMYW
                     ILCLIFPVKIGIEQDDKDYFGAFTDEEARERGVVPFSELTPEEIEEHNFSLGALDTPH
                     SSSASSTGVDAHYEGGEKTK"
     gene            complement(<713580..>714563)
                     /locus_tag="KLTH0F08184g"
                     /db_xref="GeneID:8292764"
     mRNA            complement(<713580..>714563)
                     /locus_tag="KLTH0F08184g"
                     /product="KLTH0F08184p"
                     /transcript_id="XM_002554512.1"
                     /db_xref="GeneID:8292764"
     CDS             complement(713580..714563)
                     /locus_tag="KLTH0F08184g"
                     /note="similar to uniprot|O13525 Saccharomyces cerevisiae
                     YDR204W COQ4 Protein with a role in ubiquinone (Coenzyme
                     Q) biosynthesis possibly functioning in stabilization of
                     Coq7p located on the matrix face of the mitochondrial
                     inner membrane"
                     /codon_start=1
                     /product="KLTH0F08184p"
                     /protein_id="XP_002554558.1"
                     /db_xref="GeneID:8292764"
                     /db_xref="GOA:C5DKX0"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /translation="MIRTSFKHSIETRNQLLHRRHFVVAAALTVGNFVFGRDARLADA
                     MDNGELHNKNEDYKAKAEELKEQRLRSIANSRPMKPCYEGHVPLYPHERVLLFITSGL
                     KSYFHPEDGENIVQLGEASAFTPFLERLKNTMLSDKTGRRILREQPDITSESLDMDRL
                     KKMAPNTLGHSYYKWLIKEGVSPDTRAPVKYIDDPTHAYIFKRYRQCHDFYHAVNDLP
                     IIIEGEIAVKALEAANIGVPMAALGALLAPLRLKPVQKKRLYDVYLPWAVRTGLSCEP
                     LINVYWEELLEHDVEELRKKLRITPPPDLRAIRRERAQQRKQFKLKYERHE"
     gene            <714649..>715665
                     /locus_tag="KLTH0F08206g"
                     /db_xref="GeneID:8292765"
     mRNA            <714649..>715665
                     /locus_tag="KLTH0F08206g"
                     /product="KLTH0F08206p"
                     /transcript_id="XM_002554513.1"
                     /db_xref="GeneID:8292765"
     CDS             714649..715665
                     /locus_tag="KLTH0F08206g"
                     /note="similar to uniprot|Q03956 Saccharomyces cerevisiae
                     YDR202C RAV2 Subunit of RAVE (Rav1p Rav2p Skp1p) a complex
                     that associates with the V1 domain of the vacuolar
                     membrane (H)-ATPase (V-ATPase) and promotes assembly and
                     reassembly of the holoenzyme"
                     /codon_start=1
                     /product="KLTH0F08206p"
                     /protein_id="XP_002554559.1"
                     /db_xref="GeneID:8292765"
                     /db_xref="InterPro:IPR028241"
                     /db_xref="UniProtKB/TrEMBL:C5DKX1"
                     /translation="MTAELYPGDYFGGKPDNDSVLSERSWLINEIIKPELPNIIDNVD
                     KCLELLTSDESFRMPISNGVPAEPNAAYVRGVLTRKGALITDFQVMIRFKQFNRGKHC
                     LFKMDSELPFPIEQINTITQNLKTVSELLDSLQLCGDVEIFTADLSHVMELLSKSTNL
                     LQYPPKYLLFPFNGNMVLKHMFKSSETPFESSHHVLNMDLVILNTEVCMDFRNLQKIT
                     TKPWSDYDAESDKTFTDKIRDELKLHRGKRLSEVLQDQGLHIEEPSLLRNMLPLKNTH
                     NATTLPEAQEILARCVTFEAGLVSECEKVSVSTSDPSLISITSKLNGLETCVSNYYSN
                     ITQI"
     gene            complement(<715667..>716140)
                     /locus_tag="KLTH0F08228g"
                     /db_xref="GeneID:8292766"
     mRNA            complement(<715667..>716140)
                     /locus_tag="KLTH0F08228g"
                     /product="KLTH0F08228p"
                     /transcript_id="XM_002554514.1"
                     /db_xref="GeneID:8292766"
     CDS             complement(715667..716140)
                     /locus_tag="KLTH0F08228g"
                     /note="similar to uniprot|Q03954 Saccharomyces cerevisiae
                     YDR201W SPC19 Component of Dam1p complex important for
                     spindle and kinetochore integrity localized to nuclear
                     side of spindle pole body and along mitotic spindle"
                     /codon_start=1
                     /product="KLTH0F08228p"
                     /protein_id="XP_002554560.1"
                     /db_xref="GeneID:8292766"
                     /db_xref="GOA:C5DKX2"
                     /db_xref="InterPro:IPR013251"
                     /db_xref="UniProtKB/TrEMBL:C5DKX2"
                     /translation="MTESLSQCCDALESAVELLSGTVSKLENQSNLSNQLTMSLLQPR
                     RVFELIPEYDIQRAKLDLIEEVEPLVKSLSGKLSKSLVKLERERDTLQQTLELNSLRL
                     NNQFSGEEMSDPDVSSDLVIMTSSTTEELDQLKKLKAQKAQLISSIQEIQSGEQG"
     gene            <716337..>717635
                     /locus_tag="KLTH0F08250g"
                     /db_xref="GeneID:8292767"
     mRNA            <716337..>717635
                     /locus_tag="KLTH0F08250g"
                     /product="KLTH0F08250p"
                     /transcript_id="XM_002554515.1"
                     /db_xref="GeneID:8292767"
     CDS             716337..717635
                     /locus_tag="KLTH0F08250g"
                     /note="similar to uniprot|Q03944 Saccharomyces cerevisiae
                     YDR200C VPS64"
                     /codon_start=1
                     /product="KLTH0F08250p"
                     /protein_id="XP_002554561.1"
                     /db_xref="GeneID:8292767"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C5DKX3"
                     /translation="MSGDTKPVVTRRTRSNSSSDGSASPMTQEFMAPSTAPRNRYTHI
                     IILKSLNNTFETKFLVVPFKPDGLKLGRPIANSGAQPGGKQDLQSQVRPDNGHFDSRV
                     LSRNHASLSCEPFSGKIYIRDLKSSNGTFVNGNRITQSDTELKVGDIIDLGTDIDAKF
                     EHRKISALVEDISVIPLINEDEPFTNGAGKHSRDDLTGGLATPNAQRAAFEAAMFGDV
                     NNLDLEESLLGSETEILSGIFINNSIGTSPNLINVIKTLVTEISLEKHEFEKMKSIER
                     FLIHFTTNLEHINKLRVENNDLQLVQLQNSLKQKLNEKHDVAMQTHVDRLKKVEEEND
                     SLRSDLEKQSKVEAKELKSLKREIEDLNTRLEVEKFKNTQLKKSADENSIYSKRLRDS
                     GLNKAQDSPSKKSAGRKSTILLSAFTVGIAAAAFQYASKR"
     gene            complement(<717660..>718631)
                     /locus_tag="KLTH0F08272g"
                     /db_xref="GeneID:8292768"
     mRNA            complement(<717660..>718631)
                     /locus_tag="KLTH0F08272g"
                     /product="KLTH0F08272p"
                     /transcript_id="XM_002554516.1"
                     /db_xref="GeneID:8292768"
     CDS             complement(717660..718631)
                     /locus_tag="KLTH0F08272g"
                     /note="similar to uniprot|Q06005 Saccharomyces cerevisiae
                     YLR239C LIP2 Lipoyl ligase involved in the modification of
                     mitochondrial enzymes by the attachment of lipoic acid
                     groups"
                     /codon_start=1
                     /product="KLTH0F08272p"
                     /protein_id="XP_002554562.1"
                     /db_xref="GeneID:8292768"
                     /db_xref="GOA:C5DKX4"
                     /db_xref="InterPro:IPR000544"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR020605"
                     /db_xref="UniProtKB/TrEMBL:C5DKX4"
                     /translation="MIKNARKPILRANVPYISRWRVKHSSTCSNKTLTHPVEESSKVL
                     RHLEFIKPLEFQKGLQIQEKFVRAQLDMKALESKIKRKLGLLELETNGAPINEHEQKI
                     LDTIMDMKPNPIVLTFEFEPTYTGGKRSKKAVSDEDILNFENFRPKDQVKNKSPKFVQ
                     AERGGQVTFHGPGQVVAYIVMDLKSFHSFPAKCLVSAIEGSTIDTLKSAPQGKHKTPL
                     NLQAIRTEETGVWIDEENKIASIGVHVRRSITSHGVSINVNPDLSYMNSFTMCGLPET
                     RATSVLEQIPDTTCSTHDIAVTFVNKLAKKLGITTVERIQLDDIDID"
     gene            <718731..>720125
                     /locus_tag="KLTH0F08294g"
                     /db_xref="GeneID:8292769"
     mRNA            <718731..>720125
                     /locus_tag="KLTH0F08294g"
                     /product="KLTH0F08294p"
                     /transcript_id="XM_002554517.1"
                     /db_xref="GeneID:8292769"
     CDS             718731..720125
                     /locus_tag="KLTH0F08294g"
                     /note="similar to uniprot|Q03942 Saccharomyces cerevisiae
                     YDR198C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F08294p"
                     /protein_id="XP_002554563.1"
                     /db_xref="GeneID:8292769"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5DKX5"
                     /translation="MAATSQSLPWDERLDYLLKWLEESEGFAVNEHVRLQDTKRSGRG
                     LYLKSGALKKRDCIVSIPGDKQLNFYTVIYHISLFNCELAIDGVSCPSSDRANNKIYE
                     ADDPRTEAYRHLTNNVVLGLSSFQLLSLFILFEWKILPQESNFTSFWKPFFDVFPSFE
                     DLRSIPATWVCDPESGNLELIEMLPAASKKHAERMVSQVKHDWETIFPFIQKWLESRE
                     GASQINKQKLFSEFVHVYFVINSRCLYIEIPLKTDVADNFTMVPFVDFLNHNSDVDAY
                     CKPRIERLKKSPCGLGNFSIVAGDHEYVNLGEEILLNYGAHSNDFLLNEYGFVLGENM
                     WNYIDVSSEAMELISQVHVKEFLIENNYWGDYTISSSEVSFRLLVAFAAVVCSDLRKV
                     EKFMLGYITESSFGSALSSMLREFIASLTKNVETKVRSLKATSKPDPLCSQNVLHVYE
                     GYLQILRQHLGDNA"
     gene            complement(<720142..>721236)
                     /locus_tag="KLTH0F08316g"
                     /db_xref="GeneID:8292770"
     mRNA            complement(<720142..>721236)
                     /locus_tag="KLTH0F08316g"
                     /product="KLTH0F08316p"
                     /transcript_id="XM_002554518.1"
                     /db_xref="GeneID:8292770"
     CDS             complement(720142..721236)
                     /locus_tag="KLTH0F08316g"
                     /note="similar to uniprot|P14905 Saccharomyces cerevisiae
                     YDR197W CBS2 Translational activator of COB mRNA soluble
                     protein cytochrome b translational activator"
                     /codon_start=1
                     /product="KLTH0F08316p"
                     /protein_id="XP_002554564.1"
                     /db_xref="GeneID:8292770"
                     /db_xref="GOA:C5DKX6"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:C5DKX6"
                     /translation="MNVPRVYALGNAPLNYLVCHEIASLSVQPRVPELVLLLQDQRKL
                     NRFLENESKLYVRRQDNSRSSSKQYMASCSPPKYASGEIAKIDNLIIGETRSPAFVNA
                     LKKYSECIHNDTNVLLLNPGFGVMEQLEQSVWEQKGFVPNIFMGLADLEQSFLPSEFA
                     MQYSRVRQPLQICSVPKANISYDYQQDKHNTQVLEGTNNLLRLMKMLDRENTFSNIGV
                     ATRPYGDLLLRRYEELIIASCIKPLTALYPEKGVSENTSLLQIIRSLVREFTRIIKAT
                     DPHLQHIPHFESIIDEERLFVLVSRNLKKRSRSAFSKPTIRDINQYNGYFMMKAKASG
                     LWCQSNSFIMKCAKAKLELQQKNATDFRYL"
     gene            <721404..>722114
                     /locus_tag="KLTH0F08338g"
                     /db_xref="GeneID:8292771"
     mRNA            <721404..>722114
                     /locus_tag="KLTH0F08338g"
                     /product="KLTH0F08338p"
                     /transcript_id="XM_002554519.1"
                     /db_xref="GeneID:8292771"
     CDS             721404..722114
                     /locus_tag="KLTH0F08338g"
                     /note="similar to uniprot|Q03941 Saccharomyces cerevisiae
                     YDR196C predicted to catalyze the final step in synthesis
                     of Coenzyme A"
                     /codon_start=1
                     /product="KLTH0F08338p"
                     /protein_id="XP_002554565.1"
                     /db_xref="GeneID:8292771"
                     /db_xref="GOA:C5DKX7"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKX7"
                     /translation="MLIIGLTGGIACGKSSVSERLAKSYKIPVIDADKIAREIVEPQR
                     NAYLKIVQYFKGKVPDLIREDGSINRPALGKWVFANHSDLKVLNGITHPAIRLEIFKQ
                     ILKQYLRGEKMCVLDVPLLFESGLNLFCGVTVSVICDQETQISRIRSRNPELSLEDGE
                     NRIKAQMTHKERIRRSDFIIENSDTLEHLYGQVHAFVLKVKPTWTRTILEYFPPFALI
                     SALAIVLIKYLRRNQAIS"
     gene            complement(<722163..>723695)
                     /locus_tag="KLTH0F08360g"
                     /db_xref="GeneID:8292772"
     mRNA            complement(<722163..>723695)
                     /locus_tag="KLTH0F08360g"
                     /product="KLTH0F08360p"
                     /transcript_id="XM_002554520.1"
                     /db_xref="GeneID:8292772"
     CDS             complement(722163..723695)
                     /locus_tag="KLTH0F08360g"
                     /note="some similarities with uniprot|P42073 Saccharomyces
                     cerevisiae YDR195W REF2 RNA-binding protein involved in
                     the cleavage step of mRNA 3'-end formation prior to
                     polyadenylation also involved in snoRNA maturation"
                     /codon_start=1
                     /product="KLTH0F08360p"
                     /protein_id="XP_002554566.1"
                     /db_xref="GeneID:8292772"
                     /db_xref="UniProtKB/TrEMBL:C5DKX8"
                     /translation="MSGSPIPQLVNISHALQSSFIQQLRTETREFSETPTLSQEQQRK
                     IDTYIGSLERAFTAFTRDNEHIERRDADVTPADVQLYSGLKTMYADYLTQLTKLKRKS
                     VVQNEASLRDQQKSANQSDNTRTTNPSAKKSENVRSSPQKEAVKTEAKAPSRASTTNE
                     GGLWRASQEKNAGQNEHLRANQVLEYMQDELPYQQPAERKSYVDNLQKNADLTLQKNP
                     KLLDAVANLAILDSTVSENLHSYVTLLRMVGYKDDEFAARLPHINGKLTPSDKALPPT
                     SSADQASAKAPAPEEPKKKISFLKYLKKGDVNEQGKRVLEDNTLGGSQKRSRPNNDNN
                     SNLISILKSETSKKRRNPIRFVADEKLLTVYGDDIPSDGLIVSPGKLKKVLKPFKDGE
                     PREVTFPTWKNQKVRELSIPKPTEDSDIVDIKGGPISCDTRVSANYRLNFTAFSKSLN
                     KQPLEPTELDEKDPNLTKKPLIVRAFGKNCLLLQKDRGGLPYKRVPEVSLNDYPIRPT
                     SN"
     gene            <724794..>726767
                     /locus_tag="KLTH0F08382g"
                     /db_xref="GeneID:8292773"
     mRNA            <724794..>726767
                     /locus_tag="KLTH0F08382g"
                     /product="KLTH0F08382p"
                     /transcript_id="XM_002554521.1"
                     /db_xref="GeneID:8292773"
     CDS             724794..726767
                     /locus_tag="KLTH0F08382g"
                     /note="similar to uniprot|P15424 Saccharomyces cerevisiae
                     YDR194C MSS116 DEAD-box protein required for efficient
                     splicing of mitochondrial Group I and II introns presumed
                     RNA helicase due to DEAD-box motif"
                     /codon_start=1
                     /product="KLTH0F08382p"
                     /protein_id="XP_002554567.1"
                     /db_xref="GeneID:8292773"
                     /db_xref="GOA:C5DKX9"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKX9"
                     /translation="MISALFARNVPARTFEVSKLVVRVCALRQLSDEGRQSFRGRDGN
                     RSYNGDRSSRGGYGRNDRNSRRPTGGHRGTRLQGEPPLRLSNVVRVADDQSSKDITLD
                     GLHQSGVIDKELHKAVSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLV
                     PIFEHLIKTRTESPSMVKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGS
                     NFQVAIKRMFKDTPNIVVATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDED
                     LRDISKTLNSINATGPEHIRTLLFSATLGDNVQKLAAGIMNRKESLFLDTVDVNEPEA
                     HEKIDQRLVISENFASNLYAPISAIKNRLATNNEPFKAILFVPTVKFTKFYCTILERL
                     FPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVCTDVGARGMDFPGVEEVLQLGVPS
                     ELSNYIHRIGRTARGGKEGKATIYLFKDELPFIDTLAREKNVKIVDQDDYAVNKDEIE
                     EFNSCLRDEFMFRESLESMLSFYKGCEQAYGFYMPKVARQIANSYGQCLMQPEKKMPI
                     SRSTASMRYGLKGRIVEEIFDCGQSHRESYNNEERLPNRGNKTRNFSNRSNQGGYDSG
                     RRVSRQRWESNEKFDNKRFRSPNRGENPRIDYN"
     gene            <727026..>729629
                     /locus_tag="KLTH0F08404g"
                     /db_xref="GeneID:8292774"
     mRNA            <727026..>729629
                     /locus_tag="KLTH0F08404g"
                     /product="KLTH0F08404p"
                     /transcript_id="XM_002554522.1"
                     /db_xref="GeneID:8292774"
     CDS             727026..729629
                     /locus_tag="KLTH0F08404g"
                     /note="similar to uniprot|P22543 Saccharomyces cerevisiae
                     YLR240W VPS34 Phosphatidylinositol 3-kinase responsible
                     for the synthesis of phosphatidylinositol 3- phosphate;
                     forms membrane-associated signal transduction complex with
                     Vps15p to regulate protein sorting; similar to p110
                     subunit of mammalian PI 3-kinase"
                     /codon_start=1
                     /product="KLTH0F08404p"
                     /protein_id="XP_002554568.1"
                     /db_xref="GeneID:8292774"
                     /db_xref="GOA:C5DKY0"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="InterPro:IPR008290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:C5DKY0"
                     /translation="MSFKSVTFCVSNEVELPLQVKIDSLEGVKPLLTASQKLTEPSLS
                     QRASNVAPNSDMFVSVQVFDRETLRNLTIPVYTPYVPFKNARKWDLWLTLPITIDQLT
                     SNSILRIILWEFEGDNEVEFFTIETSLYKEDSKTLKRGTESFRFQYDEPNSGALELDP
                     AKELVNNYRKGEIKAVTWLDELTLQQLGKTNRKKRLPKGIFILNIEYPLYELPVVYSE
                     KVSAKTQKNVPNFHNFELSNDVQISRQEPQAKLSLGGPAQSTLKFYDPDQFNIDPIEE
                     KFRRLERATTNSNFEKELKPDAKKRDILNKIISYPPGSSLTAHEKGLVWKYRYYLMNN
                     KKALTKLLQSASLTEENERKEVLQMVDSWAEIDIEDAIELLGPAYRNLSLRSYAVNRL
                     KKASDNELELYLLQLVQAVCFESCSPLSDKTASEFTIVDVAQSGAAANPLPEFEQINE
                     SSSLNSTESISAGHSSVLISPLAEFLIRRAIKNSRLGNFFYWYLKSESEGNSYLVHIL
                     ESFTSRLPSDKRVKLEHQIKFISMLEKFCQEVKNVRDTTPKKLELLINLISTKLRPFL
                     RATPVELPLDPDFTLTDVVYEGCKIFKSSLSPIKIVFETKQNVPYSLMFKVGDDLRQD
                     QLVVQIITVMNELLKNENVDLKLMPYKILATGAKEGAIQFIPNDTMANILSKHHGILP
                     FFRAHHPSPTNELGVQEWVMDNFVKSCAGYCVITYILGIGDRHLDNLLITPDGNFFHA
                     DFGYILGQDPKPFPPLMKLPPQIIESFGGAESQNYNKFRSYCFVAYSILRRNANLILN
                     LFELMKTSDIPDIKIDPDGAMLKVKEKFCLDMSEEEAIIHFQNLINASVNALLPLVID
                     RLHNLAQYWRT"
     gene            <730037..>732391
                     /locus_tag="KLTH0F08426g"
                     /db_xref="GeneID:8292775"
     mRNA            <730037..>732391
                     /locus_tag="KLTH0F08426g"
                     /product="KLTH0F08426p"
                     /transcript_id="XM_002554523.1"
                     /db_xref="GeneID:8292775"
     CDS             730037..732391
                     /locus_tag="KLTH0F08426g"
                     /note="similar to uniprot|Q06538 Saccharomyces cerevisiae
                     YLR241W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F08426p"
                     /protein_id="XP_002554569.1"
                     /db_xref="GeneID:8292775"
                     /db_xref="GOA:C5DKY1"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:C5DKY1"
                     /translation="MGTFFDIVQTLSVPEIESLSDGGHSDFRKPSTRVVTTQLLIALS
                     LGLFALLCFSLLLKKLPRLYASRMGRNHGSLPTWDENSLFSWLPVLYRITDSQVLEFA
                     GLDAYVFLGFFKMCIKLLAICCAFSVCLISPIRHHFTGRYDDGNDEASFLLKSSVQDG
                     VDDGSNGGQAPEHAEVYLWMYVIFTSFFTLVALKLLIEQTKNVVVTRQSFLGKQNTLT
                     DRTIRLTGIPVELRDPEALKARIEELKIGKVASVSICREWGPLNNLFNYRKKVLQKLE
                     LKYSECPEALRDLEHFDENYRLRSETSLSSDEQLGLNHDSAFAPDAPDSSRIYSDIQL
                     RGRQKIRTGLFGIFGERVDAIDYLEKQLKFIDGEIIEARKKTYPATPTAFVTMDSVAN
                     AQMAAQAVLDPRVHFFMTRLAPAPHDIKWDNVCLSRKERLVKVWSVTIFIGVCSLFLL
                     IPVSYLATLLNLKTLSKFWPQLGQYLKKNHWAQTLVTSLLPTYLFTLLNVGIPYFYEF
                     LTSRQGLVSYSEEETSLVSKNFFYIFVNLFLVFTLAGTASNYWGYLSDTTKIAYQLAT
                     SVKEFSLFYTDLIILQGVGMFPFKLLLAGSLIGFPFIKIKCKTPRQESEMLRPPIFNF
                     GLQLPQPILILIVTLIYSVMSTKILTSGLAYFVIGFYVYKYQLVFATDHLPHSTGKVW
                     PLIFRRVILGLLLFQLTMAGTLAGFQGGWVLSCCLAPLPLITLSFLWDFEKNYLPLSN
                     FIALSSIREHERDNSTVSSPFESGNYQYPYLVAPLERPIVRRAA"
     gene            complement(<732406..>733281)
                     /locus_tag="KLTH0F08448g"
                     /db_xref="GeneID:8292776"
     mRNA            complement(<732406..>733281)
                     /locus_tag="KLTH0F08448g"
                     /product="KLTH0F08448p"
                     /transcript_id="XM_002554524.1"
                     /db_xref="GeneID:8292776"
     CDS             complement(732406..733281)
                     /locus_tag="KLTH0F08448g"
                     /note="similar to uniprot|Q2VQX3 Saccharomyces cerevisiae
                     YLR242C"
                     /codon_start=1
                     /product="KLTH0F08448p"
                     /protein_id="XP_002554570.1"
                     /db_xref="GeneID:8292776"
                     /db_xref="InterPro:IPR007290"
                     /db_xref="UniProtKB/TrEMBL:C5DKY2"
                     /translation="MICINCCCEVDCLYVEYSNNHIRLTDCAKCKEVVDRYVEFDNVL
                     LFIDLLLLKPGAYRHLVYNSLELELSKYPERKHEFSARTWKQRSLLTLLRLRDWFVKF
                     DKLNRVWILITAFEVYLTWVSEERNYAQSNSNELIEFILSRSALSQYLCFAIYCVADF
                     VLLCGLTHYFLVKWFKWGRKVKYSKHVVSYTILLSYGVKIFPFLMLIWPYDTLLSTNI
                     VKLVSNAYIIEALKVVTNLAYSNIIFLYVVVFLVRWISVRPLLCMLVTEGDIQFCGKF
                     MEVEYKRLLRRLLRI"
     gene            <733431..>735029
                     /locus_tag="KLTH0F08470g"
                     /db_xref="GeneID:8292777"
     mRNA            <733431..>735029
                     /locus_tag="KLTH0F08470g"
                     /product="KLTH0F08470p"
                     /transcript_id="XM_002554525.1"
                     /db_xref="GeneID:8292777"
     CDS             733431..735029
                     /locus_tag="KLTH0F08470g"
                     /note="weakly similar to uniprot|P49686 Saccharomyces
                     cerevisiae YDR192C NUP42 Subunit of the nuclear pore
                     complex (NPC) that localizes exclusively to the
                     cytoplasmic side; involved in RNA export, most likely at a
                     terminal step; interacts with Gle1p"
                     /codon_start=1
                     /product="KLTH0F08470p"
                     /protein_id="XP_002554571.1"
                     /db_xref="GeneID:8292777"
                     /db_xref="GOA:C5DKY3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C5DKY3"
                     /translation="MSFEGRNKIPCKYFQQGRCKKGNSCNFAHVYTGGNNYSGTSSPQ
                     PGLEERYRSFVSATSLNKLSKEIEDDFKGASELIMKPLSSSYSLGSPCAVNLIQGRDL
                     SPEESRFLCYEARLQNNLAAYETQIKARGDDMQKCLDLVSKDPRKAARYLQLATQKVK
                     ETGSSQMKGFIEHPLDLTGQSYTQGTSKLFGAPSASFGASASTSNPFGSAAAKPSPFG
                     QPAFGQQSPQESNAFGMAASGSSVSGPSTAGAFGQPKFGTSAFGSGNSASPFGSTASG
                     GGGSSAFGAPSFGSPGGFSSAFGKPSFGSNTATQPSSLAAINASSTSNTMGSQTPSTQ
                     FGSGVSAFGKPAFGSNANVSPFASIQGAQGNKSPFGSTTGTTSQPAATNGAFGAPAFS
                     NQSSTTSASSSNSFRSTAQNSSIAKPFNSATPFGAPSPFGSSQAFGTNSPAFGSAGFQ
                     PPQSNAGFGAPQGATAANQNQGAFPSQNSGPNNNISTFVQGLPTGKELRESDLPAEII
                     EYFKSDHFALGKVPDNPPPVTLVS"
     gene            <735358..>736173
                     /locus_tag="KLTH0F08492g"
                     /db_xref="GeneID:8292778"
     mRNA            <735358..>736173
                     /locus_tag="KLTH0F08492g"
                     /product="KLTH0F08492p"
                     /transcript_id="XM_002554526.1"
                     /db_xref="GeneID:8292778"
     CDS             735358..736173
                     /locus_tag="KLTH0F08492g"
                     /note="highly similar to uniprot|Q06543 Saccharomyces
                     cerevisiae YLR243W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0F08492p"
                     /protein_id="XP_002554572.1"
                     /db_xref="GeneID:8292778"
                     /db_xref="GOA:C5DKY4"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKY4"
                     /translation="MSRVGVLVLGPAGAGKSTFCNSIISHMQTVGRRAHIVNLDPAAE
                     ASEYEFTVDIRDLISLEDVMEELHLGPNGSLIYCFEYLLNNLDWLEEEIGDYNDEYLI
                     FDCPGQIELYTHIPVLPTIARHLQTQMGFSLCATYLLEAPFVIDSSKFFSGALSAMSA
                     MILLELPHINILSKLDQIKDEYSKKKLKRYLNPDPTLLLDSSNETLNPRFQKLNKTIA
                     NLVDDFGMVQFLPLEAKNPESVSNILSYIDDVTQWAEGQEPKEPNDQIELEDM"
     gene            complement(<736218..>737393)
                     /locus_tag="KLTH0F08514g"
                     /db_xref="GeneID:8292779"
     mRNA            complement(<736218..>737393)
                     /locus_tag="KLTH0F08514g"
                     /product="KLTH0F08514p"
                     /transcript_id="XM_002554527.1"
                     /db_xref="GeneID:8292779"
     CDS             complement(736218..737393)
                     /locus_tag="KLTH0F08514g"
                     /note="similar to uniprot|P53688 Saccharomyces cerevisiae
                     YDR191W HST4 Member of the Sir2 family of NAD()-dependent
                     protein deacetylases involved along with Hst3p in
                     silencing at telomeres cell cycle progression radiation
                     resistance genomic stability and short-chain fatty acid
                     metabolism"
                     /codon_start=1
                     /product="KLTH0F08514p"
                     /protein_id="XP_002554573.1"
                     /db_xref="GeneID:8292779"
                     /db_xref="GOA:C5DKY5"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DKY5"
                     /translation="MHEGMKQGSFPEKGQRANTMLPLTPPSTVQKPSASDNREEILVT
                     PRKLFPELKKLSSKARKPPLRYRPEKNTVFDIEQYIEGCRRGKCNEKDAKFLRYAFEH
                     SRRVVMVAGAGVSVAAGIPDFRSSGGLFSTLRDEGVASGKELFDFNSVYSSVEVGQKF
                     NRMITNMHARCQETRPTEFHRLANTVAKEGRLTRLYTQNIDGIEDGTSHLQTQVPLEK
                     PFPNTIQLHGSIKHMFCNKCSKIYDMNPSLFKAQEEQTGREVFPLCPQCTEFEAVREV
                     AGMRSQGVGKLRPRIVLYNEVHPEGESIGDVVSKDLKGRPDCLIIVGTTLKIPGVRAM
                     CKQFARQVHQSKGIVLWLNTELPTKSIEDFLGFIDLIVVGDCQKVTSLFDASGALSK"
     gene            <739646..>741025
                     /locus_tag="KLTH0F08536g"
                     /db_xref="GeneID:8292780"
     mRNA            <739646..>741025
                     /locus_tag="KLTH0F08536g"
                     /product="KLTH0F08536p"
                     /transcript_id="XM_002554528.1"
                     /db_xref="GeneID:8292780"
     CDS             739646..741025
                     /locus_tag="KLTH0F08536g"
                     /note="highly similar to uniprot|Q03940 Saccharomyces
                     cerevisiae YDR190C RVB1 RUVB-like protein TIP49a
                     Homologue"
                     /codon_start=1
                     /product="KLTH0F08536p"
                     /protein_id="XP_002554574.1"
                     /db_xref="GeneID:8292780"
                     /db_xref="GOA:C5DKY6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DKY6"
                     /translation="MVQVSEIKDSGAGSGASTRTAAHTHIKGLGLDEFGAAKQVEGGF
                     VGQIEAREACGVIVDLIKVKKMSGKAILLAGGPSTGKTALALAISQELGPKVPFCPLV
                     GSELYSVEVKKTEALMENFRRAIGLRIKETKEVYEGEVTELTPQSAENPLGGYGKTIS
                     HVIIGLKSAKGTKTLRLDPTVYESIERESVSVGDVIYIEANTGAVKRVGRSDAYATEF
                     DLEAEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLMKPKKTEI
                     TEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNRALESSIAPVVVL
                     ASNRGMTTVRGTEDIVSPHGVPPDLIDRLLIVRTLPYNKNEIRTIIERRSSVENLKTD
                     SAALDLLADMGTETSLRYALQLLSPAGILAKTSGRTEINVSDVNEAKTLFLDAKRSIK
                     ILESSDSYL"
     gene            complement(<741154..>743152)
                     /locus_tag="KLTH0F08558g"
                     /db_xref="GeneID:8292781"
     mRNA            complement(join(<741154..743048,743110..>743152))
                     /locus_tag="KLTH0F08558g"
                     /product="KLTH0F08558p"
                     /transcript_id="XM_002554529.1"
                     /db_xref="GeneID:8292781"
     CDS             complement(join(741154..743048,743110..743152))
                     /locus_tag="KLTH0F08558g"
                     /note="similar to uniprot|P22213 Saccharomyces cerevisiae
                     YDR189W SLY1 Hydrophilic protein involved in vesicle
                     trafficking between the ER and Golgi; SM (Sec1/Munc-18)
                     family protein that binds the tSNARE Sed5p and stimulates
                     its assembly into a trans-SNARE membrane- protein complex"
                     /codon_start=1
                     /product="KLTH0F08558p"
                     /protein_id="XP_002554575.1"
                     /db_xref="GeneID:8292781"
                     /db_xref="GOA:C5DKY7"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C5DKY7"
                     /translation="MASSDVMSLRDRQIASIERMLMFNQDTSTTDLTSGLDGQEVIWK
                     ILVLDTKSTAIVSSILRVNDLLKSGVTVHSLIQQKRSPLPDVPVVYFVQPTKENVEAI
                     VQDLNEDKYSDFYINFTSVLSRELLEHLAQQVSLTGKSDKIKQVYDQYTEFVVTEPEL
                     FSLEIPSVFRQLNDPNTGENAINNLCDQVANGLYDAVMTVGSIPIIRAPKGGPAELVA
                     QKLESKLRDYVINTRSNPDLGINSLERFVLIILDRNIDLASMFAHSWIYQSLVFDVFK
                     LARNTITIPTKDSEGHEIAKKMDIDPRDFFWSENAHLPFPDAVENVEAALAAYKAQAE
                     EITRKTGVSELSELDPSSNNDTLNIQEAVSKLPELTSRKAVIDTHMSVLAALLSQLEQ
                     KGLDAFFEIEQGQDSPKTRQRFLETLKDGKSTNLEDKLRTFIILYLTSSTEIPDSFVK
                     EVEKYFEKQEYDISPLRYIYKSKGLMKLSAMSLQNKSLESANSDGKNQTYGTNSSVLL
                     SGLSSKLYGLTEGKIQGGVGSLISGIKNFLPEKKTIPITNVVEAIMDPLNSSQKNLET
                     TDNYLYFDPKVIRGSHSKKPKRQSYNKSTVFVIGGGNYLEYQNLQEWAHSQQSNIKSV
                     IYGSTSISTPTDFLKEISSLG"
     gene            complement(<743360..>744994)
                     /locus_tag="KLTH0F08580g"
                     /db_xref="GeneID:8292782"
     mRNA            complement(<743360..>744994)
                     /locus_tag="KLTH0F08580g"
                     /product="KLTH0F08580p"
                     /transcript_id="XM_002554530.1"
                     /db_xref="GeneID:8292782"
     CDS             complement(743360..744994)
                     /locus_tag="KLTH0F08580g"
                     /note="highly similar to uniprot|P39079 Saccharomyces
                     cerevisiae YDR188W CCT6 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p essential
                     protein that is required for the assembly of actin and
                     tubulins in vivo contains an ATP-binding motif"
                     /codon_start=1
                     /product="KLTH0F08580p"
                     /protein_id="XP_002554576.1"
                     /db_xref="GeneID:8292782"
