GenomeNet

Database: RefSeq
Entry: NC_013083
LinkDB: NC_013083
Original site: NC_013083 
LOCUS       NC_013083            1720065 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome G complete sequence.
ACCESSION   NC_013083
VERSION     NC_013083.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 1720065)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1720065)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1720065)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928171.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1720065
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="G"
     repeat_region   2467..2880
                     /rpt_type=long_terminal_repeat
     gene            <5908..>7284
                     /locus_tag="KLTH0G00198g"
                     /db_xref="GeneID:8293306"
     mRNA            <5908..>7284
                     /locus_tag="KLTH0G00198g"
                     /product="KLTH0G00198p"
                     /transcript_id="XM_002555009.1"
                     /db_xref="GeneID:8293306"
     CDS             5908..7284
                     /locus_tag="KLTH0G00198g"
                     /note="similar to uniprot|P38731 Saccharomyces cerevisiae
                     YHL040C ARN1 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to
                     ferrirubin ferrirhodin and related siderophores"
                     /codon_start=1
                     /product="KLTH0G00198p"
                     /protein_id="XP_002555055.1"
                     /db_xref="GeneID:8293306"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DLF7"
                     /translation="MQLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAG
                     AVLYNVGFCCVNIVLLVVMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKH
                     WSWGIGFWAFSFPLASLPFICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRIF
                     HQVDFIGTLIFSVALGCVLVPLTLAGGYSSKWSHSDSIVPLVVGSVLFVFYIVWESFM
                     ASYPALPFKLLKDRGIWIPILAGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASL
                     PLFVTTVASPFFAVLLRWTGRLKWYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVV
                     LLGLGRTFTQFPLLTTMQARAPHTKMATVTGLFHVWGSVGSVVGASISGAVWTQKMPK
                     KLLKMLGSNGLATAAYASPYTFIISYPWGTSERLAVVLAYKNVQKDTPLKSKIDNDAE
                     IEMTTSEV"
     repeat_region   complement(7541..7756)
                     /rpt_type=long_terminal_repeat
     mobile_element  complement(8030..11474)
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
                     /mobile_element_type="transposon"
     repeat_region   16301..16565
                     /rpt_type=long_terminal_repeat
     gene            complement(16891..16963)
                     /locus_tag="KLTH0G00308r"
                     /db_xref="GeneID:8293310"
     tRNA            complement(16891..16963)
                     /locus_tag="KLTH0G00308r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8293310"
     gene            18023..18096
                     /locus_tag="KLTH0G00330r"
                     /db_xref="GeneID:8293311"
     tRNA            18023..18096
                     /locus_tag="KLTH0G00330r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.40"
                     /db_xref="GeneID:8293311"
     repeat_region   18839..19255
                     /rpt_type=long_terminal_repeat
     gene            20341..20422
                     /locus_tag="KLTH0G00374r"
                     /db_xref="GeneID:8293313"
     tRNA            20341..20422
                     /locus_tag="KLTH0G00374r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=80.04"
                     /db_xref="GeneID:8293313"
     gene            complement(<21210..>22325)
                     /locus_tag="KLTH0G00396g"
                     /db_xref="GeneID:8293314"
     mRNA            complement(<21210..>22325)
                     /locus_tag="KLTH0G00396g"
                     /product="KLTH0G00396p"
                     /transcript_id="XM_002555010.1"
                     /db_xref="GeneID:8293314"
     CDS             complement(21210..22325)
                     /locus_tag="KLTH0G00396g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G00396p"
                     /protein_id="XP_002555056.1"
                     /db_xref="GeneID:8293314"
                     /db_xref="UniProtKB/TrEMBL:C5DLF8"
                     /translation="MELISSRYSVVDGFLIASQQNGTKVIIDHETCCLSLNKAEKDLI
                     SAKKLRDLSRYRKSKSKLVACESQLLFEIVTAAPQVFIQNSNYTREANKGNNIKYTQS
                     LLVIPAFFFSDVKKYFFFSQGSKGLQFQTGDTPTRPLVEEREDLFTNLELKKPKFSIH
                     DLDVLRCYKIDQDLYAQECFSLLSFFQTKTKMSSQDVLTLETALPIFDKNLKNFDLDH
                     CIMNKITDTVALLHFVLVNIGIFSFGHSPFLGKLSGAPIRSRIGRSYNLEVKSRYLGK
                     LFQSDIQSYEMDGLICLLLQILAFRTDEYSDPSQILEVREAGDFCNRLAALIIWIGYA
                     VFAESADSVISSANCKHNSSLKSLIRVYQKVKAQCDT"
     gene            complement(<23130..>24836)
                     /locus_tag="KLTH0G00418g"
                     /db_xref="GeneID:8293315"
     mRNA            complement(<23130..>24836)
                     /locus_tag="KLTH0G00418g"
                     /product="KLTH0G00418p"
                     /transcript_id="XM_002555011.1"
                     /db_xref="GeneID:8293315"
     CDS             complement(23130..24836)
                     /locus_tag="KLTH0G00418g"
                     /note="similar to uniprot|Q12198 Saccharomyces cerevisiae
                     YLL058W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G00418p"
                     /protein_id="XP_002555057.1"
                     /db_xref="GeneID:8293315"
                     /db_xref="GOA:C5DLF9"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DLF9"
                     /translation="MTEIEFGQPLPSNLEYAVSFGIPTWESAIGYVEKNPDYISKMVT
                     GYPRYFPQPAIQKLCDHFLQKFGEGSEGCRPFPSAKSASNCLEYVKSVSGPQSKARME
                     VETFYLNDNGKDAGEDSYQLAITIAAIFASEDELETVKEYWKLTGECVSSRLAVFVNK
                     FLEKLPADSKLSQNETGTDIQLLKRTGEEAKVLLRNRIANNHCNPFGEKREVVDKRPI
                     LDATKDVYLVSSGMSAVFTARKLLTHWEKNKNRKPLSHKNRDFHDKQHPVCETAAVFG
                     FPFKDTKVIMEKFGKCQFFGFGDSRDLAGLRSLLKGGKERILGVFLETPSNPMLNMPD
                     LKQLRNMANEYGFFIVVDDTIGGLNVDVLPYADIVCTSLTKLFSGSSNVMGGSIILNP
                     KSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNENTMKLIQEVLLPE
                     EGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEEDAKKFYNSLTVFKG
                     PSNGTNFTLACPYVHLAHHFELEEVSTFGAHSSLVRVSVGLENTQWLLNAFSSVINLL
                     RK"
     gene            <28632..>30089
                     /locus_tag="KLTH0G00440g"
                     /db_xref="GeneID:8293316"
     mRNA            <28632..>30089
                     /locus_tag="KLTH0G00440g"
                     /product="KLTH0G00440p"
                     /transcript_id="XM_002555012.1"
                     /db_xref="GeneID:8293316"
     CDS             28632..30089
                     /locus_tag="KLTH0G00440g"
                     /note="similar to uniprot|P04807 Saccharomyces cerevisiae
                     YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
                     phosphorylation of glucose in the cytosol predominate
                     hexokinase during growth on glucose functions in the
                     nucleus to repress expression of HXK1 and GLK1 and to
                     induce expression of its own gene"
                     /codon_start=1
                     /product="KLTH0G00440p"
                     /protein_id="XP_002555058.1"
                     /db_xref="GeneID:8293316"
                     /db_xref="GOA:C5DLG0"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:C5DLG0"
                     /translation="MVHLGPKKPPMRKGSMIDVPKNLMEQIQSLEEQFTVSGEKLKEV
                     TKHFVGELNKGLSKKGGNIPMIPGWVMEFPTGQETGDYLAIDLGGTNLRVVLVRLLGN
                     HKFDTTQSKYKLPDHIRTSSSEELFSFIADSLKTFVDEEFPEGVTEPLPLGFTFSYPC
                     SQDKVNEGFLQRWTKGFDIEGVEGEDVVPMLQEQLVKRKIPIDVVALINDTTGTLVAS
                     MYTDAETRMGCIFGTGVNGAYFDVVSDIEKLEGRLPSDITSDLPMAINCEYGSFDNEL
                     VVLPRTKYDIIVDKQSPRPGQQSFEKMTSGYYLGELLRLILLDLQQQGLIFEGQDLTK
                     LQKPYVMDTSYPARIEEDPFENLEDTYDIFKNELGVETTGGERKLIRRACELIGTRAS
                     RMSMCGIGAVCTKRGYKTAHIAADGSVFNKYPEFKERAAAGLRDIFDWEPRQNIEEYP
                     IVIVAAEDGSGAGAAIIAALTQKRLAAGKSVGVAK"
     gene            complement(<30407..>31204)
                     /locus_tag="KLTH0G00462g"
                     /db_xref="GeneID:8293317"
     mRNA            complement(<30407..>31204)
                     /locus_tag="KLTH0G00462g"
                     /product="KLTH0G00462p"
                     /transcript_id="XM_002555013.1"
                     /db_xref="GeneID:8293317"
     CDS             complement(30407..31204)
                     /locus_tag="KLTH0G00462g"
                     /note="similar to uniprot|P32496 Saccharomyces cerevisiae
                     YFR052W RPN12 Subunit of the 19S regulatory particle of
                     the 26S proteasome lid synthetically lethal with RPT1
                     which is an ATPase component of the 19S regulatory
                     particle physically interacts with Nob1p and Rpn3p"
                     /codon_start=1
                     /product="KLTH0G00462p"
                     /protein_id="XP_002555059.1"
                     /db_xref="GeneID:8293317"
                     /db_xref="GOA:C5DLG1"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR006746"
                     /db_xref="UniProtKB/TrEMBL:C5DLG1"
                     /translation="MPTLLELVKSLNTAFVNGDNSSCQKLLSPVKIELIKSHLLVPDF
                     SKAQENERYLEDLNVAKRVLEIGALCSLRNADFEAYENFFSQLRVFYFSGIPRLAESE
                     NKSKLISLYLLLLLSQGDVTKFHSELEFLGKRLGSLEEDAFLSYPIKVEKWLMEGSYQ
                     RAWDLLKSESKIEEFNVFTQTLMDAIREEIGRNTELAYHKLPLFNVKALLFFESEKDT
                     EQFALARGWKVSGGCIVFDEEEVADDHHQTSIVEKALDYAINLESIV"
     gene            complement(<32295..>34040)
                     /locus_tag="KLTH0G00484g"
                     /db_xref="GeneID:8293318"
     mRNA            complement(<32295..>34040)
                     /locus_tag="KLTH0G00484g"
                     /product="KLTH0G00484p"
                     /transcript_id="XM_002555014.1"
                     /db_xref="GeneID:8293318"
     CDS             complement(32295..34040)
                     /locus_tag="KLTH0G00484g"
                     /note="highly similar to uniprot|P32608 Saccharomyces
                     cerevisiae YGL252C RTG2 Sensor of mitochondrial
                     dysfunction regulates the subcellular location of Rtg1p
                     and Rtg3p transcriptional activators of the retrograde
                     (RTG) and TOR pathways Rtg2p is inhibited by the
                     phosphorylated form of Mks1p"
                     /codon_start=1
                     /product="KLTH0G00484p"
                     /protein_id="XP_002555060.1"
                     /db_xref="GeneID:8293318"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="UniProtKB/TrEMBL:C5DLG2"
                     /translation="MSAISDSDSETEVVSRNLCGVVDIGSNGIRFSISSKASHHARIM
                     PCVFKDRIGISLFEVQYAANSLDKAPIPEDTIKEVSAAMKRFKLICDDFGVPETGVRV
                     VATEATREAINSKEFISAVFESTEWEVELLTKEEEGKIGAYGVISSFNSVSGLYMDLG
                     GGSTQISWISCIDGQIKMSDTPVSLPYGAGALSRRMKLEDKRELFLEIKEAYKNAISK
                     IDIPQEMIEEARQKGGFDLFTCGGGLRGMGHLLLSKIKEYPIQTIINGFSCSFEEFSS
                     VADYLFLKGSLPGPKKIFKVSERRAQQLPAVGLLMSAAFESLPQVKTVHFSEGGVREG
                     TLYSILPREIRAQDPLHVATRPYAPLLAPKYLELLRAAIPEKDVPKIVYSRIAPALCN
                     LAFVHASYPKELQPTAALHVATTGIIAGCHGLSHRARALIGIALCNRWGGDVPEQELE
                     HKKLLEDVVLRDGNKVERERIVWWTQYIGTIMYVICGVHPGGNIRDGLFNFNIEQKGD
                     SDKELQNLSLDERIASSNSKKREFEVIVRISKDDLKTSASVRARIITLQKKIRKLSRG
                     SSEKVKIGVQFYEDA"
     gene            <35079..>36386
                     /locus_tag="KLTH0G00506g"
                     /db_xref="GeneID:8293319"
     mRNA            <35079..>36386
                     /locus_tag="KLTH0G00506g"
                     /product="KLTH0G00506p"
                     /transcript_id="XM_002555015.1"
                     /db_xref="GeneID:8293319"
     CDS             35079..36386
                     /locus_tag="KLTH0G00506g"
                     /note="weakly similar to uniprot|P53060 Saccharomyces
                     cerevisiae YGL250W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G00506p"
                     /protein_id="XP_002555061.1"
                     /db_xref="GeneID:8293319"
                     /db_xref="InterPro:IPR018822"
                     /db_xref="UniProtKB/TrEMBL:C5DLG3"
                     /translation="MVEASDSPAVVSETEVSLKKAPEVIVGSSRSHAEALSTFEKKQR
                     AMDGPQKSPEGSRHQSPEPNYFSLQSPEPHSEREVTVDNDDSSKINGEERSKLKQGYQ
                     SDDDNDSIIDIVSESEVYEAAKQLLSSKPPQIRVNYQGESYLLLGEYDGDNAKEWSSD
                     KIICTDSADLHRGCNVAFGRMRLFFQQVHGGLELLSKELSFEFPDLDLVMEEDNMYNK
                     DITVNDVVSIFKIIKDNSIKKCEPDVSNHLTINVSTKPRFVSRYNSLVEMLNGDATFS
                     NIKVFTNDRSHPVVLDESEQTPNSKDAEVIIMSSEGEEADENEEADDNEADDDETGGE
                     KVNDEEAGDEEPRKIELDGMERDGKESFGVHRDGLTPGNGTSVSNPAVLSEELGQHNA
                     FSPKRGAEKPEHSGIQMAEVDNSESGDSLKRRRDSVSDGDLFV"
     gene            <36584..>38485
                     /locus_tag="KLTH0G00528g"
                     /db_xref="GeneID:8293320"
     mRNA            <36584..>38485
                     /locus_tag="KLTH0G00528g"
                     /product="KLTH0G00528p"
                     /transcript_id="XM_002555016.1"
                     /db_xref="GeneID:8293320"
     CDS             36584..38485
                     /locus_tag="KLTH0G00528g"
                     /note="similar to uniprot|P43621 Saccharomyces cerevisiae
                     YFR051C RET2 Delta subunit of the coatomer complex (COPI)
                     which coats Golgi-derived transport vesicles involved in
                     retrograde transport between Golgi and ER"
                     /codon_start=1
                     /product="KLTH0G00528p"
                     /protein_id="XP_002555062.1"
                     /db_xref="GeneID:8293320"
                     /db_xref="GOA:C5DLG4"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DLG4"
                     /translation="MVEKPAQESAFRKKRDHQKDRHTPQLARRVSLVLRAESCTFSDF
                     IYSHSFAESGSLLFLACYTSLHTRNIYFLNKPKGTHIRQNSQLIVLRFSKHKMVVIAV
                     SIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYKPFDD
                     YYIILITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVITMGY
                     KENLSISQINTYLSMESHEEKIQEIIERNKEFEAAEERKRRAKEISRKEQERKMGVSP
                     MGLDATRFQASNDPNISNAYNSYYSQASAAAQQSYLQSQQKAVSPEQVASIGTEVSSS
                     LGLGGRGMKLGRKKSLGSHLQPTKQAPAPAASFQIEESEKPANNGILVCVKEVVSAEI
                     SREGNVSSSELKGSLELRVNDKNLAHAIIRLASHVDVKDKAFQFKTHPNIDKNMFLSS
                     GVVGLRDQKKAFPFNDQSLAVLRWRKVGGADDNSLVPMGVSSWVSPSDSNTGMFDVTL
                     EIEMNENYENPLNDVRFCIPVYTENVHINDDFNDLGASIESVDDENGIIVKIETIAPG
                     TTAAVGLALEAEYEDALFPMTVHFSNHAALSSFSKVEVADVISTSEEASQLQFDTISS
                     IRTDDYTIT"
     gene            <38715..>39512
                     /locus_tag="KLTH0G00550g"
                     /db_xref="GeneID:8293321"
     mRNA            <38715..>39512
                     /locus_tag="KLTH0G00550g"
                     /product="KLTH0G00550p"
                     /transcript_id="XM_002555017.1"
                     /db_xref="GeneID:8293321"
     CDS             38715..39512
                     /locus_tag="KLTH0G00550g"
                     /note="highly similar to uniprot|P30657 Saccharomyces
                     cerevisiae YFR050C PRE4 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="KLTH0G00550p"
                     /protein_id="XP_002555063.1"
                     /db_xref="GeneID:8293321"
                     /db_xref="GOA:C5DLG5"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR016295"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DLG5"
                     /translation="MNHDPLQWGRPSDEHYGTYNKSIASASPYPSMHTQQPIVTGTSV
                     ISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISGDISDMQHLENLLDE
                     MQTENNYDNEYAEDEEALKPSYVFEYLANVMYNRRSKMNPLWNALIVAGLEDGKPFLK
                     YVNLLGVTYSAPSLATGFGAHLALPLLRKIVDSESDVKKTSAEDAEKSIKEAMKVLFY
                     RDARSSRNYSIAIVDSKKGLVLNKDAVVEDMVWGFAKDIKGYGTQNV"
     gene            <40280..>41368
                     /locus_tag="KLTH0G00572g"
                     /db_xref="GeneID:8293322"
     mRNA            <40280..>41368
                     /locus_tag="KLTH0G00572g"
                     /product="KLTH0G00572p"
                     /transcript_id="XM_002555018.1"
                     /db_xref="GeneID:8293322"
     CDS             40280..41368
                     /locus_tag="KLTH0G00572g"
                     /note="similar to uniprot|P22434 Saccharomyces cerevisiae
                     YGL248W PDE1 Low-affinity cyclic AMP phosphodiesterase
                     controls glucose and intracellular acidification-induced
                     cAMP signaling target of the cAMP- protein kinase A (PKA)
                     pathway glucose induces transcription and inhibits
                     translation"
                     /codon_start=1
                     /product="KLTH0G00572p"
                     /protein_id="XP_002555064.1"
                     /db_xref="GeneID:8293322"
                     /db_xref="GOA:C5DLG6"
                     /db_xref="InterPro:IPR000396"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:C5DLG6"
                     /translation="MSAFEINILGASGGPLDGGNQGILLSKAGSDALKKYICIDAGSG
                     LRQITSMLIKNAKMKNARQEFLCQDDMTESLFENLEEPVGCFVDKSSSIMRGLGPSAT
                     PQDGESVMTLALRIFNKVEECYITHPHLDHVAALAINTPACNSNGKSIWGLRPTVEAL
                     KKHIFNDVIWPNLLEEPRMKLRVNSLDEAQRHRVSCIPNWFITPLRLMHGVTVHGSNP
                     CPSTAYLVEDDTTKDAILVFGDLESDLISRRRFVSNIWRHLSKTVAFEKLKAIVIECS
                     CPNATKDEHLFGHLSPKYLVHELKSLSKVYGRPLDGLHVIIVHVKMASGGRDPRLVIL
                     DEVRQLAAAEGLGKIVISIAIEGYTFVV"
     gene            complement(<41445..>41825)
                     /locus_tag="KLTH0G00594g"
                     /db_xref="GeneID:8293323"
     mRNA            complement(<41445..>41825)
                     /locus_tag="KLTH0G00594g"
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /transcript_id="XM_002555019.1"
                     /db_xref="GeneID:8293323"
     CDS             complement(41445..41825)
                     /locus_tag="KLTH0G00594g"
                     /note="similar to uniprot|P19955 Saccharomyces cerevisiae
                     YFR049W"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /protein_id="XP_002555065.1"
                     /db_xref="GeneID:8293323"
                     /db_xref="InterPro:IPR020373"
                     /db_xref="UniProtKB/TrEMBL:C5DLG7"
                     /translation="MRQTVVRLAKSYTPMIKFVGARHPVVQHTGGAGAHACALDGIAP
                     GSSQCLPAAEYLSKLKPFEVVSYKVKNTPKKGVSETDKRRLTFTDRALHENEVASVLD
                     LPKRFRVRPLEDPEIDVINAGGAR"
     gene            <42539..>43120
                     /locus_tag="KLTH0G00616g"
                     /db_xref="GeneID:8293324"
     mRNA            <42539..>43120
                     /locus_tag="KLTH0G00616g"
                     /product="KLTH0G00616p"
                     /transcript_id="XM_002555020.1"
                     /db_xref="GeneID:8293324"
     CDS             42539..43120
                     /locus_tag="KLTH0G00616g"
                     /note="similar to uniprot|P53062 Saccharomyces cerevisiae
                     YGL247W BRR6 Essential nuclear envelope integral membrane
                     protein required for nuclear transport depletion alters
                     nucleoporin distribution and nuclear envelope morphology
                     suggesting a role in the spatial organization of nuclear
                     pores"
                     /codon_start=1
                     /product="KLTH0G00616p"
                     /protein_id="XP_002555066.1"
                     /db_xref="GeneID:8293324"
                     /db_xref="GOA:C5DLG8"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:C5DLG8"
                     /translation="MYDQLVTSQKKRSVSSAASSSKESKRHWSDPKTLAAYIQLFVNT
                     VIISGLLYLCVRFLRLVNRDVECKFRNKVALAAKAALECRANYETNRCEPEERAPALE
                     AQCAEWAHCMSRSQELWDLQHSAVLWAETLAEIINGFFKPISIKSLIILLTFTFGVII
                     VSNIAFGSYRVHYYGALNSPQNSDLSSRGPRPL"
     gene            <43280..>44221
                     /locus_tag="KLTH0G00638g"
                     /db_xref="GeneID:8293325"
     mRNA            <43280..>44221
                     /locus_tag="KLTH0G00638g"
                     /product="KLTH0G00638p"
                     /transcript_id="XM_002555021.1"
                     /db_xref="GeneID:8293325"
     CDS             43280..44221
                     /locus_tag="KLTH0G00638g"
                     /note="similar to uniprot|Q07551 Saccharomyces cerevisiae
                     YDL124W NADPH-dependent alpha-keto amide reductase reduces
                     aromatic alpha-keto amides aliphatic alpha-keto esters and
                     aromatic alpha-keto esters"
                     /codon_start=1
                     /product="KLTH0G00638p"
                     /protein_id="XP_002555067.1"
                     /db_xref="GeneID:8293325"
                     /db_xref="GOA:C5DLG9"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DLG9"
                     /translation="MVADIPTVELKGSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQE
                     LADQVSNAIKAGFNHIDAAEAYKTHPEVGAGIANSGVPREKLWVTDKYTPWSWTWRKG
                     KGPLESLELSLGKMQMQYVDLYLVHVPFINPETAGIDLKEAWRQMEEIYDRGWAKNIG
                     VSNFDVESLEYIRTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPL
                     TKGKPGPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFE
                     LSSEDFTSITEVGKTKIFRNFMTDLYGKYDSILYKDL"
     gene            complement(<44243..>45394)
                     /locus_tag="KLTH0G00660g"
                     /db_xref="GeneID:8293326"
     mRNA            complement(<44243..>45394)
                     /locus_tag="KLTH0G00660g"
                     /product="KLTH0G00660p"
                     /transcript_id="XM_002555022.1"
                     /db_xref="GeneID:8293326"
     CDS             complement(44243..45394)
                     /locus_tag="KLTH0G00660g"
                     /note="highly similar to uniprot|P53063 Saccharomyces
                     cerevisiae YGL246C RAI1 Nuclear protein that binds to and
                     stabilizes the exoribonuclease Rat1p required for pre-rRNA
                     processing"
                     /codon_start=1
                     /product="KLTH0G00660p"
                     /protein_id="XP_002555068.1"
                     /db_xref="GeneID:8293326"
                     /db_xref="InterPro:IPR013961"
                     /db_xref="UniProtKB/TrEMBL:C5DLH0"
                     /translation="MGLSADLFVQKRSAASSLKQPKELGFYSKTQEGQFLVNDSSKLS
                     YYYLPDTELERNLDLCSGIKKFKECFGNPDVDACTLSGLLKTIQAYEERKNKKVPADI
                     ITFRGIMRKLISAAFDSPKYNRVDLRVLSFNGQLFIREPNQAHPPPANTSSMEYRSYY
                     SGYKFETLSTISKPLPQVTRNSLEKRHKRICCNGDQYITVVRSGVGHCKLVLGAEVDC
                     VFDFTEDSSDNLKHYAELKCTKGVSTFAEARAFERKMFKTWLQCFLVGINRVIYGFRD
                     ENFILRSVEEYSTQEVPLLLKNNNPQLTNACMDAVRWYGALTEWLLSSIPREESAEHI
                     RAYRLTFENNHLKLVEIEKSDTEYDQLVNGEGILTSEFREWRKSLNKSL"
     gene            <45680..>47794
                     /locus_tag="KLTH0G00682g"
                     /db_xref="GeneID:8293327"
     mRNA            <45680..>47794
                     /locus_tag="KLTH0G00682g"
                     /product="KLTH0G00682p"
                     /transcript_id="XM_002555023.1"
                     /db_xref="GeneID:8293327"
     CDS             45680..47794
                     /locus_tag="KLTH0G00682g"
                     /note="highly similar to uniprot|P46655 Saccharomyces
                     cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
                     forms a complex with methionyl-tRNA synthetase (Mes1p) and
                     Arc1p complex formation increases the catalytic efficiency
                     of both tRNA synthetases and ensures their correct
                     localization to the cytoplasm"
                     /codon_start=1
                     /product="KLTH0G00682p"
                     /protein_id="XP_002555069.1"
                     /db_xref="GeneID:8293327"
                     /db_xref="GOA:C5DLH1"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:C5DLH1"
                     /translation="MAKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSP
                     ATFEDSCDDVLKRIVQTYPEVFKHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDAC
                     LNFRTFILGGTTFSAADIACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSA
                     HEFLVKTLQELKKASTSNKKKETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAK
                     AAILNQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQ
                     EMYDLCVKMIEEGNAYCDDTPTDKMREERMDGLASARRDRSVEENLRIFTQEMKNGTE
                     EGLKNCVRAKIDYKALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEG
                     VTHALRTIEYRDRNAQYQWMLDALHLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLV
                     SNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPVAP
                     RHTAIVKPVKFHVEGAPQTPDVQIKLKHKKNPAVGEKKVIYYADILIDQDDADAVTEG
                     EELTLMDWGNAIVTKKNADGSLTGKLHLEGDFKKTKLKLTWLADTDDKVDVDLVDFDH
                     LITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKDMKKGDIIQFERKGYYRLDSFATA
                     DKPYVFFAIPDGKSVNKYGAKK"
     gene            complement(<47865..>49712)
                     /locus_tag="KLTH0G00704g"
                     /db_xref="GeneID:8293328"
     mRNA            complement(<47865..>49712)
                     /locus_tag="KLTH0G00704g"
                     /product="KLTH0G00704p"
                     /transcript_id="XM_002555024.1"
                     /db_xref="GeneID:8293328"
     CDS             complement(47865..49712)
                     /locus_tag="KLTH0G00704g"
                     /note="similar to uniprot|P43620 Saccharomyces cerevisiae
                     YFR048W RMD8 Cytosolic protein required for sporulation"
                     /codon_start=1
                     /product="KLTH0G00704p"
                     /protein_id="XP_002555070.1"
                     /db_xref="GeneID:8293328"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:C5DLH2"
                     /translation="MQSSLGFQEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFAGHA
                     AGLRGGRAAREKSDTYQGFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISI
                     DNILSDVSDVPSGRREERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVL
                     IPEDSDRKNNALQMERRRPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFL
                     RYTHDVSPRLYDECLYVPYCLPLLPGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRD
                     HHYEYYSGVETVEDMNNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQ
                     FFAEEGRDTDQSKNISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNF
                     TEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSG
                     DHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGK
                     LFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEF
                     FDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFIIRQLKNSE"
     gene            <49910..>51595
                     /locus_tag="KLTH0G00726g"
                     /db_xref="GeneID:8293329"
     mRNA            <49910..>51595
                     /locus_tag="KLTH0G00726g"
                     /product="KLTH0G00726p"
                     /transcript_id="XM_002555025.1"
                     /db_xref="GeneID:8293329"
     CDS             49910..51595
                     /locus_tag="KLTH0G00726g"
                     /note="similar to uniprot|P53064 Saccharomyces cerevisiae
                     YGL244W RTF1 Subunit of the RNA polymerase II- associated
                     Paf1 complex directly or indirectly regulates DNA-binding
                     properties of Spt15p (TATA box-binding protein) and
                     relative activities of different TATA elements"
                     /codon_start=1
                     /product="KLTH0G00726p"
                     /protein_id="XP_002555071.1"
                     /db_xref="GeneID:8293329"
                     /db_xref="GOA:C5DLH3"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="UniProtKB/TrEMBL:C5DLH3"
                     /translation="MSDIDEDLLALAGASSGEEEEEDVQIGSSKKRSRSDHQSSSKRR
                     IVDEDEEQDDDEEEGEEDDYNPEAASYDMDSEEDEDEEPNPFPLEGKYKNEEDRSYLE
                     SLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKRQLQQEGKKTRSSTRSTR
                     TTGHSDLKESRLSELKKQRAKKKGTYEYSEEEEEEGQNEEDEYGYQDQEDESEDDYEP
                     MYKKGKTEDEEELKWAEDEDLDREPELGDFNRIKIGRSFVAKFCFYPEFNDMIKGCYG
                     RVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKNRKVFQMNFFSD
                     GAITQPEFERYLRSLETSEINKPSLYIINNKSNEINSFVSQPVTSKLTDELVRNRMIF
                     NKKLSGTNAVLEKTILKDKLQYAKESGSERDVAKYSSQLRNLEKRLSSYEKHHENDQA
                     GSKKLGALTSKNRRVNLDKGKNVEVTKKEDTPFDAKTDPFSRLKTRTKIYYQEIQREE
                     NEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIISNMDFQVSLDV"
     gene            <51751..>52908
                     /locus_tag="KLTH0G00748g"
                     /db_xref="GeneID:8293330"
     mRNA            <51751..>52908
                     /locus_tag="KLTH0G00748g"
                     /product="KLTH0G00748p"
                     /transcript_id="XM_002555026.1"
                     /db_xref="GeneID:8293330"
     CDS             51751..52908
                     /locus_tag="KLTH0G00748g"
                     /note="similar to uniprot|P53065 Saccharomyces cerevisiae
                     YGL243W TAD1 tRNA-specific adenosine deaminase deaminates
                     adenosine-37 to inosine in tRNA-Ala"
                     /codon_start=1
                     /product="KLTH0G00748p"
                     /protein_id="XP_002555072.1"
                     /db_xref="GeneID:8293330"
                     /db_xref="GOA:C5DLH4"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="UniProtKB/TrEMBL:C5DLH4"
                     /translation="MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACV
                     VAINRANEDLRLVSLATGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQL
                     LKDSQSHPVPDLVSSSSDNSGIYRLNEEWSFALYISRAPCGDASMGLLYDEGCISFTD
                     DDRCQYVDDNNKTIIRGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILN
                     SLTWDLLEAPVFLEYIVIPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDD
                     KTYENQPPSLMSSILLNIIEGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQ
                     WSLFKQIKGGVDSQTYREFKSQQTDRNALKERIRLALSKDGWVGTESDDCG"
     gene            complement(<52958..>53473)
                     /locus_tag="KLTH0G00770g"
                     /db_xref="GeneID:8293331"
     mRNA            complement(<52958..>53473)
                     /locus_tag="KLTH0G00770g"
                     /product="KLTH0G00770p"
                     /transcript_id="XM_002555027.1"
                     /db_xref="GeneID:8293331"
     CDS             complement(52958..53473)
                     /locus_tag="KLTH0G00770g"
                     /note="highly similar to uniprot|P53066 Saccharomyces
                     cerevisiae YGL242C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G00770p"
                     /protein_id="XP_002555073.1"
                     /db_xref="GeneID:8293331"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DLH5"
                     /translation="MSDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTA
                     HDPMGNSGLHLCCMYGSWDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEH
                     GTFIARNLIEVGADPRIVNQAGQKPIDLVHGDELDDLIDLLQGAELAAENQGAVNEED
                     AEVIDDGPDDD"
     gene            <53588..>56653
                     /locus_tag="KLTH0G00792g"
                     /db_xref="GeneID:8293332"
     mRNA            <53588..>56653
                     /locus_tag="KLTH0G00792g"
                     /product="KLTH0G00792p"
                     /transcript_id="XM_002555028.1"
                     /db_xref="GeneID:8293332"
     CDS             53588..56653
                     /locus_tag="KLTH0G00792g"
                     /note="similar to uniprot|P53067 Saccharomyces cerevisiae
                     YGL241W"
                     /codon_start=1
                     /product="KLTH0G00792p"
                     /protein_id="XP_002555074.1"
                     /db_xref="GeneID:8293332"
                     /db_xref="GOA:C5DLH6"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DLH6"
                     /translation="MICNSERTLAKMKEKLKEAIVGAQSTNGQVRENSENALWSLCSE
                     NPSATCTSLMQLACGIENAVEDRIFSLLSLRKLITMYWSAGFESYRGPPGIGDEGKRM
                     IRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDEWPTLVDSIFDAILQRQSLSAL
                     YVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSSTQAKTASAKLYQACLLQLQ
                     SPMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKGINTSALNLQQVLLSCLNTIKT
                     GFSKKLFTIESAQELIEFLFENFRKIAELCIDVTIDPDMKLAANEVGIQMVSLFATLM
                     DTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNVFASKETGLSTSFTVRDECEQFM
                     QGLSGFAYNSVFNALTSALIYNESPNWKVQESILFFIQALCGNEDDEVSFNFEKTQSL
                     LNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVKALVKDSLFHSFSLARQTP
                     SYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQELLEEAEEDTPSILLE
                     ALAPTLSSNHKTTETISFYQLALQLILKISSKHPSNIQVGLEAQDCLSNLLKSTSTEE
                     YVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKPRDGCLPSDITSYV
                     FNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDLEKLLSAETSDS
                     GAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLANVFCYLVSLN
                     PAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKLFFQADSR
                     IDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTSQTDLE
                     KYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEEDVI
                     PGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV"
     gene            <56852..>57739
                     /locus_tag="KLTH0G00814g"
                     /db_xref="GeneID:8293333"
     mRNA            <56852..>57739
                     /locus_tag="KLTH0G00814g"
                     /product="KLTH0G00814p"
                     /transcript_id="XM_002555029.1"
                     /db_xref="GeneID:8293333"
     CDS             56852..57739
                     /locus_tag="KLTH0G00814g"
                     /note="highly similar to uniprot|P43619 Saccharomyces
                     cerevisiae YFR047C BNA6 Quinolinate phosphoribosyl
                     transferase required for biosynthesis of nicotinic acid
                     from tryptophan via kynurenine pathway"
                     /codon_start=1
                     /product="KLTH0G00814p"
                     /protein_id="XP_002555075.1"
                     /db_xref="GeneID:8293333"
                     /db_xref="GOA:C5DLH7"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR004393"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR022412"
                     /db_xref="InterPro:IPR027277"
                     /db_xref="UniProtKB/TrEMBL:C5DLH7"
                     /translation="MPEFQHLLPASGLWRQDVTNWLQEDVPAFDFGGFVVGSDAKMAT
                     LLCKQAGVLSGVPFAQEVFDQCQLNVEWLYKEGDFLDPASTANGKLAVAKVSGEARNI
                     LLAERTALNLLSRCSGIATASRELVSTARKTGYQGIIAGTRKTTPGLRRLEKYSMLVG
                     GCDTHRYDLSSMVMLKDNHIWSTGSITNAVKNARSVCGFAVKIEVECQSEEEADEAIE
                     AGADVIMLDNFSGNSLKSAAQSLKQKWDGKKQFMLECSGGLKLSNISEFLCHDIDIYS
                     TSSIHQGTGVIDFSLKINV"
     gene            <58467..>59195
                     /locus_tag="KLTH0G00836g"
                     /db_xref="GeneID:8293334"
     mRNA            <58467..>59195
                     /locus_tag="KLTH0G00836g"
                     /product="KLTH0G00836p"
                     /transcript_id="XM_002555030.1"
                     /db_xref="GeneID:8293334"
     CDS             58467..59195
                     /locus_tag="KLTH0G00836g"
                     /note="weakly similar to uniprot|P53068 Saccharomyces
                     cerevisiae YGL240W DOC1 Processivity factor required for
                     the ubiquitination activity of the anaphase promoting
                     complex (APC) mediates the activity of the APC by
                     contributing to substrate recognition involved in cyclin
                     proteolysis"
                     /codon_start=1
                     /product="KLTH0G00836p"
                     /protein_id="XP_002555076.1"
                     /db_xref="GeneID:8293334"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:C5DLH8"
                     /translation="MLDRWQGLVPDAEGRSFPVKPNQYLVLDDKQEDFDSNGVTYIGR
                     PSEEYDDEVATEAYLERYTQGLELMSSQGHIDITNLAYWKASSQKDGNPVSQALDDNP
                     TTFWQSDGLQPHKIEISFSKRVDIVQFALFLSLVVDESYTPQIIKIYAGHSASDATLY
                     KTLEVRNVNCWVALTFEDNRPEDNLLKCQYIRMIIPVNHENGKDTHLRGARIYALSLK
                     PPVDNSGVLDSFPMGTLLSGFSVR"
     gene            <59340..>62219
                     /locus_tag="KLTH0G00858g"
                     /db_xref="GeneID:8293335"
     mRNA            <59340..>62219
                     /locus_tag="KLTH0G00858g"
                     /product="KLTH0G00858p"
                     /transcript_id="XM_002555031.1"
                     /db_xref="GeneID:8293335"
     CDS             59340..62219
                     /locus_tag="KLTH0G00858g"
                     /note="similar to uniprot|P33307 Saccharomyces cerevisiae
                     YGL238W CSE1 Nuclear envelope protein that mediates the
                     nuclear export of importin alpha (Srp1p) homolog of
                     metazoan CAS protein required for accurate chromosome
                     segregation"
                     /codon_start=1
                     /product="KLTH0G00858p"
                     /protein_id="XP_002555077.1"
                     /db_xref="GeneID:8293335"
                     /db_xref="GOA:C5DLH9"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR005043"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DLH9"
                     /translation="MAELESIAQLLDQSLEASTAKSAEANLKAVENQPGFVLTLMHVV
                     ASRNLPAATRLAGSLFFKNFVKRKWIDENGAYLIPEDDVVAVKREIVPLMIALPGNLQ
                     VQIGEAISVIADSDFPHRWPDLLDELIARLSTDDFVTNRGVLTVAHSIFKRWRPLFRS
                     DDLFLEIKMVLDKFAAPFMSLLQNVDEHISNSDNDPAKLTLLFDVLLILVKLYYDLNC
                     QDIPEFFEDNVQIGMGIMHKYLAYQNLALEDADEEDQPSIVTRTKSCIQELVQLYTTR
                     YDDVFGPMVNEFIQTTWGLLTTVSLQPKNDVLISKSFNFMTAVTKIPKYFEVFNSEAA
                     LNNITVQIILPNITLRESDEELFEDDPIEYIRRDLEGSDSDTRRRGCTDFLKELKEKN
                     ESLVIPIVLAHIKAFFAEYAADPSANWKCKDLCIYLFSTLAIRGTIGNPGVSSTSNLL
                     DVVDFFTKEITPDLMGPAAHPILKVDAIKYIYTFRNQLNKSQLIEILPVLANLLQADE
                     FVVYTYAAITIERILSIRESNSSSDFIFKKADLAGSSHVLLQNLFNLIFKQGNSPEKL
                     AENEFLMKTVYRVLLTSEELTAPFAHEIAKQLLHIISIISKNPSNPRFSHYCFESLGV
                     VVKFNKQSMSEFMEMMMPQFLEILSEDVQEFTPYSIQIIAYCIEQLPAASSLPPSVSQ
                     LCQPILSPAVWELKGNIPALTRLLKDILRVDPTAYPDLVPVLGVFQRLIASKTYDENG
                     FELLEYIVTYLPLDSIVPYVKQIAVLLLQRLQNSRTEKYVKKFVVFLSIVAYKRGSDF
                     VVDFIDGVQVGLFRQIWSNFVINTLPTMGNLLDRKIAIIGILAVLTTGTKFSANYSDL
                     LAPSLEVLVETATSDSIVNLNSDYVDLENLEEITTFGSSFSRLTSISEKSFDPLPEVD
                     LTSGVRSYVREALAAFNDKTNNGLASLAPQLSESAKSALHNLGFN"
     gene            complement(<62327..>63253)
                     /locus_tag="KLTH0G00880g"
                     /db_xref="GeneID:8293336"
     mRNA            complement(<62327..>63253)
                     /locus_tag="KLTH0G00880g"
                     /product="KLTH0G00880p"
                     /transcript_id="XM_002555032.1"
                     /db_xref="GeneID:8293336"
     CDS             complement(62327..63253)
                     /locus_tag="KLTH0G00880g"
                     /note="some similarities with uniprot|P06774 Saccharomyces
                     cerevisiae YGL237C HAP2 Subunit of the heme- activated
                     glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex a
                     transcriptional activator and global regulator of
                     respiratory gene expression contains sequences sufficient
                     for both complex assembly and DNA binding"
                     /codon_start=1
                     /product="KLTH0G00880p"
                     /protein_id="XP_002555078.1"
                     /db_xref="GeneID:8293336"
                     /db_xref="GOA:C5DLI0"
                     /db_xref="InterPro:IPR001289"
                     /db_xref="InterPro:IPR018362"
                     /db_xref="UniProtKB/TrEMBL:C5DLI0"
                     /translation="MTMDNARGNHSAGEKCDTAAIKASVILDMDATKEFPPLESDAQP
                     CQRRDVNGKEELNPNIIGSSLGRQNVEVPYEDEQSPTNMYLYDQPQTNASRNESQTES
                     HVDPTALNEEDLSTSVDHHASLEVQFPETEVSGVSIKPVEQPKYPVDSKIGARDGSQQ
                     QGGDGSIVSQAESEIEQVAGSTIGSLSEPTEQPFYVNAKQYYRILKRRYARAKLEENL
                     KISRERKPYLHESRHKHAMRRPRGQGGRFLTAAEIAELKQHKELQLNLDIKQQDPADQ
                     SSKNVEEETTEEPKSQTAKRSSGKHMSEVVRQ"
     gene            <63474..>64391
                     /locus_tag="KLTH0G00902g"
                     /db_xref="GeneID:8293337"
     mRNA            <63474..>64391
                     /locus_tag="KLTH0G00902g"
                     /product="KLTH0G00902p"
                     /transcript_id="XM_002555033.1"
                     /db_xref="GeneID:8293337"
     CDS             63474..64391
                     /locus_tag="KLTH0G00902g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G00902p"
                     /protein_id="XP_002555079.1"
                     /db_xref="GeneID:8293337"
                     /db_xref="UniProtKB/TrEMBL:C5DLI1"
                     /translation="MSLGKSDALKQQLRELSFLLAKNRLQERQDTSSINSIKSFLSTE
                     VSSTESSRANDAVILSEGVDCGKRPLSQTLELSIDFQQRKHHKPSYRELELEIHDFPV
                     IETVAGDLYESEGQLHTQAVNSLSYLDSEVEWSENARPARSEGMETGQVLAENISEVV
                     DRQDNSYKNTSTSISNLEDSNITKSEQTVTKSNDTSSTLLQAKPLEIKTLKSIIKPLL
                     DKAEFEMSHDSWDSLRSFSGSLTDVVGKMFKDSSASKTKRLNRRFFISLFQECRVLSQ
                     GSDINDIFCVCSESLCAEELSELEIALFK"
     gene            complement(<64454..>66502)
                     /locus_tag="KLTH0G00924g"
                     /db_xref="GeneID:8293338"
     mRNA            complement(<64454..>66502)
                     /locus_tag="KLTH0G00924g"
                     /product="KLTH0G00924p"
                     /transcript_id="XM_002555034.1"
                     /db_xref="GeneID:8293338"
     CDS             complement(64454..66502)
                     /locus_tag="KLTH0G00924g"
                     /note="similar to uniprot|P53070 Saccharomyces cerevisiae
                     YGL236C MTO1 Mitochondrial protein required for
                     respiration in paromomycin-resistant 15S rRNA mutants
                     forms a heterodimer complex with Mss1p that plays a role
                     in optimizing mitochondrial protein synthesis"
                     /codon_start=1
                     /product="KLTH0G00924p"
                     /protein_id="XP_002555080.1"
                     /db_xref="GeneID:8293338"
                     /db_xref="GOA:C5DLI2"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR020595"
                     /db_xref="InterPro:IPR026904"
                     /db_xref="UniProtKB/TrEMBL:C5DLI2"
                     /translation="MLSASLNTNKRTLGSIFKLAQRSICLNIELRSALDKLPDSGVVV
                     VGGGHAGCEAAAGAARSGAPTVLVTPFLDKIGTCSCNPSMGGVGKGTLLREVDALDGV
                     APKVTDLAGIQFKMLNRSRGAAVWGPRAQIDREIYLREMQKVLKSYANLTLYQGKVQD
                     LVIDRQVAGEGKDSHQKHSTVVGVILEDGTLLKASKVVITTGTFLSAEIHIGAKSIPA
                     GRIGEGASYGLSKTLDEAGFKLGRLKTGTPARLDGRTINFESLEKQYGDTPPNPMSFM
                     NEDVAIKDQVLCYGTHTTPEVHEYLRSNLHQAPHIRETIKGPRYCPSIEAKIIRFADK
                     SSHRIWLEPEGLDSHVVYPNGISNSMPENVQLKFMRMIPGLEQVEILQPAYGVEYDYI
                     DPRSLAKSLEAKPVKGLYLAGQINGTTGYEEACAQGIFAGINAGLAHQGKPPLEILRS
                     DAYLGVLIDDLITKGVEEPYRMFTSRSEFRISVRADNADFRLTPLGHAAGVVSDNRYA
                     SYINQKALYSEIVTKLLNFELSAKRWNGSLGVPVADGAKNRSAWEMLRFNGIDLNTLG
                     DKFPELGIDPSQIPKHVLLKIDVEGKYAPFIKKQNQFIKAFQADEGMLLPPNFDYSIL
                     PSLSSECKTILNLVQPSTIGQARRIQGITPASLFELYKLVRFKQNDLSAETRMECQEP
                     "
     gene            <67557..>69944
                     /locus_tag="KLTH0G00946g"
                     /db_xref="GeneID:8293339"
     mRNA            <67557..>69944
                     /locus_tag="KLTH0G00946g"
                     /product="KLTH0G00946p"
                     /transcript_id="XM_002555035.1"
                     /db_xref="GeneID:8293339"
     CDS             67557..69944
                     /locus_tag="KLTH0G00946g"
                     /note="similar to uniprot|P07244 Saccharomyces cerevisiae
                     YGL234W ADE5 7 Bifunctional enzyme of the 'de novo' purine
                     nucleotide biosynthetic pathway contains aminoimidazole
                     ribotide synthetase and glycinamide ribotide synthetase
                     activities"
                     /codon_start=1
                     /product="KLTH0G00946p"
                     /protein_id="XP_002555081.1"
                     /db_xref="GeneID:8293339"
                     /db_xref="GOA:C5DLI3"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR004733"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR020559"
                     /db_xref="InterPro:IPR020560"
                     /db_xref="InterPro:IPR020561"
                     /db_xref="InterPro:IPR020562"
                     /db_xref="UniProtKB/TrEMBL:C5DLI3"
                     /translation="MSFNVLVLGNGGREHALAWKLAASNSVGTVYVAPGNGGTADLGG
                     KVVNVCDLSPSPAHFEALQKFAVENSIGLVVPGPEQPLVDGISDVFAKVGIPVFGPSA
                     KAAIFEGSKTFSKDFMAKHNIPTARYANFDNYEEAKAYLQKVDYQIVLKADGIAGGKG
                     VLIPTSQQEAQEALKALMVERQFGSAGDSIVIEEFLEGDEISILTISDGYSYFNLPPA
                     QDHKRIGENDTGLNTGGMGAYAPAPAATPQLMQRMDQEAIKPTIDGMRKDGLPFVGVL
                     FTGFILTADGPKVLEYNVRFGDPETQTVLPLLDDETDLAQVFLAAAEHRLDSVDIKLK
                     ENYFSTTVVLAAGGYPESYAKGDVITIDTEALPENAHIFHAGTVKKNGQILTAGGRVI
                     ASSAVASTLREAVDKAYQGVECIKFDNCYFRKDIAHRAFKAAEKSAANSKSITYAEAG
                     VSVDNGNLLVQKIKQKVKSTRRAGADSDIGGFGGLFDLKAAGYKTDETLLVAATDGVG
                     TKLMIAQETGIHDTVGIDLVAMNVNDLVVQGAEPLIFLDYFATGALDIKVATDFVSGV
                     ADGCIAAGCALVGGETSEMPGMYPAGHYDTNGTAVGAVGRNAILPKIERMSSGNVLLG
                     LASDGLHSNGFSLVRKIIETVDVQWSDKCPWDSSKTVGEATLVPTRIYVKQLLPSIRE
                     NLLLGLAHITGGGLVENIPRALPKNLQAKVDMNTWEVPEVFKWFGKAGNVPTEDILKT
                     FNMGIGMVLIVEKQNVARVKELLAEANETVYEIGVLCEKPDGAPGCVVENASNLY"
     gene            complement(<70012..>71049)
                     /locus_tag="KLTH0G00968g"
                     /db_xref="GeneID:8293340"
     mRNA            complement(<70012..>71049)
                     /locus_tag="KLTH0G00968g"
                     /product="KLTH0G00968p"
                     /transcript_id="XM_002555036.1"
                     /db_xref="GeneID:8293340"
     CDS             complement(70012..71049)
                     /locus_tag="KLTH0G00968g"
                     /note="similar to uniprot|P43617 Saccharomyces cerevisiae
                     YFR045W"
                     /codon_start=1
                     /product="KLTH0G00968p"
                     /protein_id="XP_002555082.1"
                     /db_xref="GeneID:8293340"
                     /db_xref="GOA:C5DLI4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DLI4"
                     /translation="MNSIVAGSAAAVFQTTVSYPFEFLKTGLQLHRALPNMAPFNMMH
                     QIKVYFAGCSALNAGTLLKTATRFTTFDRACQLLHDPELPQGAAISGPRLLAAGMITG
                     FMESLLIIPFENIKTTMIENALALSEKSRLELSRSEAKSSHNPQALKGSRTVPYAHTS
                     MTGQSRPTFHARKEQALHPRQKWAIYYDEHPSRQLFTTIQEMFRTRGLRGFVQGTAPT
                     IIRQTANSAVRFTSYTSLKQVFSPDGPINEYYAFALGFVSSCAVVAVTQPIDVVKTRM
                     QSKYTWVNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMK
                     AYAGPQEMGHD"
     gene            <71533..>73131
                     /locus_tag="KLTH0G00990g"
                     /db_xref="GeneID:8293341"
     mRNA            <71533..>73131
                     /locus_tag="KLTH0G00990g"
                     /product="KLTH0G00990p"
                     /transcript_id="XM_002555037.1"
                     /db_xref="GeneID:8293341"
     CDS             71533..73131
                     /locus_tag="KLTH0G00990g"
                     /note="highly similar to uniprot|P43616 Saccharomyces
                     cerevisiae YFR044C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G00990p"
                     /protein_id="XP_002555083.1"
                     /db_xref="GeneID:8293341"
                     /db_xref="GOA:C5DLI5"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017153"
                     /db_xref="UniProtKB/TrEMBL:C5DLI5"
                     /translation="MLPGLSSKKSSGCRLLSIAKRLNITHFSSGISHRLPQAYYLRRF
                     HIYRKMSTEANFQQLFNKIDELKPRFIERLAKAIEIPAVSSDESLRPQVIKKAQFIAG
                     ELQKLGFSDIQMKELGAQPPPVADPNLPLPPVVLARYGSDPAKKTVLVYGHYDVQPAA
                     LEDGWATEPFKLIIDEEKQLMRARGASDDTGPLKGWLNVVEAHRELGLDLPVNLVTCF
                     EGMEESGSIGLDGLIAEEAGKYFKEVDAVCISDNYWLGTKKPVLTYGLRGCNYFQITI
                     EGPAADLHSGIFGGVISEPMIDLTKVFSSLVDSRGRILIDGVNEMVAPVTEKEKELYE
                     KIDFTLDEMNAASGSQTCLYESKADILMHRWRYPSLSIHGLEGAFSAQGAKTVIPSKV
                     VGKFSIRTVPDMDSAKLDKFVIDHCDKVFASLNSPNRCKTELIHDGNYWISDPFNASF
                     TAAAKATKAVYGVEPDFTREGGSIPITLTFEKELKTSVMLLPMGRGDDGAHSINEKLD
                     ISNYMQGMKTMAAYLHYYAASKEK"
     gene            <73388..>76018
                     /locus_tag="KLTH0G01012g"
                     /db_xref="GeneID:8293342"
     mRNA            <73388..>76018
                     /locus_tag="KLTH0G01012g"
                     /product="KLTH0G01012p"
                     /transcript_id="XM_002555038.1"
                     /db_xref="GeneID:8293342"
     CDS             73388..76018
                     /locus_tag="KLTH0G01012g"
                     /note="similar to uniprot|P22224 Saccharomyces cerevisiae
                     YGL233W SEC15 Essential 113kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which mediates polarized targeting of vesicles to
                     active sites of exocytosis Sec15p associates with Sec4p
                     and vesicles"
                     /codon_start=1
                     /product="KLTH0G01012p"
                     /protein_id="XP_002555084.1"
                     /db_xref="GeneID:8293342"
                     /db_xref="GOA:C5DLI6"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:C5DLI6"
                     /translation="METDAQNVVSGELQQVLLSTDLSFLKSVHMDEGQGASFSGEHEE
                     ELDLDEHTFNRWTPLLRTAIETDSLPLVVDDLFSSVEENFENLEAQILQDSQLSDNLA
                     ASVSQIASIKDIIEGSLLHETEDLQVQLAHATNDVISRKQNYLSNKKTSTKISESIIL
                     ITKVLQILELSNKCQDLIKDSNFYKALQSLGALEKIYVQDFKNYNFEFLKKIYASIPI
                     LKSKIKDESINLVKSSFNSNLEKKLLTVGKTFFEFYNNLLLPDWLESKNELKLSSFKF
                     NSPVEISLRDSEKLESLNVEKLYPLNEFYDSILIFQNLKETDYLRKEFKKEYDFRISK
                     VVYPLEIKISGSASLSDLKKKTTTLFGDDFSLEELKEYMLRILGFVIYDRHLNRSTEY
                     VLSQNDLSANEDFWEVFIGRFSPFLEHFVSKICTSEEMLTELKDFLGIYISILENVGA
                     NIERIYEINVLVFKKYAALLVELFNKEFSTLLDDDDFMPLTINDESLYEKVLKICWLR
                     TDELEALHSREKTPDESFFATLPFSPLYPMTCTLVKKTYNKVVACLSEFYQYDLGELN
                     NIIVKTVDDIFGKIVDAKIASKLDTTSREEIAQILINLDYFIVAVGEFSKILARENIT
                     HSTDVELGLQSAKLLSKTRGLTETKLIELIDSKVSDLMEFVEFEWSSTEVLKEPDYSI
                     KDISQFLEMMFTSTLVNLPDSVKTLLIFREFDALTRRFLDVLLNSSPPSISPQSVLNF
                     ELNMNFLESIISKLFPNDESIPSTPTSPDTASIQPLDNTRSSNLIDNTIRSLHSTFSD
                     LKQHIQFLKCPDMEEYKDSGIRMRKYPRIKPEVAQMLHNKMVPPSSAGTDSDNSASID
                     QSFADSITSHRRIAKFFNRA"
     gene            <76546..>77376
                     /locus_tag="KLTH0G01034g"
                     /db_xref="GeneID:8293343"
     mRNA            <76546..>77376
                     /locus_tag="KLTH0G01034g"
                     /product="KLTH0G01034p"
                     /transcript_id="XM_002555039.1"
                     /db_xref="GeneID:8293343"
     CDS             76546..77376
                     /locus_tag="KLTH0G01034g"
                     /note="similar to uniprot|P53072 Saccharomyces cerevisiae
                     YGL232W TAN1 Putative tRNA acetyltransferase RNA-binding