                     /db_xref="GOA:C5DKY8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012722"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DKY8"
                     /translation="MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLK
                     MLVDSAGNIKLTKDGKVLLTEMQIQSPTAVMIARAAAAQDEITGDGTTTVVCLVGELL
                     KQAHRLVQEGVHPRMITDGFEIARRETMEFLNSYKIDKPAEEDMDREFLLQVARSSLS
                     TKVAPELAEVLTPIVTDAVLSVKNADSRSLDLHMVEIMQMQHLSAKDTSFIRGLVLDH
                     GGRHPDMPTRVENAHILILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDEKVK
                     KIIDLKNEVCGLDSKRGFVIINQKGIDPMSLDILAKHGILALRRAKRRNMERLQLVTG
                     GEAQNSVDDLSPSVLGFSGLVYQETIGEEKFTYVTENRDPKSCTILIKGATYHALAQT
                     KDAVRDGLRAVANVLKDKSVVPGAGAFYLAASNHLRNINGNKLGAKGKKKAGIQAFAE
                     ALLVVPKTLIKNSGYDALDVLATCQDELEEEEGRIVGVDLNVGDSCDPTIEGIWDSYR
                     VIRNAITGSTGIASNLLLCDELLRAGRSTLKEGPPQ"
     gene            complement(<745257..>746375)
                     /locus_tag="KLTH0F08602g"
                     /db_xref="GeneID:8292783"
     mRNA            complement(<745257..>746375)
                     /locus_tag="KLTH0F08602g"
                     /product="KLTH0F08602p"
                     /transcript_id="XM_002554531.1"
                     /db_xref="GeneID:8292783"
     CDS             complement(745257..746375)
                     /locus_tag="KLTH0F08602g"
                     /note="highly similar to uniprot|Q01662 Saccharomyces
                     cerevisiae YLR244C MAP1 Methionine aminopeptidase
                     catalyzes the cotranslational removal of N-terminal
                     methionine from nascent polypeptides function is partially
                     redundant with that of Map2p"
                     /codon_start=1
                     /product="KLTH0F08602p"
                     /protein_id="XP_002554577.1"
                     /db_xref="GeneID:8292783"
                     /db_xref="GOA:C5DKY9"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="UniProtKB/TrEMBL:C5DKY9"
                     /translation="MTSVAVRCSDAQCGKPCNSGLKCPICLKQGIDAQFCNEGCFKNS
                     YKAHKAMHWKDDKPDSFDPFPKFKYTGKLRAAYPLTPRRAVPDEIEKPEWAYDGLPTQ
                     EQRNDTTNKIIIYSKDEIKKIRKVCMMGREVLDIAAAAVRPGVTTDEIDRIVHEETIK
                     RGAYPSPLNYYNFPKSVCTSVNETVCHGIPDQTVLKEGDIVNLDVSLFYQGFHADLNE
                     TYYVGDNISKEALNTVETARECLKSAIKHCKPGSTFQELGDIIEKHAKDNKCSVVRTY
                     CGHGVGKFFHCAPSIPHYAGNRTSGVMKPGMVFTIEPMINEGAWQDISWPDDWTAATK
                     DGKLSAQFEHTLLVTEHGVEILTARNKKSPGGPRQRTK"
     gene            complement(<746527..>746970)
                     /locus_tag="KLTH0F08624g"
                     /db_xref="GeneID:8292784"
     mRNA            complement(<746527..>746970)
                     /locus_tag="KLTH0F08624g"
                     /product="KLTH0F08624p"
                     /transcript_id="XM_002554532.1"
                     /db_xref="GeneID:8292784"
     CDS             complement(746527..746970)
                     /locus_tag="KLTH0F08624g"
                     /note="similar to uniprot|Q06549 Saccharomyces cerevisiae
                     YLR245C CDD1 Cytidine deaminase catalyzes the modification
                     of cytidine to uridine in vitro but native RNA substrates
                     have not been identified localizes to both the nucleus and
                     cytoplasm"
                     /codon_start=1
                     /product="KLTH0F08624p"
                     /protein_id="XP_002554578.1"
                     /db_xref="GeneID:8292784"
                     /db_xref="GOA:C5DKZ0"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR006262"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ0"
                     /translation="MQMNSPLEHLSTEEFEKLKRNALEARQRSYSPYSKFRVGCCIML
                     QSKECILGANVENASYGGAICAERTAAVKAVTSGFRSDWLCMAISGDSLETCISPCGI
                     CRQVIREFASLKMPIVMFNGDGSKHMIKTLQDLLPLSFGPEDLAE"
     gene            <748172..>750319
                     /locus_tag="KLTH0F08646g"
                     /db_xref="GeneID:8292785"
     mRNA            <748172..>750319
                     /locus_tag="KLTH0F08646g"
                     /product="KLTH0F08646p"
                     /transcript_id="XM_002554533.1"
                     /db_xref="GeneID:8292785"
     CDS             748172..750319
                     /locus_tag="KLTH0F08646g"
                     /note="some similarities with uniprot|Q04007 Saccharomyces
                     cerevisiae YDR186C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F08646p"
                     /protein_id="XP_002554579.1"
                     /db_xref="GeneID:8292785"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ1"
                     /translation="MKEPTSGRSPASQVLTAKALDSTPQPPKDGPKVKVKRLDSLFLI
                     SYSDASARSPATLLAVHDFRVSLYIDIPTIDYYNDQLRHNVISRINKKFKVHKLKEQI
                     FASITNFDERTWDLILNNGYPQSPVQFNFSVSSSGSLRYVETIKFLVESCWDKIKSSS
                     DRVHAVFKLQVSPTSLIWFKTFLNKDLFACAAVQFEVIGNYNMISSSTTPFKEYYAKL
                     NDKFTKKTSSTDFDSIIVVTNSTGVKALLTILSDKPLTSYLSKDSLEALHSNALLKQP
                     SKPIAAENADSDDETPLKRDSSSLLSFQNSLITSNKDKSVKVRTPFIGRVPYNRRADA
                     KNTFQFATDNPSTDEDSETQPLETLEPFDDSDLDEEEDDEGDDDEDEDGLSFSVPSRL
                     SRCGSETDCASQTPQEGSTSRRFRSLSLMDPALQAPFAQRSEPSGSRVPSSIENFGDE
                     TCAPTAKLLNQGPTNIYVHDGQFGEGPAPGPIRRPRRMPRTKSANNVSIGLIPPEFFS
                     RISSPSSSNSSSNTSLTNLNILPGTFSKLLEPSGDGGDEESQSLFKRSLIDKSFKEVK
                     KQPSFHFGSNPLAAHDLNRFALNFRPSKTIPISAKVLDDEDRLMSGQSNFNEQTSDEE
                     ARSNADSTSTLVRPGSLKSNSSANSPGLQNLKLQIYGDNENPSGNENGAQEKGPEPAK
                     PKPAYKKPKFTLDLYNDDEVQSSGGWLLGGNAK"
     gene            <750644..>751720
                     /locus_tag="KLTH0F08668g"
                     /db_xref="GeneID:8292786"
     mRNA            <750644..>751720
                     /locus_tag="KLTH0F08668g"
                     /product="KLTH0F08668p"
                     /transcript_id="XM_002554534.1"
                     /db_xref="GeneID:8292786"
     CDS             750644..751720
                     /locus_tag="KLTH0F08668g"
                     /note="similar to uniprot|Q6B217 Saccharomyces cerevisiae
                     YLR246W ERF2 Subunit of a palmitoyltransferase composed of
                     Erf2p and Shr5p that adds a palmitoyl lipid moiety to
                     Ras2p through a thioester linkage mutants partially
                     mislocalize Ras2p to the vacuole"
                     /codon_start=1
                     /product="KLTH0F08668p"
                     /protein_id="XP_002554580.1"
                     /db_xref="GeneID:8292786"
                     /db_xref="GOA:C5DKZ2"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ2"
                     /translation="MSERNLQEGHHRSPTNGECKVPTQEPNAQPSWWRDCLYWLVTFE
                     ARETRKSNYSSMPKVVNYNFFLGGRLRAVSGTEPLSLFVLIALLAPMVLYSIFEAQAL
                     WRLGRGHGALVILFYYFWAICLVSFIKTATSDPGVLPRNVHVPIVGEEFQLPRSYYNI
                     ITLPSAHPEGKTVDVKYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNY
                     RYFLTFLASCCLATTLCIVGCGIRVAQATRPDRVVVAILLIIYCALGLCYPLLLLVYH
                     MFLTSTQQTTREYLKHVPSKTAIRQALSSPNANPFEKGNRIKNMISLICQRRGVSVMS
                     ARESHSAGDWRFVSLPQPHSFEKV"
     gene            <751956..>752651
                     /locus_tag="KLTH0F08690g"
                     /db_xref="GeneID:8292787"
     mRNA            <751956..>752651
                     /locus_tag="KLTH0F08690g"
                     /product="KLTH0F08690p"
                     /transcript_id="XM_002554535.1"
                     /db_xref="GeneID:8292787"
     CDS             751956..752651
                     /locus_tag="KLTH0F08690g"
                     /note="similar to uniprot|P35200 Saccharomyces cerevisiae
                     YLR168C possibly involved in intramitochondrial sorting"
                     /codon_start=1
                     /product="KLTH0F08690p"
                     /protein_id="XP_002554581.1"
                     /db_xref="GeneID:8292787"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ3"
                     /translation="MKLFQNTQEFSYPWEQVTAANWRKYPNEVSTHVVAVDVLRRELD
                     STGTRLTSERLITCQQSVPKWLAMLVGSSNKSYVREVSVVDLNAKTLTLRSCNLTCAH
                     LLKVYETVKYQPHALDASRTVFQQEAQITAYATIQTLCNKIEEWSVKRFGENASKGRK
                     GFDSVLRMLSDNWEQRDKLVDELSDSIADRVAGTVGEIRATTDSLIKETEMKSTSLVS
                     RYSKETQRAFNKT"
     gene            <753723..>754628
                     /locus_tag="KLTH0F08712g"
                     /db_xref="GeneID:8292788"
     mRNA            <753723..>754628
                     /locus_tag="KLTH0F08712g"
                     /product="KLTH0F08712p"
                     /transcript_id="XM_002554536.1"
                     /db_xref="GeneID:8292788"
     CDS             753723..754628
                     /locus_tag="KLTH0F08712g"
                     /note="weakly similar to uniprot|Q6Q540 Saccharomyces
                     cerevisiae YDR184C ATC1 Nuclear protein possibly involved
                     in regulation of cation stress responses and/or in the
                     establishment of bipolar budding pattern"
                     /codon_start=1
                     /product="KLTH0F08712p"
                     /protein_id="XP_002554582.1"
                     /db_xref="GeneID:8292788"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ4"
                     /translation="MAPEDKGSQVKARIDHGDVEQLVKLEPNLNDHELELTLHTLLTQ
                     ANENPDADDPLHHALEKVISEMELPEMMVGPAAGWGPLEPDQDSVLESPTHLTVENIL
                     AGDALHNYGGRGKKRAYDDQENEDETGRDPLCDAHVREPNTALQNVYETLSPESLSPI
                     SDSGYKQKSAHPAAPAAVARVDGRPTPKPASAVQSTVPNGTEKKHTSAEPPSKLTNEF
                     TMLQVADVKKRIINTHKLMLNFNFLKDGYARTCVELKRTLLRLKQSEVHRAQLLQENE
                     RLKRLVIEQNNKLEGVQATRPASLT"
     gene            complement(<754886..>755338)
                     /locus_tag="KLTH0F08734g"
                     /db_xref="GeneID:8292789"
     mRNA            complement(<754886..>755338)
                     /locus_tag="KLTH0F08734g"
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /transcript_id="XM_002554537.1"
                     /db_xref="GeneID:8292789"
     CDS             complement(754886..755338)
                     /locus_tag="KLTH0F08734g"
                     /note="similar to uniprot|P61864 Saccharomyces cerevisiae
                     YLR167W RPS31 Fusion protein that is cleaved to yield a
                     ribosomal protein of the small (40S) subunit and
                     ubiquitin"
                     /codon_start=1
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /protein_id="XP_002554583.1"
                     /db_xref="GeneID:8292789"
                     /db_xref="GOA:C5DKZ5"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ5"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAV
                     LNYFKVDSEGKVTKLRRECPNCGAGTFLANHKDRHYCGKCHSTFKIKA"
     gene            complement(<756365..>757000)
                     /locus_tag="KLTH0F08756g"
                     /db_xref="GeneID:8292790"
     mRNA            complement(<756365..>757000)
                     /locus_tag="KLTH0F08756g"
                     /product="KLTH0F08756p"
                     /transcript_id="XM_002554538.1"
                     /db_xref="GeneID:8292790"
     CDS             complement(756365..757000)
                     /locus_tag="KLTH0F08756g"
                     /note="similar to uniprot|Q04004 Saccharomyces cerevisiae
                     YDR183W"
                     /codon_start=1
                     /product="KLTH0F08756p"
                     /protein_id="XP_002554584.1"
                     /db_xref="GeneID:8292790"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ6"
                     /translation="MPLDQLEAYEKSIVDKANGRTSEVDDDGASLDEILGELEDDTDF
                     MEKYREQRLQQIADDMRKMKHNVESEQYGQVFTMTDESELMRLTSATDQVVIHFYLDS
                     FQKCATMDAKLKKLAEKHIMTRFFRISVEKCPFLVTKLQIKVLPCVVAYKNGLERDKI
                     VGFTRLGNQTDDFEAGTLETILFNCGVLARKIQPRGIRTGRTDESDSDLDL"
     gene            <757129..>759579
                     /locus_tag="KLTH0F08778g"
                     /db_xref="GeneID:8292791"
     mRNA            <757129..>759579
                     /locus_tag="KLTH0F08778g"
                     /product="KLTH0F08778p"
                     /transcript_id="XM_002554539.1"
                     /db_xref="GeneID:8292791"
     CDS             757129..759579
                     /locus_tag="KLTH0F08778g"
                     /note="similar to uniprot|Q06245 Saccharomyces cerevisiae
                     YLR166C SEC10 Essential 100kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which has the essential function of mediating
                     polarized targeting of secretory vesicles to active sites
                     of exocytosis"
                     /codon_start=1
                     /product="KLTH0F08778p"
                     /protein_id="XP_002554585.1"
                     /db_xref="GeneID:8292791"
                     /db_xref="GOA:C5DKZ7"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ7"
                     /translation="MNSLYELDPKFRELLTLDNFLGGLTVHEFVHKISNENSLKDRAA
                     HAGSWENVDPKPYIRTFESTVKELKRLSADADSRKGQLEQEVAKYELLHSQQVLQLSG
                     NLRSIVKDTGDLDSKLTDVTQVVSPLGEKLEKAIKRKNMYIKSVELISHYSSFYSQGS
                     SENLEKLRVSENWNPRARAAILVKNLLALARKVETKSLPKTLTTTAAIEKYSENMENE
                     LLAEFNSAYRESNFDQLNEIAIILNHYNNGLNVIQSFINQHEYFVDTGEEEPLFDESF
                     KSKITDMNYHGICYDKSMVTTLDEIESLIKNESKIVKKVFENRSAFVLQLFIQRIFAQ
                     KIEPRVGDLLNASLSLSNLAFVRMLYALHSLIGQFVKDLTEFFQFLSLDTEGDLVPTL
                     ERCFSDLFAKIIYDRSKYFDLEKRSLETALSLKTSTFSIAHDKEIFARALSNKLVNGA
                     TFSQDIDLQDYNASSNSKLSQINNFLKSHLERDKRPTYSDAPFQNLTEGGNANDSMRG
                     ATATDFSLQSIDSMLKCAIESIARVMELVPSKANEYTFEIVETVLMGTIGSYVEAGLE
                     VAYTEMAEQDISKCADVNLSYLEYVSKASEMLSLISASVKTVVLPLFVNAPDVKKGII
                     SLANHYIKKCELLINIMIEETIHGYTQRFAFSLSKQKKKDFLPKGQDILDQDTLPASE
                     IVKDLHSLYSQISLYLKNENLKSFLRQVGNTLYRFLLEHYKKFQVSSVGGIIVTKDII
                     GIQTAVEEWSVEEILGDFTTLRELANLFTVQPEELSSLTSEGRLALVDRSTISAYIAK
                     REDFNQESFVSKFKMHLG"
     gene            complement(<759621..>761054)
                     /locus_tag="KLTH0F08800g"
                     /db_xref="GeneID:8292792"
     mRNA            complement(<759621..>761054)
                     /locus_tag="KLTH0F08800g"
                     /product="KLTH0F08800p"
                     /transcript_id="XM_002554540.1"
                     /db_xref="GeneID:8292792"
     CDS             complement(759621..761054)
                     /locus_tag="KLTH0F08800g"
                     /note="similar to uniprot|P40986 Saccharomyces cerevisiae
                     YDR182W CDC1 Putative membrane protein of unknown function
                     involved in Mn2 homeostasis mutants display actin and
                     general growth defects heterogeneous cell cycle arrests
                     and pleiotropic defects in cell cycle progression and
                     organelle distribution"
                     /codon_start=1
                     /product="KLTH0F08800p"
                     /protein_id="XP_002554586.1"
                     /db_xref="GeneID:8292792"
                     /db_xref="GOA:C5DKZ8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ8"
                     /translation="MPYRRRDKESAAPFSSAGGERNKVLRPKEKNGSSIWGKLCWKYL
                     ISFLCLWVCLIQYYERRVIKRAVNRCQWSKWENWPSGASPHRMALLADPQIMDAHSYP
                     SRPWIVNYFTQQLLDNYHARNWKHLHYHLDPDSTFFLGDLFDGGRRWNDSDWFKEYER
                     FNKIFPKKPNRLTVMSLPGNHDIGFGDTVIEDSLTRFKFYFGDPSSAWEVGNHTIVLL
                     DTISLSDTKNENVSAVPRAFLDSFASIPKKHPRIMLTHVPLYRDPISQTCGSKRESQK
                     PFPMMKGVQYQTVIDHELSQEVLQTISPSLVFSGDDHDYCHISHTYLLPIGQQTAEEI
                     TVKSCAMNMGISKPAIQLVSLYNPDDTFASETYHTDICYLPDPYKPIKVYVFTYILTT
                     ILFFWMHFHPSSFNRLVGSTYDRKTEDLANVLPIANKKSDSRSSRQELDELFSTHKKL
                     MFERFALNMALMTLMIFLVFVFYYKQI"
     gene            <761180..>762307
                     /locus_tag="KLTH0F08822g"
                     /db_xref="GeneID:8292793"
     mRNA            <761180..>762307
                     /locus_tag="KLTH0F08822g"
                     /product="KLTH0F08822p"
                     /transcript_id="XM_002554541.1"
                     /db_xref="GeneID:8292793"
     CDS             761180..762307
                     /locus_tag="KLTH0F08822g"
                     /note="weakly similar to uniprot|Q04003 Saccharomyces
                     cerevisiae YDR181c SAS4"
                     /codon_start=1
                     /product="KLTH0F08822p"
                     /protein_id="XP_002554587.1"
                     /db_xref="GeneID:8292793"
                     /db_xref="GOA:C5DKZ9"
                     /db_xref="InterPro:IPR029184"
                     /db_xref="UniProtKB/TrEMBL:C5DKZ9"
                     /translation="MTMNQKPERKLRPKTPVPANQDELFDFDRPEYEISPFRKLNILP
                     RTTIPVTGYQLDEPGDTEDQALARKRLRSKGMAIEVKTHILDKLEPSPNDLSLDPLED
                     DLYLTFHKKMQKQETRMLNQDRLQSEGEAERLGVIYEELGTNNWVKSLTKTTVIKNPD
                     DLHELELKRDLTREIIGQMLEKFKDMKTRAMLLPRSGKHSRPLGVSRRIDAYKPPENA
                     FCINASSDEEEEFLTLPELKKHRLEARRKRYGGPVVVQFRKSQTTNYKYAIVAEPLQS
                     AYIVKCSKEEKEIWSREAGSLPAKIEHYAPFPKQCYSAKSATRSTSQGPKDQVILKAE
                     ASSPVKKTPSKRRSSQPSPKKTRKRTKTHVRGHLDKTLSEH"
     gene            complement(<762345..>766739)
                     /locus_tag="KLTH0F08844g"
                     /db_xref="GeneID:8292794"
     mRNA            complement(<762345..>766739)
                     /locus_tag="KLTH0F08844g"
                     /product="KLTH0F08844p"
                     /transcript_id="XM_002554542.1"
                     /db_xref="GeneID:8292794"
     CDS             complement(762345..766739)
                     /locus_tag="KLTH0F08844g"
                     /note="similar to uniprot|Q04002 Saccharomyces cerevisiae
                     YDR180W SCC2 Sister chromatid cohesion protein"
                     /codon_start=1
                     /product="KLTH0F08844p"
                     /protein_id="XP_002554588.1"
                     /db_xref="GeneID:8292794"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024986"
                     /db_xref="InterPro:IPR026003"
                     /db_xref="UniProtKB/TrEMBL:C5DL00"
                     /translation="MASFPGDGTNIPKRLVECLEFQPLNHLIPKDGLVKLLRSSLELY
                     PALSEDAFSETLQDHSKAEKKVFTPLGKNGKLNIRFRELNSVQPSPTGPVLNLFDGLS
                     EKAKQFLNTECLSSLKRLHSDDEMSDVDEETSSLKRSETTGSEYGDVELRLTPKKLKT
                     GFEEFSLNQSALGLQHINDLKDLMAYIGREDSEADTANQLFWTKLGPNYVLSETSAER
                     IFIILKNVSSMSDVSKILDVKTLGRILNVCSDSVDVILREGDARSFNRIAFKCSFSIF
                     MIFLLDVSEKRLYLERYIISAISFLSRINDKLAESETSLKASNEDCIQLKTLLSLLSS
                     YIQKKPMQEEGLITRIVYLLADLLTFSPTTLAGTSGSATWLESLKVESSEGLISIFQS
                     LPSQQLFIIDELLFRLEFLPNNRVLKKLKRVDHSFYATHLFFTLVSMLQTINSAKLRS
                     QASQWDEESVENFLSLFKEQQELLSTLVEHINNSVLNKCFSGNASKKFILDNYVQDLV
                     SMVARPNWSVAELLLASLTKKLLFAFSPSQQTSSTKESSILQAISHIGSGIQNIRLQS
                     PSDELTIFRIHNNPELLDRAMDAFRNCVISMVPNGNWTAQTQSFWDRQIAFLVALGDF
                     DSSDSDWKERTTMEVTSLLQKPLILQADNNFDNEVKPHENAQLSYFATLHLFELINLF
                     NPYVKLILSLLDKQKVKLRSGAIKCLTPLISKDPSLLADDSIKLVIEQRLKDSSPSVK
                     TAILDLLSLSQYTEFYHLININFNDDSASIRKHILKLNIEIYDNCENLSTKSYVAARI
                     LKRTEDEEDSIVERAQSALLERWFLILSGLETSPEEQNSKAKEITHVISAIVGLEESF
                     AELFSVFLNDFVLNKAFHEPNVLTNIMESAHVITGKVVDDAINVHYAAESDDNLETHK
                     DAELNTFRLLSIISSSDHAFVTKDHIATLYPYLLTPQRSNLQYYILKVLKNSFPKLFY
                     FKTKFLVDLETTVLGKLPRMTPLELEEALPLCWSIVKHRGDESRVSKACSSCLAQLSP
                     YINLASKNPSAVTADGKIQKLLYLAAGFARSCPFENTKENFPNLKTREPIFEYVTKCL
                     LVFTKIEIPFVIRKTALRCLLKVAASFPKLFNSRHVLTVIDREFSSGLLDLNLVMIRC
                     LHEFFELEEHKSFKLARPTVRTPSRINRSRSLGFEKPNDTICSAISSRYLKRILKIAF
                     LEDARGSCIALDFIFLTLSLGYANPSYSTATIIALTVSPYAETKKLAMTALESITMKT
                     SSMLFSNLSSGVKMGLEHSKWLQENGLPCNSMFLRGMQELITSCSPANTRFLKSVTKT
                     LVSYLNEDPRSFPKDQILLLCNNFSTLTYENMLEVCTLIRLFDVKIEELGESIEDEVQ
                     DSLDEVDNEDVSNLIISHACLFELRAFLCEKYGVSDEAVATVDTAEEDELKSQPAEPK
                     KNKLVFGFSPSEFECKKWYNHYISVDNN"
     gene            <766998..>767702
                     /locus_tag="KLTH0F08866g"
                     /db_xref="GeneID:8292795"
     mRNA            <766998..>767702
                     /locus_tag="KLTH0F08866g"
                     /product="KLTH0F08866p"
                     /transcript_id="XM_002554543.1"
                     /db_xref="GeneID:8292795"
     CDS             766998..767702
                     /locus_tag="KLTH0F08866g"
                     /note="similar to uniprot|Q06244 Saccharomyces cerevisiae
                     YLR165C PUS5"
                     /codon_start=1
                     /product="KLTH0F08866p"
                     /protein_id="XP_002554589.1"
                     /db_xref="GeneID:8292795"
                     /db_xref="GOA:C5DL01"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DL01"
                     /translation="MSRKLSINLVYEAKNYVIANKPPGVFCQPPDRNVWYNAQYKEPP
                     ILLELLKSQASTRAAEWRPVHRLDTNVTGGVLVAKNKNAAAMFSRHLKKGGNHGYKLT
                     RRYVALVEGNTAELPDTGVISENGRLSKFKKAGLHVLVLQLCTGKKHQIRQQLSQCLK
                     LPILNDLKYGGRQITGAGRQIALHSALIQAQVGVQEQIHLVPVMEKWRNLWSTYVDEE
                     GHFCPQIRRVLTENWG"
     gene            complement(<767699..>768955)
                     /locus_tag="KLTH0F08888g"
                     /db_xref="GeneID:8292796"
     mRNA            complement(<767699..>768955)
                     /locus_tag="KLTH0F08888g"
                     /product="KLTH0F08888p"
                     /transcript_id="XM_002554544.1"
                     /db_xref="GeneID:8292796"
     CDS             complement(767699..768955)
                     /locus_tag="KLTH0F08888g"
                     /note="weakly similar to uniprot|Q03984 Saccharomyces
                     cerevisiae YDR179W-A Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F08888p"
                     /protein_id="XP_002554590.1"
                     /db_xref="GeneID:8292796"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="UniProtKB/TrEMBL:C5DL02"
                     /translation="MPAILYNANSSLVSRFHRKVKSRGDQSLNEPGKTRFLSAFEKDT
                     LEYLRELCCSVYPKQIHVQLEACDGAKLAAHAFFALVFKNFVCSWFGPKIPSTDPEFL
                     CELYFIIDRLLSHFEEHTIEWELLLLDDIPLLLTQHLRAVRRAERDNWCDEARAKALL
                     DPDYDRDRVSNYICSLLESESQLQKTFMRSLFEDLLCDRILHSIADPSLVLELVNKVA
                     RSLARPASALPKAPNEKNSQSWRQRLASFRASASSESNQQPPTNSKPFLHRYVFTFVK
                     CFTAFERRKPLLYAFCKYCQALTARRSLVNRTLRNLFYNFVRTKLVSVSRVSDLFLTL
                     RHAVFPNDTTMGPPRVPLDDEQKNWLRLEGEENILKFLERLKFTSIFGLEREDVRSFV
                     MAISLDQEMNALLLERLMACFIAHAS"
     gene            <769071..>769583
                     /locus_tag="KLTH0F08910g"
                     /db_xref="GeneID:8292797"
     mRNA            <769071..>769583
                     /locus_tag="KLTH0F08910g"
                     /product="KLTH0F08910p"
                     /transcript_id="XM_002554545.1"
                     /db_xref="GeneID:8292797"
     CDS             769071..769583
                     /locus_tag="KLTH0F08910g"
                     /note="similar to uniprot|Q03981 Saccharomyces cerevisiae
                     YDR179C CSN9 Subunit of the Cop9 signalosome which is
                     required for deneddylation or removal of the
                     ubiquitin-like protein Rub1p from Cdc53p (cullin) involved
                     in adaptation to pheromone signaling"
                     /codon_start=1
                     /product="KLTH0F08910p"
                     /protein_id="XP_002554591.1"
                     /db_xref="GeneID:8292797"
                     /db_xref="GOA:C5DL03"
                     /db_xref="InterPro:IPR016806"
                     /db_xref="UniProtKB/TrEMBL:C5DL03"
                     /translation="MDDELASKDLSAHVVVALEDPSHIHYKDLWLESSTGAEQCVLEL
                     FSFGKVKDAGAELRAMLTTAMWQKLQRLTMLTLSCQERVLSYERIRDECALGACGEAE
                     QLVMSLGSLAEFSIDQVKQLVVVQKCRDCRDVYNGERALIVVGSPVASGQEILHDLQR
                     WQRKLGNDML"
     gene            complement(<769681..>770193)
                     /locus_tag="KLTH0F08932g"
                     /db_xref="GeneID:8292798"
     mRNA            complement(<769681..>770193)
                     /locus_tag="KLTH0F08932g"
                     /product="KLTH0F08932p"
                     /transcript_id="XM_002554546.1"
                     /db_xref="GeneID:8292798"
     CDS             complement(769681..770193)
                     /locus_tag="KLTH0F08932g"
                     /note="similar to uniprot|P37298 Saccharomyces cerevisiae
                     YDR178W SDH4 Membrane anchor subunit of succinate
                     dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which couples the
                     oxidation of succinate to the transfer of electrons to
                     ubiquinone"
                     /codon_start=1
                     /product="KLTH0F08932p"
                     /protein_id="XP_002554592.1"
                     /db_xref="GeneID:8292798"
                     /db_xref="GOA:C5DL04"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:C5DL04"
                     /translation="MFSRGLMARSAAMSAAMRALHSTSKRSLTIPFLPTLPPTPGGVK
                     GDVNDPTYTPPPDKLHGSMHWDFERFTAVALVPLVGSGLACGAGLSVVADSLLCSVLL
                     AHGYVGFQSCIIDYIPKRVYGKNHNYAMYLLTLGSLVGGFGIYKLETEENGITGLVKA
                     LWNAGKEDKE"
     gene            <770605..>771981
                     /locus_tag="KLTH0F08954g"
                     /db_xref="GeneID:8292799"
     mRNA            <770605..>771981
                     /locus_tag="KLTH0F08954g"
                     /product="KLTH0F08954p"
                     /transcript_id="XM_002554547.1"
                     /db_xref="GeneID:8292799"
     CDS             770605..771981
                     /locus_tag="KLTH0F08954g"
                     /note="highly similar to uniprot|P10507 Saccharomyces
                     cerevisiae YLR163C MAS1 Smaller subunit of the
                     mitochondrial processing protease essential processing
                     enzyme that cleaves the N-terminal targeting sequences
                     from mitochondrially imported proteins"
                     /codon_start=1
                     /product="KLTH0F08954p"
                     /protein_id="XP_002554593.1"
                     /db_xref="GeneID:8292799"
                     /db_xref="GOA:C5DL05"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C5DL05"
                     /translation="MLRNLLFGTRFSRPLATAASSTRTSVLRNGLTVATEHIPNTSSA
                     TVGIFVDAGSRAENTRNNGTAHFLEHLAFKGTKNRTQVGIELEIENIGSHLNAYTSRE
                     NTVYYAKTLTQNIPNAVDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYDEVVFD
                     HLHAITYKDQPLGRTILGPIENIKTIQRRDLQDYISKNYKGDRMVLAGAGAVDHEKLV
                     EYADKYFGHIPKSESPVPLGSPRGPLPVFYGNEMNIQEDTLPTTHIALAVEGVSWSAP
                     DYFTALATQAIVGNWDRALGTGTNSPSPLAVSASNNGTLANSYMSFSTSYADSGLWGM
                     YIVIDSKEHNAKLIIDEVLKDWQRIKSGNISDEEVMRAKSQLKASLLLSLDGSTAIVE
                     DIGRQIVTTGKRLSPEEVFEQVDRITKDDIITWANYRLKDKPVSIVALGNTKTVPALK
                     EIEQGLNA"
     gene            complement(<772024..>773994)
                     /locus_tag="KLTH0F08976g"
                     /db_xref="GeneID:8292800"
     mRNA            complement(<772024..>773994)
                     /locus_tag="KLTH0F08976g"
                     /product="KLTH0F08976p"
                     /transcript_id="XM_002554548.1"
                     /db_xref="GeneID:8292800"
     CDS             complement(772024..773994)
                     /locus_tag="KLTH0F08976g"
                     /note="similar to uniprot|P32494 Saccharomyces cerevisiae
                     YDR176W NGG1 Transcriptional regulator involved in glucose
                     repression of Gal4p-regulated genes component of
                     transcriptional adaptor and histone acetyltransferase
                     complexes the ADA complex the SAGA complex and the SLIK
                     complex"
                     /codon_start=1
                     /product="KLTH0F08976p"
                     /protein_id="XP_002554594.1"
                     /db_xref="GeneID:8292800"
                     /db_xref="InterPro:IPR019340"
                     /db_xref="UniProtKB/TrEMBL:C5DL06"
                     /translation="MSRAARRGKGIKDENLEDELAHEPSRLLTSILKTLDLTFERDIG
                     LLNGKHVRTLPGAPALTNLRGSLEKLETTLERILASDRTTVAKIKEAIEATPVPQKGP
                     ETSQPSPSAEPVAPEAPTSDEEANDAPKRQTTRKRSLKIEDEEEEREDQEVRKHSEKT
                     VPPEKEQEETSHVDKKSKTEIDRIESDPSVKNPKSEFVVSQTLPAAAVTLGLFTNKGL
                     ESTGEEFLKKKYGVSSYPTSDLKEFMPGELPDMDFSRPKPTNQIQYTTFLTSVDSFFR
                     DLNDDDVKFLKNKYIIPPNVSVERAYDPEVTPYVIPKLGPLYTETWAKEDNNQNIANL
                     SPPPLNDPSSILPRKSSGDLSDDVLDTEEVSCGPLVSRLLSAILKDELPADGNSGTKE
                     ENDGESLPDEESKTFTPNPNSSALTPSSEMDDNKNQNTSSTSAIPQQQGWNASSVSLD
                     YPTFEERLKRELKYVGIYMNLPRDEDSTYGEDPDWLAGREDDEISAELRELQSELKQV
                     TKKNMKRKAILIPLVERQLAWQEYASILDDLDKQVDQAYIKRIRVPKNKKKKQQASAS
                     ALNSTSQAAIQAAHQQAASSSLKSLLDKRRRWISKIGPLFDRPEIMKRFPKESVFRDL
                     DQEEEDEDGDVFGNNGNSKDDELTDSLQTKEE"
     gene            <774288..>775193
                     /locus_tag="KLTH0F08998g"
                     /db_xref="GeneID:8292801"
     mRNA            <774288..>775193
                     /locus_tag="KLTH0F08998g"
                     /product="mitochondrial 37S ribosomal protein RSM24"
                     /transcript_id="XM_002554549.1"
                     /db_xref="GeneID:8292801"
     CDS             774288..775193
                     /locus_tag="KLTH0F08998g"
                     /note="similar to uniprot|Q03976 Saccharomyces cerevisiae
                     YDR175C RSM24 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM24"
                     /protein_id="XP_002554595.1"
                     /db_xref="GeneID:8292801"
                     /db_xref="InterPro:IPR017081"