                     protein required for the formation of the modified
                     nucleoside N(4)-acetylcytidine in serine and leucine tRNAs
                     but not required for the same modification in 18S rRNA"
                     /codon_start=1
                     /product="KLTH0G01034p"
                     /protein_id="XP_002555085.1"
                     /db_xref="GeneID:8293343"
                     /db_xref="GOA:C5DLI7"
                     /db_xref="InterPro:IPR004114"
                     /db_xref="UniProtKB/TrEMBL:C5DLI7"
                     /translation="MLLTSAQKYKFSTGIIEPCVSGIYATCARKHEKQAAQELTQLFQ
                     EKLEEWYGDELRELGHGESDDESDNDASVEDKIKKELEALHAKNNGPKSKEILRFVDL
                     NCECVVFCKTRKPIDPEKFVHQLMQEFANPKESQKRTRYVQKLTPVTFSCNASLPELT
                     KLSQRVLKPHFHEEGTKPLKFAIEVTRRNFNTLDKMDIIKEVARVAGNGGQLPHKVDL
                     KNYDKLILVECFKNNIGMSVVNSEYRDDFKKYNIQQIFESKIKAQAANATQDVKLEPK
                     "
     gene            complement(<77388..>77933)
                     /locus_tag="KLTH0G01056g"
                     /db_xref="GeneID:8293344"
     mRNA            complement(<77388..>77933)
                     /locus_tag="KLTH0G01056g"
                     /product="KLTH0G01056p"
                     /transcript_id="XM_002555040.1"
                     /db_xref="GeneID:8293344"
     CDS             complement(77388..77933)
                     /locus_tag="KLTH0G01056g"
                     /note="similar to uniprot|P53073 Saccharomyces cerevisiae
                     YGL231C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G01056p"
                     /protein_id="XP_002555086.1"
                     /db_xref="GeneID:8293344"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:C5DLI8"
                     /translation="MSDIIPEWAHTLCDPNHPKKAPAVNSKSLPSPPGFKSLSGSSSK
                     DTKASLASGQRQDVAALIVQKAWQIAFQPAKSIPMNMIMSYMSGTSLQIISIMTALMF
                     VSNPVKSIANMRQTFKPVMGNAEAQPQVVVAMVMFVFFQIILMGIGIHKLNSMGLIPN
                     TRSDWLLLEQPAVYKGKSYAF"
     gene            complement(<78199..>78660)
                     /locus_tag="KLTH0G01078g"
                     /db_xref="GeneID:8293345"
     mRNA            complement(<78199..>78660)
                     /locus_tag="KLTH0G01078g"
                     /product="KLTH0G01078p"
                     /transcript_id="XM_002555041.1"
                     /db_xref="GeneID:8293345"
     CDS             complement(78199..78660)
                     /locus_tag="KLTH0G01078g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G01078p"
                     /protein_id="XP_002555087.1"
                     /db_xref="GeneID:8293345"
                     /db_xref="UniProtKB/TrEMBL:C5DLI9"
                     /translation="MSKFDNNCRTPRTMNNSSKFHETESFEGAEKKLSCMPISTVADS
                     EVGQEYCSARDKIGTKGVATAVKHPRYDFCKKKVRHSLHIFARLDLAVYEYSFIILFL
                     IQLLLIVFSIKCIYPVIIKREMVGKGILYSSSVIPDECVDYSFFAQCIPQV"
     gene            <78894..>79649
                     /locus_tag="KLTH0G01100g"
                     /db_xref="GeneID:8293346"
     mRNA            <78894..>79649
                     /locus_tag="KLTH0G01100g"
                     /product="KLTH0G01100p"
                     /transcript_id="XM_002555042.1"
                     /db_xref="GeneID:8293346"
     CDS             78894..79649
                     /locus_tag="KLTH0G01100g"
                     /note="weakly similar to uniprot|P43615 Saccharomyces
                     cerevisiae YFR043C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G01100p"
                     /protein_id="XP_002555088.1"
                     /db_xref="GeneID:8293346"
                     /translation="MTTGLSLDEGKVIEGRPKALRDKVLIVFSNKVFNREEILFEVFG
                     VEDNAGKQVHRGVDWTTKYYTVTIDVYVDSFSNLEDWTNEFCDPDFDELRDVIAGWII
                     VLPFSGNIEEETKALSRLVNNATSEDFFTAILATELNVGKNERAFLEYNVLAGAVELV
                     HNELDSDGELKEVNGVDRVKEIIDTCDWHPRLLRTAHLESETGMESACTGISLAQIMG
                     SLREARTKYMAMDPGLDREEFANEMANELSKLL"
     gene            <80433..>81317
                     /locus_tag="KLTH0G01122g"
                     /db_xref="GeneID:8293347"
     mRNA            <80433..>81317
                     /locus_tag="KLTH0G01122g"
                     /product="KLTH0G01122p"
                     /transcript_id="XM_002555043.1"
                     /db_xref="GeneID:8293347"
     CDS             80433..81317
                     /locus_tag="KLTH0G01122g"
                     /note="similar to uniprot|P43613 Saccharomyces cerevisiae
                     YFR041C ERJ5 Endoplasmic reticulum protein that may
                     function as a cochaperone as suggested by the presence of
                     a DnaJ-like domain"
                     /codon_start=1
                     /product="KLTH0G01122p"
                     /protein_id="XP_002555089.1"
                     /db_xref="GeneID:8293347"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ1"
                     /translation="MLHLQWKALVLILVSLVSLSIAFTPEEVQIFQLHQEIQKYGKNV
                     DFYKLLKLPKLKESTSQEIRKNFRQLSKKYHPDKNQKYRKLYERLNLATKILSNDSQR
                     KTYDYYLKNGFPKYDFNKGGFFFSRVRPSTWFTLAFIYIACGLIHYVLLRLQNDGNKA
                     RIERFLREVKAQDDTNGLGEKQLLLRQSENDEGKKIIVRLGDVFVLQPDGTEALVSTK
                     EIKNPGISESILVSLPFWLWSKSVGKLTGGFTGPKDSSNPSTSRAFSNKRATRNKGPG
                     ATMDLPNGKVLHSRKKAQ"
     gene            complement(<81486..>83888)
                     /locus_tag="KLTH0G01144g"
                     /db_xref="GeneID:8293348"
     mRNA            complement(<81486..>83888)
                     /locus_tag="KLTH0G01144g"
                     /product="KLTH0G01144p"
                     /transcript_id="XM_002555044.1"
                     /db_xref="GeneID:8293348"
     CDS             complement(81486..83888)
                     /locus_tag="KLTH0G01144g"
                     /note="similar to uniprot|P43612 Saccharomyces cerevisiae
                     YFR040W"
                     /codon_start=1
                     /product="KLTH0G01144p"
                     /protein_id="XP_002555090.1"
                     /db_xref="GeneID:8293348"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ2"
                     /translation="MSFWPFGQSEHSNINRLLEEYFQVLHSVEKHNENGAETQATREE
                     EGGTPHDPGPAQEALEKCLDGIPSIQMLNNSFIDGILEESELLNELTRQNNTLLDFIC
                     FGYFYTADGVKVQNIEYLIDQLIECVGHIDANEFDAATSGSGRSSRGSLHEFDDDDCI
                     SGSASPDNSPRPQQTYLNKATIISEIFALDIWLISESLVKNSSYLNKIWSIIYHPNFP
                     SEKSPLIPIFLKINQNLLSTRQDQYLNFIRSKPTLVDDLLKHIQISVLMDLLLKIIST
                     DKQESPTGIIELVHEQRLTRKLLCYLDNDKHEPDIQACAADVLKAIIAISANAPLDDM
                     SIGPNSLTRDLASEECIDHLLDAIINKRSNALINAVSIVIELIRKNNSDYDQVNLLST
                     TLSSHPPSMRDPIYLGVMLRKFTEKLTYVFQILVDIERNNSAKVLENQLGEKYKPLGF
                     ERFKVVELIAELLHCSNMGLLNSKKAERIVSERNKAREMVAKSLQDALADLDVQDNDN
                     THSAESRSDAYDEDVDESFEIPYVNPKQNSKLRENPTIGDRFKISLYDNQILPRIIYL
                     FLKYPWNNFWHNVVFDIIQQLFNGRMDFSYNSFLVYSLFNNGSASEFMPRDSRVDICD
                     FQITRDLILKGYKDSYAFYEKHNTALGFMGHLVLIAEEIVKFSKVYKVELISPKIQAA
                     FQDEEWIFYSEDVLNDTRIMYSKILGGNDYLEEENGYEANGDNFNNDSNRNENPELGG
                     SLINVGNLDQDQSANPSNFPTTSDLHNKLRKKLIDRSREDVDRRNEENGVIILGMAPE
                     DN"
     gene            <84229..>86250
                     /locus_tag="KLTH0G01166g"
                     /db_xref="GeneID:8293349"
     mRNA            <84229..>86250
                     /locus_tag="KLTH0G01166g"
                     /product="KLTH0G01166p"
                     /transcript_id="XM_002555045.1"
                     /db_xref="GeneID:8293349"
     CDS             84229..86250
                     /locus_tag="KLTH0G01166g"
                     /note="weakly similar to uniprot|P53075 Saccharomyces
                     cerevisiae YGL228W SHE10 Putative
                     glycosylphosphatidylinositol (GPI)-anchored protein of
                     unknown function overexpression causes growth arrest"
                     /codon_start=1
                     /product="KLTH0G01166p"
                     /protein_id="XP_002555091.1"
                     /db_xref="GeneID:8293349"
                     /db_xref="GOA:C5DLJ3"
                     /translation="MRRVRGVGNLLVTILVVLIGFKQARKYCESNEAEFCRLTSLSRA
                     SPWWNEHIDPYWDSYVSPCVTKIHDYEHKLDEWAAPRIDRAYYQVQDIVETKVVPVTY
                     KWYKTVQFKTQVYYNGHFVPFLGHARILAKQWLASEGFFQRLYLHVQQGLFCLRNWSL
                     WVWNGSLEAFNEIHSWSGHALQEISNKFSVTENQSGEPVTDEDPSDTDESKYYDAEYF
                     EGEQGDYNEDDETVYLTSTIIETVTLSDEKQLDKSTSAANGDDGSSLDVPLRDLVQDE
                     FQAWSNTVEQKASNTLTQFDSEVEELVEAKLSKAQPNITGLLQGISESFQSHYRIINR
                     AILDVDCTMELDPETGEQLYFNKDGTQLRKYVTRPLMREFFSSAHAHVDERLEMVRAR
                     LEKFVAAVNKEVEQVRQEHLEVYEEWGDVMVSEWSKRMAYVDVVAAMGAEDMNQQQHD
                     NWKRFLKLKKQVVNTRDLLMQHPAKLERLQKFLNDIQFTLMALQRDAGEYLFILRSQA
                     NIAFQTREKLEREREEEERRKLEQERQIQEQKEREQQELAENEARAARERLALEQGQG
                     QEQLEQNSDEAFFSMEDITATPLGADDNTDYENALDDADSQLSESGDSEDNFYDSYEG
                     DEEDASRELERLERESAERETLDRLELGQRQKLQEEQHRDELHHSSQAN"
     gene            <86471..>87820
                     /locus_tag="KLTH0G01188g"
                     /db_xref="GeneID:8293350"
     mRNA            <86471..>87820
                     /locus_tag="KLTH0G01188g"
                     /product="KLTH0G01188p"
                     /transcript_id="XM_002555046.1"
                     /db_xref="GeneID:8293350"
     CDS             86471..87820
                     /locus_tag="KLTH0G01188g"
                     /note="highly similar to uniprot|P39954 Saccharomyces
                     cerevisiae YER043C SAH1 S-adenosyl-L-homocysteine
                     hydrolase catabolizes S-adenosyl-L-homocysteine which is
                     formed after donation of the activated methyl group of
                     S-adenosyl-L-methionine (AdoMet) to an acceptor"
                     /codon_start=1
                     /product="KLTH0G01188p"
                     /protein_id="XP_002555092.1"
                     /db_xref="GeneID:8293350"
                     /db_xref="GOA:C5DLJ4"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ4"
                     /translation="MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIRAAYADAQ
                     PLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAAAGVPVFA
                     WKGETEEEYLWCIEQQLFAFKDNKKLNLILDDGGDLTTLVHEKHPEMLKDCFGLSEET
                     TTGVHHLYRMVKDAKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKV
                     SVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVCPMEEAASIGQVFV
                     TTTGCRDIITSEHFLAMPEDAIVCNIGHFDIEIDVAWLKANAKECVNIKPQVDRYLLS
                     SGKHIILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAHDNEFRQKYIEFQK
                     TGPFEIGVHVLPKILDEAVAKFHLDKLGVRLTQLSNVQSEYLGIPSEGPYKADHYRY"
     gene            <88489..>90960
                     /locus_tag="KLTH0G01210g"
                     /db_xref="GeneID:8293351"
     mRNA            <88489..>90960
                     /locus_tag="KLTH0G01210g"
                     /product="KLTH0G01210p"
                     /transcript_id="XM_002555047.1"
                     /db_xref="GeneID:8293351"
     CDS             88489..90960
                     /locus_tag="KLTH0G01210g"
                     /note="weakly similar to uniprot|P53076 Saccharomyces
                     cerevisiae YGL227W"
                     /codon_start=1
                     /product="KLTH0G01210p"
                     /protein_id="XP_002555093.1"
                     /db_xref="GeneID:8293351"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ5"
                     /translation="MSFCMDQVDCAYVRALFPAYLLEQPIGHELWKIYLRNRKLFHKL
                     KNKGQSVPVLKEARLHKLKPNVSHATRKEIWEKLMNLGVLGTVPYNSVGDEYLMQVYQ
                     YFYPDIDQDSFGDSRRNEAADEMQIDSDSADLTKPVDPIAHLVRRLGEDDDGEDDDED
                     LDDDDDDDDDDEDVTQAAERDDQVGDDEDEEDDDDNIEDIHQTEEHRGASDQKLQDSE
                     KDQYFSPLTESSHQNRPKKNYVSMDIYKLLGYPLPHAWDAQSSNSMMVSSDGSNQLKP
                     NPSLEGFPRRSDSIVGSGFSVSYSSYSAKFEYVSARANNSILSKKMAIFYYEIRVLSV
                     TSSQSGQNCNIKVGFKDLSKFQAGSASPSRTDLHAGDPVSINRQSASIMRSTVESSST
                     TSTKSRGDGFDKGSFGYCGQDGYITDGTQYKIYGKQYGRGDVIGCGVNFVDGTIFFTK
                     NGINLGTAFTDVHDLDLVPFIALKPGNMVRTNFGLHEEFVFDILNYQRMLKSKAYHHI
                     YKSIDGHDGRNDFESSIHSDQDDFDDDPPLSGDNRGGFLLQNDERFSGDKLYRPEVEK
                     LNNLSTDDDSIPCAMHAMINDHLIHEGLIDVAKGFLKDLQKDCIPNSDEERARLVIRH
                     NERQIIKEENNLKLRQSIRRFINEGDIAQCLVFINSQYPGLIEKNVDLLFELKVAEYL
                     LMFVQFKSHSIDEILRKGQELTSEFVYSQQVPADYKDGFRNHLNDISSLLAYDNPLRE
                     CNEDLAIYLTPAYLQDRLFQLVNSRVLAFLEKKSESSLESMVSYTRAMIDTLMEYGEG
                     SSLVHNDSELRFHKLVNIDEDLLNM"
     gene            complement(<91023..>91350)
                     /locus_tag="KLTH0G01232g"
                     /db_xref="GeneID:8293352"
     mRNA            complement(join(<91023..91268,91327..>91350))
                     /locus_tag="KLTH0G01232g"
                     /product="KLTH0G01232p"
                     /transcript_id="XM_002555048.1"
                     /db_xref="GeneID:8293352"
     CDS             complement(join(91023..91268,91327..91350))
                     /locus_tag="KLTH0G01232g"
                     /note="similar to uniprot|Q92316 Saccharomyces cerevisiae
                     YGL226C-A OST5 Zeta subunit of the
                     oligosaccharyltransferase complex of the ER lumen, which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="KLTH0G01232p"
                     /protein_id="XP_002555094.1"
                     /db_xref="GeneID:8293352"
                     /db_xref="InterPro:IPR020294"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ6"
                     /translation="MSSYQEVYKLYHQASEFEGVVALESQPMYGTITAVLALVFIALA
                     LSSISKAAGLPLGLQFVQYSFLSLAGSAFFGLATIFLTNSFGVYA"
     gene            <91489..>91938
                     /locus_tag="KLTH0G01254g"
                     /db_xref="GeneID:8293353"
     mRNA            <91489..>91938
                     /locus_tag="KLTH0G01254g"
                     /product="KLTH0G01254p"
                     /transcript_id="XM_002555049.1"
                     /db_xref="GeneID:8293353"
     CDS             91489..91938
                     /locus_tag="KLTH0G01254g"
                     /note="similar to uniprot|P53077 Saccharomyces cerevisiae
                     YGL226W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G01254p"
                     /protein_id="XP_002555095.1"
                     /db_xref="GeneID:8293353"
                     /db_xref="GOA:C5DLJ7"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ7"
                     /translation="MSTSLRSLRRNLGCLRRGTSHVPACLRSLSHTSYEPPRIDDLTG
                     EKWIKLEKDVKEEIMEYLDWKMEGDWREMPANEKRASYFVSFGQWGPRAKPGSKEAQL
                     QMTGAEIILRGVFSGVLFMAVAVSFMNYQNDKRVQKNLKKLEDSAER"
     gene            complement(<91956..>92510)
                     /locus_tag="KLTH0G01276g"
                     /db_xref="GeneID:8293354"
     mRNA            complement(<91956..>92510)
                     /locus_tag="KLTH0G01276g"
                     /product="KLTH0G01276p"
                     /transcript_id="XM_002555050.1"
                     /db_xref="GeneID:8293354"
     CDS             complement(91956..92510)
                     /locus_tag="KLTH0G01276g"
                     /note="highly similar to uniprot|P40029 Saccharomyces
                     cerevisiae YER042W MXR1 Peptide methionine sulfoxide
                     reductase reverses the oxidation of methionine residues
                     involved in oxidative damage repair providing resistance
                     to oxidative stress and regulation of lifespan"
                     /codon_start=1
                     /product="KLTH0G01276p"
                     /protein_id="XP_002555096.1"
                     /db_xref="GeneID:8293354"
                     /db_xref="GOA:C5DLJ8"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ8"
                     /translation="MVSAVSKSIKFSPQSEKLLTVAAGCFWGTEHIYRKYFGNRIKDY
                     KVGYANGDETKKDSSDSVSYKRVCSGETQFAEVLQISFDPKTVSLKELVDFFFRIHDP
                     TTVNSQGPDVGTQYRSAILTHTQEDLEECRRLKEQWQPKWGNKIVTEVTMCTNFYDAE
                     EYHQLYLDNNPQGYACPTHYVRDL"
     gene            complement(<92808..>94835)
                     /locus_tag="KLTH0G01298g"
                     /db_xref="GeneID:8293355"
     mRNA            complement(<92808..>94835)
                     /locus_tag="KLTH0G01298g"
                     /product="KLTH0G01298p"
                     /transcript_id="XM_002555051.1"
                     /db_xref="GeneID:8293355"
     CDS             complement(92808..94835)
                     /locus_tag="KLTH0G01298g"
                     /note="similar to uniprot|P40028 Saccharomyces cerevisiae
                     YER041W"
                     /codon_start=1
                     /product="KLTH0G01298p"
                     /protein_id="XP_002555097.1"
                     /db_xref="GeneID:8293355"
                     /db_xref="GOA:C5DLJ9"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DLJ9"
                     /translation="MGVPAFWDLIKSDESLRRLPLKQFVVEFRNNFNRPLRLAIDAFT
                     WLFESGFISNDCERLSEKGYRTDAQSTLILLNRLKCLLSLDVTFVLVFDGPMKPSFKN
                     KFSSKTLSNDHCELASDDEEYVSIYNEHRKQHEIHGTCTTTLVSEELGGLSFVKRLLK
                     TMNISFIETCGEGEAECARLQREGLVDYVLSNDSDTLVFGATRVLRNFSRFWEDVPAT
                     YTGPLKKKDHKEMFITVVDMQQIRNWNRSSLVLYCTLLGADYNQGIRGLGSKKAAKLA
                     QLTTPNFAETFKDIFEDHSQPSELRRKRYLEFQKALFEHCFIHSKELFGRNYFSSNSA
                     GFQGWPSDVAIMHYFHPILSPRVNRESLGVHYINVSGNSNFMKGDVADLMNLLEELEF
                     KGITDFGRWFHEMVHSTFLLKEILYGNRTREELTRLVKITEEWCAGICQNKFRVPCWR
                     IRYNSFLTTGNEASPQDTEDSIVAHSSPNKRSGSPSKKQSEKASHKFMTSIPKGLIPE
                     NNSLVKNYHLEKRTASEGDKRPRRGSPRKVANQKSNLDGFLKKYGTPRKHDSPKALHE
                     KLEPETEPMNTKRKLFVEEDLDNPEPGNSSSLILVSERECNHDILHTSPKRALDLFIA
                     TSEEEDLEASAGSEESPLKKLKKNAATAESQLPTPRKLLPDNFVDLTIESG"
     gene            complement(<95197..>97431)
                     /locus_tag="KLTH0G01320g"
                     /db_xref="GeneID:8293356"
     mRNA            complement(<95197..>97431)
                     /locus_tag="KLTH0G01320g"
                     /product="KLTH0G01320p"
                     /transcript_id="XM_002555052.1"
                     /db_xref="GeneID:8293356"
     CDS             complement(95197..97431)
                     /locus_tag="KLTH0G01320g"
                     /note="weakly similar to uniprot|P18494 Saccharomyces
                     cerevisiae YER040W GLN3 Transcriptional activator of genes
                     regulated by nitrogen catabolite repression (NCR)
                     localization and activity regulated by quality of nitrogen
                     source"
                     /codon_start=1
                     /product="KLTH0G01320p"
                     /protein_id="XP_002555098.1"
                     /db_xref="GeneID:8293356"
                     /db_xref="GOA:C5DLK0"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C5DLK0"
                     /translation="MTEGGANIFDMLAEGGGSTGSGVGGGFDAMLEILPEEIDVSFVE
                     GFSSEAREASAGPVRAASGGAAHVETLFEATPPIDVVDQQNGEIAQLWDFNVDEFMMT
                     PSGSSDSATISAPNSFNSEHPGQLGGYGGGGAFAGTFGAGTPAASHNWGHLLGAPFHS
                     EPGSQQPLFASPSALLADDAPGSVSAAAFRPTLPTRRSSSQLSKAAMADDGGLPLAHS
                     TTANSVRKNSMTRPLSSSSLSSYRQNSVPELPKKPQVQCFNCKTFKTPLWRRDAQGNT
                     MCNACGLFQKLHGTMRPLSLKSDVIRKRNTKKRGKKADAAKDKDKDSSATGAAATATT
                     RPVRGKQDSGSSIPQTRLPSTPVAGGQSHTNGSATTFPSTLSKSRTNSSTNLSVNGTF
                     TSSSSSSTTTQLSSNVLMNHNHRMLPTSGLGVSKKSRRSSSSSSASNSSNRSSSSRSM
                     VPILPKPSPGGTSSARNQFQLAGFPGSAGNSAASSPRFSNSPRPASATSPLPTSAGQT
                     LSSSAGRPGMTITRRKSSRQAHTSSSSSFMAASLQQHQHHQQQQPQPQPQSQHSQQGG
                     FQSNTAGSSSSTISAHSNSWNSNTIAAPSPKSGRSPRSPFDLFSSSSSSQEPQSRPAS
                     RKTHTSLLSQQLQQATASPQNPQSPSQFQTPATFQSSSLSSSVTPQPASLKRSPMTAS
                     PRNSYMDSIQQQRGLHSDTGVRRTTSLRAEANNATGIAANAPSSQRQKDAFMDDLEWL
                     KFGL"
     gene            <98101..>99108
                     /locus_tag="KLTH0G01342g"
                     /db_xref="GeneID:8293357"
     mRNA            <98101..>99108
                     /locus_tag="KLTH0G01342g"
                     /product="KLTH0G01342p"
                     /transcript_id="XM_002555053.1"
                     /db_xref="GeneID:8293357"
     CDS             98101..99108
                     /locus_tag="KLTH0G01342g"
                     /note="similar to uniprot|P40107 Saccharomyces cerevisiae
                     YGL225W VRG4 May regulate Golgi function and glycosylation
                     in Golgi Golgi GDP-mannose transporter"
                     /codon_start=1
                     /product="KLTH0G01342p"
                     /protein_id="XP_002555099.1"
                     /db_xref="GeneID:8293357"
                     /db_xref="GOA:C5DLK1"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:C5DLK1"
                     /translation="MSELKVDNGGMSQMANSGPLSILAYCGSSILMTVTNKFVVNVEN
                     FNMNFVMLFVQSFVCSLALVVLRALGYAKFRPLNKTDVKNWFPISVLLVAMIYTSSKA
                     LQFLAVPIYTIFKNLTIILIAYGEVLFFGGRVTAMELSAFLLMVLSSVVATMGDRQAL
                     AKKASELAAAATSEEAMDPTAGYIWMFANCISSALFVLIMRKRIKLTNFKDYDTMFYN
                     NALAMPILLISSFVLEDWSPENLTTNFTRNTFTALIISGLASVGISYCSGWCVRVTSS
                     TTYSMVGALNKLPIALSGLVFFDAPKNFLSIFSIFLGFLAGLVYVVAKQKKQQQPAAK
                     A"
     gene            <99120..>100518
                     /locus_tag="KLTH0G01364g"
                     /db_xref="GeneID:8293358"
     mRNA            join(<99120..99191,99325..>100518)
                     /locus_tag="KLTH0G01364g"
                     /product="KLTH0G01364p"
                     /transcript_id="XM_002555054.1"
                     /db_xref="GeneID:8293358"
     CDS             join(99120..99191,99325..100518)
                     /locus_tag="KLTH0G01364g"
                     /note="weakly similar to uniprot|P40026 Saccharomyces
                     cerevisiae YER038C KRE29 Essential protein of unknown
                     function heterozygous mutant shows haploinsufficiency in
                     K1 killer toxin resistance"
                     /codon_start=1
                     /product="KLTH0G01364p"
                     /protein_id="XP_002555100.1"
                     /db_xref="GeneID:8293358"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:C5DLK2"
                     /translation="MRLHSYRPSYARVGTACIHRCSQGAYASASISDEHSQAEPRAAD
                     ADVVYDSQDSGGGSPIVKNQFHYDADDLSDSELSSEPSDDDEAGISALIHLEAPEQAP
                     APPPSGFEAPQFREFDVHCNGFDEQLLSRTAKLRELSRELEPEPAVSAASASDKKPPL
                     RKQVASSFKQKVPRAYLDMILAENSSRKFQDWYFMTENAQPAEIDPWATFLGAKKPKK
                     QSLKELLKSLGVPSQHLSPQLQHITVDMYDTVNLLQPVHVMCKQLQRYYKCRGFAQSF
                     ICFILDRNVFNSPECTSAWCEDVYSRLDANHFTDTYLQLVAGDSYLLHLRVSRQIPEF
                     HELLLEKLFPQHTYETLLGEFDRLLKAKEHQKLLYFTLFIYGTATMPFGDTAASQRLR
                     DSVYGAGNDGNHVELVIIRSYINFFIKIV"
     gene            complement(<100515..>101414)
                     /locus_tag="KLTH0G01386g"
                     /db_xref="GeneID:8293359"
     mRNA            complement(<100515..>101414)
                     /locus_tag="KLTH0G01386g"
                     /product="KLTH0G01386p"
                     /transcript_id="XM_002555055.1"
                     /db_xref="GeneID:8293359"
     CDS             complement(100515..101414)
                     /locus_tag="KLTH0G01386g"
                     /note="similar to uniprot|P53078 Saccharomyces cerevisiae
                     YGL224C SDT1 Pyrimidine nucleotidase overexpression
                     suppresses the 6-AU sensitivity of transcription
                     elongation factor S-II as well as resistance to other
                     pyrimidine derivatives or to YER037W uniprot|P40025
                     Saccharomyces cerevisiae YER037W PHM8"
                     /codon_start=1
                     /product="KLTH0G01386p"
                     /protein_id="XP_002555101.1"
                     /db_xref="GeneID:8293359"
                     /db_xref="GOA:C5DLK3"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DLK3"
                     /translation="MQSHFSRVGSTIGSKIGKMTISTTASARAHYRDQVEAQLKANQE
                     SLDNLTHTGSQVTFEIDPPETPKPNPDLKVFFFDIDNCLYKRSTRIHDLMQVSIHEYF
                     KNELNIDDDEAWKLHHTYYREYGLAIRGLVMHHDIDALEYNRMVDDALPLQRILKPDA
                     GLRSMLSRLKESGAVDKLWLFTNAYKTHGIRCVRLLGIADMFDGITYCDYSQKDNLVC
                     KPDPAAFQRAKAQSGLGDYKNAYFVDDSGSNVKTGISLGIKKCVHLIEDEVDPNLGQT
                     PAGSIVIRNIEDLPKAIPELFQR"
     gene            complement(<101521..>103356)
                     /locus_tag="KLTH0G01408g"
                     /db_xref="GeneID:8293360"
     mRNA            complement(<101521..>103356)
                     /locus_tag="KLTH0G01408g"
                     /product="KLTH0G01408p"
                     /transcript_id="XM_002555056.1"
                     /db_xref="GeneID:8293360"
     CDS             complement(101521..103356)
                     /locus_tag="KLTH0G01408g"
                     /note="weakly similar to uniprot|P53079 Saccharomyces
                     cerevisiae YGL223C COG1 Essential component of the
                     conserved oligomeric Golgi complex (Cog1p through Cog8p) a
                     cytosolic tethering complex that functions in protein
                     trafficking to mediate fusion of transport vesicles to
                     Golgi compartments"
                     /codon_start=1
                     /product="KLTH0G01408p"
                     /protein_id="XP_002555102.1"
                     /db_xref="GeneID:8293360"
                     /db_xref="UniProtKB/TrEMBL:C5DLK4"
                     /translation="MCHGIGIRHYVRASVCHFARAARVARASSPNCRCTTSTSTSSHG
                     QQNPDPPAAMATTADALFREKPVGELRNYRLQLSHDIAKAKDRFETELGRRYTDMLAV
                     TDQVDELLQQARTADADLMELCFNDAKFKLAALPDPAAFHAAAPAAATADPELGPGAQ
                     PDLAGIEATLAVSEWVLAVKDFAREPALQKHFDSLVQGFHTVLSLHDVSRYASVLARN
                     CRALEDTILEQQAEFSASQWVKLHRLVHSHAEVFPFKRVDELDALVFSFLLANEEPLR
                     AAGVDADVQAFLEGEPFKLKFVERVLQDVDAEFQALEEAAAGSAPTPELYRMNFDDGS
                     LLALVTEANLYCSGAISPRDRALYALVENITALVRKLQRSQADSAVISKVKERLSEVL
                     IERRKEVVEAPSDNSVLQLEALQKKGDTEFGTSQQGDAGPELKHKDAPLDSVTAAQKG
                     ESTDVVGNAARKTPVVSTDAEAEAHDSDTGASSTETEAPGAETETTSAETEVVTPSAE
                     TETQTPSAETETQTPSAETETQTPSAETETQTPSAEAEATSAQTQPPSAENNNYEKTM
                     HKGNIWQPVESLPLTRDIVRAAVQKLNTDNLLAYLGGQIAQVDSF"
     gene            complement(<104505..>105005)
                     /locus_tag="KLTH0G01430g"
                     /db_xref="GeneID:8293361"
     mRNA            complement(<104505..>105005)
                     /locus_tag="KLTH0G01430g"
                     /product="KLTH0G01430p"
                     /transcript_id="XM_002555057.1"
                     /db_xref="GeneID:8293361"
     CDS             complement(104505..105005)
                     /locus_tag="KLTH0G01430g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G01430p"
                     /protein_id="XP_002555103.1"
                     /db_xref="GeneID:8293361"
                     /db_xref="UniProtKB/TrEMBL:C5DLK5"
                     /translation="MPPSASPPAAPSAARLNGTPDTPTLPARKPPTSASPSFRAPASA
                     APRGARRAPCKREPFASALSCGAAPCSRDLPRCWAYSRGSSSDVATVSALYPRRRPVA
                     KDLRPDKRIKCKNMRKAPPSSRHCSSLWSLCATFPRPLRSQRGILQFSRPRKNVVRRV
                     PRAHGG"
     gene            <105741..>107564
                     /locus_tag="KLTH0G01452g"
                     /db_xref="GeneID:8293362"
     mRNA            <105741..>107564
                     /locus_tag="KLTH0G01452g"
                     /product="KLTH0G01452p"
                     /transcript_id="XM_002555058.1"
                     /db_xref="GeneID:8293362"
     CDS             105741..107564
                     /locus_tag="KLTH0G01452g"
                     /note="highly similar to uniprot|P40024 Saccharomyces
                     cerevisiae YER036C"
                     /codon_start=1
                     /product="KLTH0G01452p"
                     /protein_id="XP_002555104.1"
                     /db_xref="GeneID:8293362"
                     /db_xref="GOA:C5DLK6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLK6"
                     /translation="MPPASASKAKREAKKAEREAKRLAEGKTVRSSKKKEGTEDEAEA
                     AAKEIAQMKLQLDKDGISDRVVTGVLDSLETSRDVKMSSVSLLFHGKVLIQDSQLELN
                     YGRRYGLLGENGCGKSTFLKSLATREYPIPEHIDVYLLDEPAEPSEFSALDYVVNEAQ
                     NELKRLEDLVEKTILDEGPESDVLEGLYERMDSLDPSTFESRAAVILIGLGFNSQTIK
                     KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLV
                     SHSQDFLNGVCTNMIDMRLQKLIAYGGNFDSYVKTRTEQETNQMKQYAKQQEEIAHIK
                     KFIASAGTYANLVRQAKSRQKILDKMEADGLIEPVVPDKVFSFRFPEVERLPPPVLAF
                     DDISFAYDGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELSAQSGRVS
                     RHTHVKLGVYSQHSQEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLGRYGLTGEGQTS
                     QMGTLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLAEAINDFNGGVVVVS
                     HDFRLLDKIAKDIFVVENKTATRWDGSILDYKNKLAKNVVL"
     gene            complement(<108671..>109738)
                     /locus_tag="KLTH0G01474g"
                     /db_xref="GeneID:8293363"
     mRNA            complement(<108671..>109738)
                     /locus_tag="KLTH0G01474g"
                     /product="KLTH0G01474p"
                     /transcript_id="XM_002555059.1"
                     /db_xref="GeneID:8293363"
     CDS             complement(108671..109738)
                     /locus_tag="KLTH0G01474g"
                     /note="some similarities with uniprot|P53080 Saccharomyces
                     cerevisiae YGL222C EDC1 RNA-binding protein activates mRNA
                     decapping directly by binding to the mRNA substrate and
                     enhancing the activity of the decapping proteins Dcp1p and
                     Dcp2p"
                     /codon_start=1
                     /product="KLTH0G01474p"
                     /protein_id="XP_002555105.1"
                     /db_xref="GeneID:8293363"
                     /db_xref="UniProtKB/TrEMBL:C5DLK7"
                     /translation="MSTDTMYLNSSRRLPAAGKNKSSQLQKPEKKQTRSTRKNRTRQE
                     ASAAEVLPKPQTLPNGEKPDFGNSSKKQYGRKNHESSSAPRPYEARESAQKKNRSKDS
                     SPSHVDTTPAKSPSVLERSAVRQLTPQSVANASPVVSPLPLSMAAPLTISPLPHQPGL
                     YQQQHQQNQFQQNQYQQHQQFNAGYPYHHPQFSSLPLPAGAHQPNYALSTGAMPYFTS
                     PQAPLMGLPAQQAPPFFGMPHPPPPVTIMPGHFPHTPPSLNNVPPPQMFQQTFSPASA
                     PTSISSSTECSGPVTALPEEPRSSSATSNSTSSSTGASGSKKPSKKTRTSGKLGRGGY
                     AGASFATSLPSITNLPKPSFT"
     gene            complement(<110060..>110593)
                     /locus_tag="KLTH0G01496g"
                     /db_xref="GeneID:8293364"
     mRNA            complement(<110060..>110593)
                     /locus_tag="KLTH0G01496g"
                     /product="KLTH0G01496p"
                     /transcript_id="XM_002555060.1"
                     /db_xref="GeneID:8293364"
     CDS             complement(110060..110593)
                     /locus_tag="KLTH0G01496g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G01496p"
                     /protein_id="XP_002555106.1"
                     /db_xref="GeneID:8293364"
                     /db_xref="UniProtKB/TrEMBL:C5DLK8"
                     /translation="MDPYALKRDNRKKFFDKEKLKRKHATPSDRKYRALNKSEELPPP
                     EPELQANDYRYHEDISMAHGQDDFDAQNVNKKLKEVLKGRDVESGSAAKSVLPMTRKN
                     LDSMTVAELNSLLQRDVVPNADAKPAQAPNSSAPNSAVKSSAVKSGGNTSGTTKPQPS
                     AVPAELESEQNFLDELI"
     gene            complement(<110693..>111550)
                     /locus_tag="KLTH0G01518g"
                     /db_xref="GeneID:8293365"
     mRNA            complement(<110693..>111550)
                     /locus_tag="KLTH0G01518g"
                     /product="KLTH0G01518p"
                     /transcript_id="XM_002555061.1"
                     /db_xref="GeneID:8293365"
     CDS             complement(110693..111550)
                     /locus_tag="KLTH0G01518g"
                     /note="similar to uniprot|P53081 Saccharomyces cerevisiae
                     YGL221C"
                     /codon_start=1
                     /product="KLTH0G01518p"
                     /protein_id="XP_002555107.1"
                     /db_xref="GeneID:8293365"
                     /db_xref="GOA:C5DLK9"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="UniProtKB/TrEMBL:C5DLK9"
                     /translation="MSKALSKPQLKLLIEKITKLYPASYADASWDNTGLLIDCSAPQS
                     SVEKPKVLLTVDLTASVAEEAVANDCSLVLAYHPFIFPSWKRLSPWSNSQHRSAIKLI
                     QSGISVYCPHTAVDAAKNGVNDWLAHSLVRDQSLLKSSVSIEKVTPEQGELECEVGYG
                     RVVSFSTVVHLKDIISQVKSALEIPHLQVAVKDPLADFEVRSVALCAGSGSGVFKALK
                     QDVDLYFTGEMSHHEVLRLKEMGKAVIVCNHSNTERGFLKHVMQHELARAGVECIVSA
                     TDSDPLVVV"
     gene            <111703..>111960
                     /locus_tag="KLTH0G01540g"
                     /db_xref="GeneID:8293366"
     mRNA            <111703..>111960
                     /locus_tag="KLTH0G01540g"
                     /product="KLTH0G01540p"
                     /transcript_id="XM_002555062.1"
                     /db_xref="GeneID:8293366"
     CDS             111703..111960
                     /locus_tag="KLTH0G01540g"
                     /note="similar to uniprot|P53082 Saccharomyces cerevisiae
                     YGL220W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G01540p"
                     /protein_id="XP_002555108.1"
                     /db_xref="GeneID:8293366"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:C5DLL0"
                     /translation="MSVSQQVIKDKLQASIGDIYHIIITDTSNGCGQSFDVIVVSDTF
                     EGKNKLQRCRLVNGALKEEVAQIHAFGCKCFTTAEWSKLVV"
     gene            complement(<112050..>113678)
                     /locus_tag="KLTH0G01562g"
                     /db_xref="GeneID:8293367"
     mRNA            complement(<112050..>113678)
                     /locus_tag="KLTH0G01562g"
                     /product="KLTH0G01562p"
                     /transcript_id="XM_002555063.1"
                     /db_xref="GeneID:8293367"
     CDS             complement(112050..113678)
                     /locus_tag="KLTH0G01562g"
                     /note="similar to uniprot|P53083 Saccharomyces cerevisiae
                     YGL219C MDM34 Mitochondrial outer membrane protein
                     colocalizes with mtDNA nucleids required for mitochondria
                     shape"
                     /codon_start=1
                     /product="KLTH0G01562p"
                     /protein_id="XP_002555109.1"
                     /db_xref="GeneID:8293367"
                     /db_xref="GOA:C5DLL1"
                     /db_xref="InterPro:IPR027536"
                     /translation="MSFRFNKGAFEDNSFNEQIREALTSALNSKTQSSSQTAPANTTN
                     SAATDEVKQETRGPKRLDILKSGISVSKVNFPSTPQLEILDLDVSAQSRSLLKGICKV
                     SCKNAMLEINTEIEANLLLLYTNDGPSFTTPRLISNDSFTVPITMTFNQIELEAITNI
                     FVKNNSVGISFNDVNLDFDFDCSIKLLQSSIEKRLKGSMETVFKEVLPSVIFSMSQRW
                     FTHGESTCNSASDDKSAGRQVENHSHTPRTILEDCDLEDLSPANMLRLSTLVSSRQSL
                     SLNPTAMNTLSTIPGCLERQNLHRFNSRIPALSNFYPDFYEVESPHLKAFGRSVSTNV
                     ISSGKLEHHNALPQRVLDERSYDLKTIASVQSRIFERSSGDGTAIRRRKIKMGKKSKS
                     KKAQSQDIENSSPTVVMPSSPSLEPSAVSTPEALHSPQPTTAVQSPELLAENSESVSI
                     PALILPTQADHYTLPVKTSAPKLNLLEEAHYLNRKREFQKLRTSLYSPIRSNRFNLNK
                     EMERPILEHKGLNFVGLTHGLNWGSEDLPPPYRG"
     gene            complement(<114328..>115530)
                     /locus_tag="KLTH0G01584g"
                     /db_xref="GeneID:8293368"
     mRNA            complement(<114328..>115530)
                     /locus_tag="KLTH0G01584g"
                     /product="KLTH0G01584p"
                     /transcript_id="XM_002555064.1"
                     /db_xref="GeneID:8293368"
     CDS             complement(114328..115530)
                     /locus_tag="KLTH0G01584g"
                     /note="similar to uniprot|Q03558 Saccharomyces cerevisiae
                     YHR179W OYE2 Widely conserved NADPH oxidoreductase
                     containing flavin mononucleotide (FMN) homologous to Oye3p
                     with slight differences in ligand binding and catalytic
                     properties may be involved in sterol metabolism"
                     /codon_start=1
                     /product="KLTH0G01584p"
                     /protein_id="XP_002555110.1"
                     /db_xref="GeneID:8293368"
                     /db_xref="GOA:C5DLL2"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DLL2"
                     /translation="MTFVEGFKPIALKDTNLFKPIKVGKTVLRNRAVLCPLTRLRASQ
                     PRHVPNSELATKYYGQRSSVPGTMIITEGTFPSAQSSGTDNAPGIWSQEQVTEWKKIF
                     SKIHENKSFVWVQLWVLGRQASPKSLKRDGLRYDAPSDEPYMSEETKKEAIESGNPQH
                     GLTHEEIKQYIQDYVQAAKNSLEAGADGVEIHSANGYLLNQFLDPKSNKRTDEYGGSI
                     EKRARFLLEVVDAVVDAVGHEHVGVRLSPYGTFGNMSGASDPLFLAQYAYVVGQLEAR
                     AKSGKGIAYIHLVEPRVTSPRLVEGEGWFKDGSNEFVGSIWKGPIIKAGNYALDPKAA
                     KEDVQFDDRTLIGYGRLFIANPDLVLRLKDGLPLNQYDRDTFYTQTAKGYVDYPTFEE
                     AQKLSAAA"
     gene            <116364..>118823
                     /locus_tag="KLTH0G01606g"
                     /db_xref="GeneID:8293369"
     mRNA            <116364..>118823
                     /locus_tag="KLTH0G01606g"
                     /product="KLTH0G01606p"
                     /transcript_id="XM_002555065.1"
                     /db_xref="GeneID:8293369"
     CDS             116364..118823
                     /locus_tag="KLTH0G01606g"
                     /note="similar to uniprot|P53086 Saccharomyces cerevisiae
                     YGL216W KIP3 Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /codon_start=1
                     /product="KLTH0G01606p"
                     /protein_id="XP_002555111.1"
                     /db_xref="GeneID:8293369"
                     /db_xref="GOA:C5DLL3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DLL3"
                     /translation="MDSEAPHTRQSSIVVSVRVRPFTVHERAHLVNEQNIFGNLQLGD
                     PNLTLPGVENSTPTKIAPSRHRPQGVRQIVDCVDDKMLIFDPAENNPLSRISENVLNS
                     ITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTV
                     FAYGATGCGKTYTVSGTAENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESI
                     RDLLEPETPSKKLVLREDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDAN
                     ETSSRSHAVLQVHITQKNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGAN
                     INRSLLALGNCINALCAGGKRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTS
                     NHYDETLNTLKYATRAKEIKTKIIRNQHSLDRHVGSYLKMITEQRQEIEELRSRERKM
                     IDLELSRYKISRERVHMSVWDSVQSLRQNYKTSEKFHHLKVIKSLMLCKRRFLQMVGV
                     ELAVLLKFTSPNSDIHVNCMALHEQLVQKVKNLEQSFDSPDELESALEHTRQVDLVKL
                     QEMEGWAESDLVWYESLLSWVSESVRNEILVGSSLMMERLMEDHVLLDRLKFISETLL
                     RFTHTAEGSDEHSFDFDSLTEQLHGQIRDLINIDDEFDRFAASVQTTMVGTRDRTLVS
                     AEALQERNFRKGALSLQVPHHRKQARAKVVKSSSGTPSPVQRSRTSQGSKAAKKVRWS
                     EVLPGNDTSSMMMDDDNPQTQHSTHITASEEDISMLDAADSAVAPSEGIYNLHPTVAP
                     RDIPPPPRKVSLTATALVRGK"
     gene            <119662..>120873
                     /locus_tag="KLTH0G01628g"
                     /db_xref="GeneID:8293370"
     mRNA            <119662..>120873
                     /locus_tag="KLTH0G01628g"
                     /product="KLTH0G01628p"
                     /transcript_id="XM_002555066.1"
                     /db_xref="GeneID:8293370"
     CDS             119662..120873
                     /locus_tag="KLTH0G01628g"
                     /note="some similarities with uniprot|P35190 Saccharomyces
                     cerevisiae YGL215W CLG1 cyclin-like protein that interacts
                     with Pho85p in affinity chromatography cyclin-like protein
                     that interacts with Pho85"
                     /codon_start=1
                     /product="KLTH0G01628p"
                     /protein_id="XP_002555112.1"
                     /db_xref="GeneID:8293370"
                     /db_xref="GOA:C5DLL4"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C5DLL4"
                     /translation="MASYMYYPNYAAPQLQPFHGHSQSMGAPPVGNYGYYQAAQPMQP
                     YYQPQPHRSFHNHSSSYPMVMPPPGMGYLAPPAPSHHMPLPPVQPQLQPPVQQHPPPA
                     QNPESQVNGGVREVLDYDLKLMSEFVVKNAYLVFDNDDAINVESSSVVDVFTKGVSSV
                     LNATRLPSVTIFMALDFLCKYISKLPAGVEAVGGDSVNVIYQNLMIALVLANKFNDDK
                     TFTNKSWSHATGMELSVINQFERAWLAVFEWRLFDDNFVLFDEYSNSFKQYCQEKSSP
                     VHQYNAPSLPPSASCVSGLSPVQQNCSGFQTPMQAPPMVYSSPCFTEERSTTSNSFYQ
                     PTFASPISNESPMTKQGMNGYSYNYYSAPQPAPALAPMSSNLLWNNRVDEFYPQSQFA
                     PPNKAYYCYSN"
     gene            complement(<121279..>122556)
                     /locus_tag="KLTH0G01650g"
                     /db_xref="GeneID:8293371"
     mRNA            complement(join(<121279..122466,122554..>122556))
                     /locus_tag="KLTH0G01650g"
                     /product="KLTH0G01650p"
                     /transcript_id="XM_002555067.1"
                     /db_xref="GeneID:8293371"
     CDS             complement(join(121279..122466,122554..122556))
                     /locus_tag="KLTH0G01650g"
                     /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
                     YGL213C SKI8 essential for protection against viral
                     cytopathology dispensable for mitotic but required for
                     meiotic recombination and spore viability antiviral
                     protein mRNA is induced early in meiosis"
                     /codon_start=1
                     /product="KLTH0G01650p"
                     /protein_id="XP_002555113.1"
                     /db_xref="GeneID:8293371"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DLL5"
                     /translation="MSKLFISTTNCGKAHEADIFGMSISNPFTITVSGDGALKLWKNR
                     LLDGQQPKEHVLSKFVHKTGVHHVDAFHSMERGGIEVFLVACVSFSGQLFVYSIDLES
                     GAFQELDLLTKSEKQKSYWCVRFFKSDDLNVSHKLVATDVKGNTIVWNLKTFKEKEEA
                     DGQHAEEKDIHLVLKGEIPSPEPNFATCVDVSSKGLIVTGFQDGSVSVSQLETLRPIY
                     VFEGFGIKGTEESSNTVRDVKFSPLGELLAVANDSGSYGCVTLYETEYGERIGNLTVP
                     THSSQANIANFTHDGWVFGISFNSTGEFLATCGYDGKIRVWDVKQKERVSTLNISAGD
                     IEIEEDIVPKDEFGDSLKIPPVMGVTFINKGVRGGVGSDTNEGISCICLDRSVRWFRE
                     AGGV"
     gene            <122726..>123775
                     /locus_tag="KLTH0G01672g"
                     /db_xref="GeneID:8293372"
     mRNA            <122726..>123775
                     /locus_tag="KLTH0G01672g"
                     /product="KLTH0G01672p"
                     /transcript_id="XM_002555068.1"
                     /db_xref="GeneID:8293372"
     CDS             122726..123775
                     /locus_tag="KLTH0G01672g"
                     /note="similar to uniprot|P32912 Saccharomyces cerevisiae
                     YGL212W VAM7 Regulator of vacuolar morphogenesis
                     hydrophilic protein heptad repeat motif"
                     /codon_start=1
                     /product="KLTH0G01672p"
                     /protein_id="XP_002555114.1"
                     /db_xref="GeneID:8293372"
                     /db_xref="GOA:C5DLL6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DLL6"
                     /translation="MLGDKSVHVEVHVSKGQIVKKSYTLYLINLKITKDGGLESSFHS
                     LRRFSEFVQLKKDLEQEVGCELPYELPPRRFIGWLRPASSCDPDVIEERVRELTTFLQ
                     DLLNDSFDTRWRKARSLCQFLRIPDDWDNSGADGKHGNRSRDFHSSKDPQEEDLADAQ
                     KWLEELRNCKILYEEAIQNTSSFAKASVQLRLRIHNLEKGLKKIEAGQLVGAAEVNRR
                     QTLLNGLKTDLNRSSLTWAPQSTETFDSGLLPTTNSQALKPIAGRKLGETNQTTRLNN
                     QELLQLHKDTTQEQDKELEQLRRIILSQKDLSLTMNQELAQQNELLDYMGNEVDSTAS
                     KLRLANRKAKKFNGN"
     gene            <124053..>125174
                     /locus_tag="KLTH0G01694g"
                     /db_xref="GeneID:8293373"
     mRNA            <124053..>125174
                     /locus_tag="KLTH0G01694g"
                     /product="KLTH0G01694p"
                     /transcript_id="XM_002555069.1"
                     /db_xref="GeneID:8293373"
     CDS             124053..125174
                     /locus_tag="KLTH0G01694g"
                     /note="similar to uniprot|P53088 Saccharomyces cerevisiae
                     YGL211W"
                     /codon_start=1
                     /product="KLTH0G01694p"
                     /protein_id="XP_002555115.1"
                     /db_xref="GeneID:8293373"
                     /db_xref="GOA:C5DLL7"
                     /db_xref="InterPro:IPR000541"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012089"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020554"
                     /db_xref="UniProtKB/TrEMBL:C5DLL7"
                     /translation="MSFTPPSDPKKPKSIKVSQLCELCHSRKALIKRPKNLQKICKLC
                     FFHVFETEIHNTIISNNLFEYGEKVAVGASGGKDSTVLAYVLKLLNERYNYGIQIVLL
                     SIDEGIVGYRDDSLATVKRNKEQYGLPLEIVSYRELYDWTMDEIVACAGVRNSCTYCG
                     VFRRQALDRGAAKLGIRHVVTGHNADDMAETVLMNILRGDVARLEKSTAIMTQSSGSP
                     IKRSKPFKYSYQKEIVLYAHYKKLDYFSTECTYAPEAFRGTARELMKNLEAVRPSCII
                     DIIYSGESLRLKPKRTKRAPPAGHVEVCSDGSVSLNGGDFVDGNRCERCGYLSSNRIC
                     KACMLLEGLQQNRAKLSIDRDVSTHGAARLTRTLEQLTF"
     gene            <125972..>128509
                     /locus_tag="KLTH0G01716g"
                     /db_xref="GeneID:8293374"
     mRNA            <125972..>128509
                     /locus_tag="KLTH0G01716g"
                     /product="KLTH0G01716p"
                     /transcript_id="XM_002555070.1"
                     /db_xref="GeneID:8293374"
     CDS             125972..128509
                     /locus_tag="KLTH0G01716g"
                     /note="some similarities with uniprot|P40021 Saccharomyces
                     cerevisiae YER033C ZRG8 Cytoplasmic protein of unknown
                     function transcription is induced under conditions of zinc
                     deficiency"
                     /codon_start=1
                     /product="KLTH0G01716p"
                     /protein_id="XP_002555116.1"
                     /db_xref="GeneID:8293374"
                     /db_xref="UniProtKB/TrEMBL:C5DLL8"
                     /translation="MRSFIKSHKKSNSLDSSPSRSQSDKESGRSSYEYAVQPQAPLSK
                     RPVLDKGPPQSLSFESFHKLTNKNKIFSTKIFKKPGSHTSKTGEPCTTPVSPHVPTFR
                     NLSSPETPQSSHFSRHFQEESKEFTTIKGTRTHEWGASKDKSSSVIVLNRSSTSSDAS
                     SEMTESGFGSQVKLQRGSVSSATSSCIDENQRGSFDLQAGTTTPLVKLDDLSEVQEKH
                     PYFSLRSHGNKAKNRQVRIHSHEDFLSLEKKSNVNLDFLPGGLGSSNRLRNLTRLNST
                     DDSLHCVAEKPSKAYDQAQKESTPNLNLLGLGIDAKNLVQGEESSLSSSDEREQSVIT
                     NDRSFEEGDENRASSIALSITKISVSEHPESSSERGSEPDEDYSDGSSKFSFEIGGVN
                     GRTSSVKYYSKPNPQPHVYIDDVYEDDDFNEDMNCFDEEEDQELEMRVGVNNDNASGV
                     RGTSKLQEKVGYGAITDAFSSDEEIEQQNSSKVKGYNDLFDISDDESESNTSFHGGQE
                     ASDGNSCFSNDEALSVKGNITTEFQSSNLKSYGDIFDLSDEELSKFPKADLSNTNEDM
                     AAHPDVNVDFEGAEAPKQPFGHKPSTTEKIIQSCIKPVHSPKLSKPSSPRGTLRLPFP
                     ADPRSPTLDSATLFLPPPARSQVVKYHDLSSNLDYEVPGAMSNLFFIDESEEDQYNKK
                     HQPDEHYLDEINNLPEDFAFSDDDEYYLSASRSPGSNVRNSSFKKSHSFSEKPIGAVK
                     EKTPSNYKLELKDRVVTFFHGPFDSTLTSTSPRSPAAEEDDDTPLSIEERQIQGVTGL
                     DPLPVTPSNSFSRPNAYLGQSNGLSPIQETNSSVDNSPRVKSRLNNN"
     gene            complement(<128741..>131494)
                     /locus_tag="KLTH0G01738g"
                     /db_xref="GeneID:8293375"
     mRNA            complement(<128741..>131494)
                     /locus_tag="KLTH0G01738g"
                     /product="KLTH0G01738p"
                     /transcript_id="XM_002555071.1"
                     /db_xref="GeneID:8293375"
     CDS             complement(128741..131494)
                     /locus_tag="KLTH0G01738g"
                     /note="some similarities with uniprot|P40020 Saccharomyces
                     cerevisiae YER032W FIR1 Protein involved in 3' mRNA
                     processing interacts with Ref2p potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0G01738p"
                     /protein_id="XP_002555117.1"
                     /db_xref="GeneID:8293375"
                     /db_xref="UniProtKB/TrEMBL:C5DLL9"
                     /translation="MLDPGPSTPTKQQGVEHDKQELPSCLKSSEKRRSSPYNHKHSTS
                     QVRFSLPLEDDSQSLLDEDEEPVRVSPTKVVFPKGSEEDMTTHFVDLHNKIMVDVPEE
                     IWRFHNERNAQQLQKMSVKGQKGHGRAQSLQSIIAGTIQSYQSPAAENTHSRSLSCTS
                     SRLKPSELYLRSDSPLNKYKVPVPLEVTLPPYLSPDKKTKRRESMIYDGEGYSLFFED
                     SDVQEERDPFDPNSSADRSESEGSDISIPSASHDYSFEVGQDIDKILGIDEDANVNLK
                     NQVRNLLNKSPSKKAFLSLEQPQLPKLPRSQPKVEPFQEEKPVKLKLPPSQLKTKPTQ
                     EEKPVEITKSYALKILSSPSKTITLPDFNEPVSSSNRNSLAEFFARVDCEDNTHPVTV
                     EHEGKDEINEFFKFPAIQQEDKTTETQPIDENLQVNEGELDNSFERRRKMLQNRASTD
                     DFRTRHSHARSRSFHNSQEMFNAKLTSSGILSSNLEAPERSPKRSSIKSVTFKEGLPG
                     ADVEANAKSTPTKSSTLQANRNCELDKGPVSEEEEEEEEESFSFTLSEHEQKDSAESG
                     IIARPAELLETAHKNSQPAQDTDELSHKSGLSYHNSSSSLAMDFFSDVISDADSSDFI
                     HSTGTSSVKNLSSSKSDSSISLIGANAKPGDNITPLSTYNSFKTPLDSPQTANDPSLI
                     ECRLTHDNRLSPSRQLSNDRSQSSECSADTMPSQPSSATTYSHNDWKQSMEVFSYINK
                     KSGNNFVSGRRAKRGNNPALVAGEIQPSYSGYRVTKEEIGGRLVDIILLDEPGNNDCA
                     PKRRPRSYHEDALQHYDQVLALCDMTADRAKSVIMNLVEDPSHTNQVSEPLSRPVPPP
                     SYLKSHEKPIKENRSPKGLAHTSLNNNMPSRPQKYISNLEKLRRASKERSNSPDRRLR
                     ENC"
     gene            <132121..>132917
                     /locus_tag="KLTH0G01760g"
                     /db_xref="GeneID:8293376"
     mRNA            join(<132121..132166,132307..>132917)
                     /locus_tag="KLTH0G01760g"
                     /product="KLTH0G01760p"
                     /transcript_id="XM_002555072.1"
                     /db_xref="GeneID:8293376"
     CDS             join(132121..132166,132307..132917)
                     /locus_tag="KLTH0G01760g"
                     /note="highly similar to uniprot|P51996 Saccharomyces
                     cerevisiae YGL210W YPT32 probably involved in intra-Golgi
                     transport or in the formation of transport vesicles at the
                     most distal Golgi compartment; ras-like GTPase, highly
                     homologous to YPT31"
                     /codon_start=1
                     /product="KLTH0G01760p"
                     /protein_id="XP_002555118.1"
                     /db_xref="GeneID:8293376"
                     /db_xref="GOA:C5DLM0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLM0"
                     /translation="MNNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNEFNMESKS
                     TIGVEFATRTIEVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYE
                     NCNHWLTELRENADENVAVGLIGNKSDLAHLRAVPTDEAKNFAQENQLLFTETSALNS
                     ENVDQAFRELITAIYQMVSKHQVDLNEYGNNAGQAPKGPTISLTPAPAKKNKKSDNCC
                     "
     gene            complement(<132995..>133435)
                     /locus_tag="KLTH0G01782g"
                     /db_xref="GeneID:8293377"
     mRNA            complement(<132995..>133435)
                     /locus_tag="KLTH0G01782g"
                     /product="KLTH0G01782p"
                     /transcript_id="XM_002555073.1"
                     /db_xref="GeneID:8293377"
     CDS             complement(132995..133435)
                     /locus_tag="KLTH0G01782g"
                     /note="weakly similar to uniprot|P40019 Saccharomyces
                     cerevisiae YER030W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G01782p"
                     /protein_id="XP_002555119.1"
                     /db_xref="GeneID:8293377"
                     /db_xref="InterPro:IPR019098"
                     /db_xref="UniProtKB/TrEMBL:C5DLM1"
                     /translation="MAETKKHELKDQPDKKRVKRRRNYDDYDKEVAAEDSKAKKENKG
                     TGDNGSESESEDDEKLDMMLNKEDEEEDDLAEIDSSNIIQGGRRTRGKVIDYKKTAEA
                     LDKESGKASEEPKEELAQKDVAKKSETAEEDEDAEDADFKEPEK"
     gene            <133466..>134044
                     /locus_tag="KLTH0G01804g"
                     /db_xref="GeneID:8293378"
     mRNA            <133466..>134044
                     /locus_tag="KLTH0G01804g"
                     /product="KLTH0G01804p"
                     /transcript_id="XM_002555074.1"
                     /db_xref="GeneID:8293378"
     CDS             133466..134044
                     /locus_tag="KLTH0G01804g"
                     /note="weakly similar to uniprot|P40018 Saccharomyces