                     /db_xref="InterPro:IPR019349"
                     /db_xref="UniProtKB/TrEMBL:C5DL07"
                     /translation="MRCGIPLMIRSALICRNSVTNSAVKTGSIATELYLEPSKWRALK
                     PEQIFSLYQERVVRLGSEYKPCKEELDALLSTAETTGVSPKTIRNIYYGGEQAAYDAT
                     GANIEDDFKPSPFMFDDLPSQAQALVQQHREQRFYNRLAAYELPKLVQYRQEYKRPSQ
                     KTHPVTYRYTTYIGEEHPNSRKVVVSLKTQQLGLNDKEVHKFRLLARTRYDHTTDIFK
                     MSSDRYPEAAQNARYLSDKLQALIKEAKDTSDDFSDVPLDTRHTTARNLRRKTRGYKF
                     PEEWKRPQDAPKEMVNVAELIQKTL"
     gene            complement(<775420..>776260)
                     /locus_tag="KLTH0F09020g"
                     /db_xref="GeneID:8292802"
     mRNA            complement(join(<775420..776130,776219..>776260))
                     /locus_tag="KLTH0F09020g"
                     /product="KLTH0F09020p"
                     /transcript_id="XM_002554550.1"
                     /db_xref="GeneID:8292802"
     CDS             complement(join(775420..776130,776219..776260))
                     /locus_tag="KLTH0F09020g"
                     /note="similar to uniprot|Q03973 Saccharomyces cerevisiae
                     YDR174W HMO1 Chromatin associated high mobility group
                     (HMG) family member involved in genome maintenance rDNA-
                     binding component of the Pol I transcription system
                     associates with a 5'-3' DNA helicase and Fpr1p a prolyl
                     isomerase"
                     /codon_start=1
                     /product="KLTH0F09020p"
                     /protein_id="XP_002554596.1"
                     /db_xref="GeneID:8292802"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:C5DL08"
                     /translation="MSEPSIKLRTAKDTLVSSLFELSKSANQTASSIIDFYNAVGEDE
                     DEKLEAFTTLTEALQKLTSATNQVQVVSSELTNPLEDDKEVIASIASPVKAPARKRAE
                     RDPNAPKKPLTVFFAYSAYVRQALREERQKAGLPPLSSTEITQEISKKWKEMSDVEKD
                     KWKQAYNVELQNYHLEKLKYLEDKKNGVAPSQDAPSSAPVPIPDYLQTELNEFEPPKE
                     KRPHEDEGNGGSSEKKKKKKKKDKKKDKHSSS"
     gene            complement(<776944..>778524)
                     /locus_tag="KLTH0F09042g"
                     /db_xref="GeneID:8292803"
     mRNA            complement(<776944..>778524)
                     /locus_tag="KLTH0F09042g"
                     /product="KLTH0F09042p"
                     /transcript_id="XM_002554551.1"
                     /db_xref="GeneID:8292803"
     CDS             complement(776944..778524)
                     /locus_tag="KLTH0F09042g"
                     /note="weakly similar to uniprot|Q07904 YLR004C
                     Saccharomyces cerevisiae YLR004C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F09042p"
                     /protein_id="XP_002554597.1"
                     /db_xref="GeneID:8292803"
                     /db_xref="GOA:C5DL09"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DL09"
                     /translation="MSVHEKKDDTKERIQVEAGEMLDIQSSSTHNTGKGQLDIAAEHA
                     VGADLFQELLLEDRETDDREYAPIRRKIDRWLLPVLCVTYMLQFLDKLSLNYASAYSM
                     NADLHLKGNEYSNIAAIFNVGYLVGSIPANWVIQKLPVAKYTGCALIVWAILLIAHIG
                     AKSYSGMMALRFILGLMEASISPSNMMMCSMFYNKQEQPFRMCTFLSMNGVATMVGAL
                     LAYGLGHSTSTTLKPWKLIFLVIGLINFVWGFVFLYMAPDSPANARFLTHEEKLKVVE
                     RVSKNQMGIKDTKLKPQQALEALRDPNTIILALIGLGCGVVNGGTSNFISSLIKGFGF
                     SGLNATLLQLPTGAIELVCVFAAGVLALFTKKNIRVILLFVLCIPTLAGLIGIHLIPL
                     SHKWALVGCCWLLYIIGGPVIMCWVLLNVTVAGSSKISTSKIMWFLMYTAGNIIGAKI
                     FYAKEAPKYITGMKGLIASYGGMMFLCIVYYALMWRRNRTRNQKYGELTPEGEKVGII
                     NGFKDHTDFENKFFRYHF"
     gene            <779431..>780516
                     /locus_tag="KLTH0F09064g"
                     /db_xref="GeneID:8292804"
     mRNA            <779431..>780516
                     /locus_tag="KLTH0F09064g"
                     /product="KLTH0F09064p"
                     /transcript_id="XM_002554552.1"
                     /db_xref="GeneID:8292804"
     CDS             779431..780516
                     /locus_tag="KLTH0F09064g"
                     /note="similar to uniprot|Q12436 Saccharomyces cerevisiae
                     YLR130C ZRT2 Low-affinity zinc transporter of the plasma
                     membrane transcription is induced under low- zinc
                     conditions by the Zap1p transcription factor"
                     /codon_start=1
                     /product="KLTH0F09064p"
                     /protein_id="XP_002554598.1"
                     /db_xref="GeneID:8292804"
                     /db_xref="GOA:C5DL10"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:C5DL10"
                     /translation="MLAAEAYAGLAKREQCSTSNEFDGREGLRVGALFVIMASSALGA
                     FFPIMASNYSAVSLPDWCFFVAKFFGSGVIIATGFVHLLQPANEALTDPCLTGTFQDY
                     PWAFGICLMSLYAIFLVEIVTHHMLSRVAPAYSATEARAHSGSDATCMDDELRLSELQ
                     DLRSKPQEMSKPGSDGDAVYQEAHRVLSASSSTVTEGFLSQVVTVFILEFGVIFHSVF
                     IGLSLAVSGSEFITLFIVLIFHQMFEGLGLGTRIAEISWPANKRYTPWILALGFSIST
                     PIAIAIGLGVRHSLSTNSRSGLIANGCFDAISSGILIYTGLVELMAHEFIFSSQFKGP
                     GGLKKMLFAFTMMCAGSGLMALLGRWA"
     gene            <781067..>782071
                     /locus_tag="KLTH0F09086g"
                     /db_xref="GeneID:8292805"
     mRNA            <781067..>782071
                     /locus_tag="KLTH0F09086g"
                     /product="KLTH0F09086p"
                     /transcript_id="XM_002554553.1"
                     /db_xref="GeneID:8292805"
     CDS             781067..782071
                     /locus_tag="KLTH0F09086g"
                     /note="similar to uniprot|P07250 Saccharomyces cerevisiae
                     YDR173C ARG82 Protein involved in regulation of
                     arginine-responsive and Mcm1p-dependent genes has a
                     dual-specificity inositol polyphosphate kinase activity
                     required for regulation of phosphate- and nitrogen-
                     responsive genes"
                     /codon_start=1
                     /product="KLTH0F09086p"
                     /protein_id="XP_002554599.1"
                     /db_xref="GeneID:8292805"
                     /db_xref="GOA:C5DL11"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:C5DL11"
                     /translation="MSGSYRKAKHQAAGHDGNFTDEGESLFFKPTTAQEVEFYQDIQR
                     RYTDSTSEDLKLDAWMPVFLGTLELGVTGRARESDDSEVQSAITAHANLTQVEPELVP
                     PNKPIIVLENLLRGYRTPNILDVKLGKTLHDEFASEDKKLRLRKVSQETTSGSLGLRI
                     CGMKIQESAAASTLDDCTYARESDGYISINKFYGRELNVNNVKDGFKLFFDSNSLSCD
                     RRKALTETFLQRIQLLYNTLLEEEVRMISASLLLVYEADSDRWDELQDEDTLLRTDFF
                     QDFSDDEEEEEPTAPLSSLSLIDFAHSKVTKGQGYDENVICGVESLIDIFDEMRLPSN
                     "
     gene            complement(<782647..>784806)
                     /locus_tag="KLTH0F09108g"
                     /db_xref="GeneID:8292806"
     mRNA            complement(<782647..>784806)
                     /locus_tag="KLTH0F09108g"
                     /product="KLTH0F09108p"
                     /transcript_id="XM_002554554.1"
                     /db_xref="GeneID:8292806"
     CDS             complement(782647..784806)
                     /locus_tag="KLTH0F09108g"
                     /note="some similarities with uniprot|P05453 Saccharomyces
                     cerevisiae YDR172W SUP35 Translation termination factor
                     eRF3 altered protein conformation creates the [PSI()]
                     prion a dominant cytoplasmically inherited protein
                     aggregate that alters translational fidelity and creates a
                     nonsense suppressor phenotype"
                     /codon_start=1
                     /product="KLTH0F09108p"
                     /protein_id="XP_002554600.1"
                     /db_xref="GeneID:8292806"
                     /db_xref="GOA:C5DL12"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR003285"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DL12"
                     /translation="MSQQGQDQSQDQQQGLYNRYYQNAGQQPGYQQPAGNYQQYYQAY
                     GQQQQQQQAGGYQAYDPNAQAYQGYDQNAQGYQGYQGYNQGYQGYNQGGRGGFKGNRG
                     GYRNNNNAGYGGYQAYNQQQAYQPFEQQAQQSQGMTLQDFQNQKSTGLNTPAASTAAA
                     ASPSAPAPKPKKTLKLASSSGIKLVGATKKPEVVKKEEPKKEEPKKEEQSAEDNTQES
                     TGPAADNAGEEATKDSETALPKVEQLKISEEKPAKKEEETANASTAQASSADAIIKEQ
                     EDEIDEEIVNDMFGGKDHMSIIFMGHVDAGKSTMGGNLLYLTGSVDKRTVEKYEREAK
                     DAGRQGWYLSWVMDTNKEERNDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGG
                     ASQADVGILVISARKGEYETGFEKGGQTREHALLAKTQGVNKMIVVVNKMDDPTVGWD
                     KERYDLCVKNISTFLKAIGYNIKQEVIFMPVSGYTGAGLKERVNPKDCPWYKGPALLE
                     YLDNMTHVDRRINAPFMLPIASKMKDLGTIVEGKIASGHIKKNTSTLLMPNRIPVEIV
                     NIYNETEAEVDMAVCGEQVRLKIKGVEEEDISPGFVLTSPKNPVKNVTKFIAEIVIVE
                     LKSIISAGFSCVMHVHTAIEEVTISKLLHKLEKGTNRRSKKPPAFAKKGMKIIALLET
                     EEPVCVETYQDYPQLGRFTLRDQGTTIAIGKIVKIKD"
     gene            complement(<785577..>786575)
                     /locus_tag="KLTH0F09130g"
                     /db_xref="GeneID:8292807"
     mRNA            complement(<785577..>786575)
                     /locus_tag="KLTH0F09130g"
                     /product="KLTH0F09130p"
                     /transcript_id="XM_002554555.1"
                     /db_xref="GeneID:8292807"
     CDS             complement(785577..786575)
                     /locus_tag="KLTH0F09130g"
                     /note="some similarities with uniprot|Q12329 Saccharomyces
                     cerevisiae YDR171W HSP42 Small cytosolic stress-induced
                     chaperone that forms barrel-shaped oligomers and
                     suppresses the aggregation of non-native proteins oligomer
                     dissociation is not required for function involved in
                     cytoskeleton reorganization after heat shock"
                     /codon_start=1
                     /product="KLTH0F09130p"
                     /protein_id="XP_002554601.1"
                     /db_xref="GeneID:8292807"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:C5DL13"
                     /translation="MSFTQPTVSIYDILEALSSQQDRSNARRRPHHSNYVRPRTRGAY
                     GNPYVQSPYYYAERPQTTYYRPRYYDENEYESPYVVGGRGGYGPQPDVLPAILRAFMA
                     QQSSEHNEPEEAELPDQLEQDQEAAEVPQIAAQPLAQALADEVLEQAEAESAEENGAE
                     VAGEATDAEQKQAPRSGASSPIPEPLQVSKPQVRLDLPFSPEVNVYDTPEAYVVVLAL
                     PGANSKSFKIDYHPSSHELLIKGSLDRKIDVNDKFLRISELKGGKFERSVKFPVVPRI
                     KDEEIKATYANGLLQIKTPKILDESSQHQPRRRIVIEDVPDEELVFEENPNPPTSI"
     gene            787336..787408
                     /locus_tag="KLTH0F09152r"
                     /db_xref="GeneID:8292808"
     tRNA            787336..787408
                     /locus_tag="KLTH0F09152r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:8292808"
     gene            complement(<787684..>789021)
                     /locus_tag="KLTH0F09174g"
                     /db_xref="GeneID:8292809"
     mRNA            complement(<787684..>789021)
                     /locus_tag="KLTH0F09174g"
                     /product="KLTH0F09174p"
                     /transcript_id="XM_002554556.1"
                     /db_xref="GeneID:8292809"
     CDS             complement(787684..789021)
                     /locus_tag="KLTH0F09174g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F09174p"
                     /protein_id="XP_002554602.1"
                     /db_xref="GeneID:8292809"
                     /db_xref="GOA:C5DL14"
                     /db_xref="InterPro:IPR000926"
                     /db_xref="InterPro:IPR022163"
                     /db_xref="UniProtKB/TrEMBL:C5DL14"
                     /translation="MSPVALSTHQCQDAHVPAKTGKAEPVSRSSPVDGVVLTTYPEDS
                     NPIPLKWGAASPEARGPIVASRLRDGLAKHNSIGAHSGSYCVYHALAVGSKQLDPNHV
                     ADYTNSQPAFSMPEQKTWYNPRDIVAMDPFGHLTPYLFDEAGRTENVEIRPTIAITKA
                     TMQLFEMKDAVINGRLQVDGKVVLNSNGDLSVSKVAVEPTWYLPGVAERFGISEEELR
                     KALFEDTNGMYPELITRPDIKVFLPPIGGLTVYIFGDPSYVSDPSKKLALRVHDECNG
                     SDVFGSDICTCRPYLIFGIEEAVKQAQNGGSGVVVYFRKEGRALGEVTKYLVYNARKR
                     GGDTADEYFHRTECIAGVRDMRFQQLMPDVLKWLGISKIDRMLSMSNMKHDAIVEQGI
                     PIIERIPIPDELVPPDSRVEIDAKINSGYFTTGKIMNQDELKTVQGRAWSDVQ"
     gene            <790623..>796013
                     /locus_tag="KLTH0F09196g"
                     /db_xref="GeneID:8292810"
     mRNA            <790623..>796013
                     /locus_tag="KLTH0F09196g"
                     /product="KLTH0F09196p"
                     /transcript_id="XM_002554557.1"
                     /db_xref="GeneID:8292810"
     CDS             790623..796013
                     /locus_tag="KLTH0F09196g"
                     /note="similar to uniprot|P11075 Saccharomyces cerevisiae
                     YDR170C SEC7 Guanine nucleotide exchange factor (GEF) for
                     ADP ribosylation factors involved in proliferation of the
                     Golgi intra-Golgi transport and ER-to- Golgi transport
                     found in the cytoplasm and on Golgi- associated coated
                     vesicles"
                     /codon_start=1
                     /product="KLTH0F09196p"
                     /protein_id="XP_002554603.1"
                     /db_xref="GeneID:8292810"
                     /db_xref="GOA:C5DL15"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR015403"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:C5DL15"
                     /translation="MTQNEAHSASSETPSAPAGEDNASIASVSVQQGVSPTSDSYARS
                     ANGGHSRQTSTASVGQHNLRSTVVLVKTTFESILQQKEIKKFSDTQKSLERSVKKLDE
                     TIASTNNDPKFLDSILIFEPLRLCCRTKATNIVIKALDCLSKLFSFQALDHSIMVNPP
                     NSMASNDQSNAPAAGITPPPKQRLIDAAIDTITDCFEGESTDSRIELQMLRALASCIL
                     TDNAISMCHGQSLLKAIRQIYNIFIYSLSSTNQGIAQATLTQVVNSVYDKLNDGLSTA
                     PVPNRSTSKVSLKGLPSEGSETQSPDSSKPLTLQNLENLNDEQERIVDEQQEEIEDEK
                     ALLVKDAFLVFRAMAKISAKPLENDTDMRSHAVRSKLLSLHIIHSIIKDHIDVFLSQE
                     LILPGKENSSLVDAVRQYLCLLLSRNAASPISPVFEITLEIMWLLISNLRSEFKREIP
                     VFLTEIYFPISELKTSTAHQKRYFLSVMQRVCNDPRTLIEFYLNYDCDAHLPNVVEII
                     VDYLTRMALTRVEITPSQRAYYDEQRTKPLATYNLAQLPLLSISNLSSSNTTENANFP
                     VEFALKMTSLSCMVAVLRSLSSWAHKALNPKDLNSTGSRLRATSVSTFGGRRPLSARS
                     STVEVNGEGVTANLDLERGEQQQNETFEEGDDPMQFENLKLRKNELQDCINIFNYKPK
                     KGIKELVEKKFIPDDSPASIAKWLLETDGLDLAAVGDFLGEGDDRNIAIMHAFVDEFN
                     FSKMSLVEALRIFLQKFRLPGEGQKIDRFMLKFAERYVDQNVGQFAKADTAYVLSYSI
                     ILLNTDLHSSQIKNKMTLQEFIENNAGIDNGNDLPEEYLVQVFNEIAEDEIKLQSEQH
                     QAMLTGDVNPVQQQQSAFNFFSSRDLNREAYMQVSKEISSKTELVFKNLTKHRGKENN
                     TYYAASHIEHVKSVFDTLWMSFLAALTPPFKEYDDSVTTDMCLEGIRISIKISATFGN
                     DYARTSFVGALVQFANLQNVQEIKAKNINATIVLLELALTEGNFLKESWKDVLLVVSQ
                     VERLQLISKGVDGQTLPDVSQARLANSRSSFDSTRSASMGFFERWTKKSTPIELAQEK
                     HHNQILTPEISKYISSSHLVVLIDRIFTNSSNLTGAAIVEFIKALTEVSFEEIESSQN
                     AASPRMFSIQKMVDVCYYNMDRIRLEWTPIWAVMGEAFNRIGTNPNLAVVFFAIDSLR
                     QLSMRFLDIEELSGFEFQHDFLKPFEYITYNTTDTEVQEMCVECFKNFILTKSSKIKS
                     GWKPILESLQYAAKSPKETIVVKTYQLVADDIVRNNFESVFSQDNSFNDLVAILKEIT
                     KNQKFQKLALHALEVLKKITQKVADVCFKKDAAALLHGKDLFHDVWFPVLFCFNDTIM
                     TAEDLEVRSRALNYMFDALVAYGGEFDDSFWTSICTKLLFPIFGVLSKHWEVNQFNSH
                     DDLSVWLSTTLIQALRNMVALFTHYFSCLNKMLDGFLGLLVSCICQENDTIARIGRSC
                     LQHLILQNISKFDDTHWSQITAAFSRLFELTTAHELFDMDPLHQGRRQSESAAKSENA
                     ATVEEEVERAHQEEEGEDVGNVDTEAEKPSKRLVKTKSSEDLRRRLSAKNAIVVKCVL
                     QLLMIESLSELFEDDGFSNHIPYKESIKLTNLLQNTYEFARDFNDDFELRTRLLNARL
                     VDKIPNLTKQETSASAVLINIMFKLFLNSEKESKDEKKKLSERLISISVRVVQKYVSL
                     DDRSTERDINAWRPVVVEILQGYYEFDDSDFKENCPVMYELAMQILDKSVPTDLRLAI
                     KDFLTRVGELYL"
     gene            <796555..>797685
                     /locus_tag="KLTH0F09218g"
                     /db_xref="GeneID:8292811"
     mRNA            <796555..>797685
                     /locus_tag="KLTH0F09218g"
                     /product="KLTH0F09218p"
                     /transcript_id="XM_002554558.1"
                     /db_xref="GeneID:8292811"
     CDS             796555..797685
                     /locus_tag="KLTH0F09218g"
                     /note="highly similar to uniprot|P28777 Saccharomyces
                     cerevisiae YGL148W ARO2 Bifunctional chorismate synthase
                     and flavin reductase catalyzes the conversion of
                     5-enolpyruvylshikimate 3-phosphate (EPSP) to form
                     chorismate which is a precursor to aromatic amino acids"
                     /codon_start=1
                     /product="KLTH0F09218p"
                     /protein_id="XP_002554604.1"
                     /db_xref="GeneID:8292811"
                     /db_xref="GOA:C5DL16"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="UniProtKB/TrEMBL:C5DL16"
                     /translation="MSSFGRFFTVTTYGESHCKSVGCIVDGVPPGMSLTEDDIQPQMS
                     RRRPGQSKLSTPRNEKDRVMIQSGTEFGKTLGTPIGMIVMNEDQRPHDYNEMDLYPRP
                     SHADFTYLEKYGIKASSGGGRSSARETIGRVAAGAIAEKFLKQLSNVEIVAFVTQIGA
                     IKMNRDPLDKNFQHLLNTITREKVDSMGPVRCPDSSVAEDMVHEIEKYRGNKDSIGGV
                     VTCVIRNLPVGIGEPCFDKLEAMLAHAMLSIPASKGFEIGSGFEGVAIPGSKHNDPFY
                     FDEETKTLRTKTNNSGGIQGGISNGENIYFSVPFKSAATISQEQPTAAYNGKDGVLAA
                     KGRHDPSVTPRAVPIVEAMAALVLADAVLIQKSREFAKGIVN"
     gene            <799558..>802224
                     /locus_tag="KLTH0F09240g"
                     /db_xref="GeneID:8292812"
     mRNA            <799558..>802224
                     /locus_tag="KLTH0F09240g"
                     /product="KLTH0F09240p"
                     /transcript_id="XM_002554559.1"
                     /db_xref="GeneID:8292812"
     CDS             799558..802224
                     /locus_tag="KLTH0F09240g"
                     /note="similar to uniprot|Q07533 Saccharomyces cerevisiae
                     YDL117W CYK3 SH3-domain protein located in the mother-bud
                     neck and the cytokinetic actin ring mutant phenotype and
                     genetic interactions suggest a role in cytokinesis"
                     /codon_start=1
                     /product="KLTH0F09240p"
                     /protein_id="XP_002554605.1"
                     /db_xref="GeneID:8292812"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="UniProtKB/TrEMBL:C5DL17"
                     /translation="MPPALPQPPFKVKAHYSWSGETKNDLGFLENDVIQVTKIKGNWF
                     YGTLLRNSKKYGYFPTNFVTIIQEKYNDFKQDGESSEPRTPGAPQEPIGIPPIPQRGP
                     RTNSSNFKGSRDRHRSEAKAAKAALSEQLRSPYEQASRKQSRYQRMPYAHSLERLPQS
                     YSASNVSAKHYSTPDFESVRAKPRNSYSGPSKQEDSAGYHSRRMEGLPPLPPIPQLKE
                     RLKSKSTVPKSFSSNDLPNVLPNADLDTRVSQQRLSMDFYDGCSSPMSPSDESSTVFS
                     QARYLEDSVASSEDSFALMSDFSATSAGSFARHRYAKSFNDSMQRSQLAVEEGPAHSR
                     NSPGSSTKFNGIFRKLRSRTGDTSPTSPTGSYPKLPDLSSLQLNSSNGEAHGWVEAKA
                     HLHRAQTLTSKERHERQMLALEENRDLVLHPHEYILDEINTNEVRHGRQPGLVDIELN
                     CIDKEFIAALAKKKAKKGGSSSVETFARQIINSAFKTQVEKLFAIFIFCTETFALIDD
                     HGQTDFGKQPSHLSKTLHKNYCTPYELTWIFKRMANALGIVCEIVIGFLKTPGADNMD
                     FKYNHCWLRVLTNEEWRMVDVILGNMTNPIHEYINNITPEHAEAFYFLTQPLHLIYTH
                     VPRLYQEQHIIPVIDQNIALSLPVVFPSFIYNELTLFKFSNGLAKMHDNQIYECTLAI
                     PNDVELFCSVVPEDSKNQHYENMDLSLVQIKHRKKDRLAVIKAVLPVGVSRGDLHIHS
                     GIKGTQTTLANIHPLSMIIPLEHSGSAKEYEFVTRIPSKSVQRIDMYIKEPQNKYLFA
                     THEYNFQVIQNPCDGIIYGSAGFSKSIKQPLALQSPSGKLRPMRKSDPNFEFGTWEIT
                     IASKEMEIGIWTGLVTSDAGAGWCPFAEWKCV"
     gene            <802460..>804619
                     /locus_tag="KLTH0F09262g"
                     /db_xref="GeneID:8292813"
     mRNA            <802460..>804619
                     /locus_tag="KLTH0F09262g"
                     /product="KLTH0F09262p"
                     /transcript_id="XM_002554560.1"
                     /db_xref="GeneID:8292813"
     CDS             802460..804619
                     /locus_tag="KLTH0F09262g"
                     /note="similar to uniprot|P52891 Saccharomyces cerevisiae
                     YDL116W NUP84 Subunit of the nuclear pore complex (NPC)
                     forms a subcomplex with Nup85p Nup120p Nup145p-C Sec13p
                     and Seh1p that plays a role in nuclear mRNA export and NPC
                     biogenesis"
                     /codon_start=1
                     /product="KLTH0F09262p"
                     /protein_id="XP_002554606.1"
                     /db_xref="GeneID:8292813"
                     /db_xref="GOA:C5DL18"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:C5DL18"
                     /translation="MEVDTIDSYEALVKFANVLKDFRVGVLNDPGSRDAFDVVKDFRS
                     IAGEGALDIARTDSSERGGVFENWELEAKLWHLIELLVNFRTADLNIDEDIEQLEDDS
                     LGFTKSLLKKDRSLYEIWLIMLWIQSNISVPARPDGIAGSKWSHSFMSGELKSCDLDY
                     PLRESDCKIDNRDKQSDHAFYKYIYELLLAGRYDDARKECELSDNTTLALILCGLDNY
                     VGFSVGEPANDDLQPQENIKGKALWRRAVHSLSLQQELDEYERAIYSYLAGDVFEGID
                     TNWDIDLLLYLNQALQISLENHLLEDKLVDSKEIILPMASDPVPLQSVLDIIARKHVA
                     EGEHPIRVLMGAVILDKIPTVVKSSTAMLLDVVKGKDASNDMVEEPYLLRVVTHLVIL
                     MDFICPGLINEQDKSKLITAYVTILSLYQLYNEIPVYISFLDDSEALEAYSFFLSNLT
                     NAAARKKQLDLCNILKIPTANILRRTTQRVFDDTEGSYNPTAGIIVDNTVDEIDKRVV
                     ASVEWLTEGKLYVDAINAIIVLSRRFLINGKIRSLSYLYETHDIDNVIKNFEMDTISD
                     PNSCKAAVDEIKQYKELIDIHEQFEQWDALLVNSQSESNLPHLLKKFKQLCSNVYRFS
                     KSFLIELSESPGIAGSDVIYEIRALYTPHLIVKLHNSLVTASRELKIESFINEALSLA
                     NLVANETDRIYLLFQSSGRLQEYLQLIAKTATFVKTQ"
     gene            complement(<804826..>805401)
                     /locus_tag="KLTH0F09284g"
                     /db_xref="GeneID:8292814"
     mRNA            complement(<804826..>805401)
                     /locus_tag="KLTH0F09284g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_002554561.1"
                     /db_xref="GeneID:8292814"
     CDS             complement(804826..805401)
                     /locus_tag="KLTH0F09284g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
                     RPL9A Protein component of the large (60S) ribosomal
                     subunit, nearly identical to Rpl9Bp and has similarity to
                     E. coli L6 and rat L9 ribosomal proteins and to YNL067W
                     uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
                     Protein component of the large (60S) ribosomal subunit,
                     nearly identical to Rpl9Ap and has similarity to E. coli
                     L6 and rat L9 ribosomal proteins"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_002554607.1"
                     /db_xref="GeneID:8292814"
                     /db_xref="GOA:C5DL19"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:C5DL19"
                     /translation="MKYIQTDQTLDIPEGVTVNIKSRVIKVTGPRGTLTKNLKHIDVT
                     FAKVSNKQVKITVHNGDRKHVAALRTVKSLVANMVTGVTKGFKYKMRYVYAHFPINVN
                     VVEKDGAKFVEIRNFLGDKQVRMVPVREGVSIDFSNNQKDEIVLSGNSIENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSQKGFIEEEN"
     gene            complement(<805770..>806477)
                     /locus_tag="KLTH0F09306g"
                     /db_xref="GeneID:8292815"
     mRNA            complement(<805770..>806477)
                     /locus_tag="KLTH0F09306g"
                     /product="KLTH0F09306p"
                     /transcript_id="XM_002554562.1"
                     /db_xref="GeneID:8292815"
     CDS             complement(805770..806477)
                     /locus_tag="KLTH0F09306g"
                     /note="similar to uniprot|A2TBP4 Saccharomyces cerevisiae
                     YDL115C IWR1 Protein of unknown function deletion causes
                     hypersensitivity to the K1 killer toxin"
                     /codon_start=1
                     /product="KLTH0F09306p"
                     /protein_id="XP_002554608.1"
                     /db_xref="GeneID:8292815"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:C5DL20"
                     /translation="MLNDYLSLGSNSEVPQRPRKLKRPGGRRSEPEQDPKALPSLDYV
                     YDIYYREVVPEDEFVFDESTVGYIKIVEDSGDLIPEEEDDENSLALSDDEDSNDEAYY
                     RNDYPEDEDDDRSVLFGSDDGVVATASRQYAESDASEGTGAESAPSHVAMLGDEETDL
                     LYQKFAGAPNVLQAADTYFDSTDERDGVSDEELEEDHDIVGFTQHDFFPTDAEDPLAI
                     HRDKIFARLERMIEKRS"
     gene            complement(<807097..>808947)
                     /locus_tag="KLTH0F09328g"
                     /db_xref="GeneID:8292816"
     mRNA            complement(<807097..>808947)
                     /locus_tag="KLTH0F09328g"
                     /product="KLTH0F09328p"
                     /transcript_id="XM_002554563.1"
                     /db_xref="GeneID:8292816"
     CDS             complement(807097..808947)
                     /locus_tag="KLTH0F09328g"
                     /note="similar to uniprot|Q07528 Saccharomyces cerevisiae
                     YDL113C ATG20 Protein required for transport of
                     aminopeptidase I (Lap4p) through the cytoplasm-to-vacuole
                     targeting pathway binds phosphatidylinositol-3-phosphate
                     involved in localization of membranes to the
                     preautophagosome potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0F09328p"
                     /protein_id="XP_002554609.1"
                     /db_xref="GeneID:8292816"
                     /db_xref="GOA:C5DL21"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DL21"
                     /translation="MGDSSESKPDSVGDSSILVDIKRTLENDEDKPSNGADGQELTAK
                     NANLDLSNTTHAGLMRTEILEQDNPFTNKRPEIASDTSSLKENRLLENPNKQYQSRTD
                     VDEDTEPLNTQPRSHSSGSGSMDIKRPEPSTREADTGLGDKVYISEASKASEGQGRTY
                     IAYTIKYKASTVKRRYSDFESLRKILIKLFPMTLIPPIPEKQSITSYGKSMAGSKSSY
                     LLPSEAAGSVDLSLSVINGSVNTNDEKLIRHRIRMLTSFLNRLLKNEEITKTSIITDF
                     LDPNNTNWNDVITSSATISSLPKSVLLCNPLDPTNTTRAHIFLPIPSSSTQLLLNKEI
                     LATTAHDEADDGFGKIEQEYRNYEHVMEAGFYKYNKRITKNFHALRQEMKELSEAFAE
                     FSNDQKRGAELAEQLSHLSNAFDESALELESIVGKLYYNINEPLSEAVHMAGAAQELL
                     RYRRLKSVQKTILIRTLLYRKAQVKKLQERESEARKVDHMVDEQVGQQDHINLKHPQN
                     RTYSGKFMTKINKIASMVKETVSYQDPDPTTAIENLEKEISQLSESLEMSEKDLGIIS
                     TTIKDYELPKFSKERNEEVSDIMKNYTKYLKSFAERNLKLWQDVKQQQGE"
     gene            <809231..>813421
                     /locus_tag="KLTH0F09350g"
                     /db_xref="GeneID:8292817"
     mRNA            <809231..>813421
                     /locus_tag="KLTH0F09350g"
                     /product="KLTH0F09350p"
                     /transcript_id="XM_002554564.1"
                     /db_xref="GeneID:8292817"
     CDS             809231..813421
                     /locus_tag="KLTH0F09350g"
                     /note="similar to uniprot|Q7LGS3 Saccharomyces cerevisiae
                     YDL112W TRM3 2'-O-ribose methyltransferase catalyzes the
                     ribose methylation of the guanosine nucleotide at position
                     18 of tRNAs"
                     /codon_start=1
                     /product="KLTH0F09350p"
                     /protein_id="XP_002554610.1"
                     /db_xref="GeneID:8292817"
                     /db_xref="GOA:C5DL22"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:C5DL22"
                     /translation="MSTNKLIGKYFPIEKQTELLQTLSTNEEFGEMFEVLGTMEFGKE
                     ALEVATQCTTEQVLKGFKGHNETEEWDVSKLRELAKLTSKLPNTFAALQEWIVGILDQ
                     NLQAPNDTNVKMLLEFLEQTHMFSEGQELPKSAKLDKQLVKLMQADDPQLAEISSKIL
                     KWKILDLSQKCMEDEEFDLFVWDELRKVFTCNTDTLKLKNGYLFILRFLMEDKISQRL
                     HDFIVSDLFWESLKRGLEHDVHDLRKFSLSILKLTLQKLSPKDSFTNNWIQWKPELYA
                     ENIAAWKRFTTLYEIVALDTALNQFEAASADILDLFENKLLNPSWVLVIFSTGLKASM
                     ESVRRHTVRLMLRIKDKSVFQTSLNELSTVFLPAAMYAPYFSVIEKKCPYGELVSQFV
                     AELVLHICEMEPKSGPFEMILAILSCLYQQRTSFEPAKIYIILGLYGALRQAKARSIG
                     GSHIELIAKSFESESEDDVFEITLQTTYLKLLMHIEVDISPYTWIDALSRHVKAKGGS
                     YRYIAPLIDDLIDVSVQCFDKNQIQDIFSDYDHEDSTFKTIAYLIFGTVPSAIEPSFL
                     KELSKYGEVQTQFNENFSLLLSELISAKPPNSTYQGSHELSKLPVFGPSAWCTVDLHP
                     LYQSLLNDFDAAKFKFFVCSYQQTVEHTMSTLDLNLDDLLKLYAFLKRHCQENVSKGF
                     KYKDSIYGDFFMFLLSFLKCYALELNTSSKSNELDSILESLSSNVLRDNGNYQGNLAI
                     IKVLHYLLSNYVTPRIQDFECEPQDDEAIVFQVVQILCSIWDSTSDERLVLNQKDLHL
                     SFIECIFHPSVFFFALTYKDLELALAGTLSKYGKSIIQHSYSRRTLLPVLSQQINAFM
                     EVYGKNLEWKQHNNDWLIVLMFEVFTQHQVNVNGFRLKPIIAKAFDEQIERLGGHSMG
                     LYERVYKLPEVSARVFIISALLNANDEFKEKALDYMLNNDENLLKAKKSTDGPEELGR
                     LLKWQLLLLTVKSVDHVTLSKYVEEKVLPSIITEASPLVRAYMEWISAIDLTQTYSEA
                     HPLNNEDALFDMLKDHSRPLISITAERILFIALKGLSAGTFCDRLLQRFIAELILNCT
                     SNKPLIRHFSNSLMLSFWPAFENLLKEGTLRNVLKNLYDNAQKTQVHGQFRLGDAIIW
                     DADTDFTLTNIFGGVILKSTDHDVPYIESATFRRFLTCVDNVPVGQDQKHLWLKKRTR
                     PKQEAEVSLQKDSPLQTKSGAWETVMDIDNQSSAVTVKRSPLIVIASLVDKAPNLGGI
                     CRLCDVLGAGLLTVHDIRIKNHPQFKSVAVTADRWMPMEAVTTQDITKFMRSKKQEGY
                     TLIGLEQTDKSIQLDNKFQFPPKSLILLGTESEGIPGHLLSELDLCLEIKQSGVIRSM
                     NIQTATAVIVHAYSAQHT"
     gene            complement(<813488..>814279)
                     /locus_tag="KLTH0F09372g"
                     /db_xref="GeneID:8292818"
     mRNA            complement(<813488..>814279)
                     /locus_tag="KLTH0F09372g"
                     /product="KLTH0F09372p"
                     /transcript_id="XM_002554565.1"
                     /db_xref="GeneID:8292818"
     CDS             complement(813488..814279)
                     /locus_tag="KLTH0F09372g"
                     /note="similar to uniprot|Q12277 Saccharomyces cerevisiae
                     YDL111C RRP42 Ribosomal RNA Processing Component of the
                     exosome 3->5 exoribonuclease complex with Rrp4p Rrp41p
                     Rrp43p and Dis3p (Rrp44p)."