                     cerevisiae YER029C SMB1 associated with U1 U2 U4 and U5
                     snRNPs as part of the Sm-core that is common to all
                     spliceosomal snRNPs U1 snRNP protein"
                     /codon_start=1
                     /product="KLTH0G01804p"
                     /protein_id="XP_002555120.1"
                     /db_xref="GeneID:8293378"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5DLM2"
                     /translation="MWGFDVYYPHLRIFSQFQMNLNSYRSRGRPEMSVKVGHKSKLAD
                     LLRYRIRAVTNDGKAFVGELLAFDAHMNLVLAECVEHRIPSTQVQSLKAKAKEVDAQP
                     KIETRTLGLVVLRGDQVLTTVVESGPTMSKRERAVAHDRKQAQLNKHKRKGKGVVRPG
                     ASNNAVAPAPGFQRTSQPQPRPFQPPPGFRRR"
     gene            <135376..>136299
                     /locus_tag="KLTH0G01826g"
                     /db_xref="GeneID:8293379"
     mRNA            <135376..>136299
                     /locus_tag="KLTH0G01826g"
                     /product="KLTH0G01826p"
                     /transcript_id="XM_002555075.1"
                     /db_xref="GeneID:8293379"
     CDS             135376..136299
                     /locus_tag="KLTH0G01826g"
                     /note="some similarities with uniprot|P53035 Saccharomyces
                     cerevisiae YGL209W MIG2 Protein containing zinc fingers
                     involved in repression along with Mig1p of SUC2
                     (invertase) expression by high levels of glucose binds to
                     Mig1p-binding sites in SUC2 promoter"
                     /codon_start=1
                     /product="KLTH0G01826p"
                     /protein_id="XP_002555121.1"
                     /db_xref="GeneID:8293379"
                     /db_xref="GOA:C5DLM3"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DLM3"
                     /translation="MGVAQQESDHRPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHACN
                     FPGCVKRFSRSDELKRHVRTHMSTSRGKSRKRSGSSPALEHPVVVHQLPPISVPGVAQ
                     MPPLVPVAQLASVAQLASVAAPVAVAPSATAYIPRAGPSSSTSLLIPGVVAPMVSPAV
                     SRAVSPAVSPAFSPHTSSIHLHPGHASFLSSSSSSMSSVFSGGESGLASPLPSSPDLR
                     VHKLAGLLPSVQKSTRSASGGMSIASAVLNNAKRQQPLPAARPRLQGRNSQRAKFELN
                     DDDDSDSSQPADVRLPPLSSMLDGIQAFQER"
     gene            <136780..>138030
                     /locus_tag="KLTH0G01848g"
                     /db_xref="GeneID:8293380"
     mRNA            <136780..>138030
                     /locus_tag="KLTH0G01848g"
                     /product="KLTH0G01848p"
                     /transcript_id="XM_002555076.1"
                     /db_xref="GeneID:8293380"
     CDS             136780..138030
                     /locus_tag="KLTH0G01848g"
                     /note="similar to uniprot|P34164 Saccharomyces cerevisiae
                     YGL208W SIP2 Member of a family of proteins including
                     Sip1p and Gal83p that interact with Snf1p and Snf4p and
                     are involved in the response to glucose starvation
                     component of Snf1 protein complex involved in response to
                     glucose starvation and similar to YER027C uniprot|Q04739
                     Saccharomyces cerevisiae YER027C GAL83 One of three
                     possible beta-subunits of the Snf1 kinase complex allows
                     nuclear localization of the Snf1 kinase complex in the
                     presence of a nonfermentable carbon source contains
                     glycogen-binding domain"
                     /codon_start=1
                     /product="KLTH0G01848p"
                     /protein_id="XP_002555122.1"
                     /db_xref="GeneID:8293380"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DLM4"
                     /translation="MGNTHSKRAMSENMKDVSMVDVSSAEDEDKKGSQRAIVQSFSKL
                     DIGDHSSSGAPLMRRRSTLIFDDEDESPRHEENVGDQADLNEFGGPSSESSSSASVFH
                     QRQQQTPPAQESEPPAAEAPRVMVPVEITWQQGGSKVYVTGSFTGWRKMIGLVPVADQ
                     PGVFHIKLQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEISPQDSQQQLQL
                     QQQQQQQQQQQPQQLQPLQQPQQPQPQEQPQHPANYPPRSRRAEAAAEPLSARSKLAL
                     QIEEEPDDMGDGYSRFHGGAEATPAYSYTTDIPAVFTDSSVMEQYYLTLDQQQNNQQS
                     MAWLTPPQLPPHLENVILNNYSNSSDPGGSGSENNSGALPIPNHVVLNHLATSSIKHN
                     TLCVASIVRYKRKYATQILYSPLQ"
     gene            <138361..>141459
                     /locus_tag="KLTH0G01870g"
                     /db_xref="GeneID:8293381"
     mRNA            <138361..>141459
                     /locus_tag="KLTH0G01870g"
                     /product="KLTH0G01870p"
                     /transcript_id="XM_002555077.1"
                     /db_xref="GeneID:8293381"
     CDS             138361..141459
                     /locus_tag="KLTH0G01870g"
                     /note="similar to uniprot|P32558 Saccharomyces cerevisiae
                     YGL207W SPT16 Subunit of the heterodimeric FACT complex
                     (Spt16p-Pob3p) facilitates RNA Polymerase II transcription
                     elongation through nucleosomes by destabilizing and then
                     reassembling nucleosome structure"
                     /codon_start=1
                     /product="KLTH0G01870p"
                     /protein_id="XP_002555123.1"
                     /db_xref="GeneID:8293381"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="InterPro:IPR029148"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C5DLM5"
                     /translation="MSDVEINFKVFQKRLTQLHSEFRNFEGSPQSLLFVVGSSDEEDP
                     YKKSTILHNWLLGYEFPATLIAFVPDKVIIVTGAGKAKHLLGAVDLFKDSAFKLELWQ
                     RKAKDDAHNDKLFADVIELLKTAGKTVGTPVSDKYQGKFIAQWTPHWEGATGKGEFET
                     VDIALGLSQVWEKKDDQEVAFLKVSSKGTDLFMNLLSDEMVTAVDEELKISNAKLSDK
                     IENKIDDPKFLKKLANQMAPLCPSGEKFDINLLDWAYSPIIQSGSKFDLKVSARSNND
                     QLHGNGCILASCGIRYKSYCSNVTRTFLIDPTEEMVSNYEFLVSLQQEIINSFLKIGK
                     TPKEVYESTVEYVKSHKPHLLSGLTKNVGSLIGLEFRDSQFVLNSKNEQRKIGEQDCF
                     NVSLGFNNLKDSKTGVNYAVQIADTVLISSDGKAAALTDYTKLKSQISFYFNNEEEEV
                     TTKVKKENAAGSPPIPMKSDGNSKILRSKLRGESRVQEDSQKEQIRKENQRKLHEKLQ
                     KNGLIRFSAADANGADDQPQHQFKKYESYIRETQIPNNVRDLRVHVDWKNQTIILPIY
                     GRPVPFHINCYKNGSKNEEGEYTYLRLNFHSPGAGGISKKAEELPYEDSPDYQFVRSI
                     SLRSKDGDRMNEVFKQIADLKKEATKREQERKLLADVVEQAKLLENKSGRTKRLDQIF
                     ARPSPDAKRVPGTVFIHENGIRYQSPLRTDSRIDILFSNIKNLIFQPCKGELIVIIHV
                     HLKNPILMGKKKIQDVQFYREASDMAVDETGNGRRSNMKFRRYGDEDELEQEQEERRK
                     RAALDKEFRYFAEAIADASDGLVDLDTTFRELGFQGVPSRSAVYCMPTRDCLVQLVEP
                     PFLVINLSEVEICVFERVQFGLKNFDMVFVYKDFSKPVTHINTVPIEDLELLKSWLTD
                     VDIPYAVSTINLKWSTIMKSMQEDPHQFFLEGGWSFLVAGSDDEMSDESEEEISEYEA
                     SDEDPSDESAYSEEDGGSEDDFSDGGSEDASADESEEEGEDWDELEKKAAKADRENRQ
                     NE"
     gene            complement(<142143..>147116)
                     /locus_tag="KLTH0G01892g"
                     /db_xref="GeneID:8293382"
     mRNA            complement(<142143..>147116)
                     /locus_tag="KLTH0G01892g"
                     /product="KLTH0G01892p"
                     /transcript_id="XM_002555078.1"
                     /db_xref="GeneID:8293382"
     CDS             complement(142143..147116)
                     /locus_tag="KLTH0G01892g"
                     /note="highly similar to uniprot|P22137 Saccharomyces
                     cerevisiae YGL206C CHC1 vesicle coat protein presumed
                     vesicle coat protein"
                     /codon_start=1
                     /product="KLTH0G01892p"
                     /protein_id="XP_002555124.1"
                     /db_xref="GeneID:8293382"
                     /db_xref="GOA:C5DLM6"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="UniProtKB/TrEMBL:C5DLM6"
                     /translation="MSDLPIEFTELVDLTSIGISPQSLDFRSTTFESDRFVTARESQN
                     GANSVAIVDLQNGNQVTRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKTKLKSF
                     TLEEPVLFWKWLSEETLGFVTANSLYVSNVFDGDTSRKPSKLTQRHANLNNAQIINFV
                     ANKRLDWFAVVGIIQENGRVAGKIQLFSKARGISQAIEGHVATFSTILLEGNTQPVQV
                     FVTGNKTASGTGELRIIEIDHDASNAVSYQKKTVDIFFPPDAVNDFPISVQVSEKYGV
                     IYVLTKHGFIHLYELETGANLFVNRITVEPVFTATTYNQKNGIACINRRGQVLAVEIS
                     TDQIVPYVLNKLSNVSLALKMASRGGLPGADDLFNKQFDTLLASGDYQNAAKVAASSQ
                     QLRTQTTINRLKNIQAPPGAISPILLYFSTLLDKGKLNKYETIELARPVLQQDRKQLF
                     EKWLKEDKLECSEELGDVVKPFDTTLALACYLRAEAHSKVVTCLAELQQFDKILPYAQ
                     KVGYQPNFIVLISNLARSSPDKASEFAVSLLQSPETASQIDIEKIADIFFAQNFVQQG
                     TSFLLDALKGDTPDQGHLQTRVLEVNLLHAPQVADAIMGNSIFSHYDKPTIASLAEKA
                     GLYQRALENYTDIKDIKRCIVHSNALPIDWLVAYFGKLNVEQSVACLRALLDDNLQAN
                     VPIAIQVATKYSDLIGSQVLIKLFEEYRATEGLYYYLASLVNLTEDKDVVFKFIQAAA
                     KVGQFKEVERIVKTNNVYDPEKVKNFLKDIKLADQMPLVIVCDRFNYIHDLILYLYKA
                     QDFKFIEVYVQQVNPSKTPQVVAALLDVDCDEKVIQNLLGSVLGQVPIGELTAEVEKR
                     NRLKLLLPFLEDTLRQGTQEQAVYNTLAKIYIDSNNSPERFLKDNDQYDTLDVGRYCE
                     KRDPYLAYIAYEKGANDDDLIRITNENSMYKYQARYLLKRSDANLWNKVLDEENIHRR
                     QLIDAVVGTGIGELTDPEPVSLTVQAFMSNGLKGELIKLLEKIILEPSPFNDNPALQG
                     LLMLSAIRYEPSKVSSYIEKLDKFDEDEIAPLCVENGLNEEAFEIYSKNEKHDKALQV
                     LVEDVMSLDRAESYVDKINSPELWSQLGAAQLVGLRIPEAINSYIKANDPSNYETVIE
                     VAEQAEKYEELIPYLSMARSSLKEPKIEGALILSYAKLGKLHEIENLLTGSTVADLES
                     VGNKLFEEKDYKAAKLCFSAVSNYSRLATTLVYLNDYQAAVDTARKASNVRVWREVGD
                     ACVDNKEFRLAQICGLNLIVHAEELEELVEKYESHGYFEELISLFEAGLGLERAHMGM
                     FTELAILYTKYDMGKTYEHLKLFWSRINIPKVIRAVESAHLWTELIFLYAHYDEWDNA
                     ALTMIDKSADDFDHSYFKEIIVKVSNLEIYYKAINFYVKEHPTLLIDLMTVLSSKLDI
                     PRTIRIFSKSDNLPLIKPFLVNVLPKNNSVVNQAYHDLMIEEEDYKALQVAVDSYDKF
                     DQLDLAARLEKHDLIFFKKIAAQLYRRNKKWSKSLAILREEKLWADAIETAAISQSTE
                     VAEELLNYFVDTNNREGFVALLYTAYHLIRYEVVLELAWMNSLEDLIKPYEISVKKEQ
                     YSNVQKLLEQSKSGAKSDAAQSEDQPLLLTNGAMAYQATGQAFGNYA"
     gene            <148464..>150680
                     /locus_tag="KLTH0G01914g"
                     /db_xref="GeneID:8293383"
     mRNA            <148464..>150680
                     /locus_tag="KLTH0G01914g"
                     /product="KLTH0G01914p"
                     /transcript_id="XM_002555079.1"
                     /db_xref="GeneID:8293383"
     CDS             148464..150680
                     /locus_tag="KLTH0G01914g"
                     /note="similar to uniprot|P13711 Saccharomyces cerevisiae
                     YGL205W POX1 Fatty-acyl coenzyme A oxidase involved in the
                     fatty acid beta-oxidation pathway localized to the
                     peroxisomal matrix"
                     /codon_start=1
                     /product="KLTH0G01914p"
                     /protein_id="XP_002555125.1"
                     /db_xref="GeneID:8293383"
                     /db_xref="GOA:C5DLM7"
                     /db_xref="InterPro:IPR002655"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR012258"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR029320"
                     /db_xref="UniProtKB/TrEMBL:C5DLM7"
                     /translation="MTRITTNEFSGPTFKPQAFIQHERRESQLNIDAVNVFLESDPAN
                     AQLTHDLVTEVTMDPVLKTGSEYYDMSKDQHRRATALKIAKMAVYLEQDIKRAARNYR
                     GGAVEKFQTSDKTPILTAQDLAIFDKRLSIISNQDPQLGTRIGVHLGLFGNCIRGNGT
                     NEQIRYWLQEKGALFLKGIYGCFAMTELGHGSNVAQLQTRAEYNIQTDTFLINTPNLP
                     ATKWWIGGAAHSATHATVYARLIVKGKDYGVKTFVVPLRDPGTFQLLPGVFIGDIGTK
                     MGRDGIDNGWIQFKNVVIPREFMLCRFTKVIRSEQGDDAKVWSEPTLDQISGYSALLN
                     GRVNMVMDSFRFGAKFVTIAVRYAVGRQQFAPAGDKTGKAEETQLINYPLHQYRVLPH
                     LAVVYLISPVAFNLMATYHSTLDQLFKASSSGDKKQLGPVSLKLKDLFIDSASLKATN
                     TWLVATAIDELRQACGGLGYSAYNGFGKGFSDWVVQCTWEGDNSILSLTSARSILKKF
                     TDLSKGKVQESQSFKYLSPSFVTQVLRGSKSAQIRSLEDYIEVWGIMLVKILHYCVDL
                     VSKTKNTDSISKHLIMISRFHAFHTMLQAYYEKLKSPEDSHVSDQESQKMLWNLFRLF
                     SLYFIDKHSGEFLQFKVFTPDQIQTIVQPQLLALLPEIRKECIALTDAFKLPDAMLNA
                     PIGYYDGDIYNNYYAEVLKNNPPEAPGPGKPNYHEVLTTMLRRDYEPEENLAKLGK"
     gene            <151117..>151929
                     /locus_tag="KLTH0G01936g"
                     /db_xref="GeneID:8293384"
     mRNA            <151117..>151929
                     /locus_tag="KLTH0G01936g"
                     /product="KLTH0G01936p"
                     /transcript_id="XM_002555080.1"
                     /db_xref="GeneID:8293384"
     CDS             151117..151929
                     /locus_tag="KLTH0G01936g"
                     /note="similar to uniprot|P08456 Saccharomyces cerevisiae
                     YER026C CHO1 phosphatidylserine synthase"
                     /codon_start=1
                     /product="KLTH0G01936p"
                     /protein_id="XP_002555126.1"
                     /db_xref="GeneID:8293384"
                     /db_xref="GOA:C5DLM8"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004533"
                     /db_xref="InterPro:IPR016271"
                     /db_xref="UniProtKB/TrEMBL:C5DLM8"
                     /translation="MSKRGEQVPREEATQDLGGAVSSDAEDDAFTASRTPSRRASSIF
                     SLDNPPLEPPNESDIRKFTSDEYHFNMIRNLHLADLITMMNGFSGFYSIVSCLRFTLT
                     GKPHYVQRAHFFILLGMFFDFFDGKVARLRNRSSLMGQELDSLADLVSFGVAPASIAF
                     AIGFQTTLDVLVLSFFMLCGLTRLARFNVTVAQLPKDVSGKSKFFEGLPIPTSLALVG
                     AMAYLVSKGLILEKLPFGLFAAGEWYELHPAVLLFGIQGCGMISKSLKIPKP"
     gene            complement(152104..152175)
                     /locus_tag="KLTH0G01958r"
                     /db_xref="GeneID:8293385"
     tRNA            complement(152104..152175)
                     /locus_tag="KLTH0G01958r"
                     /product="tRNA-His"
                     /note="tRNA-His (GTG) cove score=64.62"
                     /db_xref="GeneID:8293385"
     gene            complement(<152313..>154550)
                     /locus_tag="KLTH0G01980g"
                     /db_xref="GeneID:8293386"
     mRNA            complement(<152313..>154550)
                     /locus_tag="KLTH0G01980g"
                     /product="KLTH0G01980p"
                     /transcript_id="XM_002555081.1"
                     /db_xref="GeneID:8293386"
     CDS             complement(152313..154550)
                     /locus_tag="KLTH0G01980g"
                     /note="similar to uniprot|P09620 Saccharomyces cerevisiae
                     YGL203C KEX1 Protease involved in the processing of killer
                     toxin and alpha factor precursor cleaves Lys and Arg
                     residues from the C-terminus of peptides and proteins"
                     /codon_start=1
                     /product="KLTH0G01980p"
                     /protein_id="XP_002555127.1"
                     /db_xref="GeneID:8293386"
                     /db_xref="GOA:C5DLM9"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR029058"
                     /translation="MSHFKYRNQTTDICNAAALDAFAMYSNYSVPLALLFALLLSFQT
                     ARALKAADEYAVSPDLIPGLSQAEDRALVPTMHAGHIPLDENNDEHTKNYFFWKFHDE
                     SGSASGPARDTLIFWLNGGPGCSSMDGALMESGALRIDSDGKAYLNRGGWHTRGDIVF
                     VDQPAGTGFSTVASDNDYDNDLKVVSEHFVAFLRNYFQVFPDDAGKQVVFAGESYAGQ
                     FIPYFARAVLDQDEVQVNLQALLIGNGWIDPNQQSLYYIPFAVEKGLITQDDPSFSYL
                     LKQQENCQNKINSKENDRFSFKECENILNNLLEVTRKIKDSEGKKVPSDQQCINMYDL
                     RLKDSYPSCGMNWPQDLPNLGKFFGTEGVLEALHLDPEHVSQWHECDDKVSNYLKNPD
                     SRASAAILPGLLEAGLEVMLFNGDQDIICNNMGVEAVISQMSWGGETGFSENVQLYDW
                     VYRSPENSEITPAGFVKYDRNLTFMSVYNASHMVPFDNALVSRGVVDLFLNDVDLVQI
                     DGRDTLITDDVNKGKDGDASETDDTTELDCEGKDKLSEECKQLNASKGQNGESDKDEG
                     EKGNEEDDNDDTEDGKKDAGDEKDDGEKDDDEKDGDEKDGDEKDEEDDDDKDENEKDE
                     EDDDKDGDKPEGKNNDGAEDEDDDHNSGSHLAVTMICLLVSGTIIGGLYFTFRDRFRP
                     RLRAILVDPTNRSEASKKTVSWAADLEQDAADLSNPENGAKKKGPYTSVPTQESRDSF
                     ELDNL"
     gene            <155219..>156709
                     /locus_tag="KLTH0G02002g"
                     /db_xref="GeneID:8293387"
     mRNA            <155219..>156709
                     /locus_tag="KLTH0G02002g"
                     /product="KLTH0G02002p"
                     /transcript_id="XM_002555082.1"
                     /db_xref="GeneID:8293387"
     CDS             155219..156709
                     /locus_tag="KLTH0G02002g"
                     /note="highly similar to uniprot|P53090 Saccharomyces
                     cerevisiae YGL202W ARO8 Aromatic aminotransferase
                     expression is regulated by general control of amino acid
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0G02002p"
                     /protein_id="XP_002555128.1"
                     /db_xref="GeneID:8293387"
                     /db_xref="GOA:C5DLN0"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DLN0"
                     /translation="MTVGESLDFSHLYSEETKSRKSSPLKTCIHLFQDPNIVFLGGGL
                     PLSKYFPWENLQAESPLPPFPNGIGAAPSGDAKDTCVTSIPKDGTSKAGDTNDIPLSR
                     ALQYGFSMGQPEYLSFVREHTQLVHKMQYEDWDVLATIGNTGSWESTLRIFCNRGDTI
                     LAEKYTFSSSVYAAEAQGVNVFPVPLDADGLIPERLEAILDNWNPETPKPKLLYTIPT
                     GQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFLQMDAYEKDPSKRKAIEFASHD
                     EFVNSLAKSFISLDTEGRVIRMDSFSKVLGPGTRLGWLVGSKRILRAYTQLHEMTIQN
                     PSGFSQAIVSGTLNRWGQHGFLDWLIGLRQEYNEKRDVAIDALYKYVPSTPALTVTPP
                     IAGMFFTVNIDASAHPEFATKYQSKPELVEQAIYEKVIACGVLVVPGIWFKADGETTP
                     AQPKESKAEPNPNGIFFRGTYAAVPLDKLQDGIKRFGIALKEEFGL"
     gene            complement(<156778..>158406)
                     /locus_tag="KLTH0G02024g"
                     /db_xref="GeneID:8293388"
     mRNA            complement(<156778..>158406)
                     /locus_tag="KLTH0G02024g"
                     /product="KLTH0G02024p"
                     /transcript_id="XM_002555083.1"
                     /db_xref="GeneID:8293388"
     CDS             complement(156778..158406)
                     /locus_tag="KLTH0G02024g"
                     /note="similar to uniprot|P36035 Saccharomyces cerevisiae
                     YKL217W and to gnl|GLV|KLLA0F10043g Kluyveromyces lactis
                     KLLA0F10043g"
                     /codon_start=1
                     /product="KLTH0G02024p"
                     /protein_id="XP_002555129.1"
                     /db_xref="GeneID:8293388"
                     /db_xref="GOA:C5DLN1"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DLN1"
                     /translation="MTRNSFASSSNSVVETEGSKCCVERKPRAQHQVTWAEVQEYLRT
                     RFTTLVPTRQKLREARSKYALNPFPALRHMNARQTQFFIVGFLAWTWDALDFFAVSLN
                     MSAIAKDLDKSIKDMSNAITLVLLLRVIGAVIFGYLGDRYGRKLPYCISMFLIIVVQI
                     GTGFVKTFPAFLGCRAIFGIVMGSIFGVASATALENAPEESRSILSGIFQEGYALGYL
                     LGVIFKRAIVDNSPHGWRSFFWFSAGPPALFIVWRLLLPESEVYTRRMNESKRVAQEQ
                     EKTNSSQFWQNVKVALIQHWMTLVYLVILMAMFNFSSHGSQDLFPTMLTNQYNYSDDA
                     STVTNSVANIGALVGGILVAHVSSFIGRRCAIVICCIGGGALLYPWGFVSNPKGLNPA
                     VFFLQFFVQGAWGVVPIHLTELSPVEFRAFVTGVAYQMGNMISSASSTIEATIGERFP
                     IDGKEGVYDYGKVMCIFMGCVFAGLLITTVLGPENKGGELLIDERVLDTRGALNNVGD
                     FDLEHADTFSLPKPSVEQIADVERNSENSDRAPK"
     gene            complement(<158828..>161563)
                     /locus_tag="KLTH0G02046g"
                     /db_xref="GeneID:8293389"
     mRNA            complement(<158828..>161563)
                     /locus_tag="KLTH0G02046g"
                     /product="KLTH0G02046p"
                     /transcript_id="XM_002555084.1"
                     /db_xref="GeneID:8293389"
     CDS             complement(158828..161563)
                     /locus_tag="KLTH0G02046g"
                     /note="highly similar to uniprot|P06738 Saccharomyces
                     cerevisiae YPR160W GPH1 Non-essential glycogen
                     phosphorylase required for the mobilization of glycogen
                     activity is regulated by cyclic AMP-mediated
                     phosphorylation expression is regulated by stress-response
                     elements and by the HOG MAP kinase pathway"
                     /codon_start=1
                     /product="KLTH0G02046p"
                     /protein_id="XP_002555130.1"
                     /db_xref="GeneID:8293389"
                     /db_xref="GOA:C5DLN2"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="InterPro:IPR011833"
                     /db_xref="UniProtKB/TrEMBL:C5DLN2"
                     /translation="MSFGRRPSLSNDLISEDPNAPHVPRLTRRLTGFLPQEIKAIETT
                     IPAQSREIWNKHKVQKFNTADEFQERFISHVEWTLARSLYNCDDLAAYQATSQSVRDN
                     LVIDWNKTQQRQTARDPKRVYYLSLEFLMGRALDNALINMRTDTDVRDVGDTDETLTK
                     GNTSREMIKNAMNELGFKLEDILDEEPDAALGNGGLGRLAACFVDSMATGNYPAWGYG
                     LRYQYGIFAQKIINGYQVETPDYWLNFTNPWEIERAEIQVPINFYGYVDRGQNEKSTL
                     EPSDWIGGERVLAVPYDMPIPGFKTSTVNNLRLWSAKPTTEFDFKKFNNGDYKNSVEE
                     QQRAESITAVLYPNDNFLQGKELRLKQQYFWCAASLHDIVRRFKKGKRAWSEFPDAIA
                     IQINDTHPTLAIVELQRILVDLEKLDWHEAWKIVTSTFAFTNHTVMQEALEKWPISLL
                     GRLLPRHLEIIYDINWFFLQDVEKKFPHDMDLLSRVSVIEESSQERQVRMAYLAIIGS
                     HKVNGVAELHSDLIKTTIFKDFVKIYGSNKFTNVTNGITPRRWLKQANPKLAQLISET
                     INDPEDNYLLDMSKLTQLSKYAEDEKFQKKWNDVKQFNKQRLADLIKKLNNGVDIIER
                     DHIRNTLFDIQVKRIHEYKRQQMNIFGVIHRYLTMKELLQSGASIEEVVKKYPRKVSI
                     FGGKSAPGYYMAKLIIKLINSVADVVNNDKEIQDLLKVYFIPDYNVSKAEIITPASDL
                     SEHISTAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNIFLFGNLAENVDE
                     LRYKHQFHNEGVPASLAKVLDAMQNGAFSPQNHSEFMPLIDSIKSHGDYYLVSDDFEA
                     YISTQELVDQVYHKDKKEWLKKSILSVANIGFFSSDRCIEEYADTIWNAEPVKPE"
     gene            complement(<162461..>165571)
                     /locus_tag="KLTH0G02068g"
                     /db_xref="GeneID:8293390"
     mRNA            complement(<162461..>165571)
                     /locus_tag="KLTH0G02068g"
                     /product="KLTH0G02068p"
                     /transcript_id="XM_002555085.1"
                     /db_xref="GeneID:8293390"
     CDS             complement(162461..165571)
                     /locus_tag="KLTH0G02068g"
                     /note="similar to uniprot|P53091 Saccharomyces cerevisiae
                     YGL201C MCM6 Protein involved in DNA replication component
                     of the Mcm2-7 hexameric complex that binds chromatin as a
                     part of the pre-replicative complex"
                     /codon_start=1
                     /product="KLTH0G02068p"
                     /protein_id="XP_002555131.1"
                     /db_xref="GeneID:8293390"
                     /db_xref="GOA:C5DLN3"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5DLN3"
                     /translation="MSSPPRNSGANLSSTFNDDSPAGNPNIPSSAPPTHHSSPPYSSM
                     SGNYAGSAHFGEDEIGSGPSGATPAFPSSSRSIGGPDRSSQPQMGSSQHFEREEGDVE
                     QEELPLDGVRRRNLNTIKKVDDVTGEKVREAFEHFLEDFTIESQDDGQEPQAVKAYRS
                     QIEFMRVYDLNTIYIDYQHLSTRENGALAMAISEQYYRFLPFLQKGLKRVIRRHAPQL
                     LFTADSVSQNPGGLDTQNTSNADSYTQESQGTGESVPRGGNPSSGFATGASTAGSPEQ
                     TERVFQISFFNLPTINRIRDIRAEKIGSLMSISGTVTRTSEVRPELFKASFTCEMCRA
                     VVDNVEQVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKARIQENANEIPTGSMP
                     RTLDVILRGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGVKPSSSMDTRGLARSSEG
                     LNNGVSGLKSLGVRDLTYKISFLACHVAPTGKDATSGADTRDEGTELLNLQVNSSGND
                     DERDQEVFLNSLNPQEINELKEMVKDEQIYDKLVRSIAPAVFGHNTVKKGILLQMLGG
                     VHKTTVEGINLRGDINICIVGDPSTSKSQFLKYVCSFAPRAVYTSGKASSAAGLTAAV
                     VKDEEAGDFTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHA
                     TLNARTSILAAANPVAGRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELA
                     AHIVDLHMKRDEAIDPPFTADQLRRYIKYARTFKPLMNEEARNYLVEKYKELRRDDAQ
                     GFSKSSYRITVRQLESMIRLSEAIARANCVDEISPNFVAEAYDLLRQSIIRVDVEDVD
                     VTGDSDDESNEGGNDGGNDSGNDSDGHGDSGDQVASQRSSEEPLETRETPLPSESGHG
                     DKKGKVTISYDKYAAMINLIVQKVAQEDRDGGAELTAADIVDWYLLQRENEINSESEY
                     WQERKLAFKVIKRLVKDKILMQVQGNMQALADHEGDHPISERVVYVIHPNCAVLDNIV
                     GPSRQG"
     gene            complement(165811..165881)
                     /locus_tag="KLTH0G02090r"
                     /db_xref="GeneID:8293391"
     tRNA            complement(165811..165881)
                     /locus_tag="KLTH0G02090r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=62.63"
                     /db_xref="GeneID:8293391"
     gene            complement(<166538..>168667)
                     /locus_tag="KLTH0G02112g"
                     /db_xref="GeneID:8293392"
     mRNA            complement(<166538..>168667)
                     /locus_tag="KLTH0G02112g"
                     /product="KLTH0G02112p"
                     /transcript_id="XM_002555086.1"
                     /db_xref="GeneID:8293392"
     CDS             complement(166538..168667)
                     /locus_tag="KLTH0G02112g"
                     /note="similar to uniprot|P32486 Saccharomyces cerevisiae
                     YPR159W KRE6 Protein required for beta-1 6 glucan
                     biosynthesis putative beta-glucan synthase appears
                     functionally redundant with Skn1p"
                     /codon_start=1
                     /product="KLTH0G02112p"
                     /protein_id="XP_002555132.1"
                     /db_xref="GeneID:8293392"
                     /db_xref="InterPro:IPR005629"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DLN4"
                     /translation="MSVRNLTSNTREQQASYSGGDQGNASASQNVPVRNPFTDDAEDD
                     TYASYSASDTSLLHHDDGASATDAAGAAGSAAVGSRDVSDYKGYYSKGAAGARLTPGS
                     RAGPAALPSSSSLSSHTGISNNDITAPPGFDRYPVVGSRVASMAPVGGAAAVGAAGAA
                     AHNGSHNNSSASISSSDPFISDQDFSPFGGYPTSSFPLHLDEKEDDDYLHNPDPEEEA
                     RLDNSKFMLDFKHMDRRSAGGFFGFLFLFLGALTLFVVLPVLTFTGAVDHGKPQTITY
                     LSLYEYPQLSAIRTSLVDPDTPTSAKTWKAKDGSEWPLAFSDEFNAEGRTFYDGDDQF
                     WTAPDFHYAATHDLEWYSPDAVTTANGTLKLRMDAYKNHDLYYRSGMLQSWNKLCFTQ
                     GYIEASANLPNYGRVIGLWPGMWTMGNLGRPGYLASTEGVWPYSYEACDAGITPNQSS
                     PDGISYLPGQKLSSCTCDGEDHPNQGVGRGAPEIDIIEGSADTYIGGSGVGVASQSLQ