                     /codon_start=1
                     /product="KLTH0F09372p"
                     /protein_id="XP_002554611.1"
                     /db_xref="GeneID:8292818"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DL23"
                     /translation="MVLSVTEKSYLHESLASVPPARPDGRKADQFRPIEVFTDFLPAS
                     NGSSKVVASDGTECLVSVKCKVVDHAVEEDLVVVDVDIAGHRDDSGFVQGIASTLSKV
                     LSTQLDRSCLRLTKKYSFKLYIDVLVLSSFSHPLTLISFAVYSALNSTQLPKLISSDD
                     DLDVAELPTFHDYDFVKLNVSVPLLFTLAICGKNVLVDPASNESDVANNGILVTWNNG
                     KATAPIRTLGLNEDYVSGVSPQSLQDSIKMIEQVAPEVLQALGGI"
     gene            complement(<814413..>815351)
                     /locus_tag="KLTH0F09394g"
                     /db_xref="GeneID:8292819"
     mRNA            complement(<814413..>815351)
                     /locus_tag="KLTH0F09394g"
                     /product="KLTH0F09394p"
                     /transcript_id="XM_002554566.1"
                     /db_xref="GeneID:8292819"
     CDS             complement(814413..815351)
                     /locus_tag="KLTH0F09394g"
                     /note="weakly similar to uniprot|P53117 Saccharomyces
                     cerevisiae YGL146C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F09394p"
                     /protein_id="XP_002554612.1"
                     /db_xref="GeneID:8292819"
                     /db_xref="GOA:C5DL24"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="UniProtKB/TrEMBL:C5DL24"
                     /translation="MEEPAQAGQVLFKSSFFLALLRLAWQLLLCQLNVSKSSTKVAVL
                     RTTTKHSTTWPHTRMLPAALSLVALLASSFAEPLISPLLLPQLTFVCPPVKASRARPH
                     SLDDTFCFNFDVDSESGSFTFSIDVSDTLCYQVDWGRAGPSSGERGKQTLDVSVTDSR
                     GNLLRARRGLLAGRTVLHLACPDHATSLKFCFANRVFDGSWKSIDFDKTVTVALLNCD
                     SARKETLETELRETRSRLETVSRALFPLVAERQSQELFILERQRRNINEDTFPKILLH
                     QVLICSVACIANVVVVRYAASRANRGPLRRSAKGAC"
     gene            complement(<815432..>815893)
                     /locus_tag="KLTH0F09416g"
                     /db_xref="GeneID:8292820"
     mRNA            complement(<815432..>815893)
                     /locus_tag="KLTH0F09416g"
                     /product="KLTH0F09416p"
                     /transcript_id="XM_002554567.1"
                     /db_xref="GeneID:8292820"
     CDS             complement(815432..815893)
                     /locus_tag="KLTH0F09416g"
                     /note="similar to uniprot|Q12513 Saccharomyces cerevisiae
                     YDL110C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F09416p"
                     /protein_id="XP_002554613.1"
                     /db_xref="GeneID:8292820"
                     /db_xref="UniProtKB/TrEMBL:C5DL25"
                     /translation="MSDASSMRRPVEIQEFKAVIKDLPEGQLAKIRSELENSMRHLDR
                     SNLRLKKYIAKIEGKREDTPDGVDQEELDKVDANDLQLFQDSFRENEIVLRNHYERLE
                     ALDLEESYRQRGARSAPSAASGSSQSHTSRAPAFDSDNTGGDTNAPNSVYL"
     gene            <818524..>820551
                     /locus_tag="KLTH0F09438g"
                     /db_xref="GeneID:8292821"
     mRNA            <818524..>820551
                     /locus_tag="KLTH0F09438g"
                     /product="KLTH0F09438p"
                     /transcript_id="XM_002554568.1"
                     /db_xref="GeneID:8292821"
     CDS             818524..820551
                     /locus_tag="KLTH0F09438g"
                     /note="similar to uniprot|P33891 Saccharomyces cerevisiae
                     YGL145W TIP20 transport protein that interacts with Sec20p
                     required for protein transport from the endoplasmic
                     reticulum to the golgi apparatus"
                     /codon_start=1
                     /product="KLTH0F09438p"
                     /protein_id="XP_002554614.1"
                     /db_xref="GeneID:8292821"
                     /db_xref="InterPro:IPR007528"
                     /db_xref="UniProtKB/TrEMBL:C5DL26"
                     /translation="MLQSIEDLKGIPQLIHEVEAQRGELAEKIQGHNSPGDDLLDDFD
                     MLDAQLAKAAADVVQARSTADVKALKEKYGNLAILEQLDSLFTREETKQAQKHALVKV
                     QNIYDSMAAQQEANSAQLELWHEDIKQALAEVDPDLGAQSGVYVRFTALLTQEAAVLS
                     EELKTLLLNANWDATQFSVVDAVATEHLRDLSNRLYRLWQLQLPEPDSNSIWNFECIA
                     NNFKIKFIYHFNNQAVQEPQSVEMYFKFLDKYLDQNLFKCVDIFQDPSSSSSMTQELV
                     HQQFINHILNPIREKVSSTLLKNPEISSDQDLKTLIALISQIFIIDNALIKKHLYYGH
                     GLIAMIPKSILDTWHQFEIEASISQFQKIIKSPLEKSGVDFCKLLQNLYAYFEPFFHI
                     DFDELMDYKIKITNRIFMGLPNRYRENLLAVKDDQATSYTDEAQFKQTLWKLNNLELI
                     MSLLKDLETKLTFIQITNYVNIATSSDYSTVLSDVLDSYEDTVIAVKDSVIHRIKKML
                     NMSLRNYFKLNEWALVTSEPHQCSAELIAPLSLSNRLIGTMDSFDLKPHTTLSVKNEV
                     LNIIIHYMLDYVVNLNKFSEMGFVQLQLDYNALKETLSFPHVSIPQNAEEGAFLESLK
                     VLELRYKRSQTNKQFLSKSYIDRREFSAFRDYLQIKYSTDSELANAMYRLI"
     gene            complement(<820558..>822564)
                     /locus_tag="KLTH0F09460g"
                     /db_xref="GeneID:8292822"
     mRNA            complement(<820558..>822564)
                     /locus_tag="KLTH0F09460g"
                     /product="KLTH0F09460p"
                     /transcript_id="XM_002554569.1"
                     /db_xref="GeneID:8292822"
     CDS             complement(820558..822564)
                     /locus_tag="KLTH0F09460g"
                     /note="similar to uniprot|P53118 Saccharomyces cerevisiae
                     YGL144C ROG1 and similar to uniprot|Q12103 Saccharomyces
                     cerevisiae YDL109C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F09460p"
                     /protein_id="XP_002554615.1"
                     /db_xref="GeneID:8292822"
                     /db_xref="GOA:C5DL27"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR016445"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DL27"
                     /translation="MTQDGILYHAKSSVKVGEVERYVITYQLYDEDEGLPADLSLNSL
                     WLKVRNLENFTFRAAYLMGPYILYCDVRTEDYHHSQRLFVSADQPKFEPMLQPQQDFI
                     AELSLHNLKKTYVWVVDVVSQIIFTNTTQIGFEVSIGSSKKCLSKSSDCDPMVGSCSP
                     KLNVTKLNTLDIWNLPNQLSTHASQKEHLVLLTHGLHSNVPADLFYLKEQIEKCQKYY
                     ADEQIVVKGYDKNVCKTEKGIKYLGTRMAEYIVNELYHDRVVKISFIGHSLGGLVQTF
                     AIAYISVKYPWFFQKVEPINFITLASPLLGIVTDNPAYVNILLSFGIVGKTGQDLGLK
                     ESGKDGKPLLYCLPGEPTKRILKMFKRRTLYANAVNDGIVPLYSASLLFADYEGVVNQ
                     LKGMPEFQDKLRTTAPGDYIKRNFLSPLTKAISIWAPQKFPEETESKLPKVSVIESAT
                     SVLIPPLPDKAYVMDPSSRENVILHDRIYSEKDIPPRNSQSEKDLIESENVLLKAFTM
                     SSEKHNQTLEEDIARKWHEGLVWRKVIVGLKPDAHNNIIVRRRFANAYGWPIIDHLTQ
                     NHFNGAESETAAHGEAQDRGTSSSPVQENDENKDIGWLDGISKPSMFDVGPTGMISTV
                     GEIIDSLSKNNFLSKKSTTVHDLPAGPFEQQDLFSYEMEEKDLA"
     gene            complement(<823401..>824603)
                     /locus_tag="KLTH0F09482g"
                     /db_xref="GeneID:8292823"
     mRNA            complement(<823401..>824603)
                     /locus_tag="KLTH0F09482g"
                     /product="KLTH0F09482p"
                     /transcript_id="XM_002554570.1"
                     /db_xref="GeneID:8292823"
     CDS             complement(823401..824603)
                     /locus_tag="KLTH0F09482g"
                     /note="similar to uniprot|P30775 Saccharomyces cerevisiae
                     YGL143C MRF1 Mitochondrial polypeptide chain release
                     factor involved in stop codon recognition and hydrolysis
                     of the peptidyl-tRNA bond during mitochondrial translation
                     lack of MRF1 causes mitochondrial genome instability"
                     /codon_start=1
                     /product="KLTH0F09482p"
                     /protein_id="XP_002554616.1"
                     /db_xref="GeneID:8292823"
                     /db_xref="GOA:C5DL28"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:C5DL28"
                     /translation="MLWKAVRAKKLHLPRILVRLQSSSTAEFQELHPLLLKRAEKYAE
                     ELKALEKWMAKGEGTFDVERQKKFSRLCAVVDSFHRYSREIELLKDLQDMMKDDPSLR
                     DEAQQEMAEIRPQLEKTSSSLLGQLLPPHPFADRPCILEIRPGVGGIEAMIFAQDLLG
                     MYINYAHNKRWKYHIISQSANESGSGIVDAILSIDEPGSYDKLRFEAGVHRVQRIPAT
                     ETKGRTHTSTAAVVVLPQMAEDNEKEAESYERTFKPDEIRIDVMRARGKGGQHVNTTD
                     SAVRLTHYPSGIVINMQNERSQHKNKAKAFAILRARLAEIEQKAKEEKARAARKGQVS
                     TTDRSDKVRTYNFPQNRITDHRCGFNLHDMEGIMAGERLDDVIDAMQIYDSDTRAKEL
                     LVEVQGTA"
     gene            <824743..>825729
                     /locus_tag="KLTH0F09504g"
                     /db_xref="GeneID:8292824"
     mRNA            join(<824743..824770,824831..>825729)
                     /locus_tag="KLTH0F09504g"
                     /product="KLTH0F09504p"
                     /transcript_id="XM_002554571.1"
                     /db_xref="GeneID:8292824"
     CDS             join(824743..824770,824831..825729)
                     /locus_tag="KLTH0F09504g"
                     /note="highly similar to uniprot|P06242 Saccharomyces
                     cerevisiae YDL108W KIN28 Serine/threonine protein kinase
                     subunit of the transcription factor TFIIH involved in
                     transcription initiation at RNA polymerase II promoters"
                     /codon_start=1
                     /product="KLTH0F09504p"
                     /protein_id="XP_002554617.1"
                     /db_xref="GeneID:8292824"
                     /db_xref="GOA:C5DL29"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DL29"
                     /translation="MISQAEYSKEKKVGEGTYAVVYVGTKQSSNRKVAIKEIKTSGFK
                     DGLDMSAIREVKYLQEMQHINVIELIDVYMAQSNLNLVLEFLPADLEMIIKDTAILFT
                     QADIKSWLLMTLRGVHHCHRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDF
                     LTSNVVTRWYRAPELLFGARHYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTF
                     RALGTPTDKDWPEISTFGTYNKIQFYPPPSREELRRRFIAATENALDLMSGMLIMNPH
                     KRWDPIQCLTNQYFVELPEPTTPADLPQLNKK"
     gene            complement(<825741..>826970)
                     /locus_tag="KLTH0F09526g"
                     /db_xref="GeneID:8292825"
     mRNA            complement(<825741..>826970)
                     /locus_tag="KLTH0F09526g"
                     /product="KLTH0F09526p"
                     /transcript_id="XM_002554572.1"
                     /db_xref="GeneID:8292825"
     CDS             complement(825741..826970)
                     /locus_tag="KLTH0F09526g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F09526p"
                     /protein_id="XP_002554618.1"
                     /db_xref="GeneID:8292825"
                     /db_xref="GOA:C5DL30"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:C5DL30"
                     /translation="MLKFPKRGLLSRQWKAGCTSIRTYTNSLDVATDYSHAVIGGGVV
                     GLSVAHELSKKSENKVLLIEKNPSTGLETSSRNSEVIHAGLYYPVQSLKTKLCLEGSN
                     IIYNELLPLKTGVNWSKCGKWIVAQTDADDAYLESMYLKAKNDLDLPVEMIPANKTKW
                     IEPAIHVGRSVLNSPTSGIIDSHSLMQYLLTGMDNNGVELAIGTELIDMAYDYGRGYT
                     LLCKSTVNNSDETVEIRVENVINAAGLQAHKVANMLLPRNKQKTQYFAKGNYYTLSGS
                     ASPPVRRLIYPVPPKSGKSLGTHLTIDLMGQMRFGPDLQYVESPSDYEVSCSNLKAAY
                     EAICRYYPHIQLNDLQPAYSGIRPKLAGPGDKSFKDFYISEEKGLPGFVNMLGIESPG
                     LTAGLAIGRHVCGLYHG"
     gene            <827100..>828278
                     /locus_tag="KLTH0F09548g"
                     /db_xref="GeneID:8292826"
     mRNA            <827100..>828278
                     /locus_tag="KLTH0F09548g"
                     /product="KLTH0F09548p"
                     /transcript_id="XM_002554573.1"
                     /db_xref="GeneID:8292826"
     CDS             827100..828278
                     /locus_tag="KLTH0F09548g"
                     /note="similar to uniprot|P40990 Saccharomyces cerevisiae
                     YDL107W MSS2 Peripherally bound inner membrane protein of
                     the mitochondrial matrix required for export of C-terminal
                     tail of Cox2p through the inner membrane"
                     /codon_start=1
                     /product="KLTH0F09548p"
                     /protein_id="XP_002554619.1"
                     /db_xref="GeneID:8292826"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DL31"
                     /translation="MRSSLLRFEGTNSRSSMNSKASLCFKRLASFKLPNRPPFHEVFP
                     QKTLVNRILFELDSKLTFPKLYPVYESIYNNLGHSDRENALPKSFTASDVMIMKKVLE
                     KLRHRTKSTNRNFIALENELLEKAAEMGDNDAIGLLAYSVLKNPQKNSAEDVAHAKSL
                     IKQLYQMNHSLTLKLTGDFAWRSDDFTNAESYYKRFLEFENDTFRAGEVYGQLGILYL
                     RKPDLKEAERCFLSSISLAPRENVVKSYYHLAQLYMESYPLKARSLMESAAAEGFKES
                     FQLLGFLEMNYFQNYAKSQQWFKLGMELFEVDCYIGYFDSCVKMQKWHLAKKCLETMH
                     LLVQKNTAQYPAYETFLKSREDKIEALKLHSTNPHIEVSKYATQMRGSPATKRNTWGL
                     "
     gene            complement(<828282..>830075)
                     /locus_tag="KLTH0F09570g"
                     /db_xref="GeneID:8292827"
     mRNA            complement(<828282..>830075)
                     /locus_tag="KLTH0F09570g"
                     /product="KLTH0F09570p"
                     /transcript_id="XM_002554574.1"
                     /db_xref="GeneID:8292827"
     CDS             complement(828282..830075)
                     /locus_tag="KLTH0F09570g"
                     /note="similar to uniprot|P30777 Saccharomyces cerevisiae
                     YGL142C GPI10 Integral membrane protein involved in
                     glycosylphosphatidylinositol (GPI) anchor synthesis
                     putative alpha 1 2 mannosyltransferase required for
                     addition of the third mannose onto the GPI core structure
                     human PIG-Bp is a functional homolog"
                     /codon_start=1
                     /product="KLTH0F09570p"
                     /protein_id="XP_002554620.1"
                     /db_xref="GeneID:8292827"
                     /db_xref="GOA:C5DL32"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:C5DL32"
                     /translation="MAPKEHQKVSLRHVLILFRLINCFFVQSFFQPDEFWQCLEPAHY
                     MAFGYGDLTWEWKFGLRSYAIPFIFELVYRTVGAVSKFASGIVYMAANSFAALVHYLA
                     PNSDLGWEMAFEMQQFPREIQEFLEYQGVLWAPKIFMALLAAVGEWYMIDFIDEVLSR
                     AFNGDEKDKVSNKAHVKIAASILSLTNFFNYFMITRTFANTFEMALTSIALYYWDWSM
                     GQTISSRDFTVSLFLGILLCFQRPTNALIWVPLGTYTVLNLTLRNDTQNLLRLGRKLF
                     FVFFQVFILNLGIDYYFYGHLSVPAYRFIKFNYTSALSSFYGTAPWHFHLLQTLPLIL
                     GFSIPLFAYGFFFMNFKKTIGFLGNTVTQIRVIVIINVLAFSAVSHKEFRFLYTLQPF
                     LTLFSSAALGRLIPKIKEVKNALLKSILWAVPFISIFSALAILSFQEVGVIEVTKYLH
                     NIPRVQSVGFIMPCHSTPWQSHIHRKDIGDLWSITCEPPLYLLNDPQGKKKLSDYMDE
                     SDYLYENIPKFVYKNFPPVFRKELRSPGKVYTHEWPEYLVIFQHLDEEFMNKFLEDSG
                     YLVEKRFFNSLKHWDSRRSGDIIVYHKPPWV"
     gene            <830181..>832910
                     /locus_tag="KLTH0F09592g"
                     /db_xref="GeneID:8292828"
     mRNA            <830181..>832910
                     /locus_tag="KLTH0F09592g"
                     /product="KLTH0F09592p"
                     /transcript_id="XM_002554575.1"
                     /db_xref="GeneID:8292828"
     CDS             830181..832910
                     /locus_tag="KLTH0F09592g"
                     /note="similar to uniprot|P53119 Saccharomyces cerevisiae
                     YGL141W"
                     /codon_start=1
                     /product="KLTH0F09592p"
                     /protein_id="XP_002554621.1"
                     /db_xref="GeneID:8292828"
                     /db_xref="GOA:C5DL33"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:C5DL33"
                     /translation="MLNFTGQTKRRNVNLGNRSGKSKQDLLINAKIEREKRALARRNE
                     ENAIVMQSAIRKHLSNKKTFGILTKDITRTKSLSLAIAYPTAILNIMGSEVLSKVLTG
                     LSNDGDLLLNLRLIRIIPELGYQEYSKEFLISVLSRLSPLNQLQKEFVDAVVVFLETA
                     CYDLPKEVLIKVVQLIKAFGADQTQYVASVYGVSMQHARNSNNIRRFLQCLGPQCSPR
                     FLPTDAVSSNLVENLAYILNSTENIDSAAYCHQVLLCVSNMELGSLSGCENFGKLYNR
                     EFVDFITSSDSEQLFDKMSVFVKHAPSVESRNNILVSLIAKPGFLMKSHQQALGATTN
                     STAASKKIYLLVELLNVFLSVASDFEILRNTDVFPLELLRRTTDFLKMICFESMWNES
                     GPWQELPDSFLNTLKKIHLRDSRLHFCSRKKDADYWSISDGEFLNVNITKYIEDYEAF
                     YREKLHSSQSEEDEAENFNLLERKRDIRQEFLSHLELSFSNRPSTRQFRKLGILTKAP
                     FFIPFRQRVEWLYFLISLDRKRLALESNGMGGLFPAWNSGSGSDKQNATISREHLLED
                     AYNAYNPIGESFKSKLSITFVNEFGPEAGIDGGGITKEFLTSVTGEAFKIDKHKLFRS
                     NNNHEIYPTSNLTSAQSVKFLWFLGKVLGKCLYDHVLINVTFADFFLKKLLNVNNANS
                     SFDDLASLDSELYSNLAKLSEMNAEQLQSLGLRFEVTDEDTLEAVDLMPSCPASFVTK
                     SNVLQYLLAVADYKLNRKLKTGSRAFAGGLYTMIPPHWIEMFNSVELQMLISGGDKDI
                     DLADLRKHTEYGDYSEQHQTVRDFWEILEECTAEERLKFIKFVTSVPRAPLQGFGSLN
                     PLFGIRNAGRETARLPTASTCVNLLKLPDYRNKQLLKTKLLYAINAEARFDLS"
     gene            <833092..>834609
                     /locus_tag="KLTH0F09614g"
                     /db_xref="GeneID:8292829"
     mRNA            <833092..>834609
                     /locus_tag="KLTH0F09614g"
                     /product="KLTH0F09614p"
                     /transcript_id="XM_002554576.1"
                     /db_xref="GeneID:8292829"
     CDS             833092..834609
                     /locus_tag="KLTH0F09614g"
                     /note="similar to uniprot|Q03212 Saccharomyces cerevisiae
                     YMR171C Endosomal protein of unknown function mRNA is
                     targeted to the bud via the mRNA transport system
                     involving She2p"
                     /codon_start=1
                     /product="KLTH0F09614p"
                     /protein_id="XP_002554622.1"
                     /db_xref="GeneID:8292829"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR027713"
                     /db_xref="UniProtKB/TrEMBL:C5DL34"
                     /translation="MFLAELLRKHLGVVLLGALWVRPSACGYVPERFEEQHYLGSEPY
                     DDGYKNDLDIDLMLFSLAFMVSCYFVLTLVYFAVKFFLRRYFRSGIALSGDGEGHVIG
                     PAVNARWPSPLDDVNAVRDKLAAMSPEEQFYYKQGEEFIKQNPPLLIPDQLPGGSNTV
                     DPIINEHTLRFIDEEGAHAWEFQPDPKLPNDSVLVENKTEITFLNYNYDVSVMTNLPI
                     PRLNWVYYCEFKIFELNTAGSNNNNHLSQNELISFGLSTSPYPYFRLPGRHHHSVAYD
                     STGARRFNDSFELSAELSSIFPSCEKGDVIGIGYRTNSGTIFFTRNGKKLSEKSIGGH
                     IKGWKFKYIYPVVGSNIPCKIHVNFGTYGFVYIEANVKKWGYAKSHGLKLPPPSYEDY
                     GQDVLLESSYEDDATDNESISTTDGDIIDNEGHLLPPPPGFEFSVSPQPSDAGQFTLN
                     SLPAEPPVYASDNQIDGEDNETAERLEHIVRDSDIRDSAYPGNELGKNTMANQFL"
     gene            complement(<834845..>836299)
                     /locus_tag="KLTH0F09636g"
                     /db_xref="GeneID:8292830"
     mRNA            complement(<834845..>836299)
                     /locus_tag="KLTH0F09636g"
                     /product="KLTH0F09636p"
                     /transcript_id="XM_002554577.1"
                     /db_xref="GeneID:8292830"
     CDS             complement(834845..836299)
                     /locus_tag="KLTH0F09636g"
                     /note="similar to uniprot|P07269 Saccharomyces cerevisiae
                     YDL106C PHO2 Homeobox transcription factor regulatory
                     targets include genes involved in phosphate metabolism
                     binds cooperatively with Pho4p to the PHO5 promoter
                     phosphorylation of Pho2p facilitates interaction with
                     Pho4p"
                     /codon_start=1
                     /product="KLTH0F09636p"
                     /protein_id="XP_002554623.1"
                     /db_xref="GeneID:8292830"
                     /db_xref="GOA:C5DL35"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:C5DL35"
                     /translation="MEEYQANGIEFNPQFQPQYEVQNTFENGQSGSEASENAAQTGAQ
                     KDGTAGSRAAPAHSDQNRDERPRTKRTRATGEALNILKREFEENPNPNAQNRKRISEL
                     TGLPEKNVRIWFQNRRAKHRKTDRIAKPTAVETSVPGNSYLASDFDRIPLDINPNYCF
                     IDVKSLTVGSWKRLKSGNLKADDLSTIKRLSNLSPISINEIMANATDLMVLISKKNHE
                     INYFFSAIANNTKILFRIFFPIATVVDCSLTVAPESLQNEDPATEDAVRAEQDKVCEL
                     RLNVSKAPTFAVYFSDGADQFSANQWSICEDFSEERQVSEAYTGGSNIPHIITGLGNS
                     LNFMNSTIQDHNSGNSVLSHTSHSGSQGSVNVSDAQNLILHPEPQSLGPRQQPFFDDF
                     NEHEELYGMGEQNTSQFAHSNANQTHPFTQHAAPAAGNDHGSPQYTESGVPRTPDFLR
                     SHAEMGNEEQSGLNNLLIFEDQNNNNTKNGQSYF"
     gene            complement(<836662..>838173)
                     /locus_tag="KLTH0F09658g"
                     /db_xref="GeneID:8292831"
     mRNA            complement(<836662..>838173)
                     /locus_tag="KLTH0F09658g"
                     /product="KLTH0F09658p"
                     /transcript_id="XM_002554578.1"
                     /db_xref="GeneID:8292831"
     CDS             complement(836662..838173)
                     /locus_tag="KLTH0F09658g"
                     /note="similar to uniprot|P47771 Saccharomyces cerevisiae
                     YMR170c ALD5 and to YMR169c uniprot|P54114 Saccharomyces
                     cerevisiae YMR169c ALD4"
                     /codon_start=1
                     /product="KLTH0F09658p"
                     /protein_id="XP_002554624.1"
                     /db_xref="GeneID:8292831"
                     /db_xref="GOA:C5DL36"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR015657"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DL36"
                     /translation="MSFAEVKLPSGKTYKQPLGLFINNEFVDSSCDEKIESIDASTGK
                     VIAAVQAADAKVDLDRAVAAARKAFPAWRDTPAPEKRDLLLKLASLVEENAQMLAEVE
                     SLDSGKPLESNALEDILGLAGILKYYAGWVDKAQGQSYSPSPSRLTYTTHQPLGVVGC
                     IIPFNYPLAMMAWKWTAIATGNTTVFKSAEQTPLSILYFAQLVIEAGFPAGVFNVLSG
                     TGAKVGDAMARHLDIDKIAFTGSTAVGQIIQKTAAVNLKALTLECGGKSPNVVFEDAD
                     FDQAVKWTAAGIFYNMGQICSGTSRCYVQDSIYEKFLSALAEHVDKTYKVGPPSDPEV
                     LIGPQVSKTQQQRIQSLIKKGIEEGARVVLGGEGLPDSIAQSEEHKSGFFVKPTILAD
                     IEPTNTVAREEIFGPVIVVGKFSDYDEALKLANDTEYGLASAVFTADITRAHTFASQV
                     EAGVCYINSSNELDPACPFGGIKMSGYGRELGEYGLSNFTNVKAVYVNLGTKL"
     gene            <839033..>840541
                     /locus_tag="KLTH0F09680g"
                     /db_xref="GeneID:8292832"
     mRNA            <839033..>840541
                     /locus_tag="KLTH0F09680g"
                     /product="KLTH0F09680p"
                     /transcript_id="XM_002554579.1"
                     /db_xref="GeneID:8292832"
     CDS             839033..840541
                     /locus_tag="KLTH0F09680g"
                     /note="similar to uniprot|P47771 Saccharomyces cerevisiae
                     YMR170C ALD2 Cytosolic aldehyde dehydrogenase that uses
                     NAD as the preferred coenzyme expression is induced in
                     response to high osmotic stress"
                     /codon_start=1
                     /product="KLTH0F09680p"
                     /protein_id="XP_002554625.1"
                     /db_xref="GeneID:8292832"
                     /db_xref="GOA:C5DL37"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DL37"
                     /translation="MSLFTEISIPQLNISYKQPVGLFINNKFVESSENEQIETVNPAT
                     GEAITKFHAASEADIDKAVAAAREAYESTWSKTSPEERGVLLGKLGQLIEQEKELLAA
                     IETVDSGKPYYTNALGDLEQILQLTRYYAGAADKFTQGKLLPVSSDKYAYTVKAPYGV
                     VAQVVPWNYPLAMASWKMQGCLAAGNTIVIKPAENTSLSLLYFAQLVEKAGFPPGVVN
                     VVPGYGGVAGSRLAAHPDVDKIAFTGSTAVGQKVMAAAAMSNLKAVTLECGGKSPALV
                     FEDANLDEAVKWTAAGIYYNSGQNCTANSRIYVQESVYEKFLLKFTAHVQETWKFGKT
                     SDLFDQECTVGPVVSKTQYERVQGYIEHGKSTEKLSLKQMGQPSDSKGYFITPTIFIN
                     VPQDSKLNQEEIFGPVAVIAKFKDYKEGIALANDTSYGLASAVFTEDIRKANYFARDI
                     KAGTVWINSSNDEEVSVPFGGFKMSGIGRELGESGMDAYLQTKAVHVNISKL"
     gene            <840760..>842589
                     /locus_tag="KLTH0F09702g"
                     /db_xref="GeneID:8292833"
     mRNA            <840760..>842589
                     /locus_tag="KLTH0F09702g"
                     /product="KLTH0F09702p"
                     /transcript_id="XM_002554580.1"
                     /db_xref="GeneID:8292833"
     CDS             840760..842589
                     /locus_tag="KLTH0F09702g"
                     /note="similar to uniprot|P40969 Saccharomyces cerevisiae
                     YMR168C CEP3 Essential kinetochore protein component of
                     the CBF3 complex that binds the CDEIII region of the
                     centromere contains an N-terminal Zn2Cys6 type zinc finger
                     domain a C-terminal acidic domain and a putative coiled
                     coil dimerization domain"
                     /codon_start=1
                     /product="KLTH0F09702p"
                     /protein_id="XP_002554626.1"
                     /db_xref="GeneID:8292833"
                     /db_xref="GOA:C5DL38"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DL38"
                     /translation="MLPQSRPVKSKNPCSVCTKRKVKCDRLVPCSNCVKREEEERCIA
                     SYRTKLDRAGDLLSESKHEFLTTWQAYDYWVFGIGIFQNGALNKKRSVDSRSFEEEEE
                     ESSYWRDGLNMDTSFKLLDFAIENLGSLFFGCVSDVGELYFKLEEYWGRLNDTQAAPT
                     TDSLFSSAILWSIFTMAIFYMPIELLGKYFPSEQVARLYDSTPEQALTERLRMNLFEG
                     FYRTTVNQLKKADFLRNPVVETIQTYLILAATPFPALEPSLANSLLTQCLHLAKYWRL
                     DQFRPLVTDTPDLRLTKVVCEKLWYRLCVQDFWQSGPNKPLSIHEDNISLLSHAAYLM
                     DRPNVDVYQSEDTFEALIWKIVSLDRDLEKYFITTSKPPLKTIDAIQRQIDIFSQKIN
                     STDAQASTTARCDKFLAGFLLNFVNWKLSNLNYIYYDPHTGAARLNHYTTVLIAQVLH
                     NIKNKLDFYNRMPLVLRIITKLMTFHTLCNVYDDSATNEQLALDLSEVFAGLGEVSSS
                     LTTPTSKLLDRVRKLKPIWRNVRVVDSESSSNHPVFKILQDDIVFLRDSCTKRLPKFL
                     AAHSSKDRLDDGLEAEPQSREFLQIVANFEKSYPLNKILNLCD"
     gene            complement(<842593..>844849)
                     /locus_tag="KLTH0F09724g"
                     /db_xref="GeneID:8292834"
     mRNA            complement(join(<842593..844758,844826..>844849))
                     /locus_tag="KLTH0F09724g"
                     /product="KLTH0F09724p"
                     /transcript_id="XM_002554581.1"
                     /db_xref="GeneID:8292834"
     CDS             complement(join(842593..844758,844826..844849))
                     /locus_tag="KLTH0F09724g"
                     /note="similar to uniprot|Q2I041 Saccharomyces cerevisiae
                     YMR167W MLH1"
                     /codon_start=1
                     /product="KLTH0F09724p"
                     /protein_id="XP_002554627.1"
                     /db_xref="GeneID:8292834"
                     /db_xref="GOA:C5DL39"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DL39"
                     /translation="MSAPLKIKPLAESVVNKIAAGEIIVAPVNALKEMMENSIDAGAT
                     AIDILIKEGGLKILQITDNGSGIDKSDLPILCQRFTTSKLKTFEDLSSIQTYGFRGEA
                     LASISHIARVTVTTKTKNEACAWRVSYSAGKMIGEPKPIAGRDGTIILVEDLFYNVQS
                     RLRSLRSPGDEFAKILDCVGRYAINSKNVGFSCKKFGESQFALTVRYDADVRERVQAV
                     FGRGTASNLIELKVPEIEGLGASASGQVSTLNFINKKSISPIFFINNRLVTCDPLRRA
                     LYQTYSSHLAKGNRPFIYLNVTIRPELVDVNVHPTKREVRFLHDEEIIEQIASQLGDV
                     LSNCDTSRSFKTTSIFTQKPVSIRENLGKPHSQLINNIPVTPLGNKVKRQENKLVRID
                     ASQTKITNYLRSAEYTENTEQSTPYKQSYEDDSIQSSCRASEGRQHQGSWIADTPSRR
                     ASKTSTYTVSRKTRVEVNLASVNMLRKEVDSSMNKDLTNIFANLTYIGLADEQRRLAC
                     IQHDLRLFLVDYGSICSELFYQVGLTDFANFGKIFLINEDESAGSQEEGLSVGSLLQE
                     VVSSRGGSSTELIRPLWDMREMLEEYFSIELYGGDTHVENTKIKSLPLLIKGYIPPLS
                     KLPHFLYRLLTKIDWSDEMKCLQGILKQIALLYVPEMIEQIDPEDSSIKEEERIRYLT
                     DTENMEKILEETIFPCIKKRLLAPRDLMGNVVEVANLPGLYRIFERC"
     gene            <844961..>846112
                     /locus_tag="KLTH0F09746g"
                     /db_xref="GeneID:8292835"
     mRNA            <844961..>846112
                     /locus_tag="KLTH0F09746g"
                     /product="KLTH0F09746p"
                     /transcript_id="XM_002554582.1"
                     /db_xref="GeneID:8292835"
     CDS             844961..846112
                     /locus_tag="KLTH0F09746g"
                     /note="similar to uniprot|P43124 Saccharomyces cerevisiae
                     YDL105W NSE4 Nuclear protein that plays a role in the
                     function of the Smc5p-Rhc18p complex"
                     /codon_start=1
                     /product="KLTH0F09746p"
                     /protein_id="XP_002554628.1"
                     /db_xref="GeneID:8292835"
                     /db_xref="GOA:C5DL40"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="InterPro:IPR029225"
                     /db_xref="UniProtKB/TrEMBL:C5DL40"
                     /translation="MTRQREEDDERGNLSSKRRRTEVPQAEAEQASALEEDLEFEILQ
                     GYRDVDKDVSKDRVEVARNGDIAIALDRLKAIDTLFDRMVSVNSNRNSLLAQDSKAAL
                     NVSELAQLSVRNLKLDESQRVLGISDVINYSKRFMLKEYFNANGIKQERAKVNSSDDA
                     EEEDSSNAQDDSATNQDVYAQGRQQRSLLDQFDQYNRFTQFNWFKMGMLFRTISKTPL
                     TVDHLLGPFAAEKKIRSSSQRIRTTDIVGEAVTAERVTKSSLNSTQEETTPEQVKKCF
                     KVLIEKNGLKQINLFKFIIHPKSFAKSVENLFYTSFLIKGGKLVLEEDEDGFPAIRPK
                     EGLPKNPHDREVEIQRRNDARQNHIIFQLDMATWRRLIQRFDITSPFIP"
     gene            complement(<846278..>847453)
                     /locus_tag="KLTH0F09768g"
                     /db_xref="GeneID:8292836"
     mRNA            complement(<846278..>847453)
                     /locus_tag="KLTH0F09768g"
                     /product="KLTH0F09768p"
                     /transcript_id="XM_002554583.1"
                     /db_xref="GeneID:8292836"
     CDS             complement(846278..847453)
                     /locus_tag="KLTH0F09768g"
                     /note="similar to uniprot|P43122 Saccharomyces cerevisiae
                     YDL104C"
                     /codon_start=1
                     /product="KLTH0F09768p"
                     /protein_id="XP_002554629.1"
                     /db_xref="GeneID:8292836"
                     /db_xref="GOA:C5DL41"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:C5DL41"
                     /translation="MFRSRTIRWLTSLGGRVSKVCSRRNYRVLAIETSCDDTCVAVID
                     RKSRQEPPVLLAHLKETLDSEKHGGIVPTKAHLHHQIKVGSLVQQALRQTSSERSIDL
                     VCVTRGPGMPGSLSGGLDFAKGLAVAWDKPLVGVHHMLGHLLISRMHTNGSSPRYPFV
                     SLLVSGGHTIFVHSKSISEHEILCNTIDIAIGDSLDKCAREIGIKGNMIAKNMEKFIN
                     ENLEEAQSQTVDMSLPNPLRNQNGRMNVQAFSFAPFLTAVRTAMAKNKMEKCTKETRS
                     MAYQIQEALFEHLITKLKLVISLRPDIFECTRHLVCSGGVGANRRLQQKLRDELSFQF
                     QEFHYPEPSLCTDNAVMIGWAGIEIFETLGIKTELGVTPVKKWPLSDLLNVPGWIST"
     gene            <847760..>848833
                     /locus_tag="KLTH0F09790g"
                     /db_xref="GeneID:8292837"
     mRNA            <847760..>848833
                     /locus_tag="KLTH0F09790g"
                     /product="KLTH0F09790p"
                     /transcript_id="XM_002554584.1"
                     /db_xref="GeneID:8292837"
     CDS             847760..848833
                     /locus_tag="KLTH0F09790g"
                     /note="similar to uniprot|Q03829 Saccharomyces cerevisiae
                     YMR166C"
                     /codon_start=1
                     /product="KLTH0F09790p"
                     /protein_id="XP_002554630.1"
                     /db_xref="GeneID:8292837"
                     /db_xref="GOA:C5DL42"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DL42"
                     /translation="MISLTSPIPVLHPTHEAHEHRDCVGGNNGANGNGKDKESSSREN
                     SAIWHCVIAGGLGGAIGDSVMHSLDTVKTRQQGAPNAPKYRNMVSAYKTLFVEEGIRR
                     GLYGGYTAAMLGSFPSAAIFFGTYEFTKRKMIDEWGVNDTVSHLTAGLGGDLVSSAAY
                     VPSEVLKTRLQLQGRFNNPYFHSGYNYRNLRDAISVIARIEGWRTLFFGYKATLCRDL
                     PFSAFQFAFYEKFRHWAFSLENKGQDEDLSVLSELTTGAAAGGLAGIITTPMDVIKTR
                     IQTQTPLMALGDSAKLVRIENSLIKGLTAVYRSEGVLGFFSGVGPRFIWTSIQSSIML
                     LLYQVTLKSLDRLTAPNSAFKHD"
     gene            <849268..>851634
                     /locus_tag="KLTH0F09812g"
                     /db_xref="GeneID:8292838"
     mRNA            <849268..>851634
                     /locus_tag="KLTH0F09812g"
                     /product="KLTH0F09812p"
                     /transcript_id="XM_002554585.1"
                     /db_xref="GeneID:8292838"
     CDS             849268..851634
                     /locus_tag="KLTH0F09812g"
                     /note="similar to uniprot|P32567 Saccharomyces cerevisiae
                     YMR165C SMP2 Protein involved in respiration and plasmid
                     maintenance"
                     /codon_start=1
                     /product="KLTH0F09812p"
                     /protein_id="XP_002554631.1"
                     /db_xref="GeneID:8292838"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DL43"
                     /translation="MQYVGRAIGSVSKTWSSINPATLSGAIDVVVVEHPDGRLACSPF
                     HVRFGKFQILKPSQKKVLVSVNGQPTNIPMKLGDSGEAYFVFETEGDMGTIPDELISS
                     PVVSAASSPSASPNTNSKSQSETNLEEPDFLDIGKPAQGEVAPPSTPPPPRRPSIFEE
                     RARKLNEKLHEKQIPSKFDMNGDLLLDIEGYKPSKDRVHTTDEMLKQLLRDELGTEFD
                     ISTFVKEDHNGNMRIMNPGESNHLHSPLCSPRTLASDDFDNTVSGISESSSQTDVTTS
                     TERDSRESLGKANSAVSEKNYIKTIRLTSEQLQCLELKYGENDLSFSVDNSRAVVTAK
                     LFLWRWDVPLVISDIDGTITKSDALGHVLTMIGRDWTHLGVAQLFTQIKRNGYNVVYL
                     TARSAGQADSTRSYLRSIVQDGFKLPRGPVILSPDRTMAALRREVILKKPEVFKIACL
                     NDLRNLYVGEFDSGEKADDDRKDELPTPFMAGFGNRITDALAYRTVGIPSSRIFTINP
                     DGEVHMELLELAGYRSSYIHINELVDHFFPPVGLNYVNCADDHRSLSPTPGSPVGTMT
                     EERSFHRPQDVKFTDVNFWRDPIPSLADVSDLSSLESEDTRDPLDSSSRGKAPSEGWD
                     VKSSKSDSLETDAPSTPQSARSAGHPSSASKNIGKQMYLELGSPLASPKLRYIDSKKA
                     EDKMKSLAISSPPKASTQTSTFSVFNDGSMHDPKDTDAKFAPPGRSMNHQETSDDEFD
                     EDEFDYEPCSSGVSDHDVNENSELDDANDNLTGNEVNDDEFDEDEFDQ"
     gene            <852041..>853669
                     /locus_tag="KLTH0F09834g"
                     /db_xref="GeneID:8292839"
     mRNA            <852041..>853669
                     /locus_tag="KLTH0F09834g"
                     /product="KLTH0F09834p"
                     /transcript_id="XM_002554586.1"
                     /db_xref="GeneID:8292839"
     CDS             852041..853669
                     /locus_tag="KLTH0F09834g"
                     /note="some similarities with uniprot|Q03825 Saccharomyces
                     cerevisiae YMR164C MSS11 Transcription factor involved in
                     regulation of invasive growth and starch degradation
                     controls the activation of MUC1 and STA2 in response to
                     nutritional signals"
                     /codon_start=1
                     /product="KLTH0F09834p"
                     /protein_id="XP_002554632.1"
                     /db_xref="GeneID:8292839"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="UniProtKB/TrEMBL:C5DL44"
                     /translation="MVSNGAGEQDDPSNMSESNQEPAHTGWSSMANGAAGAHTEENGN
                     GEKRPTEEEPTFNQEILVSDAMAKNSRQLLYAHIYNYLIQHKYYETSRRLLDEADVPL
                     SKSFPEERQKSGELLHAKMLMNSRDTFLCEWWQSLWTLHEYVESQPVEKISSSRLLRE
                     PVTPILPQRPPSAQGFVPANSPWMQNQHFMQGGLGYGRMTSNPGMPTNMGPPRGNDVK
                     AGKAGVPPASPLRKTAASYPQAQTTPGVSHTPTALSGSGAGVPSQIGVAANQMPAAQS
                     ALTTPLYTNLSSAARSTASSTTPQPQAPAKTMMKTFAREYQQMGPLPQGVANTPVAPD
                     NMMLYMQQQREMMTRYQGDDDMEKAGMNGAWSANQQRLHEQYQKNMYMMQQQQQSKRA
                     QQSRPYPRQQELSKQAMLAQNAQTTQSSQSGAHQLRHGIQEHKSEPTSNQQDSAIHQH
                     ASPRQPPASAYPTAGDMVSESSAGAVPTMDQQYLNMMMMQYSPTGLSPGLAQPAVNMN
                     ETSNTGQSSGPTDKFRDNLASEFFPLQPSSSQHD"
     gene            854236..854309
                     /locus_tag="KLTH0F09856r"
                     /db_xref="GeneID:8292840"
     tRNA            854236..854309
                     /locus_tag="KLTH0F09856r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8292840"
     gene            <854476..>856575
                     /locus_tag="KLTH0F09878g"
                     /db_xref="GeneID:8292841"
     mRNA            <854476..>856575
                     /locus_tag="KLTH0F09878g"
                     /product="KLTH0F09878p"
                     /transcript_id="XM_002554587.1"
                     /db_xref="GeneID:8292841"
     CDS             854476..856575
                     /locus_tag="KLTH0F09878g"
                     /note="weakly similar to uniprot|Q03824 Saccharomyces
                     cerevisiae YMR163C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="KLTH0F09878p"
                     /protein_id="XP_002554633.1"
                     /db_xref="GeneID:8292841"
                     /db_xref="GOA:C5DL45"
                     /db_xref="InterPro:IPR026235"
                     /db_xref="InterPro:IPR026859"
                     /db_xref="UniProtKB/TrEMBL:C5DL45"
                     /translation="MSCDSSGDVGKTKLPGLQIFSHNWNRSNSTLASNKTRPPQGMWM
                     TEDEKLTRFELQARKLSDWGVDALHDNSPTVVGSAEFNSEGQEVWLEHDIERELAKLE
                     SERLRSSSKLEMLASRIFQEAPFSTENFVEEFQYTIIASQLLTDCLRPRWVPPKSQKS
                     MLDFHSGLKGPKIPHARSVPTKYGKLTATERQFVLRKTVPFLPTLMFSRQCFGIMVRS