                     LAPFDIWYMPDYDFIEIHNSTVTAMNTYAGGPFQQAVSAVTALNVTWNEFGPDAGYFQ
                     SYGFEYLNDHDTGYIRWFVGQQPTMTIHSTALHPNGNINWRPISKEPMSIILNLGISN
                     NWAYIDWNSIFFPVTMSIDYVRIYQPENATSITCDPSGFPTYQYIQDHLNVYSNVNLT
                     SWEDAGYTFPKNTLTGNCKSSKKNKDY"
     gene            complement(169262..169342)
                     /locus_tag="KLTH0G02134r"
                     /db_xref="GeneID:8293393"
     tRNA            complement(169262..169342)
                     /locus_tag="KLTH0G02134r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (GAG) cove score=65.59"
                     /db_xref="GeneID:8293393"
     gene            complement(<169670..>170752)
                     /locus_tag="KLTH0G02156g"
                     /db_xref="GeneID:8293394"
     mRNA            complement(<169670..>170752)
                     /locus_tag="KLTH0G02156g"
                     /product="KLTH0G02156p"
                     /transcript_id="XM_002555087.1"
                     /db_xref="GeneID:8293394"
     CDS             complement(169670..170752)
                     /locus_tag="KLTH0G02156g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G02156p"
                     /protein_id="XP_002555133.1"
                     /db_xref="GeneID:8293394"
                     /db_xref="GOA:C5DLN5"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="UniProtKB/TrEMBL:C5DLN5"
                     /translation="MWLSAGTPFIGAIVLGILKPQGPSELLVQSFKMPSKSQSLMGQD
                     GVRTFQDMLYQHARAMSHVSVYYATEEVGVSELLHTLVQVLKKGSKLVFLGSGKSFKI
                     ILKTVAMLTSLGIDSRYLHPSEALHGDMGAVRPGDALVVCSSSGETQELVQFLEHAGR
                     VLEPSVKVLVTSSTQSTLHALVDQVLYVPQPVQFQEKTLQDGLPSPTVSTTLMLTVLD
                     CFCLALTELYFDGDTARRREFFRKMHPGGGIGKQSQVPVPVPVPVLMPMALHKDAVGA
                     PIDSTVCGHVPDGASESEFLQSIVQFDYCVVAGVRYDSHVLQHRYREWKRSMPAFPLK
                     YSADRSWNLAALLASAVVAANQADSM"
     gene            complement(170898..170970)
                     /locus_tag="KLTH0G02178r"
                     /db_xref="GeneID:8293395"
     tRNA            complement(170898..170970)
                     /locus_tag="KLTH0G02178r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8293395"
     gene            complement(<171670..>172959)
                     /locus_tag="KLTH0G02200g"
                     /db_xref="GeneID:8293396"
     mRNA            complement(<171670..>172959)
                     /locus_tag="KLTH0G02200g"
                     /product="KLTH0G02200p"
                     /transcript_id="XM_002555088.1"
                     /db_xref="GeneID:8293396"
     CDS             complement(171670..172959)
                     /locus_tag="KLTH0G02200g"
                     /note="some similarities with uniprot|P53286 Saccharomyces
                     cerevisiae YGR142W BTN2 Cytosolic coiled- coil protein
                     that modulates arginine uptake interacts with Rhb1p
                     possible role in mediating pH homeostasis between the
                     vacuole and plasma membrane H()-ATPase may have a role in
                     intracellular protein trafficking"
                     /codon_start=1
                     /product="KLTH0G02200p"
                     /protein_id="XP_002555134.1"
                     /db_xref="GeneID:8293396"
                     /db_xref="UniProtKB/TrEMBL:C5DLN6"
                     /translation="MFHFNQSPCIFDREPAVEGFLPFTVAPDQKRRRVCCQPFYNNAM
                     KRDRKGIRFDVTENQQEYVLSVYKNVAEDTMSKAICDQLQKLRNDRPPTYHVVRDFFG
                     NEYYVQDHEDDEDFMRHAIANLDLSPIKRQVARQVFRDYEITLNHRGDELVLMSRKDG
                     LFKEFSLGIEFEDVSVKGFDMISESVAVLKIGIKKAQKEVPQMYHIEFQPSSNDTQQQ
                     EKIEQQEQQKLIEAAQEEELAKREAAATLKQRERAQAAHYAQIKKQEELARKERAALR
                     EREEQRAIEAATLRKREEQREREVAALKKHEEEERAREQEAAQREEKRHAISQKKAFL
                     VEQKRKRRQQERQRRAKSQKNEKQPEKKNISPSDSPHNVVININFPNAVSEKTSEKSR
                     GRSRSPVVLEDVDDEEEFRYRRSLDKSPRGSSIIDDM"
     gene            complement(<173533..>174849)
                     /locus_tag="KLTH0G02222g"
                     /db_xref="GeneID:8293397"
     mRNA            complement(<173533..>174849)
                     /locus_tag="KLTH0G02222g"
                     /product="KLTH0G02222p"
                     /transcript_id="XM_002555089.1"
                     /db_xref="GeneID:8293397"
     CDS             complement(173533..174849)
                     /locus_tag="KLTH0G02222g"
                     /note="similar to uniprot|P53285 Saccharomyces cerevisiae
                     YGR141W VPS62 and similar to uniprot|Q06466 Saccharomyces
                     cerevisiae YPR157W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G02222p"
                     /protein_id="XP_002555135.1"
                     /db_xref="GeneID:8293397"
                     /db_xref="InterPro:IPR009291"
                     /db_xref="UniProtKB/TrEMBL:C5DLN7"
                     /translation="MSLALLLFLLQGVCAVIVPWLDNDPFAESTETHKLDLGYPPVLS
                     PDEITDDTRSLPHEGFVPQFVIDNCPLVHLYSEEEYWPADISDFVRHFNIQLSNGSVL
                     QEHPLDLQDLKSKIQGPAGAISGRETYLSSVDDFDKDPRWLLGHEPDYGSGQIKNAPA
                     ILIVVDKGNGWVDAFWFYFYSFNLGPFIMGYGPWGNHVGDWEHSLVRFFEGEPKYLWM
                     SAHGGGGCYRFDAIEKKTRVQYSNNHRTSKILQRPLIFSARGTHANYASVGQHAHDVP
                     FFFSALSDFTDRGPLWDPSLNYLAYTYNGTVVTPVSDRERELGTKWLHYMGHWGDKQL
                     PWSDPRQRWCPVQWRYIDGPRGPLAKNLGRTSLCQRSKWFNFWGGCPARRKIKRGQGL
                     DAEHNDLVGDNCGILLYRVRPKWLRTLMRLIMWRGIACFIMDYFTG"
     gene            complement(<175051..>177507)
                     /locus_tag="KLTH0G02244g"
                     /db_xref="GeneID:8293398"
     mRNA            complement(<175051..>177507)
                     /locus_tag="KLTH0G02244g"
                     /product="KLTH0G02244p"
                     /transcript_id="XM_002555090.1"
                     /db_xref="GeneID:8293398"
     CDS             complement(175051..177507)
                     /locus_tag="KLTH0G02244g"
                     /note="weakly similar to uniprot|P32504 Saccharomyces
                     cerevisiae YGR140W CBF2 Essential kinetochore protein
                     component of the CBF3 multisubunit complex that binds to
                     the CDEIII region of the centromere Cbf2p also binds to
                     the CDEII region possibly forming a different multimeric
                     complex ubiquitinated in vivo"
                     /codon_start=1
                     /product="KLTH0G02244p"
                     /protein_id="XP_002555136.1"
                     /db_xref="GeneID:8293398"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DLN8"
                     /translation="MPDVPSRPMDPHLHIKALVDTLAPRTAHQYKLYHTKFIQWCRDN
                     KLLRRDPGADHPYRDIVVTATLVHCFVLSQYVCVSDSQFSASVLRKMISAFKFLHRVC
                     CAYEPDYPYELDHDYLEAVARLHVSASAENPPFSPLHLVSVNMWTPHSNRLSEKYFKG
                     GLERLRFLVDFHVQQYWHLPFADRARLKLGDLRFAADPGMLHVVRQGQHGADAPETVQ
                     QLALLPQRVPWICPLVSLAAYLYLRFYGAPKAYKGDGFPDLLGADEWAFLPMVRGKSL
                     DKYPREETMTNYYAHVFRHCHLPYKRREYFYNKSVDYCQYPEIRRTELDQLQEIAPAQ
                     QRELFPHLIPLDFLRHMNHFPVYEPPSENHYADLANVPKSLLVQVFPEIEEYKRSSIP
                     LGEQAQHFIDALQLLRSALVSALPLFYHFFPEHDLFKDPMFQNAEFQGYFHQKIEQLR
                     ATDQLQSYDPAAFGLVEAERDFAAPSQPPQALNVPPSADTQDLQIYLRDQTFRMVQFQ
                     TTSNFHLLLQSLSRIFEKLETKKSNREYIIHQLGSLEQTLQDQIAASKPQDVKTEEET
                     SSSSTNGPKQETRESLPAGKLSRPAVFDSDAEDDDDYKEEDDNEDNDDEVDPNLQNEL
                     QALVSQVMDTRFKSAVEQQTAQIERHVQSLISAQVKEEVRKQLAHLLNQQSSTPTPQP
                     SQQPVTIAPKRPREEQEPPSTAGESTFAMSPQLTSIEDIILEWFTPNPEQGNECVHTM
                     NKKFGKTWRAGSQEATHLYKQRKLIIEFYICLVNQRQMDRYEAVAVCEKLRDNASIQE
                     FSNMLKSWKKGHNNSFDGLG"
     gene            <178663..>180597
                     /locus_tag="KLTH0G02266g"
                     /db_xref="GeneID:8293399"
     mRNA            <178663..>180597
                     /locus_tag="KLTH0G02266g"
                     /product="KLTH0G02266p"
                     /transcript_id="XM_002555091.1"
                     /db_xref="GeneID:8293399"
     CDS             178663..180597
                     /locus_tag="KLTH0G02266g"
                     /note="highly similar to uniprot|P53283 Saccharomyces
                     cerevisiae YGR138C TPO2 Polyamine transport protein"
                     /codon_start=1
                     /product="KLTH0G02266p"
                     /protein_id="XP_002555137.1"
                     /db_xref="GeneID:8293399"
                     /db_xref="GOA:C5DLN9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DLN9"
                     /translation="MDSDQESINSFNSRDSYTQVPQTYVPSDATSARRAGRRSSASAS
                     SAVGSDRLRLVPTETVKSLQDMGVTPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGL
                     VPVATLQSLGRTQSAVSRTRTRVMREGAAARRRGSDAGSENEQKLTLSDHGSKSGSGS
                     GEGEGEGAAAGAPELDPEIEFVTFVTGDPENPHNWPLWLRWVYTILLSILVIAVAYGS
                     ACITGGLGTVSDKFHVSQEVSILTCSLMVLGFSLGPLIWSPVSDLLGRRVAYFISLGL
                     YVIFNIPCALAPNIGCLLACRFLCGVWSSSGLCLVGGSIADMFPPETRGRAIAFFAYA
                     PYCGPVFGPLVNGFISVATNRMDLIFWVNMAFAGVMWIIVALIPETFAPVILKRRAAR
                     LRKETGNPKIMTEQEAQGLSVREMVQDCLLRPLYLAVTEPVLDLMCFYVCLIYSLLYA
                     FFFAYPVIFGELYGYKDNLIGLMLIPILIGASVALATTTFCENQYIKITRRRKPTPED
                     RLLGAMIGAPFAAIALWILGATAYKHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCY
                     AVYASSALATKVFLRSAGGAAFPLFTEQMYHKLGLHWASWLLAFISTAMVAIPFAFFH
                     WGKDLRAKLSKKNYAFSGME"
     gene            <181647..>182219
                     /locus_tag="KLTH0G02288g"
                     /db_xref="GeneID:8293400"
     mRNA            <181647..>182219
                     /locus_tag="KLTH0G02288g"
                     /product="KLTH0G02288p"
                     /transcript_id="XM_002555092.1"
                     /db_xref="GeneID:8293400"
     CDS             181647..182219
                     /locus_tag="KLTH0G02288g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G02288p"
                     /protein_id="XP_002555138.1"
                     /db_xref="GeneID:8293400"
                     /db_xref="UniProtKB/TrEMBL:C5DLP0"
                     /translation="MFRNQSLIPSCHTLGASGAVVPVLSPECGLPQPEMRKGSAGHAS
                     AGHSSSGSSGKGGSSSGSSGSSSGSSGSSSKGGSSSGSSGSSSKGGSSSGSSSSSNSG
                     SGGYYGGSSSGTYGGSSSGTYGGAAGGAAAGAAAGHAGTRGHHNSTSGSSQRNGAAVV
                     SPSWPRLLIFVFLLCSLTGVAPPATLDAHN"
     gene            <182450..>184267
                     /locus_tag="KLTH0G02310g"
                     /db_xref="GeneID:8293401"
     mRNA            <182450..>184267
                     /locus_tag="KLTH0G02310g"
                     /product="KLTH0G02310p"
                     /transcript_id="XM_002555093.1"
                     /db_xref="GeneID:8293401"
     CDS             182450..184267
                     /locus_tag="KLTH0G02310g"
                     /note="similar to uniprot|Q12374 Saccharomyces cerevisiae
                     YPR155C NCA2 Protein involved in regulation of
                     mitochondrial expression of subunits 6 (Atp6p) and 8
                     (Atp8p) of the Fo-F1 ATP synthase functions with Nca3p"
                     /codon_start=1
                     /product="KLTH0G02310p"
                     /protein_id="XP_002555139.1"
                     /db_xref="GeneID:8293401"
                     /db_xref="InterPro:IPR013946"
                     /db_xref="UniProtKB/TrEMBL:C5DLP1"
                     /translation="MFTDQFVLDAFEDIDAKLELALQQSSFVGQDHSSSNSDQLKKLQ
                     DQLWLVKNEVVALTASLRQRRVRLPNIKLLKSVLESLQEDAPSDFVAVSDNVEGPVRA
                     AIIQYVTVCLYYCVVQKSLDQLPLVHDTAQYYSEIHDSTRWSLLYALQVAPQRLVHEA
                     NAVKNDVSRSASWRAMGSLEARSIGTAWYHRLVEQCRKMVMVHNFQLVGVPRDAKKVV
                     SSLWALPLAAVRDEVGTRRQAADTLFNSTASRLGALMTQFPATRDTEARVALLSTFFN
                     HSRASSPGGSEKALLAVMPEVMTLAPASKIQAPGFLTRYWPTLLCSLAYGPSSAFALW
                     QSRDKILQFFQENVVDFCAGLIQNWIWTPLQQVWSTVRHDESQPSIAVASKGSLDSEF
                     SSLTRMVVQLVAENSDGHVNTDALAVQVENGDLTEFMQIYERQIHHPVKNILTGKLVR
                     SLLIQIQKTKVDASLALNGIDKLLSSQQLVFGVVAMSPALLIVYSIWTCIYRLSKLGR
                     IWSNVAQFRFRLMSSMNNIERLLNYNVSEIESSDKDLNTGLLALEVVSARRYGEKLVP
                     KKYRGQWTRDVGELVDPGLNNTARLNVVNRIYHVYGRYL"
     gene            complement(<184383..>185084)
                     /locus_tag="KLTH0G02332g"
                     /db_xref="GeneID:8293402"
     mRNA            complement(<184383..>185084)
                     /locus_tag="KLTH0G02332g"
                     /product="KLTH0G02332p"
                     /transcript_id="XM_002555094.1"
                     /db_xref="GeneID:8293402"
     CDS             complement(184383..185084)
                     /locus_tag="KLTH0G02332g"
                     /note="similar to uniprot|Q06449 Saccharomyces cerevisiae
                     YPR154W PIN3 Protein that induces appearance of [PIN ]
                     prion when overproduced"
                     /codon_start=1
                     /product="KLTH0G02332p"
                     /protein_id="XP_002555140.1"
                     /db_xref="GeneID:8293402"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DLP2"
                     /translation="MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDP
                     SRGPQQPSATQGEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGM
                     FPSNYVKPAFSGSTTTERPVVPPPPQYQSQQLVPQQTNASAQSAYSQPPFPPSSTNYY
                     QPPPQQYPQQYPQQQYYQAQQAPVAAPVAAPAAQQGHSSQASSAFKKFGGKLGNAAVF
                     GAGATIGSDIVNSIF"
     gene            complement(<185220..>185769)
                     /locus_tag="KLTH0G02354g"
                     /db_xref="GeneID:8293403"
     mRNA            complement(join(<185220..185343,185400..185693,
                     185765..>185769))
                     /locus_tag="KLTH0G02354g"
                     /product="KLTH0G02354p"
                     /transcript_id="XM_002555095.1"
                     /db_xref="GeneID:8293403"
     CDS             complement(join(185220..185343,185400..185693,
                     185765..185769))
                     /locus_tag="KLTH0G02354g"
                     /note="similar to uniprot|Q06HN0 Saccharomyces cerevisiae
                     YPR153W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G02354p"
                     /protein_id="XP_002555141.1"
                     /db_xref="GeneID:8293403"
                     /db_xref="UniProtKB/TrEMBL:C5DLP3"
                     /translation="MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWK
                     FTVFWTLILFMGFYTAAGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILA
                     VTYKAGLFEMSTWIPLCSAVVLILFHVSTTYSMAGIII"
     gene            complement(<185961..>186716)
                     /locus_tag="KLTH0G02376g"
                     /db_xref="GeneID:8293404"
     mRNA            complement(<185961..>186716)
                     /locus_tag="KLTH0G02376g"
                     /product="KLTH0G02376p"
                     /transcript_id="XM_002555096.1"
                     /db_xref="GeneID:8293404"
     CDS             complement(185961..186716)
                     /locus_tag="KLTH0G02376g"
                     /note="highly similar to uniprot|P23638 Saccharomyces
                     cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
                     the only nonessential 20S subunit"
                     /codon_start=1
                     /product="KLTH0G02376p"
                     /protein_id="XP_002555142.1"
                     /db_xref="GeneID:8293404"
                     /db_xref="GOA:C5DLP4"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DLP4"
                     /translation="MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGI
                     VLAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSY
                     NEEIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGW
                     KAISVGANTSAAQTLLQMDYKDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITK
                     LDNGKIAQKIFKPQEIETLLNKTGVTKKENDDE"
     gene            <186986..>188374
                     /locus_tag="KLTH0G02398g"
                     /db_xref="GeneID:8293405"
     mRNA            <186986..>188374
                     /locus_tag="KLTH0G02398g"
                     /product="KLTH0G02398p"
                     /transcript_id="XM_002555097.1"
                     /db_xref="GeneID:8293405"
     CDS             186986..188374
                     /locus_tag="KLTH0G02398g"
                     /note="similar to uniprot|Q06525 Saccharomyces cerevisiae
                     YPR152C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G02398p"
                     /protein_id="XP_002555143.1"
                     /db_xref="GeneID:8293405"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="UniProtKB/TrEMBL:C5DLP5"
                     /translation="MHPRKMPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSF
                     RSKSRRVDPGVTFVVPLSNDWVLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVD
                     KNKLVLLLATARGFDIGERDVYQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEP
                     SNATEEPSQAVRTLISAYESSDEDGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQY
                     NEATKQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVK
                     LEDVIEDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSE
                     QKQLFKQFKIKESLGKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFR
                     NIEQLESVLSQQDLPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTA
                     LKEFLKQLNSEV"
     gene            complement(<188767..>189636)
                     /locus_tag="KLTH0G02420g"
                     /db_xref="GeneID:8293406"
     mRNA            complement(<188767..>189636)
                     /locus_tag="KLTH0G02420g"
                     /product="KLTH0G02420p"
                     /transcript_id="XM_002555098.1"
                     /db_xref="GeneID:8293406"
     CDS             complement(188767..189636)
                     /locus_tag="KLTH0G02420g"
                     /note="similar to uniprot|P47137 Saccharomyces cerevisiae
                     YJR096W"
                     /codon_start=1
                     /product="KLTH0G02420p"
                     /protein_id="XP_002555144.1"
                     /db_xref="GeneID:8293406"
                     /db_xref="GOA:C5DLP6"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DLP6"
                     /translation="MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGY
                     RHVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESL
                     EMAKELEYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYS
                     WEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKE
                     SYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHF
                     LAQPGFDPIETED"
     gene            complement(<189819..>193160)
                     /locus_tag="KLTH0G02442g"
                     /db_xref="GeneID:8293407"
     mRNA            complement(<189819..>193160)
                     /locus_tag="KLTH0G02442g"
                     /product="KLTH0G02442p"
                     /transcript_id="XM_002555099.1"
                     /db_xref="GeneID:8293407"
     CDS             complement(189819..193160)
                     /locus_tag="KLTH0G02442g"
                     /note="similar to uniprot|P53280 Saccharomyces cerevisiae
                     YGR134W CAF130 Part of the evolutionarily- conserved
                     CCR4-NOT transcriptional regulatory complex involved in
                     controlling mRNA initiation elongation and degradation"
                     /codon_start=1
                     /product="KLTH0G02442p"
                     /protein_id="XP_002555145.1"
                     /db_xref="GeneID:8293407"
                     /db_xref="UniProtKB/TrEMBL:C5DLP7"
                     /translation="MVRKKRSAVISDPPRRPSALPAPAEPNGTPGSPVGQPSREPRAF
                     TDIDAQEKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRM
                     VKRWTSSTEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEVLVIDDEYN
                     LLLDFALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQD
                     ICYKYLSVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSD
                     HWPQKRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQ
                     FFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINELHIDWRFHVCFNLQKIV
                     QATLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYII
                     HKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGS
                     SALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALG
                     IELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKE
                     MRAYYKRCHCQFDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNTSKPMALRSQ
                     KDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQ
                     LLRVIATCVAKEQELTVLRSALLLGETPESENHSTLVADGDLTTDFVYEKWCENSMFE
                     KILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRGEKAAS
                     DGDYAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAIFFSKQLRESLGDGEDDEDQGDDE
                     KGSGISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDYIFELQTLLMSWICILPEARDLF
                     FALRSLVDEQSQNIKLESESIASACEPDSQSEPQLPQGTHAELEPEATHAVSIYNKKL
                     MSLLPPAAGTENSAITALRSFISKHSLTTKTALFGRRVISQDDTIMPMYMSDREMDNR
                     QFLAEFGIDYNDFVDGAYDSDFVYD"
     gene            <194153..>195133
                     /locus_tag="KLTH0G02464g"
                     /db_xref="GeneID:8293408"
     mRNA            <194153..>195133
                     /locus_tag="KLTH0G02464g"
                     /product="KLTH0G02464p"
                     /transcript_id="XM_002555100.1"
                     /db_xref="GeneID:8293408"
     CDS             194153..195133
                     /locus_tag="KLTH0G02464g"
                     /note="similar to uniprot|P53598 Saccharomyces cerevisiae
                     YOR142W LSC1 Alpha subunit of succinyl-CoA ligase which is
                     a mitochondrial enzyme of the TCA cycle that catalyzes the
                     nucleotide-dependent conversion of succinyl-CoA to
                     succinate"
                     /codon_start=1
                     /product="KLTH0G02464p"
                     /protein_id="XP_002555146.1"
                     /db_xref="GeneID:8293408"
                     /db_xref="GOA:C5DLP8"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:C5DLP8"
                     /translation="MLRTAASRRLASRCFSRETVPYDKTIGNLRLTKDTKVIIQGFTG
                     KQATFHAKLSQEYGTNIVGGTNPKKAGQTHLGQPVFATVAEAMKQTGATATGIFVPPP
                     IAAKAIREAIEAEIPLAVSITEGIPQHDMLYVAEMLKSQQKTRLVGPNCPGIISPEAR
                     VRIGIQPSRIFKPGKIGIVSKSGTLTYEAVQQTTITGLGQTLVIGMGGDAFPGTDFID
                     TLKYFMEDPATEGIVMLGEIGGKAEIEAAQFLKEFNLTRSNPMPVASFIAGAVAGQMK
                     GVRMGHSGAIVEGSGTDAESKKAALRDAGVAVVESPGHLGKALLDEFAKL"
     gene            complement(195831..195901)
                     /locus_tag="KLTH0G02486r"
                     /db_xref="GeneID:8293409"
     tRNA            complement(195831..195901)
                     /locus_tag="KLTH0G02486r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (CCC) cove score=62.22"
                     /db_xref="GeneID:8293409"
     gene            complement(<196658..>197587)
                     /locus_tag="KLTH0G02508g"
                     /db_xref="GeneID:8293410"
     mRNA            complement(<196658..>197587)
                     /locus_tag="KLTH0G02508g"
                     /product="KLTH0G02508p"
                     /transcript_id="XM_002555101.1"
                     /db_xref="GeneID:8293410"
     CDS             complement(196658..197587)
                     /locus_tag="KLTH0G02508g"
                     /note="similar to uniprot|P35202 YOR143C Saccharomyces
                     cerevisiae THI80 Thiamine pyrophosphokinase"
                     /codon_start=1
                     /product="KLTH0G02508p"
                     /protein_id="XP_002555147.1"
                     /db_xref="GeneID:8293410"
                     /db_xref="GOA:C5DLP9"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="UniProtKB/TrEMBL:C5DLP9"
                     /translation="MESVVENTEELQFQPPAYSHVLDLNGFLSPHQNDSALLILNQKI
                     MVTGVFEKLWRNYFLHVCADGGANRLYEYFDNDEDRSRHIPDYIVGDLDSVREDVLRF
                     YIQKGVAIIRQTSQYATDFTKSLQLISLHFFSSSFHKVTRSSGIDTNYGIEDCHGIHT
                     LYHSERKIWVDRDVDLLVLNAIDGRFDQTIHSITQLYATARTDAYYRLCYLTTTDLIM
                     LVPTGGALIKYSKKFKEECIKNCGLLPVGKPSVIRATRGLKWDVENWPTSIISGKVSS
                     SNRFVGDTCCFFDVEDPMVLNIELNLEKLSMFM"
     gene            <197769..>198761
                     /locus_tag="KLTH0G02530g"
                     /db_xref="GeneID:8293411"
     mRNA            <197769..>198761
                     /locus_tag="KLTH0G02530g"
                     /product="KLTH0G02530p"
                     /transcript_id="XM_002555102.1"
                     /db_xref="GeneID:8293411"
     CDS             197769..198761
                     /locus_tag="KLTH0G02530g"
                     /note="similar to uniprot|P06844 YDR392W Saccharomyces
                     cerevisiae SPT3 Subunit of the SAGA and SAGA-like
                     transcriptional regulatory complexes"
                     /codon_start=1
                     /product="KLTH0G02530p"
                     /protein_id="XP_002555148.1"
                     /db_xref="GeneID:8293411"
                     /db_xref="GOA:C5DLQ0"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ0"
                     /translation="MDKYKYRVEIQQMMFVSGENNDPPVETTCLIEDIVRGQVIEILL
                     QSNKTAHSRGSKSILPEDVIFLIRHDRAKVNRLRTYLSWKDLRKNAKDQDANAAAGGN
                     SGGGGDGPEGAVEEDDKKGDKDGGNMMRVKKSQIKLPWELQFMFNEQPLETNEDADDL
                     DEDEREANVATLKRLKMADDRTRDMTKEEYVHWSDCRQASFTFRKGKRFKDWSGITQL
                     TEGKPHDDVIDILGFLTFEIVCALTETALKFKKREELLQLKKDKSQKSQPDVVQDSTR
                     ERKKRLFDGPDNVVNPLKPKHVEDAWRALQTIDMKHRALTNFKGGRLSSRPAIM"
     gene            complement(<198794..>201187)
                     /locus_tag="KLTH0G02552g"
                     /db_xref="GeneID:8293412"
     mRNA            complement(<198794..>201187)
                     /locus_tag="KLTH0G02552g"
                     /product="KLTH0G02552p"
                     /transcript_id="XM_002555103.1"
                     /db_xref="GeneID:8293412"
     CDS             complement(198794..201187)
                     /locus_tag="KLTH0G02552g"
                     /note="some similarities with uniprot|Q12050 Saccharomyces
                     cerevisiae YOR144C ELG1 Protein required for S phase
                     progression and telomere homeostasis"
                     /codon_start=1
                     /product="KLTH0G02552p"
                     /protein_id="XP_002555149.1"
                     /db_xref="GeneID:8293412"
                     /db_xref="GOA:C5DLQ1"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ1"
                     /translation="MTSPTPRKTVRLGTLLSGNRKPKIELASDLHSDVSTDDFLDSIE
                     TSGIIDYDNNWTTGDSSPLRIELNNQKISCATDDVHLPQREPPHRTSLPFVGDCEIIA
                     EPGTPKLTVKQILSGKSQPGLGNKKTQPSSKTSCSKSEDLEVIHISDSGKNRETHERI
                     MSGLTCTKKTSVKKLFDNFQKRNRNQEEYQEIDEVELVSTTPVKPLHEVSSLDSMETP
                     LPASQNVTDNTDYINARPLSLKKKNKSAPELVLNFDPHEYKSLNLSNKQSKTALQTLG
                     LEASGRRCSNKIWTEDFEPHDVENVILNDNLKRDVHSWLDKAFKKLRKKTTRNKLRKK
                     KVEADDEMDFFVVDDDLEEGDEQEEEFVPLMILSGEAVGKTTLLKSLMNSYSGQIFEI
                     NASGNRGKRDFLQSVLDFSTTHYVKDKGSKGLILFDDVDVLFRERDKLFWNAVEKLLI
                     KARRPVVLICRDINYIPLNILQVAQEENSLFQAKAIDFPKAVDQLQQFLTSRGLLWPR
                     EFLEHIIKLNMCDIRKCLMELQWMSLSDHTSERTVEPVVPPQDIASALFSSTLLSEQD
                     VILRGIQWKSNLEQDRDSTVYFASKSKDFVSFSDEQKLAFDYMVDYKQHLHDSLKRPL
                     MPFEMDVTEYLRSRVFDPNEQQECGNHIFQKAAMETIHYLKSRVSETASFNEDHGGNA
                     RMTRNSRKVKEIMDRFSENGDHVRSSFNDYFMNLTSVMTRSQICQDVIPLVCEVAKHD
                     KARKAQNRLIYQNAMTGVPPENEREVVIRLLQEHAFYPIWFKGEPDLLLSAWSFRPL"
     gene            complement(<201390..>202205)
                     /locus_tag="KLTH0G02574g"
                     /db_xref="GeneID:8293413"
     mRNA            complement(<201390..>202205)
                     /locus_tag="KLTH0G02574g"
                     /product="KLTH0G02574p"
                     /transcript_id="XM_002555104.1"
                     /db_xref="GeneID:8293413"
     CDS             complement(201390..202205)
                     /locus_tag="KLTH0G02574g"
                     /note="similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
                     YOR145C PNO1 Partner of Nob1 Protein required for cell
                     viability"
                     /codon_start=1
                     /product="KLTH0G02574p"
                     /protein_id="XP_002555150.1"
                     /db_xref="GeneID:8293413"
                     /db_xref="GOA:C5DLQ2"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ2"
                     /translation="MVAPTALKKAQNDTAGSNTAGSTNSRIFGLENTQQIDEDDDDEV
                     LVDAQEASEGAAAPEDKTVESNSVVLDEQGKPRFASAAASGEMKVKPESRKVPVPPHR
                     MTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKAFT
                     LGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR
                     TRIVLADSKIHILGGFTHIRMARESVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <202425..>204206
                     /locus_tag="KLTH0G02596g"
                     /db_xref="GeneID:8293414"
     mRNA            <202425..>204206
                     /locus_tag="KLTH0G02596g"
                     /product="KLTH0G02596p"
                     /transcript_id="XM_002555105.1"
                     /db_xref="GeneID:8293414"
     CDS             202425..204206
                     /locus_tag="KLTH0G02596g"
                     /note="similar to uniprot|Q12171 Saccharomyces cerevisiae
                     YOR147W MDM32 Mitochondrial Distribution and Morphology"
                     /codon_start=1
                     /product="KLTH0G02596p"
                     /protein_id="XP_002555151.1"
                     /db_xref="GeneID:8293414"
                     /db_xref="GOA:C5DLQ3"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ3"
                     /translation="MISNARRHLRVLSTRPNVSRTCVYGLCGLNKYYNLRPQAKLCVT
                     NRLYSTKKDLNELSKNTDFLHTQNILLQKNQQRLTKQKLLSEATNFFERFTIKTKWFL
                     IRGNRPFSTDELSTIFSWLVISQILWVVLGTTTFVSLLLFTFNTVFAKEMVGKFVGNL
                     LNDYVDDCDIQFRDALVPEWRRGCISFKQVKLKSSSPSQGEGLRKEDSSEALSFSLDF
                     NQIDITLSFTKWFRGHGLINDLTLYGMKGEVALGQGVDQDLLISWFSNPRYHLGKVKV
                     RDSCINVLDRNLNQNYRMSIYNMDLPQLRFKWALIDFFNANVVTGAINHSLFSVHKRQ
                     HKLAYLQDFEHDLSPWKRITRLRLDEISVKDLGLDKSNSFNWVEDGQVEIIADVMLPD
                     IPEDEDYDYDENRYIVMDMKFKFKDLMARYPSEEPKLSNGDALATLDELRPLIAFVNT
                     QRGLFHSFMDIQNTNSIWNNIANVSIKKNKSYPDTTVIPSNVKWPEYEDPNRPGQEII
                     KYHDQPVHNNNEIVLRSRIVKNIDELKDLVLFRETGIYDTLSMELHVDLMRMVEEWEH
                     RKKNDWKRVWGTTVASQLMILGLGAMV"
     gene            complement(<204285..>204941)
                     /locus_tag="KLTH0G02618g"
                     /db_xref="GeneID:8293415"
     mRNA            complement(<204285..>204941)
                     /locus_tag="KLTH0G02618g"
                     /product="KLTH0G02618p"
                     /transcript_id="XM_002555106.1"
                     /db_xref="GeneID:8293415"
     CDS             complement(204285..204941)
                     /locus_tag="KLTH0G02618g"
                     /note="some similarities with uniprot|Q02521 Saccharomyces
                     cerevisiae YOR148C SPP2 Required for final stages of
                     splicesome maturation promotes step 1 of splicing
                     spliceosome-associated protein"
                     /codon_start=1
                     /product="KLTH0G02618p"
                     /protein_id="XP_002555152.1"
                     /db_xref="GeneID:8293415"
                     /db_xref="InterPro:IPR026822"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ4"
                     /translation="MVGFSINLKAGKVSKKTASSEKKKKRANIFNDADANKVPKSKIR
                     ITHIDEHQNSAEPQLVIKPPPANKGWNVPIVDENGRDEESLGYGLNQSTSGARDLRRQ
                     HNREALALSRKPNSVVHLPTETAQEEYETVPVEEFGDALLRGMGWNGELENEVVAKSA
                     GKSKPVLPHEQFRPSLLGLGAKASQNTVSEGINKSEPFLPIIKVSRRRGKPIEEQQLT
                     "
     gene            <205070..>206398
                     /locus_tag="KLTH0G02640g"
                     /db_xref="GeneID:8293416"
     mRNA            <205070..>206398
                     /locus_tag="KLTH0G02640g"
                     /product="KLTH0G02640p"
                     /transcript_id="XM_002555107.1"
                     /db_xref="GeneID:8293416"
     CDS             205070..206398
                     /locus_tag="KLTH0G02640g"
                     /note="similar to uniprot|Q04172 YDR393W Saccharomyces
                     cerevisiae SHE9 Mitochondrial inner membrane protein
                     required for normal mitochondrial morphology"
                     /codon_start=1
                     /product="KLTH0G02640p"
                     /protein_id="XP_002555153.1"
                     /db_xref="GeneID:8293416"
                     /db_xref="InterPro:IPR008839"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ5"
                     /translation="MLVRRLILLYPRRLPRQITSIRLNSTLPEGSKKKHDKVAKDSNF
                     PALEPAWSEVRAKIASANAQAKHYTGQFKNQIDKAKAAIQEANRKLAEEDRSASDSRL
                     GFDTDVETKGRIEGLPSARERSRMQWAKKLEFYLDSLQETIFTATKALNDVTGYSSIQ
                     KLRKSIELMEKDLEKRKEEVRVAKTTFNEAIVARAESQREVNELLQRKNSWSPADLER
                     FTHLYTDDTLNLKKEEDAKRTLQSAESQEEALSNNLYRAILTRYHEEQIWSDKIRRTS
                     TWGTFLLMGMNIFLFLVFQLLLEPWKRRRLVGNFEDKVKKALDEQALVQNNRLNEMSD
                     HISTTFDKKNAAPEPIVPATSRDTAEFMELSPKEPDALVPIKWKSWPEISYVFKQNFR
                     ILRNWTHRFFQKLLFIKKTNLNSTTTFTTAELYVYSALVGIAGYLTCAWI"
     gene            <206550..>207827
                     /locus_tag="KLTH0G02662g"
                     /db_xref="GeneID:8293417"
     mRNA            <206550..>207827
                     /locus_tag="KLTH0G02662g"
                     /product="KLTH0G02662p"
                     /transcript_id="XM_002555108.1"
                     /db_xref="GeneID:8293417"
     CDS             206550..207827
                     /locus_tag="KLTH0G02662g"
                     /note="highly similar to uniprot|P33298 Saccharomyces
                     cerevisiae YDR394W RPT3 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates substrate of
                     N-acetyltransferase B"
                     /codon_start=1
                     /product="KLTH0G02662p"
                     /protein_id="XP_002555154.1"
                     /db_xref="GeneID:8293417"
                     /db_xref="GOA:C5DLQ6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ6"
                     /translation="MEELGILSTPTSGSGETAPIGSYGSLVAQLNSNAGSAINGSSDN
                     YFRLKKLEKELELLNLQEDYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEPIDE
                     NTGIVSSTTGMSYVVKILSTLDRELLKPSTSVALHRHSNALVDILPPDSDSSISIMSA
                     NEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGVLLYGPPGTGKTM
                     LVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIAT
                     KRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALLRPGRLDRK
                     IEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLSGALIAAIMQEAGLRAV
                     RKNRYVILQSDLEEAYASQVKSSSDVDKFEFYK"
     gene            complement(<207890..>209416)
                     /locus_tag="KLTH0G02684g"
                     /db_xref="GeneID:8293418"
     mRNA            complement(<207890..>209416)
                     /locus_tag="KLTH0G02684g"
                     /product="KLTH0G02684p"
                     /transcript_id="XM_002555109.1"
                     /db_xref="GeneID:8293418"
     CDS             complement(207890..209416)
                     /locus_tag="KLTH0G02684g"
                     /note="similar to uniprot|Q04174 Saccharomyces cerevisiae
                     YOR149C SMP3 Protein involved in glycosyl phosphatidyl
                     inositol synthesis most likely an alpha 1 2
                     mannosyltransferase utilized for addition of the fourth
                     side-branching mannose onto the GPI core structure"
                     /codon_start=1
                     /product="KLTH0G02684p"
                     /protein_id="XP_002555155.1"
                     /db_xref="GeneID:8293418"
                     /db_xref="GOA:C5DLQ7"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ7"
                     /translation="MRLKTWHVLGYLFGLIVALEPSYIHPDEHFQSLEVMMIKIMGIK
                     GTIPWEFKPESAARSFVPLYITYGPLLYLNKYILHLSSGVALMYLVRIQNYIVFMYLS
                     KLALQFLLDSKLDRKKASFYISTSYIIWAYQTHSFSNSLESIILLLVLSLFRILIKDS
                     SDRSFNHYKTCVVLGILVTLGVFNRITFLAFILLPCVPTFHLFYSKHLKSLCVSAISF
                     ICSCLLFVFLDKTIYGSDDWCVTPLNNLLYNLQDANLAQHGLHPRYTHVLVNVPQMLG
                     PIMVFFVSKKQKINLALLSCISGLLILSLFRHQELRFLVPLFPLFCISIDLEKLNTFP
                     YPKLIAKTWVAFNIVFGIIMGSLHQRGVVTAIQRLAEKQEHVDVHLWWKTYSPPTWLY
                     MNNNLTVSTTNFVNSAERLDNVDFGITVDHVVDLKGCDYELFEFGLMSFLNSTSHGIC
                     LIIPKSTDKGVQKFRTKHEDVRFQVLWETPFSLDLDHIDFTDLSTLQPGMTIYQIDRL
                     "
     gene            <209656..>212508
                     /locus_tag="KLTH0G02706g"
                     /db_xref="GeneID:8293419"
     mRNA            <209656..>212508
                     /locus_tag="KLTH0G02706g"
                     /product="KLTH0G02706p"
                     /transcript_id="XM_002555110.1"
                     /db_xref="GeneID:8293419"
     CDS             209656..212508
                     /locus_tag="KLTH0G02706g"
                     /note="similar to uniprot|Q04175 Saccharomyces cerevisiae
                     YDR395W SXM1 Nuclear protein; has similarity to Cse1p
                     homologs including Nmd5p, Cse1p,Lph2p, and the human
                     cellular apoptosis susceptibility protein, CAS1; also has
                     similarity to the karyopherin Kap95p"
                     /codon_start=1
                     /product="KLTH0G02706p"
                     /protein_id="XP_002555156.1"
                     /db_xref="GeneID:8293419"
                     /db_xref="GOA:C5DLQ8"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ8"
                     /translation="MLDQNAILSAFNRTMASDAVAIKQAEQELFQMQKEPGFTAFLLN
                     AATDESIPLNVRISCAIYMKNKIQRCWSSKRDDAILPQEQSVLKDTLIQSLIRNSENS
                     HIKPYLTESVRGILENNEKWDLILPINELLSSNDPKFVYPGLLLLFEVCIHHRWEMPD
                     NRGYIDEVIMRVFPVVERIASQLIQENDYRSNELLYLILKSFKYACLNNFPRYFTNTE
                     KLQSWIRLHLFLCSKPLPQEVLNLEPADRSLDKRVKCNKWAFGNLSRFLMKYSRTTKT
                     VTKEFVGYIFDQIVPTILGEYFKTIESWGSGSLWLSDASLYYMIEFLEKCMTTDSLWS
                     LIQPHLESIITYVIFPCLSADEESVTLFEDDPEEYTRRYFDVNKEGTTADVASTDFIF
                     VIGHKRFEEVSKILPLINSVFNEFAEKKDLPSAYREEGALRLLSSLCGFLAENDSPVK
                     NELEGIFEHYVLPLLTQQKYPFLIARALETIAIHQQAFIDMNVLSKIYEAVYVNFMNS
                     EYLPIQVEASDALKTLVVSNPSIHPHISSQVPGIMEKLLKLSKEFEIDILSEVMESFV
                     ERFADELTPFAQDLAANLAEQFVMLGQSIVESSSGNYSTADQDQEIQASALLQTMTTM
                     VMSMNKVSLVDKFMPVVKFILVHAQITFLSEAVDLMDSLALSSKAMFNKFTPEIWEML
                     HDVLDSCQTYALEYFESFQVFFETVVTYGFPTDNTYAPAFLEVLSHAMGSEVDFDVES
                     AFDILLFYVLAMKENPLFEKALTVAGNEDTELELDDALIVKLFLAGLFTTPLETLQIC
                     EQQGVTLDLLQKWFSCNFSSVFTIKLQLVAIISVLGLPELPSCVSGFIPQLSDKLVSL
                     TASLPDAIRKRDAVSKGELGGSSFDGEDGTDFFEELEDDFKESCLDDISCFQQVHVLF
                     SQLQSGNPGLYQQITGSLSDDKLDTLKTILEFVAHN"
     gene            complement(<212646..>213140)
                     /locus_tag="KLTH0G02728g"
                     /db_xref="GeneID:8293420"
     mRNA            complement(<212646..>213140)
                     /locus_tag="KLTH0G02728g"
                     /product="KLTH0G02728p"
                     /transcript_id="XM_002555111.1"
                     /db_xref="GeneID:8293420"
     CDS             complement(212646..213140)
                     /locus_tag="KLTH0G02728g"
                     /note="highly similar to uniprot|Q04176 Saccharomyces
                     cerevisiae YDR397C NCB2 Beta subunit of the NC2 dimeric
                     histone-fold complex represses RNA polymerase II
                     transcription through binding to TBP and inhibition of
                     TFIIA and TFIIB homologous to the Dr1 subunit of the
                     mammalian NC2 (negative cofactor2)"
                     /codon_start=1
                     /product="KLTH0G02728p"
                     /protein_id="XP_002555157.1"
                     /db_xref="GeneID:8293420"
                     /db_xref="GOA:C5DLQ9"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DLQ9"
                     /translation="MGEQEDISLPKATVQKIISEVLESDLTFSKEAREIIIESGIEFI
                     MILSSMASEMADKEAKKTIAPDHVIKALEELEYHEFIPYLEQILVEHKETQRIKERRD
                     AKFKKSGLSEEELLRQQEELFRQSRNRFQQTSTTPGDGAEGAESLEAEADSSRSESVK
                     AEEL"
     gene            <214405..>214860
                     /locus_tag="KLTH0G02750g"
                     /db_xref="GeneID:8293421"
     mRNA            <214405..>214860
                     /locus_tag="KLTH0G02750g"
                     /product="KLTH0G02750p"
                     /transcript_id="XM_002555112.1"
                     /db_xref="GeneID:8293421"
     CDS             214405..214860
                     /locus_tag="KLTH0G02750g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G02750p"
                     /protein_id="XP_002555158.1"
                     /db_xref="GeneID:8293421"
                     /db_xref="UniProtKB/TrEMBL:C5DLR0"
                     /translation="MLRDMLRARPNAVCAWGGSLFFAAAHRSARKFWLVRRRSRTPVE
                     THTLGKAQRPGSGAGLCQRCATRMSIHTGGRSSMREWRESLVAKAPVAPRLCSATRFP
                     ASWIRPLDVRLSLGAPLACCRTSLCTTEPSPPHRKIFQNFNAMQFENLR"
     gene            <214898..>216805
                     /locus_tag="KLTH0G02772g"
                     /db_xref="GeneID:8293422"
     mRNA            <214898..>216805
                     /locus_tag="KLTH0G02772g"
                     /product="KLTH0G02772p"
                     /transcript_id="XM_002555113.1"
                     /db_xref="GeneID:8293422"
     CDS             214898..216805
                     /locus_tag="KLTH0G02772g"
                     /note="similar to uniprot|Q04177 Saccharomyces cerevisiae
                     YDR398W UTP5 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="KLTH0G02772p"
                     /protein_id="XP_002555159.1"
                     /db_xref="GeneID:8293422"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DLR1"
                     /translation="MSESPVVLSQYDPSGQFLAYVTVALDKHRVSVEPTNAGKANGLV
                     NENFLYLEDSQSRVTCLQWVHLASSDAQLVALGLNSGEVWLYAPSANQVVYKLSTGAL
                     HAIRDFQCKGQTAWCCDQSDTVYQFNMTEFTVAAKFKVEGCENLQKLCVVDEQHILLA
                     SHSISLVDVQSKLVVQTFPGHISAVSNLIMLNSSAFLTSATNDRFLNIYDLATGGTKS
                     VLVAQSDVLQLSHYNDSTVAVTTEDGTIEVFPDPLVNTSKKRRRTVSKQSTHLIKIQR
                     PESEERVAAMNVFITADTLNYAWLENATIPYFDQLQWAELPATHLITKSRPSATSKHA
                     NRTLHGEDVAAAKSYVEGNATVTSGDNFKHVHEAIAELERGGADASDSLADRMASSSL
                     GDDHAGSKRSKKRVTTGTLTVVLSQSLQSNDHSLLETVLNNRDEKIIKGTISRLQPSL
                     AVLLLERLAERIARQTNRQGPLNVWVKWCLIIHGGYLARMPNLMSSLASLHSTLRKRS
                     EILPRLQALETRLDFSLNQLDAYRASHVNLGEMSASAFGVGEDNEEEVEYCEELDDAG
                     LIEDGELDDDEDFSDSEDNQSDNDQRNGNFAEEDGIDGEGASEGELDDEHGYSDVEGD
                     DDSHPNGHKRV"
     gene            <217593..>218237
                     /locus_tag="KLTH0G02794g"
                     /db_xref="GeneID:8293423"
     mRNA            <217593..>218237
                     /locus_tag="KLTH0G02794g"
                     /product="KLTH0G02794p"
                     /transcript_id="XM_002555114.1"
                     /db_xref="GeneID:8293423"
     CDS             217593..218237
                     /locus_tag="KLTH0G02794g"
                     /note="highly similar to uniprot|Q04178 Saccharomyces
                     cerevisiae YDR399W HPT1 Dimeric hypoxanthine-guanine
                     phosphoribosyltransferase catalyzes the formation of both
                     inosine monophosphate and guanosine monophosphate
                     mutations in the human homolog HPRT1 can cause Lesch-Nyhan
                     syndrome and Kelley-Seegmiller syndrome"
                     /codon_start=1
                     /product="KLTH0G02794p"
                     /protein_id="XP_002555160.1"
                     /db_xref="GeneID:8293423"
                     /db_xref="GOA:C5DLR2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DLR2"
                     /translation="MSLEKQYISYNNVHQLCQEAAVKIKNFKPDLIIAIGGGGFIPAR
                     ILRTFLKEENVPTVRIFAIILSLYEDLASESSMEEKPGVTVNRTQWIDYEQCKLDLVG
                     KNVLIVDEVDDTRTTLHYALNELEKDAAEQAKAKGIDLEQQPEMKTNFGIFVLHDKVK
                     AKKADLPADLLNDENRYFAARKVPDTWYAYPWESKDIVYHTKMAIEQGNDVFLP"
     gene            complement(<219150..>220559)
                     /locus_tag="KLTH0G02816g"
                     /db_xref="GeneID:8293424"
     mRNA            complement(<219150..>220559)
                     /locus_tag="KLTH0G02816g"
                     /product="KLTH0G02816p"
                     /transcript_id="XM_002555115.1"
                     /db_xref="GeneID:8293424"
     CDS             complement(219150..220559)
                     /locus_tag="KLTH0G02816g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="KLTH0G02816p"
                     /protein_id="XP_002555161.1"
                     /db_xref="GeneID:8293424"
                     /db_xref="GOA:C5DLR3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DLR3"
                     /translation="MTSVNSSYNGSDEEKLEQTKVTENVNRIEVPDGGLRAWGVVAAY
                     FLFNISTWGANAGFSVYLAEYLKVGRFANAGALDYATIGGLAFGAGLFFAPAISYLVH
                     ITSAQLVIAVGIALQCAGLLLAAFSANLWELYLTQGVLISFGLAFISIPSITLVPQWF
                     RYKRNLAQGIASGGSGAGGIVFNLGMEKVMRARSVKWALIVQCILCTALSCIGLSLTR
                     TRLKHIWRGQKPKFWFFDREIIKSWGYWFVVLYVSMTMLGYVVLLYSMSAFTVSLGYS
                     QNQGSIVSCMISVGALVGRPFVGFSADRFGAVTVSIVAHLIVAIFSLAMWIPCRNFAT
                     ALIFSLIVGLFMGSIWSLIAPIIGRVVGLPKMGVCMGMIWTFLSAFGITAPIIGLVLR
                     DENNPTGNNFIRTAIFAGMMYFGSVVALWFLRALLIARDEIATEAKTGSDEGELHLQI
                     TFKSWAKGLFKLRNLPRQI"
     gene            <221833..>222288
                     /locus_tag="KLTH0G02838g"
                     /db_xref="GeneID:8293425"
     mRNA            <221833..>222288
                     /locus_tag="KLTH0G02838g"
                     /product="KLTH0G02838p"
                     /transcript_id="XM_002555116.1"
                     /db_xref="GeneID:8293425"
     CDS             221833..222288
                     /locus_tag="KLTH0G02838g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G02838p"
                     /protein_id="XP_002555162.1"
                     /db_xref="GeneID:8293425"
                     /db_xref="UniProtKB/TrEMBL:C5DLR4"
                     /translation="MTKHASLCINAKNTAISNGSPQATHWKPQPFKGIQVQTLLACML
                     DSGCRILHRAAQMFHIRFASILSASSTLFTILLPARPANASSLSGFRIPHAAVTLPVG
                     HFWLPVSLLCPFSFDLYAPMANFRKENLCILLDQVTERVKYFIRHVACF"
     gene            <222428..>223459
                     /locus_tag="KLTH0G02860g"
                     /db_xref="GeneID:8293426"
     mRNA            <222428..>223459
                     /locus_tag="KLTH0G02860g"
                     /product="KLTH0G02860p"
                     /transcript_id="XM_002555117.1"
                     /db_xref="GeneID:8293426"
     CDS             222428..223459
                     /locus_tag="KLTH0G02860g"
                     /note="similar to uniprot|Q04179 YDR400W Saccharomyces
                     cerevisiae URH1 uridine nucleosidase (uridine
                     ribohydrolase)"
                     /codon_start=1
                     /product="KLTH0G02860p"
                     /protein_id="XP_002555163.1"
                     /db_xref="GeneID:8293426"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:C5DLR5"
                     /translation="MTIDQTPSFDRIPIWLDCDPGHDDAVGVLMGAFLPQFELLGISA
                     SYGNAPPKKTAYNTLSLLTAMGKTRDIPVYAGAQKPWVREARYAPDIHGESGLDGTTL
                     LPIPDVPLCTDVSYLCAMEKAIEAHAGRISVVSTGSLTSVATLLDQRPHLKPKIKFIS
                     IMGGGIHQGNSNMNGTAEFNIWIDPQAANSLFRDPAVNHKCILVPLDLTHKAIATKSV
                     EERVLGDGSSNLRKLFYELFLFFAKTYENAQGFETGPPVHDPLTLMPLLQFYGLKSPR
                     DVGFVYKRLDLLVVEDESDQNLGQTKVLSEYSSESSRGAIVGFELNIDYFWGQFLSAL
                     DSASINSPL"
     gene            complement(<223474..>224994)
                     /locus_tag="KLTH0G02882g"
                     /db_xref="GeneID:8293427"
     mRNA            complement(<223474..>224994)
                     /locus_tag="KLTH0G02882g"
                     /product="KLTH0G02882p"
                     /transcript_id="XM_002555118.1"
                     /db_xref="GeneID:8293427"
     CDS             complement(223474..224994)
                     /locus_tag="KLTH0G02882g"
                     /note="similar to uniprot|P21595 Saccharomyces cerevisiae
                     YDR402C DIT2 Sporulation-specific enzyme required for
                     spore wall maturation involved in the production of a
                     soluble LL-dityrosine-containing precursor of the spore
                     wall homologous to cytochrome P-450s"
                     /codon_start=1
                     /product="KLTH0G02882p"
                     /protein_id="XP_002555164.1"
                     /db_xref="GeneID:8293427"
                     /db_xref="GOA:C5DLR6"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:C5DLR6"
                     /translation="MDLVILAFLFCLITFGILKIVLPPWNFPRNIPTIPFYVTFLATI
                     WDVDQEDIYEIYLREPLEKYGAVKLYFGSRWNIVVSRPELLAQVFKDEDTFAKSGNHK
                     KIPYGVIAAYTGENVISAHGAIWKTFRRAITPGLQIFDHTPMIKNAEIFCSLISKQLT
                     TSDSDNNEKIHLQSNEQPWELQEKKSGIVLMPELIQRLSLANISEVALGFDIETLTKE
                     NSELHVKLKNVKSHIFKSLYLNFPLLDKLPIPSRQRARRFVEDFRECLMEAVETNLLQ
                     NYTFEQTAFSSSDLIRSFNKEEISKKQLIDNVVIIMVAGHENPQLLLTTCFYMFAKNQ
                     KWQKLVREEVQGCAVENLSELPLLNSFIFECVRMYPPLSQIINRCTSKPCRLGRDIIL
                     PRDVYVGYNVLATGRQRSAWGKEAHRFIPERWGDNIDEIMKEWKHRKNTCAMSAFHGG
                     RRACLGEKLALMEVRIAMSAALKGFEWSLAPNWADKVTPAGPLCPAGLKVKFTELA"
     gene            <225923..>227479
                     /locus_tag="KLTH0G02904g"
                     /db_xref="GeneID:8293428"
     mRNA            <225923..>227479
                     /locus_tag="KLTH0G02904g"
                     /product="KLTH0G02904p"
                     /transcript_id="XM_002555119.1"
                     /db_xref="GeneID:8293428"
     CDS             225923..227479
                     /locus_tag="KLTH0G02904g"
                     /note="similar to uniprot|P21623 YDR403W Saccharomyces
                     cerevisiae DIT1 Sporulation-specific enzyme required for
                     spore wall maturation involved in the production of a
                     soluble LL-dityrosine-containing precursor"
                     /codon_start=1
                     /product="KLTH0G02904p"
                     /protein_id="XP_002555165.1"
                     /db_xref="GeneID:8293428"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="UniProtKB/TrEMBL:C5DLR7"
                     /translation="MKNTEDTSSDESATCYKTEDLSTYSKVLCLYTREPDSYQLYAIE
                     DKQSACFSQRWEKFLELLKHTVSREIGTSGISERTIEAEAAVEFTCLQGVPIKVTELR
                     RNDEGQTRGIITIIENENDFSHWMISHILEQTRMDLDEKPAVGHGKLYAEMFTDYFAQ
                     NLKNTTKNDQWGEGGREYFLEKTRYFTDRFLKIECILPAFPCKSSNIEKVHGVFPDKG
                     EELALRRLAAATQEVRKFYPPGMKIWIVSDGHVFSDCIGVDDDVVDEYTDRLHGFYQN
                     LAVPGNDAIGFAGLKELFFTGETVLDFDEEMVSDIELPHYTGSKICENSELSRRILMK
                     GFDTDDGSLRKQILIPGHPRLHLFRGFSKFMIDDLSHLAHFKNVSRKCFKKVVSKVAF
                     EMIKRNDAYSNLVELLFPHHMRFSIHAHTNSGPKFGVKIISGNQCRTVKSLESLDEPS
                     FEDLLHIPTPWHNCVIKLGDAYYLTKSKVVFEAITSGLYEGQWKEGGEQKNLGGHFVL
                     KKKMHVQKQM"
     gene            complement(<227702..>228217)
                     /locus_tag="KLTH0G02926g"
                     /db_xref="GeneID:8293429"
     mRNA            complement(<227702..>228217)
                     /locus_tag="KLTH0G02926g"
                     /product="KLTH0G02926p"
                     /transcript_id="XM_002555120.1"
                     /db_xref="GeneID:8293429"
     CDS             complement(227702..228217)
                     /locus_tag="KLTH0G02926g"
                     /note="highly similar to uniprot|P34087 Saccharomyces
                     cerevisiae YDR404C RPB7 RNA polymerase II subunit B16