                     NSPKGSKRRIFAALATAVYLALQQELFYSQYVKHSTLLSLRSVIEQLQGLDKLLHRLH
                     MRYKELTIYKPITLIQATQTSSSDLSVIRDVLSSSLDLMFYEMKRITGNILPLLRNQD
                     LTKYCEIYAVNLVDVFYAVNEEAGEVGEKAARTHTLKKFVLCCLLSIDHGPGFGSDEK
                     QPESTVGLFKAFALHKKAGPILESKKFATVLTSLKELNELLANVSLYLKHNRPHGMDP
                     ALQTHERRDSQDVKRSSFCTSATLNMLKELQKTLIGSSNEKEEELASVVIKKLEEISK
                     LWIKQNAQKNIINRQNERSKKERHFSGLQLNVVQSPTAESHERYLEERFDAASKIDLN
                     SAIEFKTIHGSQSDLDLESDEDFNATITEEIYVANSEGELREVSENKACLSKLTDEEL
                     RNRLNERIMSLARENRQGKDELRTKKSFGLLGHDRSHKESSDGGSVGSRPSHRPKFIS
                     EESIPVLYELKQLLEDK"
     gene            complement(<856617..>858035)
                     /locus_tag="KLTH0F09900g"
                     /db_xref="GeneID:8292842"
     mRNA            complement(<856617..>858035)
                     /locus_tag="KLTH0F09900g"
                     /product="KLTH0F09900p"
                     /transcript_id="XM_002554588.1"
                     /db_xref="GeneID:8292842"
     CDS             complement(856617..858035)
                     /locus_tag="KLTH0F09900g"
                     /note="similar to uniprot|P43123 Saccharomyces cerevisiae
                     YDL103C QRI1 UDP-N-acetylglucosamine pyrophosphorylase
                     catalyzes the formation of UDP-N- acetylglucosamine
                     (UDP-GlcNAc) which is important in cell wall biosynthesis
                     protein N-glycosylation and GPI anchor biosynthesis"
                     /codon_start=1
                     /product="KLTH0F09900p"
                     /protein_id="XP_002554634.1"
                     /db_xref="GeneID:8292842"
                     /db_xref="GOA:C5DL46"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DL46"
                     /translation="MSTRELYEKCGQSSLFKHWDRLSKHEKQELEKNLGENAARIRPD
                     NLVQVCQEAIRLANDNSKDVSRLEPLPSSSYESIISKPQLEREYRELGLDALRRGEVA
                     VVLMAGGQGTRLGSSEPKGCYNIGLPSGKSLFQIQAEKLARIQRLAEASAPIPWYIMT
                     SKPTRAATERFFEDQKYFGLDKQQVVFFNQGTLPALDLEGRHLLLGSPTELVESPDGN
                     GGLYRALQDKGILEDMLHRNIKHIHMYCVDNVLVKLADPVFIGFAIKNGFELATKAVR
                     KRDASESVGLIASKNSAPCVIEYSEISKEMAEATDKEGLLKFRAANIVNHYYSVDLLK
                     RELGNWCDIMPYHIAKKKIPVYNNEKDSYYKPEVPNGIKLEQFIFDVFPYVPMGKFGC
                     LEVERSHEFSPLKNASGTANDNPETSRAAFLELGTSWLQQAGADVCPGVLVEVSGSLS
                     YGGESLEKYKGHKFAVNLSILQ"
     gene            <858143..>862984
                     /locus_tag="KLTH0F09922g"
                     /db_xref="GeneID:8292843"
     mRNA            <858143..>862984
                     /locus_tag="KLTH0F09922g"
                     /product="KLTH0F09922p"
                     /transcript_id="XM_002554589.1"
                     /db_xref="GeneID:8292843"
     CDS             858143..862984
                     /locus_tag="KLTH0F09922g"
                     /note="similar to uniprot|Q12674 Saccharomyces cerevisiae
                     YMR162C DNF3 Non-essential P-type ATPase that is a
                     potential aminophospholipid translocase localizes to the
                     trans-Golgi likely involved in protein transport"
                     /codon_start=1
                     /product="KLTH0F09922p"
                     /protein_id="XP_002554635.1"
                     /db_xref="GeneID:8292843"
                     /db_xref="GOA:C5DL47"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DL47"
                     /translation="MGRGSRKRAFSLRTQLFNKQLHDKFQRDYEEEPEMGDCGDGKRD
                     NSALELLAGGAQRVTDWVLRRKREKHTKAGRVIPLGLDRLDPFFRTFAGENAELLDER
                     SGRSYCSNLITSSRYTIYSFLPRQLYAQLSRLANTYFLIVAILQMIPGWSTTGTYTTI
                     VPLLIFMSISMAREAWDDFRRHKLDKEENDKLAKMLIMESEKSDHRLRDASEGVTRTN
                     SLYSLPEWQQTATSTSALTNPASEFADEGHEMDTNEREEDSFNNWERLRRRHRIKIIQ
                     KKWKDIKVGDYVLLNQDDWIPADLLLLTCDGENNECFVETMALDGETNLKNKQPLTEV
                     SEIMKTTEGLAKFKAKVTVEDPNIDLHNFEGNLELLDENRKLTIGPDHIIYRGSIIRN
                     TQNAVGLVVFTGEETKIRMNAIKNPRIKAPKLQRAINMIVLFMVFVVASMALFSFMGQ
                     RIIKKKNVDNGRAWYLFSADAGVAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLME
                     WDIDMFHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRGLSVCGSSWVH
                     DNDPQEQELDRTESNESKTIDVVSVDDRSFLKNFQNSDGNQVQRQRTSVDFKGNSSAI
                     YTGRPSIASRVQSMRNSMEDSSKVREPSGDGENNKEARSSAELIHYIQQNPDTYFSQK
                     AKFFILSLALCHTCLPKKPSEGGNDDSVEYQASSPDELALVTAARDLGYAVMNKNANV
                     LSIKSYPDGFESEPLIENFEVLNFIEFSSQRKRMSVLVRLPQEPNRILLICKGADNVI
                     LERLHNSDLASKKVSELQESTNERKAAEADLVLQQRKSLEIAATGRPSTSLTRSSVNK
                     PTRASLSLQAVRKSLSRRSMGSGDPEVQINSIDDFLSNVERANNAVTEVFAKSRKSMN
                     EQQRERYMPIMQNSPGSASTTNSSGQMPKTPTDVLGSPLQNDIELYIGNENLLQNEEF
                     VLERTLQAIDDFSTNGLRTLLYSYKWIDIEEYEIWNKDYHSAKTSLENRKEKMHSVGE
                     QMETSLRLLGVTAIEDKLQEGVADAIEKIRRAGIKMWMLTGDKRETAINIGYSCNLIH
                     DYSTVVILSAEDENISSKLTAVTQEIDRGNIAHCVVVIDGGTLGNFESNPTLMSVFVE
                     LCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAVGDGANDIAMIQSADIGVGIAG
                     KEGLQASRSADYSLGQFRFLLKLLLVHGRYNYVRTSKFVLCTFYKELLFYLTQMIYQR
                     HTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSESF
                     NLRVFLYWMFLAALNSVIITFLNWKIWAFSSLLDNTIYPIGVINFTAIVTLVNVKCQF
                     LETHNRNILAICSVIISVGGWLLWCCLLPGIYSQDEAYDVLTGLYHQFGRDITFWCAC
                     LVLVVLPLIIDVVFKTVKIMIRPSDSEIAMELEQKDEVRKKLEFKAYNELKQGWTWDR
                     DRSTFSRYAGKVFRTGSGTLEPDASGNHTRSRKNTIPSATELPAGSASEVTVRSGTKF
                     DPEEYEILPSGKLIKRCKPASNNGPEDRPLTQKLGKKLRFKIKSKEEDVDAIIADRLR
                     SLE"
     gene            complement(<863160..>863861)
                     /locus_tag="KLTH0F09944g"
                     /db_xref="GeneID:8292844"
     mRNA            complement(<863160..>863861)
                     /locus_tag="KLTH0F09944g"
                     /product="KLTH0F09944p"
                     /transcript_id="XM_002554590.1"
                     /db_xref="GeneID:8292844"
     CDS             complement(863160..863861)
                     /locus_tag="KLTH0F09944g"
                     /note="some similarities with uniprot|P48353 Saccharomyces
                     cerevisiae YMR161W"
                     /codon_start=1
                     /product="KLTH0F09944p"
                     /protein_id="XP_002554636.1"
                     /db_xref="GeneID:8292844"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DL48"
                     /translation="MAEYTKEQEELTLFILGKDKHAFYEVLQIEREASDNEIKKAYRK
                     LAIKLHPDKNKHPRASEAFKRINRAFEVLSDEQKRRIFDQVGHDPDERPVRDPFASGR
                     STATAGFPPENMFFRRAPGGQPQDIFDFLFNAGAAGGGHPFNSGFGGPFGGPFQGGFG
                     GPFGGGGATTFTFGGPNGFKVYTNGTPRARGAPRGTQQQEQEDQREAQQILRILVPIL
                     FILFLPMLERLLFGS"
     gene            <865335..>868622
                     /locus_tag="KLTH0F09966g"
                     /db_xref="GeneID:8292845"
     mRNA            <865335..>868622
                     /locus_tag="KLTH0F09966g"
                     /product="KLTH0F09966p"
                     /transcript_id="XM_002554591.1"
                     /db_xref="GeneID:8292845"
     CDS             865335..868622
                     /locus_tag="KLTH0F09966g"
                     /note="highly similar to uniprot|P15436 Saccharomyces
                     cerevisiae YDL102W CDC2 Catalytic subunit of DNA
                     polymerase delta required for chromosomal DNA replication
                     during mitosis and meiosis intragenic recombination repair
                     of double strand DNA breaks and DNA replication during
                     nucleotide excision repair (NER)"
                     /codon_start=1
                     /product="KLTH0F09966p"
                     /protein_id="XP_002554637.1"
                     /db_xref="GeneID:8292845"
                     /db_xref="GOA:C5DL49"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:C5DL49"
                     /translation="MGTQSLKRPGEGEPKDPESVERRMKPQSFDHSSLSEPVSTIEII
                     PSDKFKKQKTVGYKPKDSTNASQTLTPTQFEEQLSSMDHDTVNAQEHGQEKTWSRESL
                     PSDFSSQTHSISFQQLDAEQSFIPGYVDQNTSAVVRFFGVTDQGHSVLCSVTGFRHYL
                     YVPAPAGFTQQDIHGFLEYLNSSYDNTVDEIEITARQSIWGYSGTAKLPFLKIYTNNP
                     NAINKLRTGFERGHINYNDSWFSGGTTSYDNIAYPLRLMIDCGITGMSWITLPEGKYS
                     MTPPNQKVSTCQLEVRINFKDLIARPAEGEWSHSAPLRILSFDIECSGRVGVFPEPDV
                     DPVIQIANVVSVAGSSKSFIRNVFTVNSCSPITGSQIFEHKTENEMLKHWRQFVVETD
                     PDVIIGYNTANFDLPYLIDRARALKIEEFPYFGRLSNVKQEVKESVFSSKAYGTRTSK
                     NINIDGRLQLDLFQFVQREYKLRSYTLNAVSAHFLGEQKEDVHYSIISSLQNGDSETR
                     RRLAVYCLKDAFLPLRLMEKLMALVNYTEMARVTGVPFSYLLSRGQQIKVVSQLFRKC
                     LQIDTVIPNMQSQGSDEQYEGATVIEPIRGYYDLPIATLDFNSLYPSIMMAHNLCYTT
                     LASKTTVETLKLKKDEEYIITPNGDYFVTSKVRSGILPEILYELINARKRAKNDLKAE
                     KDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTSFGRTMIEKTKEAV
                     EEKYSLKNGFKHDAVVVYGDTDSVMVKFGTHDLAEAMELGTEAAAYVSSLFKNPINLE
                     FEKAYFPYLLINKKRYAGLYWTNPNKYDKLDQKGLASVRRDSCPLVSIVMNKVLKKIL
                     IDRDVDGALKFIKEIIEEILHNRADISKLIISKTLAPNYTNPQPHAVLTERMKKRDGT
                     GPNVGDRVDYVVIGGNDKLYNRAEDPLYVLEHNIQIDSKYYLTNQLQNPIISIIAPII
                     GEKQANSMFVVKSIKISTGNAKGGLMGFIKKVQTCKGCKGPLKKGEGPLCKNCSSRSG
                     ELYVRALYDVRDLEEKFARLWTQCQRCSGSLHNEVLCSNKNCDIFYMRVKAKKELQEK
                     VEELGKW"
     gene            complement(<868693..>869931)
                     /locus_tag="KLTH0F09988g"
                     /db_xref="GeneID:8292846"
     mRNA            complement(<868693..>869931)
                     /locus_tag="KLTH0F09988g"
                     /product="KLTH0F09988p"
                     /transcript_id="XM_002554592.1"
                     /db_xref="GeneID:8292846"
     CDS             complement(868693..869931)
                     /locus_tag="KLTH0F09988g"
                     /note="similar to uniprot|P39009 Saccharomyces cerevisiae
                     YDL101C DUN1 Cell-cycle checkpoint serine-threonine kinase
                     required for DNA damage-induced transcription of certain
                     target genes phosphorylation of Rad55p and Sml1p and
                     transient G2/M arrest after DNA damage also regulates
                     postreplicative DNA repair"
                     /codon_start=1
                     /product="KLTH0F09988p"
                     /protein_id="XP_002554638.1"
                     /db_xref="GeneID:8292846"
                     /db_xref="GOA:C5DL50"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DL50"
                     /translation="MLVNIVDRSRNGTFVNGNRLVKKDYILRNGDRIVFGRSCSFLFK
                     YLVDGREEKDPQTSTESPGKEEVNDLFKRPTLSSQTPMKRPLSLQRRSFFDRYIPGKE
                     LGSGHYAIVKEATDKDSGDVVAVKIFHPQQNDDQKKTRQFREETKILMSIQHKNIVKL
                     IDRFVEPVSKAQIQTYLVLEKVSDGELFDRIVRKTKLRQEETNAIFKQILNGLKYLHA
                     KNIIHRDIKPENILLSIRRRRYQDEQQMGPWDDDEIDITIKIADFGLAKFIGELQFTN
                     TLCGTPSYVAPEVLRKTGYSSRVDLWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILQG
                     KFAFYSPYWDDIDDSCLHLISNLLVVNPALRYDIQKTIEHPWFSHAPQTTRATALPLQ
                     RKSAEVGKIPKTYSEMSSLH"
     gene            complement(<870395..>872626)
                     /locus_tag="KLTH0F10010g"
                     /db_xref="GeneID:8292847"
     mRNA            complement(<870395..>872626)
                     /locus_tag="KLTH0F10010g"
                     /product="KLTH0F10010p"
                     /transcript_id="XM_002554593.1"
                     /db_xref="GeneID:8292847"
     CDS             complement(870395..872626)
                     /locus_tag="KLTH0F10010g"
                     /note="similar to uniprot|Q03823 Saccharomyces cerevisiae
                     YMR160W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F10010p"
                     /protein_id="XP_002554639.1"
                     /db_xref="GeneID:8292847"
                     /db_xref="UniProtKB/TrEMBL:C5DL51"
                     /translation="MTEESPNAEGTDHDDQNSTWAKWMSAPLRGFFNQANNNGTNPEE
                     SKRSDEQVPTPWLSGLAQRLPSFSFPPQDEAVDIKDLADYANLNAKQIQLLELEAQQG
                     IVKKADTWCWFEDITSSSSADLTLQQPGELSVYNTGSSVCPLPLTKFPISKSDCPRFM
                     VENSTLLPNTVPEELYHERNTFNKVVTAFRNYYNFPSERHTYLRSGPAHSRLKEKKVV
                     VISFVGNLPDRYRKITLGKMCSARHLSLKLSASLKDFSPQQVLAFSLEVPLDQKPLEE
                     CFEECTQLLKNWRHQFDGTCLLLFNGLYHSVPLQIMVAKRMLEDAHGFGMKQVPSVGL
                     LCLESCLGGYQFWDHSSDITIDPASANYQANREKVLFQGCTRIQQEILSQISEYKDLN
                     SPKSKQVREALDWLFQNCASAKLVLMGKLYESFMTVGQKLAIDYQHPNIIRHVWLSGS
                     DLGMDLKKADKFLPTKDEFSAQPFFHQRQLDIPKDRLFEICLIRDLITAVNLGYEEAA
                     IMTKMISPFFISRSFNQHTLPATLKKQQQYELKAWLQEMDLKWKTFDVAKDGGLPAVV
                     GNVADQLEYILYKATRQSPEHIKIKSGMFEDSQVYSAFVLDIVKTTTLLEPRKLAFTT
                     GSAETSSILSSRSQYDLVWQLHSFFSFFTDLRNLPEQTLPKLLFLLSRQPASAKLIDY
                     SPTRFRRTNDEALSRLRELWEVYHDWKPPTKALKQLQRILSFLSLYPSSVRFQSDMNR
                     TKC"
     gene            <872882..>873247
                     /locus_tag="KLTH0F10032g"
                     /db_xref="GeneID:8292848"
     mRNA            <872882..>873247
                     /locus_tag="KLTH0F10032g"
                     /product="KLTH0F10032p"
                     /transcript_id="XM_002554594.1"
                     /db_xref="GeneID:8292848"
     CDS             872882..873247
                     /locus_tag="KLTH0F10032g"
                     /note="weakly similar to uniprot|Q03818 Saccharomyces
                     cerevisiae YMR159C ATG16 Protein that interacts with the
                     Atg12p-Atg5p conjugate during formation of the
                     pre-autophagosomal structure essential for autophagy"
                     /codon_start=1
                     /product="KLTH0F10032p"
                     /protein_id="XP_002554640.1"
                     /db_xref="GeneID:8292848"
                     /db_xref="InterPro:IPR013923"
                     /db_xref="UniProtKB/TrEMBL:C5DL52"
                     /translation="MSGLLLERLQERDSIEKNFSELFSEPFVDQKAPSRKASEDQLAA
                     LKSELESKDREISDLKATLKLKSKDTEHLNDEIITLNIENNLLEERLNKTKAEYDEIV
                     QRWLKKVQQEANVMNDTLK"
     gene            complement(873869..873971)
                     /locus_tag="KLTH0F10054r"
                     /db_xref="GeneID:8292849"
     tRNA            complement(join(873869..873904,873936..873971))
                     /locus_tag="KLTH0F10054r"
                     /product="tRNA-Trp"
                     /note="tRNA-Trp (CCA) cove"
                     /db_xref="GeneID:8292849"
     gene            874333..874405
                     /locus_tag="KLTH0F10076r"
                     /db_xref="GeneID:8292850"
     tRNA            874333..874405
                     /locus_tag="KLTH0F10076r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=73.94"
                     /db_xref="GeneID:8292850"
     gene            complement(<874521..>875570)
                     /locus_tag="KLTH0F10098g"
                     /db_xref="GeneID:8292851"
     mRNA            complement(<874521..>875570)
                     /locus_tag="KLTH0F10098g"
                     /product="KLTH0F10098p"
                     /transcript_id="XM_002554595.1"
                     /db_xref="GeneID:8292851"
     CDS             complement(874521..875570)
                     /locus_tag="KLTH0F10098g"
                     /note="highly similar to uniprot|Q12154 Saccharomyces
                     cerevisiae YDL100C ARR4 ATPase involved in resistance to
                     heat and metal stress active as a dimer normally localized
                     to the cytosol but appears to localize to late endosomes
                     under stress conditions"
                     /codon_start=1
                     /product="KLTH0F10098p"
                     /protein_id="XP_002554641.1"
                     /db_xref="GeneID:8292851"
                     /db_xref="GOA:C5DL53"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /translation="MDLIAEPNLKELINSTTHKWIFVGGKGGVGKTTSSCSISIQMAL
                     AQPKKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMDNLSCMEIDPSAALKDMNDMSV
                     AQNDKNDGFSDLLQGGGLAELTGSIPGIDEALSFMEVMKHIKRQEEGEGEKYDTVIFD
                     TAPTGHTLRFLQLPQTLSQLLQKFGEIAGRFGPMLNSLTGGGQNMDIMGKVDELKANV
                     EKIREQFTNPDMTTFVCVCISEFLSLYETERLIQELMSYEMDVNSIIVNQLLFADDDA
                     EHNCRRCQARWNMQKKYLDQIGELYDDFHVVKMPLCAGEIRGLNNLKKFSQFLNKEYD
                     PVADNKIIYELEEQK"
     gene            <875820..>876821
                     /locus_tag="KLTH0F10120g"
                     /db_xref="GeneID:8292852"
     mRNA            <875820..>876821
                     /locus_tag="KLTH0F10120g"
                     /product="KLTH0F10120p"
                     /transcript_id="XM_002554596.1"
                     /db_xref="GeneID:8292852"
     CDS             875820..876821
                     /locus_tag="KLTH0F10120g"
                     /note="weakly similar to uniprot|Q12191 Saccharomyces
                     cerevisiae YDL099W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="KLTH0F10120p"
                     /protein_id="XP_002554642.1"
                     /db_xref="GeneID:8292852"
                     /db_xref="UniProtKB/TrEMBL:C5DL54"
                     /translation="MSEEEEKRLKQLEEARRRVQELKNKKKKKDKKKKTKGEENESEV
                     GNASENTSEAVEERVDVAPDANAAHSDDTAEKLDNRAPEIVNVESSVETQESEGTSEA
                     LSVPKNDVQEVETATTENEEKGAEEGLINEEEKHKDEEQADVEVENAQSAEDNTVEAA
                     LEGTGQNSAETETIVEQQRSDDQATELFSSDNDNKDSDFLTELQRENDRLALIDLEKQ
                     VSELSSQLRSLKFVNMEQETTVEELQERVHELEQEVSVSQQELASVKQELMQEKQKTA
                     RSAASTEPSLLQTRSSTFSPYANNNPVVDRAAIDKWKNWNVDMTAWRSIGSGPVVHF"
     gene            complement(<876890..>877357)
                     /locus_tag="KLTH0F10142g"
                     /db_xref="GeneID:8292853"
     mRNA            complement(<876890..>877357)
                     /locus_tag="KLTH0F10142g"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_002554597.1"
                     /db_xref="GeneID:8292853"
     CDS             complement(876890..877357)
                     /locus_tag="KLTH0F10142g"
                     /note="highly similar to uniprot|Q03799 Saccharomyces
                     cerevisiae YMR158W MRPS8 Mitochondrial ribosomal protein
                     of the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_002554643.1"
                     /db_xref="GeneID:8292853"
                     /db_xref="GOA:C5DL55"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:C5DL55"
                     /translation="MSLVHLANVCAHLQNCSRARASLTSIPYTRLHLNFAYNLYKHGF
                     LSTLQRGSTKGPDASAVEVTPDNISTRRLWVGLKYRENKPVISTCRLISKPNLRIELP
                     YDDLKQLCTGKTVRLIKPLQPGELMLVRCGKDLLDINEAVARKVGGEVLCRIK"
     gene            <877585..>878268
                     /locus_tag="KLTH0F10164g"
                     /db_xref="GeneID:8292854"
     mRNA            <877585..>878268
                     /locus_tag="KLTH0F10164g"
                     /product="KLTH0F10164p"
                     /transcript_id="XM_002554598.1"
                     /db_xref="GeneID:8292854"
     CDS             877585..878268
                     /locus_tag="KLTH0F10164g"
                     /note="similar to uniprot|Q03798 Saccharomyces cerevisiae
                     YMR157C FMP39 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0F10164p"
                     /protein_id="XP_002554644.1"
                     /db_xref="GeneID:8292854"
                     /db_xref="GOA:C5DL56"
                     /translation="MLPVRSARNWLTLRNSWLLLRNAGRRSFYSTKPKAPRKDELPSF
                     TKIALVGVVGTIIFAEAVKSLDKNQPKNSYSESEYAEVVKNMKRRKVMFSPGELKVQI
                     AVQGVNPGNFHDRGRIVEPFEVAETYRKMDNDRYQPLLNDLRDTYGDQYVQNLPQGLL
                     VMLIGRYLKDTCQKGDSVLVVDFPLDMSDAIKFENEISVVDKVLFNSPEADSDLAKYY
                     QTVNKVEIL"
     gene            complement(<878318..>878878)
                     /locus_tag="KLTH0F10186g"
                     /db_xref="GeneID:8292855"
     mRNA            complement(<878318..>878878)
                     /locus_tag="KLTH0F10186g"
                     /product="KLTH0F10186p"
                     /transcript_id="XM_002554599.1"
                     /db_xref="GeneID:8292855"
     CDS             complement(878318..878878)
                     /locus_tag="KLTH0F10186g"
                     /note="similar to uniprot|Q12368 Saccharomyces cerevisiae
                     YDL098C SNU23 23 kD U4/U6.U5 snRNP associated protein
                     Putative RNA binding zinc finger protein"
                     /codon_start=1
                     /product="KLTH0F10186p"
                     /protein_id="XP_002554645.1"
                     /db_xref="GeneID:8292855"
                     /db_xref="GOA:C5DL57"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:C5DL57"
                     /translation="MSNFGRRTWDRDEYAELERESRGKLATIAEKLNPQQLEKLKTRY
                     SNHALLVAEATQNSNERVLAPTITSYKKGKQFGFYCELCDLTFKDTLQFVNHLNHKTH
                     QIKFELTFGESLILDLRDNEDVTVQEFEEVYSNLIRDFLKENRQDSRPAKKLKSEKKK
                     VAEENLPLSDGVNKIMGFTGFGSTKK"
     gene            <878993..>879715
                     /locus_tag="KLTH0F10208g"
                     /db_xref="GeneID:8292856"
     mRNA            <878993..>879715
                     /locus_tag="KLTH0F10208g"
                     /product="KLTH0F10208p"
                     /transcript_id="XM_002554600.1"
                     /db_xref="GeneID:8292856"
     CDS             878993..879715
                     /locus_tag="KLTH0F10208g"
                     /note="similar to uniprot|Q03796 Saccharomyces cerevisiae
                     YMR156C TPP1 DNA 3'-phosphatase that functions in the
                     repair of endogenous DNA damage functionally redundant
                     with Apn1p and Apn2p"
                     /codon_start=1
                     /product="KLTH0F10208p"
                     /protein_id="XP_002554646.1"
                     /db_xref="GeneID:8292856"
                     /db_xref="InterPro:IPR006551"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DL58"
                     /translation="MTPRLSHRTVVLPHMIKFLPKLPVAGELPRVYGFDLDHTLIKPK
                     SGGRFGRSADDWMFMSYALKSDRSSEKDASKVRRSADTLVDILSVDANAHVVVFSNQG
                     GVITVPRDSKSCVKYMNKIETILKDPSLEKVRDRIWLYASPKRPASLSNKKTKPGKIT
                     KAARTLPEKKPVADTTYPFETMRKPNIGMYEEFKKDFPGEFEFVYYCGDAAGRASDFS
                     DSDKMFAQNVGSEFRTPEEVFI"
     gene            complement(<879777..>881045)
                     /locus_tag="KLTH0F10230g"
                     /db_xref="GeneID:8292857"
     mRNA            complement(<879777..>881045)
                     /locus_tag="KLTH0F10230g"
                     /product="KLTH0F10230p"
                     /transcript_id="XM_002554601.1"
                     /db_xref="GeneID:8292857"
     CDS             complement(879777..881045)
                     /locus_tag="KLTH0F10230g"
                     /note="highly similar to uniprot|Q12377 Saccharomyces
                     cerevisiae YDL097C RPN6 Essential non-ATPase regulatory
                     subunit of the 26S proteasome lid required for the
                     assembly and activity of the 26S proteasome the human
                     homolog (S9 protein) partially rescues Rpn6p depletion"
                     /codon_start=1
                     /product="KLTH0F10230p"
                     /protein_id="XP_002554647.1"
                     /db_xref="GeneID:8292857"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:C5DL59"
                     /translation="MASIEEARKLVENKEYSKAEELYISLLKDSSDTSKSSAKTQTQE
                     QCIVELGSLYGLSNQPDKLAEFIPHARELMMQYAKSKTAKVLKTLIDQFDKIPNSLDK
                     QIEVCKESIEFATKEKRVFLKHSLSIRLATLYFEKTQYNESLQLINGLLREFKKLDDK
                     SSLVDVHLLEAKVYHKLRNLAKAKAALTSARTAANSIYCPTLTVAELDLISGMLHCED
                     KDYKTAFSYFYEAFEGFHNQSTNSQEKAAQVLNYMLLSKIMLNLIDEVNSILNAKYTK
                     ESYQSRGIDAMKAVAEAYSHRSLLEFNAALKKYEKELMGDSLIRSHFNALYDTLLESN
                     LCKIIEPFDCVEVRHISKMIGLDSQQVEGKLSQMILDKVFYGVLDQGNGWLYIYETPH
                     QDATYDSSLELIGQLNKVVEQLFEKASVLN"
     gene            <882483..>884990
                     /locus_tag="KLTH0F10252g"
                     /db_xref="GeneID:8292858"
     mRNA            <882483..>884990
                     /locus_tag="KLTH0F10252g"
                     /product="KLTH0F10252p"
                     /transcript_id="XM_002554602.1"
                     /db_xref="GeneID:8292858"
     CDS             882483..884990
                     /locus_tag="KLTH0F10252g"
                     /note="similar to uniprot|P33775 Saccharomyces cerevisiae
                     YDL095W PMT1 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway acts in complex with
                     Pmt2p dolichyl phosphate-D-mannose:protein O-
                     D-mannosyltransferase"
                     /codon_start=1
                     /product="KLTH0F10252p"
                     /protein_id="XP_002554648.1"
                     /db_xref="GeneID:8292858"
                     /db_xref="GOA:C5DL60"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DL60"
                     /translation="MPPKAYSESQGTGSQDPVPDLNIGKGPERPYVVTEPPSSLVESR
                     TPKSAKEKLTIAVLLLVTAFVRLYGLSYPNSVVFDEVHFGGFASKYIKGVFFMDVHPP
                     LAKMLFAAIGSIAGFTGDFDFESIGQMFPATTPYFFMRLFPAVLGTLTVLLMYMTLRC
                     SGVRVPIAFIASLCFAVENSYVTISRYILLDAPLLFFIASAVYSFKKYEIYPQGSWNS
                     QKALLSTGLALGMALSAKWVGLFTIAWVGILCVWRLWFMIGDLSKPIRKTVREAVRKF
                     SFLLVIPLVIYVFFFYVHFKCLTIHSDGAGFFSSAFRTTLQGNTIPQNILADVGIGST
                     VSIRHIATMGGYLHSHDHMYEKGSQQQQVTLYPHLDGNNDWLIELHDKPNTPVTSFEG
                     LKDGTIIKLKHVISQRRLHSHDHKAPVSESADWQKEVSCYGFDGFEGDGNDNWAIEID
                     KDATAPGEAQERVKALETKFRLKHTIMNCHLFSHEVKLPKWGFEQQEVTCASQGKPHL
                     TLWYIEGNSHPLLNETSERVSYKEPTFLEKLVESHQKMWHINKNLNEPHIYESKPHSW
                     PFLLRGINYWGHDHKQVYLLGNAIVWWSVTAFIAIFGLLVGYELLAWQLGKPILQDAK
                     VVNFHVQTIHYLLGYVLHYIPSFLMGRQLFLHHYLAAYYFGILALAHAMEITVTYVFR
                     KRETVGYAIAGAFLSAVVYFFVSYRALIYGTPWTNELCQKSKWLSGWDYPCHNFLSSY
                     EDYKKLETEQAHQPVSPSNTLAAGADSQPTVAQQAPNAQQAIPEDFDVDEIIAAPGNK
                     KFVDQNGNELPFDVVKEVLDNGGSVMSVEHRSHTEIL"
     gene            complement(<885132..>887042)
                     /locus_tag="KLTH0F10274g"
                     /db_xref="GeneID:8292859"
     mRNA            complement(<885132..>887042)
                     /locus_tag="KLTH0F10274g"
                     /product="KLTH0F10274p"
                     /transcript_id="XM_002554603.1"
                     /db_xref="GeneID:8292859"
     CDS             complement(885132..887042)
                     /locus_tag="KLTH0F10274g"
                     /note="some similarities with uniprot|Q03795 Saccharomyces
                     cerevisiae YMR155W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F10274p"
                     /protein_id="XP_002554649.1"
                     /db_xref="GeneID:8292859"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DL61"
                     /translation="MAPPSRSQLLSCFIGSNIVALGAGTPYLYSFYAPQLLERCHIPV
                     SQSSTLSFALTIGSAALGFIAGLVIDRHSPQLSCGIGAVCTFLAYWILRFCYVHEIAS
                     IMLVSLALALVGFGSVSGFYASVKCCTTNFPRHRGTAGAFPVSLYALAGLVYSSLCAW
                     LFGDRMDAVFTVLMYMCSAMILTGCFTLRIMVGHTRPKKRRQSSVIDTSSSSNVRVNQ
                     ESSSEQLAQPIFIQNKPAKSASRGSFGNYQAMSSRSSSQVSGSVESFDSQNSTFKRTS
                     SFAWARDLPGSLSFWGFGRVRPSDTDLSRAPRASSGSLSQLNAERSGQIPANFLEPSQ
                     APRSPVTASRRDSLLKNSPPPTPSAPAEPDVLVFEPNNVEKSTYKDSHLYQTITKPKY
                     VAYYLILATLQGIGQTYIYSVGFVIEALVHANPDEKVNAKAIQSLQVSIISVMSFAGR
                     LSAGPVSDLLVKRLKAQREWCVLLACVLMYYGSNKLLSDTVTIKGMLGPQSISFIRNV
                     SLTSLIIGYAFGVTFGTFPAIIADQFGTEGFSTIWGLTTTGGIISVKLFSGIFARDFS
                     NNTEPNEAFCEKGTLCYTHTFHVLAHLATAVGVVSIALIFVRYMKKRFKGERMHHAAE
                     FIIDEDAEAGSK"
     gene            <888200..>888613
                     /locus_tag="KLTH0F10296g"
                     /db_xref="GeneID:8292860"
     mRNA            <888200..>888613
                     /locus_tag="KLTH0F10296g"
                     /product="KLTH0F10296p"
                     /transcript_id="XM_002554604.1"
                     /db_xref="GeneID:8292860"
     CDS             888200..888613
                     /locus_tag="KLTH0F10296g"
                     /note="similar to uniprot|P38985 Saccharomyces cerevisiae
                     YDL092W SRP14 Signal recognition particle subunit"
                     /codon_start=1
                     /product="KLTH0F10296p"
                     /protein_id="XP_002554650.1"
                     /db_xref="GeneID:8292860"
                     /db_xref="GOA:C5DL62"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:C5DL62"
                     /translation="MSTSPHSTPEEFLKAVPDVFALANEGQNSINLSVKRLVTQDPVE
                     GNDEFNASELPQFDVSKKSQFTKVPQNANNKQYDVLVRLKKGSGEGVIKHSTVVKAEA
                     LDKFWKDYSAAIKSGMVGLVKKKKKKAKAKKSQRK"
     gene            complement(<888664..>889947)
                     /locus_tag="KLTH0F10318g"
                     /db_xref="GeneID:8292861"
     mRNA            complement(<888664..>889947)
                     /locus_tag="KLTH0F10318g"
                     /product="KLTH0F10318p"
                     /transcript_id="XM_002554605.1"
                     /db_xref="GeneID:8292861"
     CDS             complement(888664..889947)
                     /locus_tag="KLTH0F10318g"
                     /note="similar to uniprot|Q12229 YDL091c Saccharomyces
                     cerevisiae UBX3 UBX domain-containing protein that
                     interacts with Cdc48p"
                     /codon_start=1
                     /product="KLTH0F10318p"
                     /protein_id="XP_002554651.1"
                     /db_xref="GeneID:8292861"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DL63"
                     /translation="MDFFQRLLRSREQGFSQIPGSFPESEEHGNSTPPQHRTPLESVL
                     RACLGVPLWLLYHLFSFLALAVSLLRPLNRVYGFYNRKNRTLSHEDALSVLIDALSLE
                     YSSSSAGNADEQSALRDSFSFASVYGLENAVLSSYIQRGYAQLLKAASEQGKFAIIYL
                     HNPLADDCGQYLSKILCTERFVNLAQKYETLLWFGDVTVSEGLQVANSLKVRQFPFLG
                     LLAMKSGSKIELIERLEGELLTYSLDSLEAKLAKFYPRLIELRQQHQNTELRRLMREQ
                     QDSRFQESLRQDQERDRRQEAARQREAEERHEQGLKKQWLLWRRSVLADAPTSMESAC
                     KVAIRTAANGRVVQKFDASLPVEEIYAYVELLSQGMLETQRDPHSSLQKPDYEYRYPF
                     MLITPVPRVELDPQAIIRDVEVIYPSGNIVMESLE"
     gene            complement(<890083..>891582)
                     /locus_tag="KLTH0F10340g"
                     /db_xref="GeneID:8292862"
     mRNA            complement(<890083..>891582)
                     /locus_tag="KLTH0F10340g"
                     /product="KLTH0F10340p"
                     /transcript_id="XM_002554606.1"
                     /db_xref="GeneID:8292862"
     CDS             complement(890083..891582)
                     /locus_tag="KLTH0F10340g"
                     /note="similar to uniprot|P22007 Saccharomyces cerevisiae
                     YDL090C RAM1 essential for processing of ras proteins beta
                     subunit of farnesyltransferase"
                     /codon_start=1
                     /product="KLTH0F10340p"
                     /protein_id="XP_002554652.1"
                     /db_xref="GeneID:8292862"
                     /db_xref="GOA:C5DL64"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:C5DL64"
                     /translation="MNTATAFLEACNELYITLKENAIPTAWRGARAGSSCESAVCACL
                     VCVCVLSACTHCFPFTRALCSFGLVFRTNHLKKPPAPMAGSDLRTVRFINTQLLGRRR
                     PTVELVSEDEHDLQEDPAIAMNSLSTETTADREEVLFDCAELYEALADVEPTLFKHAH
                     RSYLDYALGHPLPPQMKALDASQPWLLYWTACALRLMDPQWLTQDVQRKMVHKLALCA
                     LDSGPYCGGFGQQAHLVCNYAAINALALCDNIDGCWASIKREGIYEWLLTLKMPGGGF
                     RTGALLGECDSRSTYCALSVASMLGVLTPELCEGVEAFLLRCQTYEGGFGACPHEDEA
                     HGGYTFCAAAGLAILGSLRKCDTAKLLDWCSARQTNEEKGLSGRSNKLVDGCYSYWVG
                     AVAAILEAYGLGESIDKSQLREYILKCCQSKERPGLRDKPGKSPDYYHTAYVLMGLSA
                     TEYSFSVRDCPQRIQSARLVEQPDVEPVNPIFGLPIDVLARFVDYNAAR"
     gene            complement(<891631..>892674)
                     /locus_tag="KLTH0F10362g"
                     /db_xref="GeneID:8292863"
     mRNA            complement(<891631..>892674)
                     /locus_tag="KLTH0F10362g"
                     /product="KLTH0F10362p"
                     /transcript_id="XM_002554607.1"
                     /db_xref="GeneID:8292863"
     CDS             complement(891631..892674)
                     /locus_tag="KLTH0F10362g"
                     /note="some similarities with uniprot|P10080 Saccharomyces
                     cerevisiae YHL034C SBP1 Single-strand nucleic acid binding
                     protein"
                     /codon_start=1
                     /product="KLTH0F10362p"
                     /protein_id="XP_002554653.1"
                     /db_xref="GeneID:8292863"
                     /db_xref="GOA:C5DL65"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DL65"
                     /translation="MSATTENAASPVEAPVEAPVDASAGAATGTAAAAPVESGSAAPR
                     SKVDPETTIFIGNVARDCQEEDLKKVFEEDVEVEIPSVKSGRLFKQRYAFVKFPHKID
                     FDAVKAKYDKTVIKERGIYIRRAQTEEERDAKRKARAERPRKAAAATTGGSAEAETPA
                     SAGEAATDAADAASGVSGAGKKPARSAVPAPPKRQERPRVPLETMERSTDTLYVNNVP
                     YFATKEELAEFFGTTPELVVLPLRRMRNVKTKQFFYSKRMNRGIAFVTFENCADIAQK
                     VQEFQGKSLNDRELAVDVAALKPPREDQKPQDAEQPAQATEPEQSTQSTQSAEPAKPA
                     EPVAASQQDSPAA"
     gene            <893564..>897757
                     /locus_tag="KLTH0F10384g"
                     /db_xref="GeneID:8292864"
     mRNA            <893564..>897757
                     /locus_tag="KLTH0F10384g"
                     /product="KLTH0F10384p"
                     /transcript_id="XM_002554608.1"
                     /db_xref="GeneID:8292864"
     CDS             893564..897757
                     /locus_tag="KLTH0F10384g"
                     /note="highly similar to uniprot|P07702 Saccharomyces
                     cerevisiae YBR115C LYS2 Alpha aminoadipate reductase"
                     /codon_start=1
                     /product="KLTH0F10384p"
                     /protein_id="XP_002554654.1"
                     /db_xref="GeneID:8292864"
                     /db_xref="GOA:C5DL66"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR010080"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR014397"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:C5DL66"
                     /translation="MQMSGQDHQVSSEQQALQQWAQILDNPTLSVLPHDFLRPHSEPL
                     VEQREQLAQVPQLALPHGKDAYTAAVAAWASLVLRLTGDDDIVLLVSERKVARFTVQA
                     DWTFAQAYEAAARALRAAEQRPAVCFDALAEHVQRAQGVELAPQLFRLACVQDAPVSL
                     GGEFRTQRLDAVLSVRDGGATVGIAYNALLFSERRIAILLDQFTQFVSRVLQDDSQRV
                     GAVPLVTASSTDVLPDPTVDLGWCDFAGCIHDIFQDNAERFPERTCVVETPGNSGAAS
                     RVFTYQDINRASNVVAHYLVRTGVKRGDVVMIYSSRGVDLMVCVLGVLKAGATFSVID
                     PAYPPARQTVYLGVARPRGLIVIRAAGQLDQYVEDYISRELDVVSRIPAVAIQDHGRV
                     LGGAAAGSAEDCLAPFTGLCDTRTGVVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLAY
                     YFSWMARQFNLSENDKFTMLSGIAHDPIQRDMFTPLFLGAQLLVPTQDDIGTPGQLAE
                     WMSKYGATVTHLTPAMGQLLTAQATTPFPALHHAFFVGDILTKRDCLRLQTLAENVRI
                     VNMYGTTETQRAVSFFEVKSRSEDPDFLKRLKDVMPAGKGMLNVQLLVVNRNDRTQVC
                     GIGEVGEIYVRAGGLAEGYRGLPDLNKEKFVQNWFVDPHHWDALDKGGDEPWRQFWLG
                     PRDRLYRTGDLGRYTPDGNCECCGRADDQVKIRGFRIELGEIDTHISQHPLVRENITL
                     VRKNSENEPTLITFMVPRFDKPEELSRFESEISEDAAQDPVVKGLIKFRLLAKDIKES
                     LKKRLASYAIPSVIVVLEKLPLNPNGKVDKPKLQFPTAKQLATVAENSSMDVDDSEFT
                     PVEREVRDLWLEVLPTRPASISPDDSFFDLGGHSILATRMIFSLRNKLDVDLPLGTIF
                     KYPTIKLFAGEVARARTTESSADPGVEAATADYYGDAKKLVESSLSKAYPSRDPLPEE
                     GSGILNVFVTGVTGFLGSYILADLLNRSASPYTIKVFAHVRAKDEASAMDRLKKAGVI
                     YGTWSDDFASRIQVVLGDLSKEQFGMDSAKWEQLTKEVDVIIHNGALVHWVYPYAKLR
                     DPNVVSTINVMNLAASNKPKYFNFVSSTSTIDTPHYFELSDKLATEGKGLLEGDDLMG
                     SATGLTGGYGQSKWAAEYIIRRAGERGLRGCIVRPGYVTGASSNGSSNTDDFLLRFLK
                     GVVQLGKIPDVRNTVNMVPVDQVARVVTATALTPPKEDALTVAHVTAHPRCLFKDYLS
                     ELEKYGYPVEVVSYDVWKKTLEESVMKGLEENALYPLLHMVLDNLPENTKAPELDDSN
                     AVVSLKKDAKIIGEDCSAGKGATPEQIGIYIAFLNKVGFLPPPPQAGDLPLPEIKLSG
                     EQIELVASGAGARGSSAAA"
     gene            complement(<897851..>900148)
                     /locus_tag="KLTH0F10406g"
                     /db_xref="GeneID:8292865"
     mRNA            complement(<897851..>900148)
                     /locus_tag="KLTH0F10406g"
                     /product="KLTH0F10406p"
                     /transcript_id="XM_002554609.1"
                     /db_xref="GeneID:8292865"
     CDS             complement(897851..900148)
                     /locus_tag="KLTH0F10406g"
                     /note="highly similar to uniprot|P31244 Saccharomyces
                     cerevisiae YBR114W RAD16 Protein that recognizes and binds
                     damaged DNA in an ATP-dependent manner (with Rad7p) during
                     nucleotide excision repair subunit of Nucleotide Excision
                     Repair Factor 4 (NEF4) member of the SWI/SNF family"
                     /codon_start=1
                     /product="KLTH0F10406p"
                     /protein_id="XP_002554655.1"
                     /db_xref="GeneID:8292865"
                     /db_xref="GOA:C5DL67"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DL67"
                     /translation="MLEEGGFIRKTRTRRKRKVDYKEDSDGELVRNDTSADDNYSDLG
                     KEETPVIIESSDEKPNLDKLIEIKSEEEDEDEDDLPLAKRRKADASPAKGAKKGAKGK
                     KKSTAKPKKPKTTPYERNTARLFENHPYLKTVFSDLSNAPAYKAHRAPQPEGLTIKLL
                     PFQLEGLYWLIAQEQSIYNGGVLADEMGMGKTIQTIALLMNDVSKKPSLVVAPTVALM
                     QWKNEIEQHTGGKLKTYIYHGANRTSNVGEFKDVDVLLTTYSVLESVFRKQTYGFRRK
                     NGVYKERSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLITEKKWCLTGTPLQNRIG
                     EMYSLIRFLNIDPFSKYFCTKCNCESREWKFTDRMHCDGCGHVVMQHTNFFNHFALKN
                     IQKHGIEGPGLESFQNIQTLLKNIMLRRTKVERADDLGLPPRIVTVRRDYFNEEEKDL
                     YRSLYTDVKRKFNSYVEEGVVLNNYANIFTLITRMRQLADHPDLVLKRMKNGIGVDDN
                     VIVCQLCDDEAEEPIESKCHHKFCRLCIKEYIESFMENLEKLTCPVCHIALSIDLSQP
                     ALEFDDAAQKKQSIVNRLNIQGSWRSSTKIEALVEELYNLRSDRRTIKSIVFSQFTSM
                     LDLVEWRLKRAGFQTVKLQGSMTPTQRDQTIKYFMENTHCEVFLVSLKAGGVALNLCE
                     ASQVFIMDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIESRIIELQEKKANMI
                     HATINQDDAAINRLTPGDLQFLFNN"
     gene            <902697..>905084
                     /locus_tag="KLTH0F10428g"
                     /db_xref="GeneID:8292866"
     mRNA            <902697..>905084
                     /locus_tag="KLTH0F10428g"
                     /product="KLTH0F10428p"
                     /transcript_id="XM_002554610.1"
                     /db_xref="GeneID:8292866"
     CDS             902697..905084
                     /locus_tag="KLTH0F10428g"
                     /note="highly similar to uniprot|P14922 Saccharomyces
                     cerevisiae YBR112C CYC8 General transcriptional
                     co-repressor acts together with Tup1p also acts as part of
                     a transcriptional co-activator complex that recruits the
                     SWI/SNF and SAGA complexes to promoters"
                     /codon_start=1
                     /product="KLTH0F10428p"
                     /protein_id="XP_002554656.1"
                     /db_xref="GeneID:8292866"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DL68"
                     /translation="MNTLPSQGALATSAVGQLSPRVQQVSPAQLVANIAVQQQQQPVV
                     QVQAQAQAPADPLTQSTAETWLSIASLAETLGDADRAAMAYDATLQYNPSSTKALTSL
                     AHLYRSRDMFQRAAELYQRALSINPELGDIWATLGHCYLMLDDLQRAYAAYQQALYHL
                     SNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPQFEKANEIYFRLGIIYKHQGK
                     WNQALECFRYILTQPPAPLQEWDVWFQLGSVLESMSEWQGAREAYEHVLLQNERHAKV
                     LQQLGCLYGMQNVQFYDTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDA
                     FQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYET
                     CNNQLTDALDAYKQAARLDTNNVHIRERLEALTEQLANQSNGNVMAHQPKAATASNPP
                     PVMLQPTLQSTDDGNPLNKSSVYVQPQMQAQMQNALPGHMQPHVQAQLQSQALSQQQL
                     APQPQLQMQGHQQPQLQQFRPLPQGVGPPVVGNSVPFNESAHSTGSSGGQTHALPQII
                     NQPQQLNPGSNKPPQKRPMEGGMDTLVNAAVSSAATPPSDASPAPFSKNTGAAVEGTE
                     PKRRKPSTSATKSLLAQSPQQASGTKSAAASPASQESQAPAVNPPAAKAIGESPHEEP
                     SVADLAAVATPQEVQPQAEVPVQEKTKNSEPQPSQADTPDKSETAASTAPENQTVIKA
                     SPDAIEKLREEAELRKEEEQEALANEPSAAQDGNAKPPVNERAVRDVEEDENYDD"
     gene            complement(<905240..>905703)
                     /locus_tag="KLTH0F10450g"
                     /db_xref="GeneID:8292867"
     mRNA            complement(join(<905240..905319,905391..905530,
                     905624..>905703))
                     /locus_tag="KLTH0F10450g"
                     /product="KLTH0F10450p"
                     /transcript_id="XM_002554611.1"
                     /db_xref="GeneID:8292867"
     CDS             complement(join(905240..905319,905391..905530,
                     905624..905703))
                     /locus_tag="KLTH0F10450g"
                     /note="similar to uniprot|Q6WNK7 Saccharomyces cerevisiae
                     YBR111W-A SUS1 Protein involved in mRNA export coupled
                     transcription activation; component of the SAGA histone
                     acetylase complex"
                     /codon_start=1
                     /product="KLTH0F10450p"
                     /protein_id="XP_002554657.1"
                     /db_xref="GeneID:8292867"
                     /db_xref="GOA:C5DL69"
                     /db_xref="InterPro:IPR018783"
                     /db_xref="UniProtKB/TrEMBL:C5DL69"
                     /translation="MTANGAKTMELKAQIQQYLVESGNYELISNKLSRKLLEEGWTDQ
                     VKRMTSEEIRADDSASFTQILSKVEPKALGMVSDSTKDEILSQIRNFLSEIVETE"
     gene            <905820..>906524
                     /locus_tag="KLTH0F10472g"
                     /db_xref="GeneID:8292868"
     mRNA            <905820..>906524
                     /locus_tag="KLTH0F10472g"
                     /product="KLTH0F10472p"
                     /transcript_id="XM_002554612.1"
                     /db_xref="GeneID:8292868"
     CDS             905820..906524
                     /locus_tag="KLTH0F10472g"
                     /note="similar to uniprot|Q01976 Saccharomyces cerevisiae
                     YBR111C"
                     /codon_start=1
                     /product="KLTH0F10472p"
                     /protein_id="XP_002554658.1"
                     /db_xref="GeneID:8292868"
                     /db_xref="GOA:C5DL70"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:C5DL70"
                     /translation="MIRTCSRNLYDTARPLSSRTIGIKRMSSKGRPENAKFLKAHPVS
                     NADECKWIGLERIEYLDPNGTKRQWDSAVRRTRNSGGVDGVGILAILRAPGQDPEILL
                     QKQFRPPVEGVCIEMPAGLIDSEESVDMAALRELKEETGYSGKIVSKTPTIFNDPGFT
                     NTNLSLVTVEIDTSAPENQNPQTQLEDSEFIECIKVPLKNFADEMDNLAKQGYKLDAR
                     VQNVAQGIRLAQKYSL"
     gene            complement(906592..906673)
                     /locus_tag="KLTH0F10494r"
                     /db_xref="GeneID:8292869"
     tRNA            complement(906592..906673)
                     /locus_tag="KLTH0F10494r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (TGA) cove score=84.16"
                     /db_xref="GeneID:8292869"
     repeat_region   complement(906747..906988)
                     /rpt_type=long_terminal_repeat
     gene            complement(<907083..>908417)
                     /locus_tag="KLTH0F10538g"
                     /db_xref="GeneID:8292871"
     mRNA            complement(<907083..>908417)
                     /locus_tag="KLTH0F10538g"
                     /product="KLTH0F10538p"
                     /transcript_id="XM_002554613.1"
                     /db_xref="GeneID:8292871"
     CDS             complement(907083..908417)
                     /locus_tag="KLTH0F10538g"
                     /note="weakly similar to uniprot|Q12321 Saccharomyces
                     cerevisiae YPR070W MED1 Subunit 1 of the Mediator complex
                     essential for transcriptional regulation"
                     /codon_start=1
                     /product="KLTH0F10538p"
                     /protein_id="XP_002554659.1"
                     /db_xref="GeneID:8292871"
                     /db_xref="GOA:C5DL71"
                     /db_xref="InterPro:IPR019680"
                     /db_xref="UniProtKB/TrEMBL:C5DL71"
                     /translation="MIHAEARQRSQTPHSPPMSDAYAETLGQMICLLQEYKPGLVTLE
                     NITRLCKTLKLESFTDNIDNETIRLSTASKIIVIDMDFHKSDKQVKDVKLVLASNFDN
                     FNYYNDGDNGNILFNSLSCFPNLQTFYYNLRFLTTLDTHSNIETEPGIAAKREKLDLF
                     KYFTELPEYLRAYFKDISIDLDIKTNVDNRFGVYLTHNDKAVAQVGIEECQDHDHRFY
                     EFGYRSSGWINESPDNVTTGVILTLQFYDINMHIPKEAIPHDLLLDWDAQRPYTIVNH
                     CRSTPVSNDFTSTLVPATKFNISNENIELLGELLQWAGWWQQILHPVLQIIKCPAPAP
                     GNETKRRSSSNSTTISAQRRSSATRRRRSSQKGRRPSMNESSMVKDGVVPEFSLSEVM
                     SQPVLEDEDPSEPVDLALNEEYIQLGPGSRCDIHMGVHEWQEFLTKLKGCVA"
     gene            <909235..>910119
                     /locus_tag="KLTH0F10560g"
                     /db_xref="GeneID:8292872"
     mRNA            <909235..>910119
                     /locus_tag="KLTH0F10560g"
                     /product="KLTH0F10560p"
                     /transcript_id="XM_002554614.1"
                     /db_xref="GeneID:8292872"
     CDS             909235..910119
                     /locus_tag="KLTH0F10560g"
                     /note="highly similar to uniprot|Q12074 Saccharomyces
                     cerevisiae YPR069C SPE3 biosynthesis of spermidine
                     putrescine aminopropyltransferase (spermidine synthase)"
                     /codon_start=1
                     /product="KLTH0F10560p"
                     /protein_id="XP_002554660.1"
                     /db_xref="GeneID:8292872"
                     /db_xref="GOA:C5DL72"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DL72"
                     /translation="MSQEITHPTIKDGWFREISDTMWPGQAMTLRVEKVLHHEKSKYQ
                     DVLIFKSTDYGNVLVLDNAIQVTERDEFSYQEMIAHLGLNSHPNPKKVLVIGGGDGGV
                     LREIVKHESVEEAWLCDIDEAVIRLSKQYLPEMAASYSHPKVKTHIGDGFQFLRDYQN
                     TFDVIITDSSDPEGPAETLFQKPYFELLSSALTEKGVITTQGESIWLHLPIIKELKKA
                     CSEVFPTVEYAYTTIPTYPSGQIGFMVCSKDGSVDVKKPLRQKSDEEEAKLYKYYNKK
                     IHEAAFVLPTWAAKELEL"
     gene            <910298..>911722
                     /locus_tag="KLTH0F10582g"
                     /db_xref="GeneID:8292873"
     mRNA            <910298..>911722
                     /locus_tag="KLTH0F10582g"
                     /product="KLTH0F10582p"
                     /transcript_id="XM_002554615.1"
                     /db_xref="GeneID:8292873"
     CDS             910298..911722
                     /locus_tag="KLTH0F10582g"
                     /note="similar to uniprot|Q12214 Saccharomyces cerevisiae
                     YPR068C"
                     /codon_start=1
                     /product="KLTH0F10582p"
                     /protein_id="XP_002554661.1"
                     /db_xref="GeneID:8292873"
                     /db_xref="GOA:C5DL73"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:C5DL73"
                     /translation="MVYLTISTSPFQSQVSDLLPCNNNSKSSLSFALLNAYGLLKYFD
                     EVVSLPSSSINDLTPFHCKEYLKLVLDPELIKEASSDEVDRGWESLALMAKDWGELQS
                     DEQSFAWFENKKLLYEFYSHALGLEPCSEGESSVQCGELGPSDPGSPQRELLSGYNGG
                     FSETGLDRRVLEKYGLSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDG
                     GRHHASRSRASGFCYINDIALLIQKLRRRGIRRISYIDFDLHHCDGVERAFQHSQSVQ
                     TISVHLHEPGFFPGTGSLKEASVGKNVVNIPVQHGMDDTFLNQIVQRVIMPCIRSHNP
                     EVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERLMSR
                     FYTYLTWKVVEFSRGEGLKDPFDCEEDIIPDHEFIESYKDEFYKFWAYDIDGGKGKLL
                     KNENDLDYVMRLAGFYNVRNKEVV"
     gene            complement(<911719..>913062)
                     /locus_tag="KLTH0F10604g"
                     /db_xref="GeneID:8292874"
     mRNA            complement(<911719..>913062)
                     /locus_tag="KLTH0F10604g"
                     /product="KLTH0F10604p"
                     /transcript_id="XM_002554616.1"
                     /db_xref="GeneID:8292874"
     CDS             complement(911719..913062)
                     /locus_tag="KLTH0F10604g"
                     /note="similar to uniprot|P16661 Saccharomyces cerevisiae
                     YBR110W ALG1 Mannosyltransferase in the endoplasmic
                     reticulum"
                     /codon_start=1
                     /product="KLTH0F10604p"
                     /protein_id="XP_002554662.1"
                     /db_xref="GeneID:8292874"
                     /db_xref="GOA:C5DL74"
                     /db_xref="InterPro:IPR026051"
                     /db_xref="InterPro:IPR028098"
                     /db_xref="UniProtKB/TrEMBL:C5DL74"
                     /translation="MFEGLPQWVWWLLTVYASLPLVCYLTVPFLFYGNRSTKKRIIIC
                     VLGDLGHSPRMCYHARSFSQQGWQVELCGYLEEQPPSDILEDTNITIHQLPAFQGRKG
                     GSFLIKAVRKVSLQIYAILRLLWRLRGSDYFLLQNPPSIPILPMAAVYCTFSRCKLII
                     DWHNFGYSILKLKLGSFWHPLVLISFAVEYIFAKFAAYNLTVTRAMKDYLIHTFGLSK
                     KRVAVLYDRPAFQFRPLKADRQAALQQDFIKPFIPGDFNISKGDRIIVTSTSFTPDED
                     LSILIGALKIYENSCEKFDDKLPKILCFVTGKGPLKQHFIDKVAETKWDRVHIEFLWL
                     SNEDYPKLLQLCDYGVSLHTSSSGLDLPMKILDMFGSGIPVVSYNYPVLNELVQHNVN
                     GLKFLDRRELHEALIFIMKDSHVSEVLKAGALKESNNRWQDSWEKAMEEISVIRR"
     gene            <913468..>913911
                     /locus_tag="KLTH0F10626g"
                     /db_xref="GeneID:8292875"
     mRNA            <913468..>913911
                     /locus_tag="KLTH0F10626g"
                     /product="KLTH0F10626p"
                     /transcript_id="XM_002554617.1"
                     /db_xref="GeneID:8292875"
     CDS             913468..913911
                     /locus_tag="KLTH0F10626g"
                     /note="highly similar to uniprot|P06787 Saccharomyces
                     cerevisiae YBR109C CMD1 master regulator of calcium
                     mediated signalling Calmodulin"
                     /codon_start=1
                     /product="KLTH0F10626p"
                     /protein_id="XP_002554663.1"
                     /db_xref="GeneID:8292875"
                     /db_xref="GOA:C5DL75"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:C5DL75"
                     /translation="MSRNLTEEQIAEFKEAFALFDKDNNGSITSSELATVMRSLGLSP
                     SEAEVSDLMNEIDVNGNHKIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIKQFAALLSK"
     gene            complement(<914033..>916561)
                     /locus_tag="KLTH0F10648g"
                     /db_xref="GeneID:8292876"
     mRNA            complement(<914033..>916561)
                     /locus_tag="KLTH0F10648g"
                     /product="KLTH0F10648p"
                     /transcript_id="XM_002554618.1"
                     /db_xref="GeneID:8292876"
     CDS             complement(914033..916561)
                     /locus_tag="KLTH0F10648g"
                     /note="similar to uniprot|P38266 Saccharomyces cerevisiae
                     YBR108W Protein interacting with Rsv167p"
                     /codon_start=1
                     /product="KLTH0F10648p"
                     /protein_id="XP_002554664.1"
                     /db_xref="GeneID:8292876"
                     /db_xref="GOA:C5DL76"
                     /translation="MSDFWDRNKGSIMSGLATAGKQGYKGTKFVAKTGYKAGKQHYNS
                     SKNKREGNSNNSSSSDLTISSPPPLTADVSNFPPPPVKPGQNQYHGSSRGGSGNVPPA
                     ATSRTSSTLPSSYSSEQNPIIPQIGNPQAVPYQVPAPVPQYTTADSQAPHIASRAATI
                     VPGTQLPISSHPNNTAPATYNTRPVPLPHRAPDNNAAAGLVADPQLLSNTSLPRATRQ
                     LLTIDTASIATQNPNISQEAFAVPPANTMASPFPQTTHASYLAASQSPVQPESIASNK
                     VSEPTPAVPAVPTRTYVRAPAALPVQPLPQEERQAMPQAMPQVMPQAMPQVMPQAMPQ
                     VMPQAMAQTSQPFPEENGVSDVQELKSPTSATTVKPYSWKDSEELKESLRIKIQNVDI
                     SSLPTPPVHRNRSESPSSETSSLRSKIKSRSQSPSGLKSPTQSTAVNLKTTETGKAMS
                     TSRQTPQQTGRSSREGEGANNGIAGRYDSSVQVNFPPPPKPSRSETQTPANRDMRSSS
                     SPPVKPTTAPRAPPRLPSRSVPSQPPVTSSVPKLSSTANGKADRENIKPKSAVSGAYN
                     YDIKVDFQPPPKPFRKDKESSQQAPRSVPSFEKPSKYGPPPASNAETAQGRSIRAPPQ
                     IPSRAASLDPPPAYDSSHSHAPSAPPASNVELQSLSASSIQAGAEKTVKVAGSTIQIP
                     KTKKAPPIKKALPGSLQALDTHKSNPEASAHLTEKGKKRPPKPAKKQSLMEQPNKTAS
                     NGGNSRGNFDQELEARLKSRSFHEKPAAVPSLVEHSNSFISSGKIKAAAPPVKPKIPI
                     RLASNEALQPNEQAEVKDDSDGDNPFRRYLKNAVPSENDRLHKN"
     gene            <916674..>917381
                     /locus_tag="KLTH0F10670g"
                     /db_xref="GeneID:8292877"
     mRNA            <916674..>917381
                     /locus_tag="KLTH0F10670g"
                     /product="KLTH0F10670p"
                     /transcript_id="XM_002554619.1"
                     /db_xref="GeneID:8292877"
     CDS             916674..917381
                     /locus_tag="KLTH0F10670g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0F10670p"
                     /protein_id="XP_002554665.1"
                     /db_xref="GeneID:8292877"
                     /db_xref="UniProtKB/TrEMBL:C5DL77"
                     /translation="MTDIPKVWRCYVLTGRISDDALGRLVSESLGPGLNVDIYRSDFQ
                     QTWVYHIQDKERLHGELLLFQDTENPESEFTACLFSLGSESESQTLLFKAFKKWVIEN
                     SESLIENIKFGDRLKLNIADQVLAKNWRGIKIGFGSQTGQNRLKKLELEVSAADVCLL
                     SGGERERVVSNRIFDHLYEETGLYANKLPILDLKIEGHALVTTDWFRVLRGSNTATVA
                     DVAGTVLEAFNSEQMAS"
     gene            complement(<917384..>917950)
                     /locus_tag="KLTH0F10692g"
                     /db_xref="GeneID:8292878"
     mRNA            complement(<917384..>917950)
                     /locus_tag="KLTH0F10692g"
                     /product="KLTH0F10692p"
                     /transcript_id="XM_002554620.1"
                     /db_xref="GeneID:8292878"
     CDS             complement(917384..917950)
                     /locus_tag="KLTH0F10692g"
                     /note="similar to uniprot|Q12425 Saccharomyces cerevisiae
                     YPR067W ISA2"
                     /codon_start=1
                     /product="KLTH0F10692p"
                     /protein_id="XP_002554666.1"
                     /db_xref="GeneID:8292878"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="UniProtKB/TrEMBL:C5DL78"
                     /translation="MIHRPWVQNIRTAFSPTRPWAGSRLIRFNSTSALDSCVRPSKVL
                     NAKPNLSIGITQRAANRLGQIFKDSREALRVSVESGGCHGFQYNLKLIPRDEIQLNNT
                     MNSDKKDAAEPHHDAFEDDGEFGADEDVVFVLPDDGGQVVIDEKSLKVLDKTILTYTT
                     ELIGSTFKITGGNMKNSCGCGSSFDVEL"
     gene            complement(<918159..>919100)
                     /locus_tag="KLTH0F10714g"
                     /db_xref="GeneID:8292879"
     mRNA            complement(<918159..>919100)
                     /locus_tag="KLTH0F10714g"
                     /product="KLTH0F10714p"
                     /transcript_id="XM_002554621.1"
                     /db_xref="GeneID:8292879"
     CDS             complement(918159..919100)
                     /locus_tag="KLTH0F10714g"
                     /note="similar to uniprot|Q99344 Saccharomyces cerevisiae
                     YPR066W UBA3 Protein that acts together with Ula1p to
                     activate Rub1p before its conjugation to proteins
                     (neddylation) which may play a role in protein degradation
                     GFP-fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="KLTH0F10714p"
                     /protein_id="XP_002554667.1"
                     /db_xref="GeneID:8292879"
                     /db_xref="GOA:C5DL79"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023318"
                     /db_xref="UniProtKB/TrEMBL:C5DL79"
                     /translation="MADLADVSILVLGAGGLGCEILKNLAMQGIPDIHVVDMDTIELT
                     NLNRQFLFRESDIGQSKALVAARFINEKNIMGLGGRPVVVTAHFQDLTLLDRKFIERF
                     TLIVSGLDSIEARRFMNMQLVRITFESRFEKCIPFIDGGSEGLKGHCKTIIPGFSACY
                     ECSLDTLPAKIESYPLCTVSNNPRLPEHVIEFLMSVQWAQQHPDRDFDFDSKEDLQWL
                     MDEAHARARQFNIDTSKLTPQFVLGVIKNIVPSVASTNAIIAAQCCTEVSKLLYNEYD
                     IGEAPNFLVYNGDDGCFAYSFVHERVSTCLVCRESIQ"
     gene            complement(<919274..>919846)
                     /locus_tag="KLTH0F10736g"
                     /db_xref="GeneID:8292880"
     mRNA            complement(<919274..>919846)
                     /locus_tag="KLTH0F10736g"
                     /product="KLTH0F10736p"
                     /transcript_id="XM_002554622.1"
                     /db_xref="GeneID:8292880"
     CDS             complement(919274..919846)
                     /locus_tag="KLTH0F10736g"
                     /note="highly similar to uniprot|P38264 Saccharomyces
                     cerevisiae YBR106W PHO88 Probable membrane protein
                     involved in phosphate transport"
                     /codon_start=1
                     /product="KLTH0F10736p"
                     /protein_id="XP_002554668.1"
                     /db_xref="GeneID:8292880"
                     /db_xref="InterPro:IPR012098"
                     /db_xref="InterPro:IPR019263"
                     /db_xref="UniProtKB/TrEMBL:C5DL80"
                     /translation="MNPQISNLVIMLAMMQVSRRLDMEDPNIIFYVRVAYGSSVAVAW
                     IIYQIARSRILQKNDLTTLKYVAPANAMSGETEGKLQVTTVRDYDLKELDSAVKSIYT
                     GLAMMGFMHFYMKYTNPLLMQSISPVKTALEHNEVRIHLFGKPATGDLKRPFKAPSMF
                     GGFGAPPAAKTDKKSIEEAERAGTGGVKAE"
     gene            <920547..>921416
                     /locus_tag="KLTH0F10758g"
                     /db_xref="GeneID:8292881"
     mRNA            <920547..>921416
                     /locus_tag="KLTH0F10758g"
                     /product="KLTH0F10758p"
                     /transcript_id="XM_002554623.1"
                     /db_xref="GeneID:8292881"
     CDS             920547..921416
                     /locus_tag="KLTH0F10758g"
                     /note="highly similar to uniprot|P06380 Saccharomyces
                     cerevisiae RPL11A and to uniprot|P06380 Saccharomyces
                     cerevisiae YGR085C RPL11B component of the large (60S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="KLTH0F10758p"
                     /protein_id="XP_002554669.1"
                     /db_xref="GeneID:8292881"
                     /db_xref="GOA:C5DL81"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:C5DL81"
                     /translation="MVRLPTVCNKVAFLKPSESSSTPPSEPKRRQASRARDDILERVT
                     LYHSSYFNTRTSHLVKRHHANPLVKNFDASGKPGHRPGQVHGLLARSSYTFVENRPYS
                     CYSPQEPSSIPPKMSAKAQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQTP
                     VHSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRERNFSETGNFG
                     FGIQEHIDLGIKYDPNIGIYGMDFYIVMGRPGNRITRRKRCRATVGNNHKTSKEDTIA
                     WFKQRYDADVVDK"
     gene            complement(<921544..>922128)
                     /locus_tag="KLTH0F10780g"
                     /db_xref="GeneID:8292882"
     mRNA            complement(<921544..>922128)
                     /locus_tag="KLTH0F10780g"
                     /product="KLTH0F10780p"
                     /transcript_id="XM_002554624.1"
                     /db_xref="GeneID:8292882"
     CDS             complement(921544..922128)
                     /locus_tag="KLTH0F10780g"
                     /note="weakly similar to uniprot|Q06091 Saccharomyces
                     cerevisiae YPR101W SNT309 Component of a protein complex
                     associated with the splicing factor Prp19p, essential for
                     mRNA splicing"
                     /codon_start=1
                     /product="KLTH0F10780p"
                     /protein_id="XP_002554670.1"
                     /db_xref="GeneID:8292882"
                     /db_xref="GOA:C5DL82"
                     /db_xref="InterPro:IPR008409"
                     /db_xref="UniProtKB/TrEMBL:C5DL82"
                     /translation="MNGIVDWLPHVDGIETSYRAKAEELVDLELQSLDQQGLHPDIAH
                     LIGQPVPARRGHDFGATKSLRGSKRPAEAAKPEKTSRRKMITDSLEEPEHNYSEQEGA
                     IVESYLGHQLSVLERLLPQTLAAQWATNNEYMSSAQAALTEVIEAQETQLRDLDAHRE
                     TLQEQEGGELNYLEQQWRDALVQNVERAIQLSHT"
     gene            <922439..>923386
                     /locus_tag="KLTH0F10802g"
                     /db_xref="GeneID:8292883"
     mRNA            <922439..>923386
                     /locus_tag="KLTH0F10802g"
                     /product="KLTH0F10802p"
                     /transcript_id="XM_002554625.1"
                     /db_xref="GeneID:8292883"
     CDS             922439..923386
                     /locus_tag="KLTH0F10802g"
                     /note="weakly similar to uniprot|P12686 Saccharomyces
                     cerevisiae YGR084C MRP13 Mitochondrial ribosomal protein
                     of the small subunit"
                     /codon_start=1
                     /product="KLTH0F10802p"
                     /protein_id="XP_002554671.1"
                     /db_xref="GeneID:8292883"
                     /db_xref="UniProtKB/TrEMBL:C5DL83"
                     /translation="MLRAGSRRYLSKFQSADSKLDEYYKYFATQASLRPWIYRPKNAN
                     TLLAMDLKDSESDAPLKPRAPVRPLSKQVLNTYIWSAQEASQLLSLLRKWTSLTTRKR
                     GVWDYFTAEHIQNILFASTFKLGKLSSFLQHLYMWKPLFAEAGNDRVFDVEHFFNSLV
                     TCQLHRNAVRELGDANVAEKKLLNAWHQVSVKENKTGLTSYLVSALAKQQGFPEVKLP
                     GLADADVLLPHIDLGATKSGKIAAFASKHRFLYLMARTIDEYGTPSEPISSFIQNYQA
                     AQKSLGQNDVYQEYVVIARRLNSEPHAPTVTAPHPADDQ"
     gene            <923729..>925018
                     /locus_tag="KLTH0F10824g"
                     /db_xref="GeneID:8292884"
     mRNA            <923729..>925018
                     /locus_tag="KLTH0F10824g"
                     /product="KLTH0F10824p"
                     /transcript_id="XM_002554626.1"
                     /db_xref="GeneID:8292884"
     CDS             923729..925018
                     /locus_tag="KLTH0F10824g"
                     /note="weakly similar to uniprot|P18634 Saccharomyces
                     cerevisiae YLR392C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F10824p"
                     /protein_id="XP_002554672.1"
                     /db_xref="GeneID:8292884"
                     /db_xref="GOA:C5DL84"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR014756"
                     /translation="MSTTVRVVLDPPSNGEFYTLEDVIAGSVVLGLEKSVNIREVMVK
                     LVGQSEAVVRPGDHLENEKPQSLQVPLSDNRSLHEVVKLESSVFPPENVKAAMKGSRK
                     PFKVEKGEYKFPFEFHFPSRPQCIQRHQRKLFTYLKGRTNPKLPPSFNNLLSSKDVLN
                     LNAYFYSLGCIEYFVEATVFTGGDEMWFKPFRSYPALKRTFEFIPSNVAQEHLEDALR
                     ENPNTPPQVFRSKFDVTFEGSEQQMWVEVRSKHLRSVYRLDYLFRPSGKKFNQVFLCM
                     LNPLPESADLRVARVELNLIEVVTYLAGNRSNANLSSLRLAGVDTDYKVDLTKCQQTE
                     SGFTECHVELSDIYPLDMIRFNEEDYKHNGNRLYSFDSCNIRRRFKFQLFLHWTLNGV
                     DHFQTEVLTNFTNIFCESVTVAEQPPDYMEEQLPKYE"
     gene            <925263..>927110
                     /locus_tag="KLTH0F10846g"
                     /db_xref="GeneID:8292885"
     mRNA            <925263..>927110
                     /locus_tag="KLTH0F10846g"
                     /product="KLTH0F10846p"
                     /transcript_id="XM_002554627.1"
                     /db_xref="GeneID:8292885"
     CDS             925263..927110
                     /locus_tag="KLTH0F10846g"
                     /note="similar to uniprot|P12754 Saccharomyces cerevisiae
                     YGR083C GCD2 Delta subunit of the translation initiation
                     factor eIF2B the guanine-nucleotide exchange factor for
                     eIF2 activity subsequently regulated by phosphorylated
                     eIF2 first identified as a negative regulator of GCN4
                     expression"
                     /codon_start=1
                     /product="KLTH0F10846p"
                     /protein_id="XP_002554673.1"
                     /db_xref="GeneID:8292885"
                     /db_xref="GOA:C5DL85"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:C5DL85"
                     /translation="MSEQNSQAPPSSPKEVPSSGSSGSSTSATTTSSATTEGKAPLSN
                     KELKELKKKEKAAKRSAKKEASGISIEKQQQQAQQKREKKQVQRDQQQNGGSKKGKVA
                     VPAPVAKRSTLYGHLETTEERRASLLAVTSAISSSQASKITAAGLMLPSVASVLSGSH
                     VPTNSAIAPAMSASTSQTHGLSSAPEPSVTETAQLLASMSVDDEFSLVPGTSSVIPQS
                     LLKTLSFPQLSSSVKELITNRDLLHPAIAQLTSDIAGYKIVGSIPRCLAMLEAFQVAI
                     TDYKTPEGTTLCRNLTSYLSHQIDFLKKARPLSVTMGNAIRWLKQEISLIDLATPEAE
                     AKEDLCEKIAQFAREKIELADQLIIENASQHISNGSTILTYGCSKVLCDFFLYNATEL
                     GKDFQVIVVDSRPLFEGRKMTDILRNHGLKVMYVLITSLGTVFNMHIDYVFLGAHSIL
                     SNGFLYSRVGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTSNELADPNDLVVID
                     SNNPVKRRSNKGFLLQQFIKEREIEIANSTQDQKKSGKGPASSPPVSKTFEENKPILA
                     DWQTSPKLNIFNIMYDLTPPEYIKKVITEFGALPPSSVPVILREYKGSA"
     gene            complement(<927250..>927681)
                     /locus_tag="KLTH0F10868g"
                     /db_xref="GeneID:8292886"
     mRNA            complement(<927250..>927681)
                     /locus_tag="KLTH0F10868g"
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /transcript_id="XM_002554628.1"
                     /db_xref="GeneID:8292886"
     CDS             complement(927250..927681)
                     /locus_tag="KLTH0F10868g"
                     /note="highly similar to uniprot|Q06090 Saccharomyces
                     cerevisiae YPR100W MRPL51 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /protein_id="XP_002554674.1"
                     /db_xref="GeneID:8292886"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DL86"
                     /translation="MVVRALKQTSIARNGLGANYILPCKKVILQYCNWGGSSQGMRDF
                     LTSKRLDILAKKYPQIEFNVLRKSGHPLVRAQYTNGREKVVCVRNLNIDNVENKLKLL
                     KDSSGEILRHRVSNDYVDSLNTSVRGVWSPMHVDPSQRHKV"
     gene            <928161..>928487
                     /locus_tag="KLTH0F10890g"
                     /db_xref="GeneID:8292887"
     mRNA            <928161..>928487
                     /locus_tag="KLTH0F10890g"
                     /product="KLTH0F10890p"
                     /transcript_id="XM_002554629.1"
                     /db_xref="GeneID:8292887"
     CDS             928161..928487
                     /locus_tag="KLTH0F10890g"
                     /note="similar to uniprot|Q06089 Saccharomyces cerevisiae
                     YPR098C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F10890p"
                     /protein_id="XP_002554675.1"
                     /db_xref="GeneID:8292887"
                     /db_xref="UniProtKB/TrEMBL:C5DL87"
                     /translation="MHSISPLILGLTAPMPLQAGPLISLITASLSGCLNLLWLLPWTR
                     RVKEERQKVAKELSGEELEAKDAPLRKEFGKSHGMSLLFNLTHVVGLAAYGFYLAKGL
                     IRYVPK"
     gene            complement(<928673..>929257)
                     /locus_tag="KLTH0F10912g"
                     /db_xref="GeneID:8292888"
     mRNA            complement(<928673..>929257)
                     /locus_tag="KLTH0F10912g"
                     /product="KLTH0F10912p"
                     /transcript_id="XM_002554630.1"
                     /db_xref="GeneID:8292888"
     CDS             complement(928673..929257)
                     /locus_tag="KLTH0F10912g"
                     /note="similar to uniprot|P35180 Saccharomyces cerevisiae
                     YGR082W TOM20 Translocase of Outer Mitochondrial membrane"
                     /codon_start=1
                     /product="KLTH0F10912p"
                     /protein_id="XP_002554676.1"
                     /db_xref="GeneID:8292888"
                     /db_xref="GOA:C5DL88"
                     /db_xref="InterPro:IPR002056"
                     /db_xref="InterPro:IPR023392"
                     /db_xref="UniProtKB/TrEMBL:C5DL88"
                     /translation="MSQQPGSIARILAVTGLTATVAIAGYAAYFDYQRRNNPDFRKSL
                     KRKLKKHAEEEKQAKERAKQQKLAHVGEYLTAELAKDPVSTDPTQREAVFTSNVELGE
                     RLASVAGNELESALKFYKALSVYPNPADLLGIYQRSVPEAVYEYIVLMIAIMPPVNVS
                     TFLSGGAQGGPAAVAQAMAGQAGNTGAGVGEIDE"
     gene            <929852..>930439
                     /locus_tag="KLTH0F10934g"
                     /db_xref="GeneID:8292889"
     mRNA            <929852..>930439
                     /locus_tag="KLTH0F10934g"
                     /product="KLTH0F10934p"
                     /transcript_id="XM_002554631.1"
                     /db_xref="GeneID:8292889"
     CDS             929852..930439
                     /locus_tag="KLTH0F10934g"
                     /note="similar to uniprot|P53251 Saccharomyces cerevisiae
                     YGR081C"
                     /codon_start=1
                     /product="KLTH0F10934p"
                     /protein_id="XP_002554677.1"
                     /db_xref="GeneID:8292889"
                     /db_xref="UniProtKB/TrEMBL:C5DL89"
                     /translation="MVAKKRSQLRAKAALRLGRSKDEDDSEPTSIDLPEDPKAFLHLP
                     RESKKDKMMSKSQSFLSKLHENTSINGAISKSAIRRRKRKLRDQLKPKMEDLLVSLEK
                     DGVTEALEIPGSEEEGSTRDSTERKTTRITRPPPTPSTGSVIMRKNQPSIRNQRGAKQ
                     LAQKESDRFQSVLQNKQFQQDPFAALKEVIKMQKS"
     gene            complement(<930493..>933468)
                     /locus_tag="KLTH0F10956g"
                     /db_xref="GeneID:8292890"
     mRNA            complement(<930493..>933468)
                     /locus_tag="KLTH0F10956g"
                     /product="KLTH0F10956p"
                     /transcript_id="XM_002554632.1"
                     /db_xref="GeneID:8292890"
     CDS             complement(930493..933468)
                     /locus_tag="KLTH0F10956g"
                     /note="similar to uniprot|Q06839 Saccharomyces cerevisiae
                     YPR097W mitochondrial protein"
                     /codon_start=1
                     /product="KLTH0F10956p"
                     /protein_id="XP_002554678.1"
                     /db_xref="GeneID:8292890"
                     /db_xref="GOA:C5DL90"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR024554"
                     /db_xref="InterPro:IPR024555"
                     /db_xref="UniProtKB/TrEMBL:C5DL90"
                     /translation="MTLDLTPAEEHYLKRELLKQELVREIEGLDDPKALRRFGYPFSA
                     EDPRSAHSKKKLIRRLKRSKASETESDSESNEDQGSEFPLLSHFLQHFVMKLPLLAKD
                     LVNKEDFWQEKVQLFFEHFMEQQFSSSFDREELTKRKRLATKLSKMVLLMYNSGIGCK
                     KEVEYFEQDKFELEGSKRPLKQQKLDQFVMPSKESLRYLLTEEPYYINGWDFNVMAAV
                     SHKTLNPEPPAKAKASSSSGSKWMKTPAFLSPSSLTSPSKFFSRLTMTDSSSEKGEYI
                     FVTRIRQEGAEDAWFINKKYSDFKRLVSDLNKEFPGKELPKLPHQSKVGVSSTTSFEA
                     PSDKSNTSQPSTPREKIVSTFSEEASSLEAMPDEALIRGGDDDDDFQDAAETVTKHLP
                     REKLRTSLRKFLRVLVEDNEVAQGVSLKKFVRGSKLEYAALPPPVLQDMKSREAVDVV
                     NLENQIVFQKLAFEQTLQLQNAMKEFKTSVLEDEDYLLKLFQEIKVKDCVEQLSPALK
                     GFMGWCRINLSATIYQTFLGNDGGYELFTQVKRLHRLLPYTVMIQILKITNPMAIMKG
                     MMDLFMARPFGGNSLLQNMFSSVLSDDLKSQLKLAKELEESAARESNFGSEVSKVLAS
                     AIFDNEDGKLLDMQAVHDEAVEMNMPLAIVLAMKCNEKGYLSHDALGELIESYSLWKT
                     QENTTSEALFKTDSSTSIEDVPGLYFSHIKSLLQIYIRERDKRLMKQIWQDPELSQLL
                     KSIVALFYEPMVRIFRVSRMDVAFRNFERFMNDLVSLLDGVINGRNSFSTSFNVVDAI
                     NKLVEKHENSLYQFIHEICMHDTEKTFEGMITYLTSIVKFLQKSKYGQTDRLDLSELA
                     NGGVAQGLDTALLKKQLAELVSSKEESRKLYQKLVDAKTSSPDKKSENLKEAMERKWK
                     ESNEAALPETVTELGLQDGDLVDLDLDVGDYAYLDEEEQEALQQEHREILDKKVDLSE
                     VSKMVDVVFKDKLKEILKV"
     gene            933921..933994
                     /locus_tag="KLTH0F10978r"
                     /db_xref="GeneID:8292891"
     tRNA            933921..933994
                     /locus_tag="KLTH0F10978r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8292891"
     gene            <934247..>937168
                     /locus_tag="KLTH0F11000g"
                     /db_xref="GeneID:8292892"
     mRNA            <934247..>937168
                     /locus_tag="KLTH0F11000g"
                     /product="KLTH0F11000p"
                     /transcript_id="XM_002554633.1"
                     /db_xref="GeneID:8292892"
     CDS             934247..937168
                     /locus_tag="KLTH0F11000g"
                     /note="some similarities with uniprot|Q06836 Saccharomyces
                     cerevisiae YPR095C SYT1 Suppressor of Ypt3"
                     /codon_start=1
                     /product="KLTH0F11000p"
                     /protein_id="XP_002554679.1"
                     /db_xref="GeneID:8292892"
                     /db_xref="GOA:C5DL91"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:C5DL91"
                     /translation="MNHALAEIFKSRLFHADHKRRTKDHAESTEVPINTAEPQQQPDN
                     PRILKSIEEEERPLAESGASDDGSEESSHSGKGPGSNKFRSLRKRITSFPDLRFRSAS
                     SLSSASEGSLAGLSDKQQIAGSAKSPAKKWINGRAADRRVSSSPHLNLSEKPPIINIT
                     NDTGVSFEEESLKVPRKSSSEKRLSSTSITRISTASSAGSSIFARQPRRVLIRSNSDN
                     CQPKKVSPLTPYSNPSPFATTLDEAPVSGITRRRSRTVGASDYGKTNISLHTGLSGGR
                     VGSDSNLREQAVTEGSVCTSAASRPTHLRQHSSSRVSTTTSRRSSSLVNAISNFVSLR
                     SPSVSSRNSLQKAVIDLEDLPKPPTPNENDTPETYLRSLGGFGKYLAVILASDDSGFK
                     IDCLDIFLENEFDFHLEPLDISLRKLLMFLELPKESQQIDRVLTAFSKSYYKQNNKVC
                     IWDTDEDVYSIVFSLLMLHTDAFNVNNKTKMTKQDFVKLMRADAESGGSFTPKEILEY
                     FYDNVTSKEFSKNDYLIYGSEDEIEENYFQNSETGYSPKEIIQNRLLISCASTPLSPA
                     GFSSSGYSLSPYKASSPYSNSTSLGGTSSKHESLDIYYHIASNTLASVTLGAQLKCLP
                     LSEELQKDDELSSTQYAKYLSVIKETKGGYLRLRKAHLESLFEANLEVISPAKEGDDY
                     QYLKIVQMGNLEELVTNRKFSLVGSVNRRVWKRQFGILTTSCLFLFNSMDWVEPQLLV
                     DSTTKISNYIIDCPPQLQINHKFGCNGLFATSINHVPTIEGNAAGGVVIGHSEMYVYS
                     GSKRFVFSCPNDSDRQKWIDSINVAAAFDGCFIEVSAIPDTVVTMRKATVAEKIQKLQ
                     GNGFQREERLRRLQSLIAFVHQSIPLNSKIRTALAEYLSQLEKRLDWQLYEIRRNDVY
                     SKILKELGPAPEDNSSQCDTSADQSFAFSEDLERCPTNYSTEHLSDSSINLSGIMGEF
                     R"
     gene            complement(<937194..>937517)
                     /locus_tag="KLTH0F11022g"
                     /db_xref="GeneID:8292893"
     mRNA            complement(<937194..>937517)
                     /locus_tag="KLTH0F11022g"
                     /product="KLTH0F11022p"
                     /transcript_id="XM_002554634.1"
                     /db_xref="GeneID:8292893"
     CDS             complement(937194..937517)
                     /locus_tag="KLTH0F11022g"
                     /note="highly similar to uniprot|Q06835 Saccharomyces
                     cerevisiae YPR094W RDS3 essential zinc finger protein"
                     /codon_start=1
                     /product="KLTH0F11022p"
                     /protein_id="XP_002554680.1"
                     /db_xref="GeneID:8292893"
                     /db_xref="InterPro:IPR005345"
                     /db_xref="UniProtKB/TrEMBL:C5DL92"
                     /translation="MSRHQFDLVMCLKQPGTHIGKLCDKCDGKCPICDSYVRPKSKVR
                     ICEQCSFGANWKKCIICGQMGTSDAFYCWECCRLEKNKDGCPKILNVGSNRTDKHFEK
                     KASAD"
     gene            <937668..>938543
                     /locus_tag="KLTH0F11044g"
                     /db_xref="GeneID:8292894"
     mRNA            <937668..>938543
                     /locus_tag="KLTH0F11044g"
                     /product="KLTH0F11044p"
                     /transcript_id="XM_002554635.1"
                     /db_xref="GeneID:8292894"
     CDS             937668..938543
                     /locus_tag="KLTH0F11044g"
                     /note="weakly similar to uniprot|Q06834 Saccharomyces
                     cerevisiae YPR093C ASR1 Protein involved in a putative
                     alcohol-responsive signaling pathway accumulates in the
                     nucleus under alcohol stress contains a Ring/PHD finger
                     domain"
                     /codon_start=1
                     /product="KLTH0F11044p"
                     /protein_id="XP_002554681.1"
                     /db_xref="GeneID:8292894"
                     /db_xref="GOA:C5DL93"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DL93"
                     /translation="MDSCPICFESLSKGACRLVECGHKYHFNCIRRWHYHSKNLQCPT
                     CRIKSRHLEDIERKVTINLAEFSDANLAISEISAQMGSLEIRSNEVRQEETRWNLDSL
                     ECRLCGESNVRTNVFCQECHTAYHEICLRTLHLEVGDFSRCVACCNCHHIFGSSSREP
                     PASREHLARFLTERPGLHAARTHPHRSIRAPTSDGFEVVQSWRLLSELQEKCCLLDLS
                     EHKRKIQAHVRKVLNAHYSKGSGAIATKDQYTEINKAVSRNLYRVSDNKYQPDKFDYD
                     VEALRLIAIELRKTG"
     gene            complement(<938597..>939562)
                     /locus_tag="KLTH0F11066g"
                     /db_xref="GeneID:8292895"
     mRNA            complement(<938597..>939562)
                     /locus_tag="KLTH0F11066g"
                     /product="KLTH0F11066p"
                     /transcript_id="XM_002554636.1"
                     /db_xref="GeneID:8292895"
     CDS             complement(938597..939562)
                     /locus_tag="KLTH0F11066g"
                     /note="similar to uniprot|P53250 Saccharomyces cerevisiae
                     YGR080W TWF1 Twinfilin A member of a conserved family of
                     actin monomer sequestering proteins comprised almost
                     entirely of two tandem repeats each having sequence
                     homology with cofilin (Cof1p)"
                     /codon_start=1
                     /product="KLTH0F11066p"
                     /protein_id="XP_002554682.1"
                     /db_xref="GeneID:8292895"
                     /db_xref="GOA:C5DL94"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR028458"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DL94"
                     /translation="MSNQSGITADESLLGSFGSLANNESPSDVVVAEISSDNTTVKLC
                     TTLSNAAELEIFAKREERPLYVFIRDSGRIVFISYVPESAPVRSKMLYASTKNTVLRQ
                     VGSNHISKQLLASLPEELSPGFWSSDASDEPAPLTEAEQISARISSEQRIESARGGRQ
                     LVSQTGGTSHTLSFKIASGEPIPSLLEQHNFVSFKINLEKEQVEVLSTAQLPGAREVP
                     RSLSQNHPTYNIYKNNGKLHFIYSCPSGSKVKERMLYASNKSGFVKHLKEMDHLTMET
                     VLEIGDSDELEISMLEKSSPATSEHGNPAPGQLKFNRPKRPGRRS"
     gene            complement(<939970..>940629)
                     /locus_tag="KLTH0F11088g"
                     /db_xref="GeneID:8292896"
     mRNA            complement(<939970..>940629)
                     /locus_tag="KLTH0F11088g"
                     /product="KLTH0F11088p"
                     /transcript_id="XM_002554637.1"
                     /db_xref="GeneID:8292896"
     CDS             complement(939970..940629)
                     /locus_tag="KLTH0F11088g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F11088p"
                     /protein_id="XP_002554683.1"
                     /db_xref="GeneID:8292896"
                     /db_xref="UniProtKB/TrEMBL:C5DL95"
                     /translation="MSSIMTELASSVAGTPFRGRAAQDVAGLELWGEDEELTFPSFPK
                     RFQAQAGEAGPAPAAEKPDDETSIEQLLHKDEALSTNTDFWREVRASSEAEPAGSPAG
                     SAAAAALGESLTEPLSPLSPAPRAASETRLEDFIRDVGPLHAASPGSFQPDFQIKRLC
                     FRDAEGKLALTAVGSSHVHKPAHRHPHNHKKLLKKVLRRKSGLWEMASPSFAVAEFML
                     L"
     gene            941416..941551
                     /gene="SNR41"
                     /locus_tag="KLTH0F11110r"
                     /db_xref="GeneID:8292897"
     ncRNA           941416..941551
                     /ncRNA_class="snoRNA"
                     /gene="SNR41"
                     /locus_tag="KLTH0F11110r"
                     /product="snR41"
                     /note="C/D snoRNA polycistronic Cluster 3 SNR41"
                     /transcript_id="XR_002432203.1"
                     /db_xref="GeneID:8292897"
     gene            941569..941774
                     /gene="SNR70"
                     /locus_tag="KLTH0F11132r"
                     /db_xref="GeneID:8293296"
     ncRNA           941569..941774
                     /ncRNA_class="snoRNA"
                     /gene="SNR70"
                     /locus_tag="KLTH0F11132r"
                     /product="SNR70"
                     /note="C/D snoRNA polycistronic Cluster 3 SNR70"
                     /transcript_id="XR_002432204.1"
                     /db_xref="GeneID:8293296"
     gene            941854..942001
                     /gene="SNR51"
                     /locus_tag="KLTH0F11154r"
                     /db_xref="GeneID:8293301"
     ncRNA           941854..942001
                     /ncRNA_class="snoRNA"
                     /gene="SNR51"
                     /locus_tag="KLTH0F11154r"
                     /product="snR51"
                     /note="C/D snoRNA polycistronic Cluster 3 SNR51"
                     /transcript_id="XR_002432205.1"
                     /db_xref="GeneID:8293301"
     gene            <942194..>944638
                     /locus_tag="KLTH0F11176g"
                     /db_xref="GeneID:8293298"
     mRNA            <942194..>944638
                     /locus_tag="KLTH0F11176g"
                     /product="KLTH0F11176p"
                     /transcript_id="XM_002554638.1"
                     /db_xref="GeneID:8293298"
     CDS             942194..944638
                     /locus_tag="KLTH0F11176g"
                     /note="similar to uniprot|Q06833 Saccharomyces cerevisiae
                     YPR091C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F11176p"
                     /protein_id="XP_002554684.1"
                     /db_xref="GeneID:8293298"
                     /db_xref="GOA:C5DL96"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:C5DL96"
                     /translation="MTSFTTFVYVYLLGGLTFPLLVAYVLFKAAPDAQKRASQAPELL
                     VPGLQRDFKAGDFEEAKGVEVVKKGWVTVTTKYYYHSSELVQLAQQQVPVENLPSRVK
                     LKRKHNFYAVLKHGNLFLYRDDAPDAGVAHVIVLKDSFVSLWPRNPRDEALDGSLFTK
                     KMCIAILKNGSASIDQQGNLDIALHQTDFKHFDHFFVYVTNNTEKEDWYFALINASKV
                     GLPKPGESLESSKLNPNVSAKTAHFRTRDMLYLIQNLNSNEGQLSTKWLNALLGRLFL
                     GLQQTETLSLFLRERLYKKLTKINKPGFLDDFVIERVDVGNAAPVITHPELRELTPTG
                     LMKIAFQFFYKGGMSLIISTKANINLGSRFKTREVALELAVTVKEIAGPMVVMIKPPP
                     SNRVWYSFETEPLIDLDVEPVVSTKQLSYNMVTNAIKSKFREAIKESLVMPFMDDMTF
                     YNTRDELFRGGIWEQGNESAEDGITVKEDLKSLDQEEDDLDAKPEATGPHEELADSPT
                     DARSAVSDDAMPDRDSLSNKKDEDSASISVTQKTLQKVGTFKSLLKRSDSTSSSNESD
                     CFEDEKSKKSIAESRPSIDTEDSKISKKYLNAGFKKFGKWYKDTVASSSSIAEGSDNA
                     SVHPQNAPEMISNRRALPKTKERDLPKVPPENIRRSSNAAEMFAKNKPRSGSVNSSAG
                     TSTNPRYRLGTSPPHSPSLVNSWASHHSDEEPLEKSFSETVNSDKFQASDVPEKLHTK
                     EQYNEVAVTTQAIGNVGDQPQRVDAEPPRVNLHELSRRRPVPPTPISIEKPADEKEQP
                     SLPDPPSSSHHQTETT"
     gene            complement(<944703..>951785)
                     /locus_tag="KLTH0F11198g"
                     /db_xref="GeneID:8292898"
     mRNA            complement(<944703..>951785)
                     /locus_tag="KLTH0F11198g"
                     /product="KLTH0F11198p"
                     /transcript_id="XM_002554639.1"
                     /db_xref="GeneID:8292898"
     CDS             complement(944703..951785)
                     /locus_tag="KLTH0F11198g"
                     /note="similar to uniprot|P38111 Saccharomyces cerevisiae
                     YBR136W MEC1 Central regulator of the Mec1p/Tel1p
                     signaling network; required for mitotic growth, DNA repair
                     and mitotic recombination,regulates phosphorylation of
                     Rad53p, required for dmc1 arrest and meiotic
                     recombination; similar to phosphatidylinositol(PI)3-
                     kinases required for DNA damage induced checkpoint
                     responses in G1, S/M, intra S, and G2/M in mitosis"
                     /codon_start=1
                     /product="KLTH0F11198p"
                     /protein_id="XP_002554685.1"
                     /db_xref="GeneID:8292898"
                     /db_xref="GOA:C5DL97"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012993"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR027011"
                     /db_xref="UniProtKB/TrEMBL:C5DL97"
                     /translation="MESRVKYLDELVLAIKTSRDEESPNQVFPPEPPTNGDHKSFKVV
                     VTLLKNLKSPGVPSSVFVRSLEALDLLFQSKTYLLLGAVETGSTESGLIWLLKQILEV
                     STTHWESVHYKWLLKQKVASWCKLASDCQEFEAKSLISTFVFGQVAKLETQLTSVFNK
                     PLEEHLFTEICKRIHALCEWCNHKGFQSSVLMFDETLQANKWDYFFQRLVRIVLYVLD
                     SISNDAIAIEELQVKFISLVTSYVVMKGTKYRGLRRTANYKLPFSYALETINPFLTSV
                     GRSLKPQNDALFAKCVLRLFSIAIADASTFELFQETCPFEEWHETYVTGGIDPKLLSY
                     TEKALILVFYDCKRRSAKPSQLVMVNDACIFSSGEYKKLHSAVLRPFDQSRQLENLRK
                     HILQGFQPDIWSLKSADYALLGSKINSIDTQSAFNDLESMIIRNFKQKNVRSQVYVLR
                     IVGKLACHESSCECIKNDWNSCFICENSLPGASLDLIDQERPDALTKSHAFRLLLTHF
                     IKNQDLYEFSESLLTALIFALKRVFAHFKPPNIIPQEKNKEPQQLLSSLVKHLFLTPN
                     RYIRLVSVNLVSSWSFSNAHGLDDLQTAYFISFLQERTYPSFTETSLMAWVCLTLSTK
                     GDYFDPLLVKLIDMFNSTDFAERSMMTHQLRYVSWLKKKTPYQLLSPILPTLLKQIGK
                     NLVEKKLTFQRLADFLEYPQKTILENFQRYIVPYAITQYKNDVITEISNIMCDYEEDE
                     LSAQKEKLLKKNSRQIFAVALVKHGFFSVDTLESLFVNCLPTFDRSYVTGYLPDYKTL
                     AEILKLYKNFDEHSDSKTSNESMILSALRFLFTKFNTEKRRSSRSKLLADWSDELEAR
                     FHKELQENILGIFQVFSSDMHDVEGRTTYFEKLRVINGIHFLIKHASSECIISALAQI
                     SICLQTGQEVPEIRANAFCCWFDLIKRLTQEQLSTVIDSFVPFMLQKWHNFNQKSKRI
                     VRNILNVLINEKKDLILSTRPYITVALVNMHELRALEENKSFARLVNKVLYTTNWYQE
                     YSKNLQSKNNYLIHQSLCDVRSLLLKRQIENYARAESSGSLKFDIAMLLGSLLDASYR
                     FRADNLELCKECIAVIGIIGVLDATKHQLPRISTHMRDVYDFSDHSQTIKFLIKITDS
                     ILVPAFWECENPTKQLFVALVMQESLKYCGLSASSWDIQKPDLYPNEAKLWARFNDIS
                     KTTLYPLRSSLYMAQSWKEYSPISHPSFNPKEGYRSWLKNLTLDLLKTSTDESHPLHV
                     FSSLIREDDGFLSENLLPYVIMDILIKAEEHTTFKRFADNLALEFTYIFELEHPSLNH
                     YQVDSLKMCYEIIFKVFEYCKKWITQFKQNYYKKYGTFTIREQKTSKIIERINNFLVI
                     IPYGLLAQRSLETDSFERSALYLEQSYRIKDGSYFGNDKLLPYLQRTYAEIGDIDSVD
                     GVLKVFSTGSVTSKIEELQYTPNWGMAQQCFEALGNIPEPSEKYKELCFSGNTKMLKS
                     MYDHQQYDQVLAKLASLVPSQYKSTDCTNNEWTSMGIECAYLSGQNDALAEWVARLES
                     WEGQNDPMTCLHYNFGKLILALAQGDKDKALLYSERCHKVIGAKFSVSSINTTLLKVR
                     DIILKLHAIRDLWIISGSSESSTIDAVEKVLKVRLDNIGTDFEPRHFLLSVRKSFNLL
                     KNEGSNSLTLAEDFFRIAQNARVNSRADLASSALIPALICDFPNADLEYAEVLWNQGE
                     NDKAIKLVAEIHQKLQSRPGLKPRERAKVYLKYTEWLDFSNNSISEQIIRQYNDVIRT
                     DSSWSEPYYSLGLYFSRLLEKRSAEGFVTNGKFENKSISYFLLAFEKDTTRVREALPK
                     VVTFWLDTAHMYVSESNSARRETLKRSVEDQCKKIESAIKACPAYIWYSVLTQLLSRL
                     LHPHKTSMQLMMHILLNLATEYPSHILWYVSALMNSSSSTRAAVGAHIAEQFKQRAGG
                     TAGLLDSSEALVKALTNVCVTEVKSSSSRSGRFLDKDFNFDMKMAPCNMVVPISANLE
                     MLTPSSGESLSGFHAFNKVISIVKFGSSYKIFSSLKKPKKLNVVGSDGRIYGIMCKKE
                     DVRQDNQYMQFSTTMDFLLSKDSASRKRGLGITTYAVMSLREDCGLIEIVPNVTTLRS
                     ILVTKYDSMKIKYSLKALHDKWQSLPDDQKLGFFKDLLLKFPPVLYQWFLEIFPDAIA
                     WYKARSTFSRSYAVMAMVGHILGLGDRHCENILLNVETGKVLHVDFDCLFEKGKRLPI
                     PEIVPFRLTHNLEDALGITGTEGTFKKTSQVTLELMRGNEVALVNIIETIMYDRNMDH
                     SLQKALKVLRNKIRGIDARDGLVLSVAGQVETVIQESTSEENLSKMYVGWLPFW"
     gene            complement(<952103..>952435)
                     /locus_tag="KLTH0F11220g"
                     /db_xref="GeneID:8292899"
     mRNA            complement(<952103..>952435)
                     /locus_tag="KLTH0F11220g"
                     /product="KLTH0F11220p"
                     /transcript_id="XM_002554640.1"
                     /db_xref="GeneID:8292899"
     CDS             complement(952103..952435)
                     /locus_tag="KLTH0F11220g"
                     /note="highly similar to uniprot|P20486 Saccharomyces
                     cerevisiae YBR135W CKS1 Subunit of the Cdc28 protein
                     kinase required for mitotic proteolysis may also be
                     involved in the proteolysis of the G1 cyclins"
                     /codon_start=1
                     /product="KLTH0F11220p"
                     /protein_id="XP_002554686.1"
                     /db_xref="GeneID:8292899"
                     /db_xref="GOA:C5DL98"
                     /db_xref="InterPro:IPR000789"
                     /db_xref="UniProtKB/TrEMBL:C5DL98"
                     /translation="MYQHGHAFQGRKLTDQERARVLEFQDTIHYSPRYSDDTHEYRHV
                     MLPKAMLKVIPSDYFNSETGTLRILTEDEWRGLGVTQSLGWEHYECHAPEPHILLFKR
                     VLDYKVER"
     gene            <954186..>956594
                     /locus_tag="KLTH0F11242g"
                     /db_xref="GeneID:8292900"
     mRNA            <954186..>956594
                     /locus_tag="KLTH0F11242g"
                     /product="KLTH0F11242p"
                     /transcript_id="XM_002554641.1"
                     /db_xref="GeneID:8292900"
     CDS             954186..956594
                     /locus_tag="KLTH0F11242g"
                     /note="similar to uniprot|P38274 Saccharomyces cerevisiae
                     YBR133C HSL7 Protein arginine N-methyltransferase, bud
                     neck localization"
                     /codon_start=1
                     /product="KLTH0F11242p"
                     /protein_id="XP_002554687.1"
                     /db_xref="GeneID:8292900"
                     /db_xref="GOA:C5DL99"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DL99"
                     /translation="MKSNVFVGLKPAVGAGADYKKSGDNYDYILHPITNSRYRERVKK
                     VFQEYRAEVDRNVTLWVPEPQLQELCIPPSTSKEDSPSFIGLLSSWVDLESTDTCVRE
                     LSYQVLINEWNYAKFVGIKQLILAPPKNLANLHCYALMVARLLLKCDAESPVLSISLP
                     FFEDTDPLSTWELWGTIRKTCGYHPSLTISLALPRDRTPSYVLQRWLAEPVTCLLVSS
                     SIFATNQYNYPVLNKFNQQIIFEFQKINGNSQARLSELCVILHGIEKYAAQVKGGEPA
                     YLEYVNYLLKRGDKVLAAESVSTPGKYSEPRIMPPLDPYSDEISNAVYHTFEQDRVKY
                     ELYGRAIKEALKEMKINRMAGASALNSAPVTILIAGAGRGPLVDEAFKAVKELNIQNC
                     HMVALEKSSQAILYLQKRKYEYWKDAVEIVKDDMCTWQSSIKIDLCVSELLGSFGCNE
                     LSPECLSNIERNNCKKGTVFIPQSYSSFLAPISSPLLYQTLKNLDVPDPFEKPWIVHS
                     IPYCIISTKINEAWCFQHPPATINDQLTKSVVTDFKIKNKCEVHGLMGFFKATLYGDI
                     GLSIVPDDSTIKLIGDTDFIPDSEKRSSGLYVKGEHTPNMTSWSPIIFPLKQPLFIPD
                     DTELEVFMTRNHSSVNRKFWYEWSVSSYVYLVMSDRSPPSRRPINKPPVQSGYEETSQ
                     DNGFYSSPPAIGVERAFERFRPSPNYLSEHGISGFDEESEAFEGAESESGFLGHQQSG
                     WKSVNDIHGLGIKNPPVFDLHSPLGHSASGDHSAAEEYHVRVKTGVSELHNVGGRFNN
                     ISLR"
     gene            complement(<956704..>959058)
                     /locus_tag="KLTH0F11264g"
                     /db_xref="GeneID:8292901"
     mRNA            complement(<956704..>959058)
                     /locus_tag="KLTH0F11264g"
                     /product="KLTH0F11264p"
                     /transcript_id="XM_002554642.1"
                     /db_xref="GeneID:8292901"
     CDS             complement(956704..959058)
                     /locus_tag="KLTH0F11264g"
                     /note="similar to uniprot|Q86ZS6 Saccharomyces cerevisiae
                     YPR089W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F11264p"
                     /protein_id="XP_002554688.1"
                     /db_xref="GeneID:8292901"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DLA0"
                     /translation="MNLLSDPWSTHKDGDTQADSSNESRIKAVTDTLQGLKESEEAWS
                     KLALLISDDYDDESQFRELLVQVQDLNDTAQTGVSLLVYCVVFDKPLYIEILHNTGKL
                     DANVPDKIFGCSPLTWCIHLNRQQCCVELLNFADELDFGYENPGGFTALDLLIPGNAM
                     YEFAKEHELFRFIKNNESAHDSLFKAPASTFATSDVDHTLDQIDLQTAGLNINQDDLF
                     TNDENSTQNYKESSFAASFLSQNFDFENVLPNQYIEFADYDIPRLLELLVSLPSRKPH
                     KTCIPAAIIFQCIRFADKIRQSTPLVESVAHLSLTKILSSAASSSGGVLNNQSGDIIL
                     QSYWLSSLNFLFYYLYRQDGFFKRYPSILQELIDGMRSLILELNTSIHSRIEPLIEPT
                     LLEHTTIAQVKETLYKKDWNLFKKRKHRSTKSSSRDSYDETLAMLYPPSLDEQMKPSP
                     LKIVQIFGALSYVLDLHQVHPLIAQQCLSVALKWFSAKLFNKMMDNKKKSLSRAHAVQ
                     IRLNLSVIQDWIKNHNFKAPLPTMIDDFMWRRFPYTLVLDLSDIDGPSKPFELRNVTF
                     YSPADEKHAENMDNSLFYYQSFYHISQIHMEPCMQLLQWLQVATSLEDEESLNSTLSI
                     LNKLSPAQLLKSVEKYRYDSDEQKFKSPLKKKLVAMVKETSSTNTRLAEKTLCSLTLP
                     TITELIGMYTQREDAQELLPLLPMDVQDDVDEIHEQNVKQQQLQAESAGLKNRNDSDN
                     EGEASSSRIEGETGDELFKELNAPSTAAQRPLWAINSDIEANPW"
     gene            <959314..>961062
                     /locus_tag="KLTH0F11286g"
                     /db_xref="GeneID:8292902"
     mRNA            <959314..>961062
                     /locus_tag="KLTH0F11286g"
                     /product="KLTH0F11286p"
                     /transcript_id="XM_002554643.1"
                     /db_xref="GeneID:8292902"
     CDS             959314..961062
                     /locus_tag="KLTH0F11286g"
                     /note="similar to uniprot|P38090 Saccharomyces cerevisiae
                     YBR132C AGP2 Plasma membrane carnitine transporter
                     expression is down-regulated by osmotic stress also
                     functions as a low-affinity amino acid permease"
                     /codon_start=1
                     /product="KLTH0F11286p"
                     /protein_id="XP_002554689.1"
                     /db_xref="GeneID:8292902"
                     /db_xref="GOA:C5DLA1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DLA1"
                     /translation="MLLPTEASGTRETSLGAQKGKTEFKYQTVKVASHQDSVVSIDAK
                     QTITGYLTAEAESDMEDSVTRRTLRERHVLLIGISGVIGTALFVSIGKGLFRGGSVFL
                     LLGMALWCIPMLCITVSTAEMVCYLPLDSPFLCLASRCVDDSLAIMAGWNFWFLECVQ
                     IPFEIVAVNTILHYWRDDYSAAIPLVVQVILYFAISVLAVRFYGEMEFWLASFKIILA
                     AGLFVFTLVAMLGGNPKKDRFGFRNFADAPFKQYFPSGKPGSPSAGYFQGFLACLIQA
                     SFTIAGPDYVAMIAGETRLPRKILPVAFKQVFNRLTILFLGSSLCVGILCSANDPSLM
                     AAISEARPGAGASPYVLAMKNLGIKTLPDVVNAALVTAAFSAGNAYTFCSSRTLHGMA
                     LVGNAPAVFKRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINMITASQLIN
                     FAVLCVTYLYFRRAYHAQCGALPELPFKSWGQPYTALVGLVAVLIMVLVQGYAVFCSS
                     LWDVQEFLFCYLMIFIDIAIYVVHKFVVQRGRCWPRAPKAVDLVTGLLAVERHEREAG
                     FDRYVFFTERASPLRA"
     gene            <962129..>962620
                     /locus_tag="KLTH0F11330g"
                     /db_xref="GeneID:8292903"
     mRNA            <962129..>962620
                     /locus_tag="KLTH0F11330g"
                     /product="KLTH0F11330p"
                     /transcript_id="XM_002554644.1"
                     /db_xref="GeneID:8292903"
     CDS             962129..962620
                     /locus_tag="KLTH0F11330g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F11330p"
                     /protein_id="XP_002554690.1"
                     /db_xref="GeneID:8292903"
                     /db_xref="UniProtKB/TrEMBL:C5DLA2"
                     /translation="MNGTSHVQEAARNAARLADSRREHSIHKPHGAPDRMSRQGHANR
                     LSDLAIHKLSDLFDFEHFFKDHVPSGLPSELPAVAAHEYTLAPHGGGARGAGDESVFA
                     PLDVSESSGSHMLGLPPPAPCQIDLAARAAHEVPCAYNSTLMNYESQLFLHDLISGDI
                     YDE"
     gene            complement(<962701..>964596)
                     /locus_tag="KLTH0F11352g"
                     /db_xref="GeneID:8292904"
     mRNA            complement(<962701..>964596)
                     /locus_tag="KLTH0F11352g"
                     /product="KLTH0F11352p"
                     /transcript_id="XM_002554645.1"
                     /db_xref="GeneID:8292904"
     CDS             complement(962701..964596)
                     /locus_tag="KLTH0F11352g"
                     /note="similar to uniprot|P38273 Saccharomyces cerevisiae
                     YBR131W CCZ1 Protein involved in vacuolar assembly"
                     /codon_start=1
                     /product="KLTH0F11352p"
                     /protein_id="XP_002554691.1"
                     /db_xref="GeneID:8292904"
                     /db_xref="InterPro:IPR013176"
                     /db_xref="UniProtKB/TrEMBL:C5DLA3"
                     /translation="MLDSITVFNPSYSTNESDSDKQLLLYHSFQGEQSYSLNEKLSQI
                     GIIQAVWSFSQSFGDFKGVHQNVVELDQQIICTVLVEDDFFVSLAITAEHTSIPASYV
                     FSHLRHCYDFFVLQFGLWRDFHDRRALTDRLNEVLVSYWSELNLMPQYLQFKGFLSLW
                     PQAYKVAELPGLEDSSEPSWESDLKQQILLDETSFLGLKDVLVYNLPKPTSRKGYKSY
                     GLVRNFAPNCDSLPQVSNWIEHMDTIYTRLSSHVIAGNVQYKENPEDEEPAENNAEHT
                     TAGESLRNHSRKLYHNVTLPISFAYDAVQEVGNMAGISSSVSLLTDFMPNISSWNPWG
                     SSAKKEKKARSEFLISPLSASFLPDSYKVKKLRLSFDQNAKEYNCLFWFYNEILVILV
                     FEQDFMKIWEHEFLSDLHFKLQSCISKLSSEHLNTVPHNAEKFCYAVVSKKTSQIKSS
                     FPLYKAPKVSETASPLELVVNGLDEFLNSGANRKTSVSTISANDVQLADEERSARQSW
                     GLGLMGGFFKKEQSGKTPQVQVDTFLDCIPEEKLRDLHLDVTTFVNTLSTSKRADDLK
                     EEKLIKLNNGVLCFIREDSEEIVVLAENWFNKKASKSKASTPSRDGLVEYMGKEASEW
                     WSNRTHS"
     gene            <965873..>967477
                     /locus_tag="KLTH0F11374g"
                     /db_xref="GeneID:8292905"
     mRNA            <965873..>967477
                     /locus_tag="KLTH0F11374g"
                     /product="KLTH0F11374p"
                     /transcript_id="XM_002554646.1"
                     /db_xref="GeneID:8292905"
     CDS             965873..967477
                     /locus_tag="KLTH0F11374g"
                     /note="similar to uniprot|P20424 Saccharomyces cerevisiae
                     YPR088C SRP54 Signal recognition particle (SRP) subunit
                     (homolog of mammalian SRP54) contains the signal
                     sequence-binding activity of SRP interacts with the SRP
                     RNA and mediates binding of SRP to signal receptor
                     contains GTPase domain"
                     /codon_start=1
                     /product="KLTH0F11374p"
                     /protein_id="XP_002554692.1"
                     /db_xref="GeneID:8292905"
                     /db_xref="GOA:C5DLA4"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR006325"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR022941"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLA4"
                     /translation="MVLADLGKRINSAVNSALSNSQDDYVTTVDVMLKTIVTALLESD
                     VNIKLVFSLRNNIRAKLLDVKSRSTNNAQTKKLIQKTVFDELCNLVDGETEPFQPKKR
                     KQNVIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIKARI
                     PFYGSYTETNPVKVAAEGVAKFKKEKFEVIIVDTSGRHRQEEELFQEMVEISQVVKPN
                     QTIMVLDASIGQAAEQQSKAFKDSSDFGAIILTKMDGHAKGGGAISAVAATKTPIIFI
                     GTGEHVHDFEKFSPKSFISKLLGIGDIESLLEHFQTLSNKEDTKATMENIQQGKFTLL
                     DFQKQMQTIMKMGPLSNIASMIPGMGNMLNQVSEEETTKRMKKMVFVMDSMTKQELES
                     DGRIFIDQPSRIVRVARGSGTSAFDVEMILMQQQMMARMAQSTKAAQRGNGMPNMPQM
                     PGMPNIPGMPQISPSMMQQAQQKLRQNPGMMKNMMNMLGGAGGPGGSGGGFPGMGGGM
                     PNMDDMMKMMQDPQMQQMANQFGMGM"
     gene            <967691..>968962
                     /locus_tag="KLTH0F11396g"
                     /db_xref="GeneID:8292906"
     mRNA            <967691..>968962
                     /locus_tag="KLTH0F11396g"
                     /product="KLTH0F11396p"
                     /transcript_id="XM_002554647.1"
                     /db_xref="GeneID:8292906"
     CDS             967691..968962
                     /locus_tag="KLTH0F11396g"
                     /note="some similarities with uniprot|P38272 Saccharomyces
                     cerevisiae YBR130C SHE3 Protein that acts as an adaptor
                     between Myo4p and the She2p-mRNA complex part of the mRNA
                     localization machinery that restricts accumulation of
                     certain proteins to the bud also required for cortical ER
                     inheritance"
                     /codon_start=1
                     /product="KLTH0F11396p"
                     /protein_id="XP_002554693.1"
                     /db_xref="GeneID:8292906"
                     /db_xref="GOA:C5DLA5"
                     /translation="MSNQEVDFQAAHLESPMKMSPSKVSMNHGAFMANMQNGYSPTRE
                     GATAGSSSTRVIEALHAQIDSLTKTNLDLTVQSNNLLSRLESSNNTQSKHLESISTLK
                     HENDNLGLMLSRKERRVRDLEQQLSQLKHSYEEAAMDNKTMRHQLQTSGQREGTLENQ
                     LQQLQVQYDALVDGQKRYREKYDLEVEELKKSLQDFKRDNEMYLTKNIQTVVSNNTAL
                     QTKINQYSGKYKNLESLSQQHMQELSREVEGMASKLDLAKWEKLYEESRNMAIEYSEK
                     TNVPLSPSFLAQHGAKSGSRSPSTSSSSTFVHPSQIRVPKVRHSSSSAKRSSFYGSNV
                     SVPGGTVPGVKQPSASPTTPSSGGLPGVRRSSSVRGSSSSSRNSSGDLASAESAAQSQ
                     KGASKNSANNKKKRMSSHSYSKSNGFSFGEP"
     gene            <969077..>970063
                     /locus_tag="KLTH0F11418g"
                     /db_xref="GeneID:8292907"
     mRNA            <969077..>970063
                     /locus_tag="KLTH0F11418g"
                     /product="KLTH0F11418p"
                     /transcript_id="XM_002554648.1"
                     /db_xref="GeneID:8292907"
     CDS             969077..970063
                     /locus_tag="KLTH0F11418g"
                     /note="weakly similar to uniprot|P38271 Saccharomyces
                     cerevisiae YBR129C OPY1 Protein of unknown function
                     overproduction blocks cell cycle arrest in the presence of
                     mating pheromone"
                     /codon_start=1
                     /product="KLTH0F11418p"
                     /protein_id="XP_002554694.1"
                     /db_xref="GeneID:8292907"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DLA6"
                     /translation="MDQNEDLKLLYTDTQHFNDVLISSFLFKKSSSSAATNKLASDHK
                     QSAPGTSSPDIGGSHHWFMRGGFHKYWCVLRRGQFSYYKDKNERKPVDVIPADQVLDF
                     RVRMDEYRLDFYTKQKTISFGSESQEVLRGWDAALQEFVSDRRRSSLPMRIYDSGNDE
                     NDNECICEDDDDDFEILSEAQPQDPEKERDRNVWSSFKVPDEDREFYAIYNPEQPKRV
                     IQTGTLLCRVKKRLGRKTWKRVNAVLENTSLLIESVSSGRLYKKIDLNGVVDCVEDEK
                     SRYDTGFAVITYDERTKFRAPSEQDTIEWIMNLKSCVLVRKKLEELKSLCEA"
     gene            <970205..>971455
                     /locus_tag="KLTH0F11440g"
                     /db_xref="GeneID:8292908"
     mRNA            <970205..>971455
                     /locus_tag="KLTH0F11440g"
                     /product="KLTH0F11440p"
                     /transcript_id="XM_002554649.1"
                     /db_xref="GeneID:8292908"
     CDS             970205..971455
                     /locus_tag="KLTH0F11440g"
                     /note="weakly similar to uniprot|Q06822 Saccharomyces
                     cerevisiae YPR085C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0F11440p"
                     /protein_id="XP_002554695.1"
                     /db_xref="GeneID:8292908"
                     /db_xref="GOA:C5DLA7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MQGHQPAAYTLRKHETEVTCLKVVSWEPYPVLASGDAKGELYLW
                     NLVTRRPFAGYKLETKAQIIYIKWLNNYLIVLSKDHTLRFLQLHNETAVAIRGWAGNQ
                     FELQSFKIVYEVPVNTLNFANVVVTHMRESQYRLWCCNTMDSESIDVYEFDVKEQRSL
                     RRLVSGINLYKAIIKAGNWSTGESLDKTGIVMCFLEHNGVVYLGYECGFVLGLQLVER
                     SGENPTIVVSYVSSVHYPEPVLSLCYNEREEVILSSSTNDAIGVHALQAHSVNVSESE
                     IAFFSIEEGIAIKRDLTLINKSIHLPTSKIGHLGCVDGRLIAVDWSGRTLVCEKDETK
                     FCFSKQRSNVLVDESSAGTFDQGKAPRCHIKATSMACIGKQTLRELRGIRRGEKRRTE
                     LCANRSWCFTGYEDGSVIMQSFET"
     gene            complement(<971534..>972919)
                     /locus_tag="KLTH0F11462g"
                     /db_xref="GeneID:8292909"
     mRNA            complement(<971534..>972919)
                     /locus_tag="KLTH0F11462g"
                     /product="KLTH0F11462p"
                     /transcript_id="XM_002554650.1"
                     /db_xref="GeneID:8292909"
     CDS             complement(971534..972919)
                     /locus_tag="KLTH0F11462g"
                     /note="similar to uniprot|Q06821 Saccharomyces cerevisiae
                     YPR084W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0F11462p"
                     /protein_id="XP_002554696.1"
                     /db_xref="GeneID:8292909"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLA8"
                     /translation="MKNLKDEPFKLAVLGGCGTGKSSLVSRLTVDMVHEVHYPTRKQN
                     NWLFTFEPENVLAKTIMDEQPHKRRLLQSGKSDRSFFKSPQITPHILLSPVLFQAFAQ
                     EWTEAKALARQPTPKLESRVSTASNRFYTYQDLPENGGSLDQSKTTLTNSDTNILRTQ
                     LHADMSASKDLCPVPSGYKPPNIKPVTVDVVDTPGFKPDMVVPFLEVSMFRNLDKDVL
                     KGLANEPRRPVSTTSLLVASGASELNGKINGYIFVYSAVPELNKGALPPGYDSTCQEK
                     PASNPTQDPDSSSLRSVTSSSSATSAIGREVDGGLSLLTTIRNCILDAWSEFRDYQDR
                     WSQGKEGDVYSLMYSFKQMWKNQNARNEKLKQLRSFHTKPNALTWDASSPDSPPPCII
                     ICTHVLDQLASPLLIERGKELAIQWGCTFVGVDTVDDYNVDVALGLILREAAERENII
                     KMMGKGKSKAR"
     gene            <973231..>974205
                     /locus_tag="KLTH0F11484g"
                     /db_xref="GeneID:8292910"
     mRNA            <973231..>974205
                     /locus_tag="KLTH0F11484g"
                     /product="KLTH0F11484p"
                     /transcript_id="XM_002554651.1"
                     /db_xref="GeneID:8292910"
     CDS             973231..974205
                     /locus_tag="KLTH0F11484g"
                     /note="weakly similar to uniprot|P38270 Saccharomyces
                     cerevisiae YBR128C ATG14 Subunit of an autophagy-specific
                     phosphatidylinositol 3-kinase complex (with Vps34p Vps15p
                     and Vps30p) required for organization of a
                     pre-autophagosomal structure ATG14 transcription is
                     activated by Gln3p during nitrogen starvation"
                     /codon_start=1
                     /product="KLTH0F11484p"
                     /protein_id="XP_002554697.1"
                     /db_xref="GeneID:8292910"
                     /db_xref="GOA:C5DLA9"
                     /db_xref="InterPro:IPR018791"
                     /db_xref="InterPro:IPR023261"
                     /db_xref="UniProtKB/TrEMBL:C5DLA9"
                     /translation="MALKCCTCHRQSKVMYCSHCINTSPRLLLRYKMELYQVTAAREE
                     LRAQVDEILRDAMNGDEQPSDVLGKHLAMLRKTHLKRRTNKIRSKLQQLQEVVQVKRE
                     RVRTLKAQMNQPNPRVAHSVETDEKIAQFRSSQQKLTMLQRVLESSKALKFQALAHLF
                     LIRQREHPEFPFTISFQPIVNVQNLCHLPQNVVECSLRSMWDFLLLAGRVLLIELPLQ
                     KPAKDVLDSLTGIVLNLLVFLQSLELVPQKFCGDRGYLRSLLRNYDVDRLFYYMVMNR
                     DIELLDTGELHSAVNYDVCHAELQAMFQGSSELSVLNKSIDDKWFLVG"
     gene            <974710..>976245
                     /locus_tag="KLTH0F11506g"
                     /db_xref="GeneID:8292911"
     mRNA            <974710..>976245
                     /locus_tag="KLTH0F11506g"
                     /product="KLTH0F11506p"
                     /transcript_id="XM_002554652.1"
                     /db_xref="GeneID:8292911"
     CDS             974710..976245
                     /locus_tag="KLTH0F11506g"
                     /note="highly similar to uniprot|P16140 Saccharomyces
                     cerevisiae YBR127C VMA2 Vacuolar H ATPase regulatory
                     subunit"
                     /codon_start=1
                     /product="KLTH0F11506p"
                     /protein_id="XP_002554698.1"
                     /db_xref="GeneID:8292911"
                     /db_xref="GOA:C5DLB0"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005723"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022879"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLB0"
                     /translation="MLSDKELYELNKKAVSEGFKIKPRLNYNTVGGVNGPLVILEKVK
                     FPRYNEIVNLTLPDGTVRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGENLRIP
                     VSEDTLGRIFDGSGRPIDNGPKVFAEDYLDINGSPINPYARIYPEEMISTGVSAIDTM
                     NSIARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGVNL
                     ETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLTI
                     LTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPIL
                     TMPNDDITHPIPDLTGYITEGQISVDRQLYNKGVYPPINVLPSLSRLMKSAIGEGMTR
                     KDHGDVSNQLYAKYAIGRDAAAMKAVVGEEALSIEDKLSLEFLEKFEKTFISQGAYEN
                     RTIFESLDQAWSLLRIYPKEMLNRISPKILDEFYDRARDEDDEDEQDADEQDKKPQEE
                     SLI"
     gene            complement(<976482..>977978)
                     /locus_tag="KLTH0F11528g"
                     /db_xref="GeneID:8292912"
     mRNA            complement(<976482..>977978)
                     /locus_tag="KLTH0F11528g"
                     /product="KLTH0F11528p"
                     /transcript_id="XM_002554653.1"
                     /db_xref="GeneID:8292912"
     CDS             complement(976482..977978)
                     /locus_tag="KLTH0F11528g"
                     /note="similar to uniprot|Q06820 Saccharomyces cerevisiae
                     YPR083W MDM36 Mitochondrial Distribution and Morphology"
                     /codon_start=1
                     /product="KLTH0F11528p"
                     /protein_id="XP_002554699.1"
                     /db_xref="GeneID:8292912"
                     /db_xref="UniProtKB/TrEMBL:C5DLB1"
                     /translation="MEYEDPIISHFKGQKEVSAETLAQLIDEQKHEQAAHKTRASPKK
                     VHLQSANLRKCEKALSIFTDVIKLKFLIQKSWDLQALGKSVLVRFDIQTGALSSQEAK
                     LDHAETFYRELALKTITRCGKLSKATEQLSLDLEDIGEHIRSKSDENPAACVENSACL
                     LLEMWFLCGRVMRGLKRNVAALFIKSKLLLIDCELELMNSTAQGGYGNLQETIVSYRS
                     FIKVLLQQLQDAESGNDQTLFEECLQVFLDVESMYGAMNLNWLLLETDQQESDMPSTT
                     ESRSAIFEEAAELRDIAQFVDNAVNEEKESGSDEFSSFTTEKLEPTHDRRMSETSSSS
                     RISLMMERTSLTKELPHLLQAFNNAKRLEQELENVRAAKTEELETSMFGSPPPSLSSS
                     MFSPSSSLFLASSPRYGNDMTATTYSTSSSMAFDDEEKSTENAPEKCTPIAHPRLVSS
                     ELSSHLIGSDFLRLSSLQQQPSSLRQPRSVQGFGSSVLNNLYGLGNRK"
     gene            <978906..>980429
                     /locus_tag="KLTH0F11550g"
                     /db_xref="GeneID:8292913"
     mRNA            <978906..>980429
                     /locus_tag="KLTH0F11550g"
                     /product="KLTH0F11550p"
                     /transcript_id="XM_002554654.1"
                     /db_xref="GeneID:8292913"
     CDS             978906..980429
                     /locus_tag="KLTH0F11550g"
                     /note="highly similar to uniprot|Q00764 Saccharomyces
                     cerevisiae YBR126C TPS1 Probable regulator of glucose
                     influx into the cell & into glycolytic pathway indirectly
                     regulating glucose-induced signalling (activation &
                     inactivation) & initial step(s) of glucose metabolism.
                     Homologue of E. coli otsA protein 56 kD synthase subunit
                     of trehalose-6-phosphate synthase/phosphatase complex"
                     /codon_start=1
                     /product="KLTH0F11550p"
                     /protein_id="XP_002554700.1"
                     /db_xref="GeneID:8292913"
                     /db_xref="GOA:C5DLB2"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR012766"
                     /db_xref="UniProtKB/TrEMBL:C5DLB2"
                     /translation="MAETVVNSLKNALSAKDDKATGIENHPGNVVVVSNRLPVTITKN
                     NSTGKYEYSMSSGGLVTALQGLKKSTTFQWYGWPGLEIPDEEKEQVKKDLLEKFNAIP
                     IFLSDEVADLHYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANMAFAQEIEKNLSD
                     NDIVWVHDYHLMLLPEMLRSGIKQKHLKNIKLGWFLHTPFPSSEIYRILPVRQEILKG
                     VLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEFEGRFVNVGAFPIGIDVDNFTE
                     GLKQESVIERIKQLKKTFKDVKIIVGVDRLDYIKGVPQKLHAMEVFLKEHPEWIGKVV
                     LVQVAVPSRGDVEEYQYLRSVVNELVGRINGQFGTVEFVPIHFMHKSVPFQELISLYA
                     ASDVCLVSSTRDGMNLVCYEYIACQQEKKGSLILSEFTGAAQSLNGALIVNPWNTDEL
                     AESIYESLTIPEEKKDANWEKLHKYISKYTSAFWGENFVHELYKIAPNGGSHEAETK"
     gene            <980847..>982034
                     /locus_tag="KLTH0F11572g"
                     /db_xref="GeneID:8292914"
     mRNA            <980847..>982034
                     /locus_tag="KLTH0F11572g"
                     /product="KLTH0F11572p"
                     /transcript_id="XM_002554655.1"
                     /db_xref="GeneID:8292914"
     CDS             980847..982034
                     /locus_tag="KLTH0F11572g"
                     /note="similar to uniprot|P38089 Saccharomyces cerevisiae
                     YBR125C PTC4 Cytoplasmic type 2C protein phosphatase
                     identified as a high-copy number suppressor of the
                     synthetic lethality of a cnb1 mpk1 double deletion
                     overexpression decreases high-osmolarity induced Hog1p
                     phosphorylation and kinase activity"
                     /codon_start=1
                     /product="KLTH0F11572p"
                     /protein_id="XP_002554701.1"
                     /db_xref="GeneID:8292914"
                     /db_xref="GOA:C5DLB3"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C5DLB3"
                     /translation="MGQLLSHPLTEKTIIYNDYEHLSQQASRRRSSEHSSSANKHRAQ
                     KGAQFFNCVGSMQGYRLTQEDAHLVANCDSMMELNFYNPFTDREEMLSMSVFGVFDGH
                     GGDECSKYVSSENDAYQGIRKWIRLSFETHEYGPVKGLESKSFKRRFRTIEGLVSQVL
                     KDAFLLQDRELYCHYANSSCGSTGILAVIINEKKLYVANTGDSRCVLSTKGRGVKTLS
                     YDHKPQHIGELVRINDDGGTVSLGRVGGVLALSRAFGDFQFKTSVSYTNSAHGPAAAQ
                     RYVAPAQESQVTVEPDVICHQISYDRDEFLVLACDGIWDLYSNRNLVQFIKYHLMLGQ
                     KLDDIVTKLLDHGINSADSNTGVGFDNMTIIIIALNKQGETLAHWYGKMKSRLEREKG
                     LTI"
     gene            <982237..>984177
                     /locus_tag="KLTH0F11594g"
                     /db_xref="GeneID:8292915"
     mRNA            <982237..>984177
                     /locus_tag="KLTH0F11594g"
                     /product="KLTH0F11594p"
                     /transcript_id="XM_002554656.1"
                     /db_xref="GeneID:8292915"
     CDS             982237..984177
                     /locus_tag="KLTH0F11594g"
                     /note="similar to uniprot|P32367 Saccharomyces cerevisiae
                     YBR123C, subunit of the RNA polymerase III transcription
                     initiation factor complex (TFIIIC)"
                     /codon_start=1
                     /product="KLTH0F11594p"
                     /protein_id="XP_002554702.1"
                     /db_xref="GeneID:8292915"
                     /db_xref="InterPro:IPR019136"
                     /db_xref="UniProtKB/TrEMBL:C5DLB4"
                     /translation="MDTPKEKSASPDYTGVPAKEYTLDIPRIPSIELPLKVSASQQSV
                     QRAVSMCGGIDNVKKALNTHRDTSDGLELYLNGEKEEDGSSKFFNEHPITGRLVPERD
                     ESIVMKLSLPKGTLEACGGDIQKAISSVPPHRTKIVPVGIINNTIRFREMSDFQVRLD
                     NVPSAREFNESFGTLDWAHFKNYVESIPDQDSRPFENISRMIVDRASDIPGTDFQLPP
                     PPKFSMVNIPFVYKYKGNPYATKTSTGESTVKGTYLKNYQQLVHSFGRGTKVPVAADP
                     SLQKDYEKAKETGVYPGSNKDSKFFEKLEECLQILGRLFEKRRIWVKRHIDGLVPQEL
                     HATLKIALSLVSYRFTKGPWRNTYIKFGIDPRDSPEYAKFQTEYFKIESRLQKSPLAA
                     KYMPDPPPKFYQSDVPDGIDSRFRFNGKQIPWYLMLQIDLLTDEPNIAEVCSKAEYLD
                     EPTELTGWFHELDLTKIRRVVKYELGCLVQGNSEFSEYKLKFFKNMLYSKESMMSKSN
                     EAQAPDADGDIEMADADEHPDQATRMARNDDKGANNNDDDGGDNEDDDDNGVEAGELD
                     DTILEQEEGGEDDGLEPGDESDGEPMENQGSDVTSSGSSAFDIKSASFDQIIGQVSQR
                     DPDLAARLRKDLGGFVFEPELS"
     gene            <984336..>984878
                     /locus_tag="KLTH0F11616g"
                     /db_xref="GeneID:8292916"
     mRNA            <984336..>984878
                     /locus_tag="KLTH0F11616g"
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /transcript_id="XM_002554657.1"
                     /db_xref="GeneID:8292916"
     CDS             984336..984878
                     /locus_tag="KLTH0F11616g"
                     /note="similar to uniprot|P36531 Saccharomyces cerevisiae
                     YBR122C MRPL36 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /protein_id="XP_002554703.1"
                     /db_xref="GeneID:8292916"
                     /db_xref="UniProtKB/TrEMBL:C5DLB5"
                     /translation="MLRSVIFKRFATGGYHGAQQISIPKRPLKKIRLGKARPAIYHKF
                     DVQVELSDGSVITRRSQFPKDQIRLIQDQRNNPLWNQSRDDLVVVDANAGGRLDRFKQ
                     KYDTLFNFEAPAKQPAADAKGKNKVKEVKSAPEEEAAATPAAEEEDAFGMDDYMSLLD
                     QNAQQVQSGGKLATKKRDKK"
     gene            <985064..>985492
                     /locus_tag="KLTH0F11638g"
                     /db_xref="GeneID:8292917"
     mRNA            <985064..>985492
                     /locus_tag="KLTH0F11638g"
                     /product="KLTH0F11638p"
                     /transcript_id="XM_002554658.1"
                     /db_xref="GeneID:8292917"
     CDS             985064..985492
                     /locus_tag="KLTH0F11638g"
                     /note="highly similar to uniprot|Q06819 Saccharomyces
                     cerevisiae YPR082C DIB1 component of the U4/U6aU5
                     tri-snRNP"
                     /codon_start=1
                     /product="KLTH0F11638p"
                     /protein_id="XP_002554704.1"
                     /db_xref="GeneID:8292917"
                     /db_xref="GOA:C5DLB6"
                     /db_xref="InterPro:IPR004123"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DLB6"
                     /translation="MGSVFLPHLHSGWHVDQAIVTEQERLVVVRFGRDWDKDCMLMDE
                     VLYSIAEKVRRFAVIYLCDIDEVPDFNDMYELYDPMTVMFFYRNKHMMCDFGTGNNNK
                     MNFVVEDKQEMIDILETIFRGARKNKGLVVSPYDYNSKRV"
     gene            <985924..>987909
                     /locus_tag="KLTH0F11660g"
                     /db_xref="GeneID:8292918"
     mRNA            <985924..>987909
                     /locus_tag="KLTH0F11660g"
                     /product="KLTH0F11660p"
                     /transcript_id="XM_002554659.1"
                     /db_xref="GeneID:8292918"
     CDS             985924..987909
                     /locus_tag="KLTH0F11660g"
                     /note="highly similar to uniprot|P38088 Saccharomyces
                     cerevisiae YBR121C GRS1 glycyl-tRNA synthase"
                     /codon_start=1
                     /product="KLTH0F11660p"
                     /protein_id="XP_002554705.1"
                     /db_xref="GeneID:8292918"
                     /db_xref="GOA:C5DLB7"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR027031"
                     /db_xref="UniProtKB/TrEMBL:C5DLB7"
                     /translation="MSVEEVAQAKNAVEFSRENLESVLKRRFFFAPSFELYGGVSGLY
                     DYGPPGCAFQANVIDVWRKHFILEEDMLEVDCSMLTPYEVLKTSGHVDKFSDWMCRDL
                     KTGEIFRADHLVEEVLESRLKGDQEARGLTKDANANAQEDADKKKRKKKVKEIKAVKL
                     DDNVVKEYEEILAKIDGYSGQELGELMIKYNIGNPVTGEALEPPMAFNLMFETAIGPS
                     GQLKGYLRPETAQGQFLNFNKLLEFNNHKTPFASASIGKSFRNEISPRSGLLRVREFL
                     MAEIEHFVDPLNKTHPRFDEVKNIKLRFLPREVQQSGSTEPIETTIEDAVATKMVDNQ
                     TLGYFIARIYSFLMAIGVDSNKLRFRQHMANEMAHYAADCWDAELKTSYGWIECVGCA
                     DRSAYDLTVHANKTKEKLVVRQKLEEPVQVTKWEIELTKKLFGPKFRKDAPKVESFLL
                     NLSQEELEAKAKELKAGGKIVFEVEGMDSQIELDDKFVSIEQVTRTEHVREFVPNVIE
                     PSFGIGRIIYSVFEHVFWSRPEDSARAVLSFPPLVAPTKVLLVPLSNHPDLSSVAHQV
                     SKVFRKEKIPFKVDDSGVSIGKRYSRNDELGTPFGVTIDFESAKDGTVTLRERDSTKQ
                     VRGTVEEVVKAIRDITYNGVTWEEGTKSLKPFETQSE"
     gene            <988129..>988599
                     /locus_tag="KLTH0F11682g"
                     /db_xref="GeneID:8292919"
     mRNA            <988129..>988599
                     /locus_tag="KLTH0F11682g"
                     /product="KLTH0F11682p"
                     /transcript_id="XM_002554660.1"
                     /db_xref="GeneID:8292919"
     CDS             988129..988599
                     /locus_tag="KLTH0F11682g"
                     /note="similar to uniprot|P07253 Saccharomyces cerevisiae
                     YBR120C CBP6 Translational activator of COB mRNA"
                     /codon_start=1
                     /product="KLTH0F11682p"
                     /protein_id="XP_002554706.1"
                     /db_xref="GeneID:8292919"
                     /db_xref="UniProtKB/TrEMBL:C5DLB8"
                     /translation="MSSAVRGAAVQLVKTIEKLPAERMKHMVSLKESQLERFKPVAGL
                     EAGAHGSKQKPTLQEIKDIISRTSGPLGLQKEALKKVQEAFPQEQYTAEAIQEQTKSL
                     NNILSNKYRDYYAVGDKLLKPQGNPAYYQRLMDEIEGKKKETFWTAMRTVVLGK"
     gene            complement(<988725..>989963)
                     /locus_tag="KLTH0F11704g"
                     /db_xref="GeneID:8292920"
     mRNA            complement(<988725..>989963)
                     /locus_tag="KLTH0F11704g"
                     /product="KLTH0F11704p"
                     /transcript_id="XM_002554661.1"
                     /db_xref="GeneID:8292920"
     CDS             complement(988725..989963)
                     /locus_tag="KLTH0F11704g"
                     /note="similar to uniprot|P32605 Saccharomyces cerevisiae
                     YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
                     involved in nuclear mRNA splicing"
                     /codon_start=1
                     /product="KLTH0F11704p"
                     /protein_id="XP_002554707.1"
                     /db_xref="GeneID:8292920"
                     /db_xref="GOA:C5DLB9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024888"
                     /db_xref="UniProtKB/TrEMBL:C5DLB9"
                     /translation="MVGTADIPGLSAEIPSRCVHLRNLPRRPSSYDAFVRTLLSCVDP
                     QNKFAKDRDLPLPQIDLKQLPKDNRRLVIDKFGSSGTHLDLEAAKRSFLNDSIFTNAE
                     ATKSLLSDFLTALQSEYEQSLHKLTIGQFRKAYKKFQQGLPDSERKKLNSLEGIRSKT
                     RSLERDICTGSKAYLSPLDPSLGIIGLSRTTHWKYQSEGFLTFVDAGSARHFVETFKG
                     KLVVQGRNVGVSFATKDSMLGAYLKEGKRGLDRIMREKHKSLPDNKLRDEAAKKQKRH
                     LRRLRTKLVNKGLSEQEISSIIKAKTEQPGLSSQSSTKRPRSPSPEPAAKKKKVVAEV
                     AGNPPNKVLLIQNLPTGVTREEVADTFRSEGLVEVRLVGVRNLAFVEYETVSNATDVK
                     NRLGNPYEWNGSAVSVGFAK"
     gene            complement(<990165..>991541)
                     /locus_tag="KLTH0F11726g"
                     /db_xref="GeneID:8292921"
     mRNA            complement(<990165..>991541)
                     /locus_tag="KLTH0F11726g"
                     /product="KLTH0F11726p"
                     /transcript_id="XM_002554662.1"
                     /db_xref="GeneID:8292921"
     CDS             complement(990165..991541)
                     /locus_tag="KLTH0F11726g"
                     /note="uniprot|Q7Z8W9 Translation elongation factor
                     1-alpha"
                     /codon_start=1
                     /product="KLTH0F11726p"
                     /protein_id="XP_002554708.1"
                     /db_xref="GeneID:8292921"
                     /db_xref="GOA:C5DLC0"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLC0"
                     /translation="MGKEKSHVNVVVIGHVDSGKSTTTGHLIFKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDSVKW
                     DESRYQEIVKETSNFIKKVGYNPKNVPFVPISGWNGDNMIEATTNAPWYKGWEKETKA
                     GTVKGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLEAGVPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     AASFNAQVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLVKIDRRTGKTLEEAPKFI
                     KSGDAAMVKFVPSKPMCVEAFTDYPPLGRFAVRDMRQTVAVGVIKSVDKSDKAGKVTK
                     AAQKAAKK"
     gene            complement(<992126..>993049)
                     /locus_tag="KLTH0F11748g"
                     /db_xref="GeneID:8292922"
     mRNA            complement(<992126..>993049)
                     /locus_tag="KLTH0F11748g"
                     /product="KLTH0F11748p"
                     /transcript_id="XM_002554663.1"
                     /db_xref="GeneID:8292922"
     CDS             complement(992126..993049)
                     /locus_tag="KLTH0F11748g"
                     /note="similar to uniprot|Q06815 Saccharomyces cerevisiae
                     YPR079W MRL1 Membrane protein"
                     /codon_start=1
                     /product="KLTH0F11748p"
                     /protein_id="XP_002554709.1"
                     /db_xref="GeneID:8292922"
                     /db_xref="GOA:C5DLC1"
                     /db_xref="InterPro:IPR000479"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="UniProtKB/TrEMBL:C5DLC1"
                     /translation="METRSTRDAAPDADDELFCAVMNPVTGNYIDLSHLSTTPNKLGK
                     GERRRKGTEDSEKTRWVVRSKETGLNFTLGVCSSPASEDDEVANTTGAFYVDPVSSRQ
                     VSIGEFATQPRFMGKKLTLAYEDGDVCPNGVDGKAALLNFVCDKEIATKAQVQFVGSL
                     HDCSYYFEVRSIYACPTSHKSNDVNVLGIFFGIFLVFFAVEWGRRWFYRKMRSRMRYT
                     GGAGSAASGAADRMMRPQWENVEGTSWWRRVLKRLVRGRARPRTAAIKLSSAPQYHSP
                     STDSLVRDMEAQNRLLDNLEAVGEDATTVVD"
     gene            993802..993873
                     /locus_tag="KLTH0F11770r"
                     /db_xref="GeneID:8292923"
     tRNA            993802..993873
                     /locus_tag="KLTH0F11770r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=62.09"
                     /db_xref="GeneID:8292923"
     gene            complement(<993957..>994721)
                     /locus_tag="KLTH0F11792g"
                     /db_xref="GeneID:8292924"
     mRNA            complement(<993957..>994721)
                     /locus_tag="KLTH0F11792g"
                     /product="KLTH0F11792p"
                     /transcript_id="XM_002554664.1"
                     /db_xref="GeneID:8292924"
     CDS             complement(993957..994721)
                     /locus_tag="KLTH0F11792g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0F11792p"
                     /protein_id="XP_002554710.1"
                     /db_xref="GeneID:8292924"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:C5DLC2"
                     /translation="MPFEITTKALRADQLPTRKADIASAAQELIDEVHTSWKKGKCYQ
                     YKLQHNPTLDAGPVSVQTYSTTRAGEYWLSRVSEHRLEPAVYERLVKELNGSVRDGDG
                     WTLPDRSARSRREIDYIEVLSRVDVAQTLESGWVLVNLEYELGKPLTTREFNEWVYVL
                     EPSRGAQRERSSVVSVVADAPLHDSVAHTPAVYASVEQLDYDYETQKLIWTMATTSDA
                     GGNVPKWIQNTMIAKTVSKDVGYCFEWLAKNMEAEK"
     gene            <995425..>996774
                     /locus_tag="KLTH0F11814g"
                     /db_xref="GeneID:8292925"
     mRNA            <995425..>996774
                     /locus_tag="KLTH0F11814g"
                     /product="KLTH0F11814p"
                     /transcript_id="XM_002554665.1"
                     /db_xref="GeneID:8292925"
     CDS             995425..996774
                     /locus_tag="KLTH0F11814g"
                     /note="weakly similar to uniprot|Q6B149 Saccharomyces
                     cerevisiae YPR075C OPY2 Protein of unknown function
                     overproduction blocks cell cycle arrest in the presence of
                     mating pheromone"
                     /codon_start=1
                     /product="KLTH0F11814p"
                     /protein_id="XP_002554711.1"
                     /db_xref="GeneID:8292925"
                     /db_xref="InterPro:IPR018571"
                     /db_xref="UniProtKB/TrEMBL:C5DLC3"
                     /translation="MEAVSSRVGPPTQARRPERTVRVLEEWPEWENMKIYRRDESSSA
                     AAAASSTVSSSSAKATSAGSGCVSCPQGSPSCPVCADDEYCAVSLLSCTQCPQTYCTK
                     KKGSVSESSAAASASNSSGASSGSKNASARVGGIVGGVVGGVALIAALLLLWLYFKYW
                     RKSRSRNKDVVIAREEYAGEYDDDKEKDGFREAGAGAGAGGAEGSSLRDSRALYQARN
                     RSSAATQMTKASNILPIAYIPGVTAGSRSQHKLPPLPRHLLRNGDTRSHITLGSSILG
                     GGDDDRESLIDLPLEDSREGTSAASPAAEGVYSGANAEHVTSQDALTTAIRARPKLVQ
                     ISEEDEEHGNSSSGEAEDTHSGKHFGVTTVLLRSSGDTSRQDDTAEDVPQSDNDDRDS
                     SDDNDDGSFILDVGMQGSLRNATQGEYASVTAARESTLGEDMHREGSGSPFEDKFEL"
     gene            <997547..>999589
                     /locus_tag="KLTH0F11836g"
                     /db_xref="GeneID:8292926"
     mRNA            <997547..>999589
                     /locus_tag="KLTH0F11836g"
                     /product="KLTH0F11836p"
                     /transcript_id="XM_002554666.1"
                     /db_xref="GeneID:8292926"
     CDS             997547..999589
                     /locus_tag="KLTH0F11836g"
                     /note="highly similar to uniprot|P23254 Saccharomyces
                     cerevisiae TKL1 and to YBR117C uniprot|P33315
                     Saccharomyces cerevisiae TKL2 Transketolase"
                     /codon_start=1
                     /product="KLTH0F11836p"
                     /protein_id="XP_002554712.1"
                     /db_xref="GeneID:8292926"
                     /db_xref="GOA:C5DLC4"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DLC4"
                     /translation="MSNFSDIDRLAISTIRLLSVDQVAAANSGHPGAPLGLAPAAHVI
                     WKQMRLNPKNPEWINRDRFVLSNGHACALLYSMLHLSGFDFSIEDLQSFRQLGSKCPG
                     HPEFELPGVEVTTGPLGQGISNAVGIAIAQANFAATYNKPNYTLSDSFTYAFLGDGCL
                     QEGVSSEASSLAGHLKLGNLIAFYDDNQITIDGNTNVSFTEDVAKRYEAYGWEVLHVQ
                     NGNEDLDGILEALNQAKKSQDKPTLIKMTTTIGFGSLNAGSHSVHGSPLKPDDVKQLK
                     TALGFNADQSFVVPQEVYDFYNKEIIQPGQQLNEAWNKTLEEYSAKYPELAAELKRRI
                     SGELPQGWESALPLYTPKDSAVATRKLSEIVLQNIQGTLPEMIGGSADLTPSNLTRWK
                     EAVDFQPPSTGLGDYAGRYIRYGVREHGMGAIMNGISAFGANYKAYGGTFLNFVSYAS
                     GAVRLSALSGHPVIWVATHDSIGLGEDGPTHQPIETLAHFRALPNMQVWRPADGNEVS
                     AAYKVALTHKHTPAVIALSRQNLPQLEGSSIEKASKGGYVLQEVDNADITLVSTGSEV
                     SITVEAAKVLAGKNIKARVVSLPDFHTFDQQPEEYQLSVFPDGVPIMSIEVLSTSGWS
                     KYAHESFGLDRFGASGKAPEIYKAFEFTPEGISTRAEKTIAFYKNKQVTSPLHKPF"
     gene            <999895..>1000371
                     /locus_tag="KLTH0F11858g"
                     /db_xref="GeneID:8292927"
     mRNA            <999895..>1000371
                     /locus_tag="KLTH0F11858g"
                     /product="KLTH0F11858p"
                     /transcript_id="XM_002554667.1"
                     /db_xref="GeneID:8292927"
     CDS             999895..1000371
                     /locus_tag="KLTH0F11858g"
                     /note="similar to uniprot|P40347 Saccharomyces cerevisiae
                     YPR073C LTP1 phosphatase"
                     /codon_start=1
                     /product="KLTH0F11858p"
                     /protein_id="XP_002554713.1"
                     /db_xref="GeneID:8292927"
                     /db_xref="GOA:C5DLC5"
                     /db_xref="InterPro:IPR000106"
                     /db_xref="InterPro:IPR002115"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="UniProtKB/TrEMBL:C5DLC5"
                     /translation="MTQKQISVAFVCLGNICRSPMAEAVFAHTVKAKGLEDRFSKIDS
                     FGTGNWHKGESPDPRSAATCRSHGVPVNHRAQQIRAPQFDEFDYIICMDEMNLRNLKR
                     LKPSDSKAEIYLFGHWNTAGKFREIVDDPYYGGDEGFEYNFKQVQYFSEQFLEMEL"
     gene            complement(<1000583..>1002274)
                     /locus_tag="KLTH0F11880g"
                     /db_xref="GeneID:8292928"
     mRNA            complement(<1000583..>1002274)
                     /locus_tag="KLTH0F11880g"
                     /product="KLTH0F11880p"
                     /transcript_id="XM_002554668.1"
                     /db_xref="GeneID:8292928"
     CDS             complement(1000583..1002274)
                     /locus_tag="KLTH0F11880g"
                     /note="highly similar to uniprot|Q12514 Saccharomyces
                     cerevisiae YPR072W NOT5 Subunit of global transcriptional
                     regulator"
                     /codon_start=1
                     /product="KLTH0F11880p"
                     /protein_id="XP_002554714.1"
                     /db_xref="GeneID:8292928"
                     /db_xref="GOA:C5DLC6"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:C5DLC6"
                     /translation="MSQRKLQQDIEKLLKKVKEGLQDFEDVYDKFQSTDASNTSYREK
                     LESDLKREIKKLQKHRDQIKTWLSKEDVKDKQQVLMENRRLIESGMERFKSVEKMMKT
                     KQFSTEALTNPDIIKDPRELKKRDQFLFVQDCLEELQKQLESYEAQDNEEQCERHAFH
                     IANLENILKQLQNNELEPDTVEEYQEDIQYYVENNDDPDFIEYDTIYEDMDCEIQPGE
                     EAKDLEPSSKPVKASKAERSPRKKGSSGAALPPSASNSLTDNQNSPSAVASPSTSSTG
                     LASLPAKRDTPPQSQAPGQSQGQNSNEEQHPDHNSDLTPQQNSSLDQDQNRSQNQNQQ
                     QQNVNQTQPQTEAQPPRDMSKQIDEMLAQDRSQNSAFQNPLFHPGLDYWLESKRTLLQ
                     PYETMPAEMASQLESSLLNCPDSLDADTPHLYHNVLSLPHPTSIFFPNEPIRLVSNEP
                     VDPTKTHPKHNDIYSRTSLARIMSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQF
                     NKVNRCWFYKEVEKLPPGMEQSEEISWRYFDYQKSWLARRCGAEFVYREEEFERI"
     gene            complement(<1002844..>1003758)
                     /locus_tag="KLTH0F11902g"
                     /db_xref="GeneID:8292929"
     mRNA            complement(<1002844..>1003758)
                     /locus_tag="KLTH0F11902g"
                     /product="KLTH0F11902p"
                     /transcript_id="XM_002554669.1"
                     /db_xref="GeneID:8292929"
     CDS             complement(1002844..1003758)
                     /locus_tag="KLTH0F11902g"
                     /note="similar to uniprot|P53257 Saccharomyces cerevisiae
                     YGR096W TPC1 Tpc1p is a transporter that catalyzes the
                     uptake of the essential cofactor thiamine pyrophosphate
                     (ThPP) into mitochondria it is located in the
                     mitochondrial membrane and its expression appears to be
                     regulated by carbon source"
                     /codon_start=1
                     /product="KLTH0F11902p"
                     /protein_id="XP_002554715.1"
                     /db_xref="GeneID:8292929"
                     /db_xref="GOA:C5DLC7"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DLC7"
                     /translation="MSGDHLRKGQEIPLAKSLLAGCVSGLSARLVTAPLDTLKIRLQL
                     QLANEAANGGTLLTLGKLVREEGVRALWKGNVPAMTMYVLYGSTQFSSYSTLNKWLSG
                     NDWPAQVHTAVVGALAGTCSAVASYPCDVLRTRFIANHNRQFSTMLSTVREILQHEGL
                     HGFFKGVTSSVVSITITCSSMFATYEAVKIFCEQSSSRDSTHIQMLDRSASMIAGVVS
                     KTIVFPLDTVRKRYQVVNWQRIAHLSHANVAYEYYTGVGFIKLALRITEKEGLRALYR
                     GYSLAIFKSVPSTVVSLGMYEWCLRRTG"
     gene            <1003953..>1004627
                     /locus_tag="KLTH0F11924g"
                     /db_xref="GeneID:8292930"
     mRNA            <1003953..>1004627
                     /locus_tag="KLTH0F11924g"
                     /product="KLTH0F11924p"
                     /transcript_id="XM_002554670.1"
                     /db_xref="GeneID:8292930"
     CDS             1003953..1004627
                     /locus_tag="KLTH0F11924g"
                     /note="similar to uniprot|P53256 Saccharomyces cerevisiae
                     YGR095C RRP46 Ribosomal RNA Processing Putative 3'->5'
                     exoribonuclease component of exosome complex of 3'- >5'
                     exonucleases"
                     /codon_start=1
                     /product="KLTH0F11924p"
                     /protein_id="XP_002554716.1"
                     /db_xref="GeneID:8292930"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:C5DLC8"
                     /translation="MISAQTGVLDQVDGSCKLQCGETTVICSVTGPIEPKARQELPSQ
                     LALEVVVRPCKGVPNTREKLLEDQIRGVVTPVLAKYLYPRQLCQICFQILESGEPEDE
                     YNVKELNSCINAAYLALIDSGVALQSSFSSVCVSVLGSNNEILVNPTQEQLIKSDSTH
                     ILALEVGSGGKKIQNVLLIESNGDFTEEIMFNVLSRAEKACVEVALELRKAVED