                     forms two subunit dissociable complex with Rpb4p"
                     /codon_start=1
                     /product="KLTH0G02926p"
                     /protein_id="XP_002555166.1"
                     /db_xref="GeneID:8293429"
                     /db_xref="GOA:C5DLR8"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:C5DLR8"
                     /translation="MFFFKDLSLNITLHPSFFGPQMKQYLRTKLLQEVEGTCTGKFGY
                     ILCVLDCENVEIERGRILPGDGSAEFTVKYRAVVWKPFKGEVVDGVVSSCTNLGFEVD
                     VGPLSVFVSPFLMPEDLSYNSGSNPPSYQSSEQIITKGSRVRLKIVGARSEVNSIYAI
                     GSIKEDYLGVI"
     gene            <228482..>228964
                     /locus_tag="KLTH0G02948g"
                     /db_xref="GeneID:8293430"
     mRNA            <228482..>228964
                     /locus_tag="KLTH0G02948g"
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /transcript_id="XM_002555121.1"
                     /db_xref="GeneID:8293430"
     CDS             228482..228964
                     /locus_tag="KLTH0G02948g"
                     /note="highly similar to uniprot|Q12487 Saccharomyces
                     cerevisiae YOR150W MRPL23 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /protein_id="XP_002555167.1"
                     /db_xref="GeneID:8293430"
                     /db_xref="GOA:C5DLR9"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:C5DLR9"
                     /translation="MSQKLGHTGLAFARLWHHVDIAQDKRTLGRLASSIALTLIGKHK
                     PVYHPTQDCGDYVVVTNCQQLRVTGKKFEQKTYWSHSQKPGHLKLTTMQKMAENKGYG
                     EILKKAVSGMLPKNKLRKPRLERLKVFDGSEHPYTSNVTAFVDQQPKIAQQLKKLEAK
                     "
     gene            complement(<229131..>232793)
                     /locus_tag="KLTH0G02970g"
                     /db_xref="GeneID:8293431"
     mRNA            complement(<229131..>232793)
                     /locus_tag="KLTH0G02970g"
                     /product="KLTH0G02970p"
                     /transcript_id="XM_002555122.1"
                     /db_xref="GeneID:8293431"
     CDS             complement(229131..232793)
                     /locus_tag="KLTH0G02970g"
                     /note="highly similar to uniprot|P08518 Saccharomyces
                     cerevisiae YOR151C RPB2 RNA polymerase II second largest
                     subunit B150, part of central core"
                     /codon_start=1
                     /product="KLTH0G02970p"
                     /protein_id="XP_002555168.1"
                     /db_xref="GeneID:8293431"
                     /db_xref="GOA:C5DLS0"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:C5DLS0"
                     /translation="MSTEEFYEEDPYGYEDDEASITAEDSWTVISAFFREKGLVSQQL
                     DSFNQFINYTIQDSIVEDSTLILEQLAQHTTEADNISRKYEISFGKIYLAKPSMTESD
                     GVSHAMYPQEARLRNLTYASGLFVEIRKRTYEAVDIPGRDLKYEVIDEESEMSDESKI
                     FIGRVPIMLRSKYCLLDELTESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIV
                     QVFKKSAPSPISHIAEIRSALEKGSRFISTLQVKLYGREGSTNRTIKATLPYIKQDIP
                     IVIIFRALGIIPDGEILEHICYDVNDWQMLELLKPCVEEGFVIQDRETALDFIGRRGT
                     ALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDD
                     RDHFGKKRLDLAGPLLAQLFKTLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITA
                     GLKYALATGNWGEQKKAMTSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQ
                     LHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPLPIITFLNEWGMEPLEDYVP
                     HQSPDATRVFVNGVWHGIHRNPAKLVDTIRKLRRKGDVTSEVSIVRDIREKELKIFTD
                     AGRVYRPLFIVDENEETGVKELKLRKGHIRKLMMTEYQDIEGGFEEEDINYTWSSLLN
                     EGLVEYIDAEEEETILIAMQHEDLDPTIEAADPEEELDPAKRIKAIHHSSTFTHCEIH
                     PSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKP
                     LGTTRSMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYM
                     DQEKRIGMSITESFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGDDMIIGKTTPI
                     PPDAEELGQRTAFHSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQI
                     GDKFASRHGQKGTIGITYRREDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKV
                     AALSGNEGDASPFTDITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYY
                     QRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKER
                     LMEASDAFRVHICGVCGLMTVVAKLKHNQFECRGCKNKIDIYQIHIPYAAKLLFQELM
                     AMNIAPRLYTDRSRDF"
     gene            <232992..>233831
                     /locus_tag="KLTH0G02992g"
                     /db_xref="GeneID:8293432"
     mRNA            <232992..>233831
                     /locus_tag="KLTH0G02992g"
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /transcript_id="XM_002555123.1"
                     /db_xref="GeneID:8293432"
     CDS             232992..233831
                     /locus_tag="KLTH0G02992g"
                     /note="similar to uniprot|P32387 Saccharomyces cerevisiae
                     YDR405W MRP20 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /protein_id="XP_002555169.1"
                     /db_xref="GeneID:8293432"
                     /db_xref="GOA:C5DLS1"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:C5DLS1"
                     /translation="MKKRNGIFQEPFDEQRQKFKRTQRRSEVTEMPRLVRKWLNAVPT
                     AVKNNFKIRSFATVSEVRDTTTINVTATEPVKVSDKILNWSREAIAQGKPHFKVGGTP
                     VFFPKARVVLLRPNAKHTPFQAKFIVPKSFNKLDLRDYLFHVYGLRAMNVTTQLLHGK
                     YTRVNQVMPRYRSAQIKKMTIDMAEPFVWPAEPVDKEPWAATLVEDLQKYREEQTRIG
                     SDKFKPGTAFDGALGPYQPPPQPFVPKFLKRRITNSRRRAQARVSQLERLLKVDKFAQ
                     ASS"
     gene            complement(<233917..>234399)
                     /locus_tag="KLTH0G03014g"
                     /db_xref="GeneID:8293433"
     mRNA            complement(<233917..>234399)
                     /locus_tag="KLTH0G03014g"
                     /product="KLTH0G03014p"
                     /transcript_id="XM_002555124.1"
                     /db_xref="GeneID:8293433"
     CDS             complement(233917..234399)
                     /locus_tag="KLTH0G03014g"
                     /note="weakly similar to uniprot|Q99325 Saccharomyces
                     cerevisiae YOR152C"
                     /codon_start=1
                     /product="KLTH0G03014p"
                     /protein_id="XP_002555170.1"
                     /db_xref="GeneID:8293433"
                     /db_xref="UniProtKB/TrEMBL:C5DLS2"
                     /translation="MPNPIVYVFQALPLSNFVELAAWLVISRELLGRFCEMEAGRGGF
                     SGFERPAYGAEKSTWISYLQNMSSQANRDKYVFGKLTTFVLRAVEKWPLDIKILDTSF
                     QAVVAWIGRLGRRAQPSTESQSWAWTYQWFSASTSQPTAAGEEEYDLLEDVLRDFKKS
                     "
     gene            complement(<234881..>236179)
                     /locus_tag="KLTH0G03036g"
                     /db_xref="GeneID:8293434"
     mRNA            complement(<234881..>236179)
                     /locus_tag="KLTH0G03036g"
                     /product="KLTH0G03036p"
                     /transcript_id="XM_002555125.1"
                     /db_xref="GeneID:8293434"
     CDS             complement(234881..236179)
                     /locus_tag="KLTH0G03036g"
                     /note="similar to uniprot|Q99312 YOR155C Saccharomyces
                     cerevisiae ISN1 Inosine 5'-monophosphate (IMP)-specific
                     5'-nucleotidase"
                     /codon_start=1
                     /product="KLTH0G03036p"
                     /protein_id="XP_002555171.1"
                     /db_xref="GeneID:8293434"
                     /db_xref="GOA:C5DLS3"
                     /db_xref="InterPro:IPR009453"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DLS3"
                     /translation="MPSRYRVEYQLKSHRKDELIEWIKGLLAVPFVLHSASHDPAARQ
                     ILRQRYAEVFVAVEALIDEQVSVGKLARQSEDREFLVGRTRLAQLVPSIGPFFTRLPL
                     RQAFLHEDHKRAISARTMVSPSFNDIRHILNSAQILQMRECHDVRLVTFDGDVTLYED
                     GGSLTATSKVVPFLLSLLRSGICVGIVTAAGYDEAQKYMERLFGLMTSLKDDTSISAD
                     FKRNLVVLGGESNYLFRYEPSQHELVSIENKAWIKPPMCHWSESDMTETLDLAESLLR
                     DFRTTLNLPEESTIIRKPRAVGIVPGNRWNPETKRTIRVKMDREQLEEMVLTLQHRLE
                     DFAPARRIQFSCFDGGSDVWCDIGGKDLGVAALQHYFDPYNPIKPCQTMHIGDQFAPM
                     GSANDFKARLSGCTLWISSPQETVEVLRCLTAGFDHYFQT"
     gene            <237157..>238761
                     /locus_tag="KLTH0G03058g"
                     /db_xref="GeneID:8293435"
     mRNA            <237157..>238761
                     /locus_tag="KLTH0G03058g"
                     /product="KLTH0G03058p"
                     /transcript_id="XM_002555126.1"
                     /db_xref="GeneID:8293435"
     CDS             237157..238761
                     /locus_tag="KLTH0G03058g"
                     /note="similar to uniprot|Q12412 YOR161C Saccharomyces
                     cerevisiae PNS1"
                     /codon_start=1
                     /product="KLTH0G03058p"
                     /protein_id="XP_002555172.1"
                     /db_xref="GeneID:8293435"
                     /db_xref="GOA:C5DLS4"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:C5DLS4"
                     /translation="MSEKYSRPAQPPPSYAPQQQQDQQQPEQQQQQPDQDYQFRQDQY
                     YNLNSKSDGAPIGSFEESFPTENDNKFRLNDWPFTIFFLLTVCGFIAIAGITLRAWAN
                     TYSLTGSGIYDGQNTGTLNTNSAVLLVFSCVIALIFSMLGLVLMRASPKWFIYCGMVF
                     NIISGLGTAIAYLSMRYWSAGIVFLVFTLITAWCYWGMRSRIPLSVAILKTVVDVMKR
                     LPQVYFISFLGSILASAFAMLFSAVIVATYMKYDPSQTNGTCAQGGGSCTKSKLIGIL
                     VLVFFCGYYISEVLRNVIHCTVSGVYGCWYYMSKSDQGMPRWPSFGSLKRALTVSFGS
                     ICFGSLIVSLIETAKTVFNLLRNGQITNVSDSAWAQCLFIVIDWIIGFLEWLARYFNH
                     YAYCFIALYGKPYLRAAKETWYMLREKGMDALINDNLINIALGFFSLFASYMAALFAF
                     LYLRFTSPSYNSGGGFNAPLMAFSFVIALQICNIANETVRSGTATFFVALGNDPEVFR
                     VSYPQRFDEIFRAYPDVLKKLSHQNV"
     gene            complement(<238995..>241895)
                     /locus_tag="KLTH0G03080g"
                     /db_xref="GeneID:8293436"
     mRNA            complement(<238995..>241895)
                     /locus_tag="KLTH0G03080g"
                     /product="KLTH0G03080p"
                     /transcript_id="XM_002555127.1"
                     /db_xref="GeneID:8293436"
     CDS             complement(238995..241895)
                     /locus_tag="KLTH0G03080g"
                     /note="similar to uniprot|Q99189 Saccharomyces cerevisiae
                     YOR160W MTR10 Nuclear import receptor mediates the nuclear
                     localization of proteins involved in mRNA- nucleus export"
                     /codon_start=1
                     /product="KLTH0G03080p"
                     /protein_id="XP_002555173.1"
                     /db_xref="GeneID:8293436"
                     /db_xref="GOA:C5DLS5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DLS5"
                     /translation="MSYNIGDIGTALQCITSSSEQETKKQALQFLEHFQKSPEAWNLC
                     HEALASNGGQISLELQVFSAQTLRNKVTYDLSQLDGHLFTFKDSLLQLITQHSQKLIV
                     TQLSVALARLAIQFLEWREPIAEIIGSLRQFPSKLLEFLKILPEETLDIKSTPLSEDE
                     FRSRTHELIDQIAGDVLQYLISAAESLRSGSTEVSVSQLLNCVNSWAYEIPIEELLSV
                     NTLMSLIFHALNQGEESDPEVFDVAVECMCTVLKETRDVPSEAVIKALYEQLVSMQTT
                     LLPVDQISDFEDYAEVMDGLTRVFVEAGEAWCIHIAKNPQIFKPLVSVLLLLTCKNTD
                     LDVVKYTFPFWFNLKQMLVLPRFKDQRAAYQDIFTELVDGIITHLHYPTGSFSSREEE
                     DKFRDFRYDMGGVLKDCTAVVGSATALSRPYEKITNALNEPNPLANWQNLEAPLFSLR
                     TMAQEISKNENVVLPQLFRLLCTLPEHPKVRYATTLVLGRYTEWTSKHPDFLEMELNY
                     IFNGFQHANGSIEILTASSHALMYFCQDCSSLLSGFVSQLIEFYWKIETMVESESLFE
                     VCQGLSCVIDRQTDDQVGASLELFLKPHLSKLVDAVSVWKANNNDKKATAEVCGKIDL
                     IFAIFEELKPRYETPEQGREPLQPYICTIWETLESLLVNQEAFNNPDVAEIAMKWVRK
                     VALNFHIFIAPILPSVANFLAQSYASTGFGVYLWCSGSIIAVFGDDESFPIDQQTKEA
                     VWEFTCTQCVTFMNNFTGIEATKLESYHEAIQDFFMMMTDVVMFFPDRFVTSDILLSP
                     VFSIGLNCVTKITNYDAYITIVRFLDDVLSWGFETPPISTATLDVVPEQWRQKILTEV
                     VQAQGSLLVRTLLIGLVTNFSSDAHPDAIGCLVKCLRLCQDCSANDPTVSLGWLNEAM
                     DTLGNVSAQERTNLVSTVGNALPQKDMRRVRTGLKDFVSWYTRKNVSPRLYK"
     gene            <243531..>243815
                     /locus_tag="KLTH0G03102g"
                     /db_xref="GeneID:8293437"
     mRNA            <243531..>243815
                     /locus_tag="KLTH0G03102g"
                     /product="KLTH0G03102p"
                     /transcript_id="XM_002555128.1"
                     /db_xref="GeneID:8293437"
     CDS             243531..243815
                     /locus_tag="KLTH0G03102g"
                     /note="similar to uniprot|Q12330 YOR159C Saccharomyces
                     cerevisiae SME1 Required for pre-mRNA splicing, cap
                     modification and U1 U2 U4 and U5 snRNA stability"
                     /codon_start=1
                     /product="KLTH0G03102p"
                     /protein_id="XP_002555174.1"
                     /db_xref="GeneID:8293437"
                     /db_xref="GOA:C5DLS6"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:C5DLS6"
                     /translation="MAPNNPKVTVPPINCIFNFLQQQTLVNFWLFEQVQTRIRGRISG
                     FDEFMNVVIDDASEIPIDTKTGSELPDQAVKLGRILLKGDNITLITPVSD"
     gene            complement(<243931..>244845)
                     /locus_tag="KLTH0G03124g"
                     /db_xref="GeneID:8293438"
     mRNA            complement(<243931..>244845)
                     /locus_tag="KLTH0G03124g"
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /transcript_id="XM_002555129.1"
                     /db_xref="GeneID:8293438"
     CDS             complement(243931..244845)
                     /locus_tag="KLTH0G03124g"
                     /note="similar to uniprot|P17558 Saccharomyces cerevisiae
                     YOR158W PET123 Mitochondrial ribosomal protein of the
                     small subunit PET123 exhibits genetic interactions with
                     PET122 which encodes a COX3 mRNA-specific translational
                     activator"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /protein_id="XP_002555175.1"
                     /db_xref="GeneID:8293438"
                     /db_xref="UniProtKB/TrEMBL:C5DLS7"
                     /translation="MGKGAAKFGFQSGLLPNARSILKNPTIKQTSIIEKVKAPKPKGP
                     HGVGYAKNIAHPKGSHRDSPDVKFIDVEELISKTVPEPQHTRIPKTVQQEARLHKAQL
                     RRSYLSESFRNEEKRLLHQEKMLQEKEAAHAEERQKELLALNESRSSDLTIPTMENTL
                     QGPLMRQRTPEEMKILDMKRKHNRDIQQFQAKERKLEKLLKLFHVTDHFIVTEDQLIK
                     KIDEVFANEASEALRTKLSVGSSRPRSRSEKDIGDALFGSLGGGEFVGLPTIKEYVSG
                     EMHTFANEVEDRNKQLLQQRKENLDTIL"
     gene            complement(<244963..>248622)
                     /locus_tag="KLTH0G03146g"
                     /db_xref="GeneID:8293439"
     mRNA            complement(<244963..>248622)
                     /locus_tag="KLTH0G03146g"
                     /product="KLTH0G03146p"
                     /transcript_id="XM_002555130.1"
                     /db_xref="GeneID:8293439"
     CDS             complement(244963..248622)
                     /locus_tag="KLTH0G03146g"
                     /note="similar to uniprot|Q04183 YDR407C Saccharomyces
                     cerevisiae TRS120 Component of the targeting complex
                     (TRAPP) involved in ER to Golgi membrane traffic"
                     /codon_start=1
                     /product="KLTH0G03146p"
                     /protein_id="XP_002555176.1"
                     /db_xref="GeneID:8293439"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:C5DLS8"
                     /translation="MKEYSLLGPAAVRTLVVPIGQWERKSFLKKVQLYQERFEARLVD
                     ITPLEDATFNPQGFPQGRLMFWFHTNMLNEEQMLFLHDFEPYRKTFVVVGLVNTLDQD
                     PQSSLEALQKRYPDSISHNLVYFGVSAPESKNVYCATSSNVETTVCDIGRNFLEALSL
                     YYSSYKHVTLRSPGAVGGASVTKTSLMRQPAAAPASAVSRVASMDTSSTSGLKRSGSI
                     KSLGLNATSADQQRAKARQCKILANFQLLAGRYVDSLNNFADAAFTLHKYHDYIWLGS
                     ALEGLIISMVLLSQLRVSFQIPAIVSLLCQIKDFEQLPQATSSQRNSLSSAPMQSPRN
                     SVSSMSSKVHTVDVQNVALPPLIKALSEKTLHYYEVSLSHNTEYAPQVVYCEHVLRIL
                     SYMTSYHYPRTSSKIPSQSDGIQTPRNSNPLWTQDSSADCFTKWEICQFSNKLFELQL
                     KEMDLVSQIKIYTSLACIYRDIGFHKKQSFVSRILLVSLLPQLESEAIFNFWKETEEE
                     TLKSLLGAYGIHRQPETLIEDAADCSWVTIQKNILLLCISMASKIYDKQKVCEYSLIL
                     LQRYSHVLTQSEQNSLLQNNILPAAGDTNILGYWDPFLLRNLQIIHLENRREVPQEKL
                     IGAEEPGETKQRHSQVFNPFKQNAINSVTDQKRVSETAKKFLLGETAELVLTFQNPFK
                     FNLEISHLSFDADDEKLVQFLKDSTIRELPFRVKANSMRSLHLPVTFLKETGGKTHLL
                     KRLNVGVLSLKPTSLNIVLAENFKNPEKHTTSRAKLGSFEFQVIAEQPEIEFMSSTLN
                     ENTCMILDGTKKTFEIVLRNQSLCRSANYLQFTHITNVEMNLKSDYWKNMSPDDLYDA
                     EYQLKWMQNNCIKIRNAPDTIPPNTSVTLSLDLDVTKASFQFSKFEIVLEYGYKPDGT
                     ARSIFTKTLRIPFDVTLKRSLEAPGLEVIPLIEHIRGEDGALISTDRINDKATSNHSA
                     KTGSALLLLDIRNSWYDGAKLRVHFEDYSSEEEILASTNTKRFVIPIKKYSFDHDWDH
                     KEIPKLVSGRQFVSSGMAQDEITIMRRKFWCREAILKGLKCDWKLQDASQTAGSLDFR
                     QFLDKFDARTVDILYTQRDSPFNVEISTQRSELRLGETLSICAKIGFNQKFPCSETKP
                     AKLEFLIYNRRTGKLLPRSNTSILYNGQLSKRIIPKYDSEVKIELVPIDKGDYEVGCC
                     LESVFNDVPVYFRVI"
     gene            <249621..>250412
                     /locus_tag="KLTH0G03168g"
                     /db_xref="GeneID:8293440"
     mRNA            <249621..>250412
                     /locus_tag="KLTH0G03168g"
                     /product="KLTH0G03168p"
                     /transcript_id="XM_002555131.1"
                     /db_xref="GeneID:8293440"
     CDS             249621..250412
                     /locus_tag="KLTH0G03168g"
                     /note="highly similar to uniprot|P25043 YOR157C
                     Saccharomyces cerevisiae PUP1 Endopeptidase with
                     trypsin-like activity that cleaves after basic residues"
                     /codon_start=1
                     /product="KLTH0G03168p"
                     /protein_id="XP_002555177.1"
                     /db_xref="GeneID:8293440"
                     /db_xref="GOA:C5DLS9"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DLS9"
                     /translation="MAGLSFDNYQRNQFLAERSKTVPQATSTGTTIVGVKYDGGVLIA
                     ADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEEVTKLIGSNLELHSMYASRE
                     PRVVSALQMLKQHLFKYQGHIGAYLIVAGADPTGTHLFSIHAHGSTDVGFYQSLGSGS
                     LAAMAVLEANWRPDLKKEEAMQLASDAIEAGIWNDLGSGSNVDLCIMETGKDAEYLRN
                     YRTPNVREAKQRSYKFPRGTTAVLSERVLDICQVEEETVDIELEA"
     gene            complement(<250460..>251125)
                     /locus_tag="KLTH0G03190g"
                     /db_xref="GeneID:8293441"
     mRNA            complement(<250460..>251125)
                     /locus_tag="KLTH0G03190g"
                     /product="KLTH0G03190p"
                     /transcript_id="XM_002555132.1"
                     /db_xref="GeneID:8293441"
     CDS             complement(250460..251125)
                     /locus_tag="KLTH0G03190g"
                     /note="similar to uniprot|P04161 YDR408C Saccharomyces
                     cerevisiae ADE8 Phosphoribosyl-glycinamide transformylase"
                     /codon_start=1
                     /product="KLTH0G03190p"
                     /protein_id="XP_002555178.1"
                     /db_xref="GeneID:8293441"
                     /db_xref="GOA:C5DLT0"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR004607"
                     /db_xref="UniProtKB/TrEMBL:C5DLT0"
                     /translation="MGARIVVLISGSGSNLQALIDAKARGALSGDIVRVISSSKKAYG
                     LERSSKHGIPTRVHSLYPYTKGIAKEDKSGRADARKNFEIDLASVVLEDKPDLIVCAG
                     WLLILGSEFLKRVNGVPIINLHPALPGAFDGTTHAIEMAWKKCQDEGAPLIAGCMVHF
                     VIEEVDRGEPVVIKELQLMPGEESLEKYEERVHAAEHVAIVEAVQKVLKANGESAGTE
                     KQH"
     gene            <251547..>254195
                     /locus_tag="KLTH0G03212g"
                     /db_xref="GeneID:8293442"
     mRNA            <251547..>254195
                     /locus_tag="KLTH0G03212g"
                     /product="KLTH0G03212p"
                     /transcript_id="XM_002555133.1"
                     /db_xref="GeneID:8293442"
     CDS             251547..254195
                     /locus_tag="KLTH0G03212g"
                     /note="weakly similar to Q04195 YDR409W uniprot|Q7LIJ4
                     Saccharomyces cerevisiae SIZ1 SUMO ligase that promotes
                     the attachment of sumo (Smt3p small ubiquitin-related
                     modifier) to proteins"
                     /codon_start=1
                     /product="KLTH0G03212p"
                     /protein_id="XP_002555179.1"
                     /db_xref="GeneID:8293442"
                     /db_xref="GOA:C5DLT1"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:C5DLT1"
                     /translation="MTASSGGLHQEIDFCVQEMEKLRVAELKAVSRAIGLSLSGRKAD
                     LQDRIRAYLKNSFRLGSIDPWRPKAILVLIDKAKLSDPLPTYESVWQSLRTGAFRHPV
                     ATGHQPPSALNPSAIEVHKPPPVPRAPKTRLALQFGESPFYKLRRMLNGSPKLAAKNN
                     GRGVCIYRFLLNQEESSILGKGPQFKLYLFSGILDPLENRGDAPIQFPHPNEIRFNDV
                     QVKDNVRGLKNKPGTAKPADLTPYLRPSGSENVLQLIYAFTKSDYLMYCYLVEVISPE
                     KILQEVLRHPKIVKPATLQYLKETLSEDEDEDLVTTSTVMTLQCPISYCRMRYPSKSV
                     YCQHLQCFDSLWFIESQQQIPTWHCPVCQKKIKIEDLALCEFVEEIIQQCDEEVEQVE
                     ISRDGTWKPVFEDDPPAPQQHSATEVKLENGHSLEGIVRPGSEDSDEEPISSRRRNLP
                     QNEPVVISLDSDDEEEEAPKAAPQPPGENQTPSQPGQELQERPGGRTAPSNSTLPHEN
                     TLANIYGTYMDINSGHEPQRSLDPKNANTTPSSARFNFNHGTPNNSETPNSSPFIQPH
                     HQIPNLLGKTPLNNNVNESYTSGHEQGQKSPSPTVSVQQSSSRVHPSFGEVNVPLLNA
                     HNQGPNIQSGHTPVRRHSENTSAYGQEVRLTYRPSSFANNTLPPPWQDVRGQQSLLGL
                     GGDTSQIHREARRSSTGSYNGENSLEGVQDHSRSPPLVARQPVINGAPIHNSPHSERG
                     ATSSAPPFSKPPAPAALASTGPLISSPRSQGQPPPLPPVPQSINRAESGQKPASASNA
                     RYRKPIVSPFIPKKPYVNMLPQKRQISSTSINKVAPTGHNAHSSQTRQPQLENEGVSV
                     SATSPPPLLAQSMANELDFIDLTSDE"
     gene            complement(<254257..>255051)
                     /locus_tag="KLTH0G03234g"
                     /db_xref="GeneID:8293443"
     mRNA            complement(<254257..>255051)
                     /locus_tag="KLTH0G03234g"
                     /product="KLTH0G03234p"
                     /transcript_id="XM_002555134.1"
                     /db_xref="GeneID:8293443"
     CDS             complement(254257..255051)
                     /locus_tag="KLTH0G03234g"
                     /note="similar to uniprot|P32584 Saccharomyces cerevisiae
                     YDR410C STE14 Farnesyl cysteine-carboxyl methyltransferase
                     mediates the carboxyl methylation step during C-terminal
                     CAAX motif processing of a-factor and RAS proteins in the
                     endoplasmic reticulum localizes to the ER membrane"
                     /codon_start=1
                     /product="KLTH0G03234p"
                     /protein_id="XP_002555180.1"
                     /db_xref="GeneID:8293443"
                     /db_xref="GOA:C5DLT2"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:C5DLT2"
                     /translation="MIEEDSGEPKSRRRSLPQDYDGDDVGDVGVIIKGQVYPYIEKNP
                     LDSISLTGFLLGGTVGLSIGLLPHSFFKNFNIYLVAVSVFHFLEFYTTAKYNPGKVTS
                     DSFLFNNGKAYTFSFVFAVSEALLESIFFDWKTRFSSWYHTTAAIIGLMLMLLGQYIR
                     TSAMITAGRSFSHQVKTSQNPDHVLITTGIYAQLRHPSYFGYFWWALGTQLWLMNPVS
                     FALFAYVLWKFFHSRINYEERYLNSFFGEEYTKYTQNVGVGIPFIS"
     gene            complement(<255316..>256092)
                     /locus_tag="KLTH0G03256g"
                     /db_xref="GeneID:8293444"
     mRNA            complement(<255316..>256092)
                     /locus_tag="KLTH0G03256g"
                     /product="KLTH0G03256p"
                     /transcript_id="XM_002555135.1"
                     /db_xref="GeneID:8293444"
     CDS             complement(255316..256092)
                     /locus_tag="KLTH0G03256g"
                     /note="similar to uniprot|Q03433 Saccharomyces cerevisiae
                     YML041C VPS71 Protein of unknown function component of the
                     Swr1p complex that incorporates Htz1p into chromatin
                     required for vacuolar protein sorting"
                     /codon_start=1
                     /product="KLTH0G03256p"
                     /protein_id="XP_002555181.1"
                     /db_xref="GeneID:8293444"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:C5DLT3"
                     /translation="MPFVEEINWKSYNPDVYFTSVNAAGPSGRNRITKTTAASGVRNN
                     KRVNYSLPDLEAKIYAQRNGSNSEASNSSAITTTSSALDRYTPEELLKSRKRFMELDT
                     ENVLDIKDVSYLMSSVTGISKDRIDSSSGSNSSGGASSNVNRSHRNKFELPKNMELMY
                     RSTKPPVPKKKNTNRVVALKKTLSSRRPLTSYLDALDQVNRSIIFNNVYNKKFFKVLP
                     VITICSICGGYNSISGCVRCGNKICSLRCFNLHNEARCTM"
     gene            256250..256323
                     /locus_tag="KLTH0G03278r"
                     /db_xref="GeneID:8293445"
     tRNA            256250..256323
                     /locus_tag="KLTH0G03278r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8293445"
     gene            complement(<256458..>258407)
                     /locus_tag="KLTH0G03300g"
                     /db_xref="GeneID:8293446"
     mRNA            complement(<256458..>258407)
                     /locus_tag="KLTH0G03300g"
                     /product="KLTH0G03300p"
                     /transcript_id="XM_002555136.1"
                     /db_xref="GeneID:8293446"
     CDS             complement(256458..258407)
                     /locus_tag="KLTH0G03300g"
                     /note="similar to uniprot|P32796 YML042W Saccharomyces
                     cerevisiae CAT2 Carnitine acetyl-CoA transferase present
                     in both mitochondria and peroxisomes"
                     /codon_start=1
                     /product="KLTH0G03300p"
                     /protein_id="XP_002555182.1"
                     /db_xref="GeneID:8293446"
                     /db_xref="GOA:C5DLT4"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:C5DLT4"
                     /translation="MREISRVVRRMVSTLQRFSFETRNGESYSALRPNSYYQKKRSTF
                     KGTTFSHQNQLPSLPVPVLEETLTKYLESVKPFCRDAEQFEEQERLCQDLVQKEGAKL
                     QERLVRYSEKSRNWLSEFWDNQAYLEYNDPVVPYVSYFYAHKPLPTSHAKIQTDPLIK
                     ATAIIVSVLKFLEAVKDEALPSEHSGNTLLCMNSFQMMFNNSRVPGDGRDSNVFYSLY
                     ENNFIVVAFKGNFYKVLTHNASGDVLGPADIWQQLYKITANLDGQVRDNNKVGIGSLT
                     SLPRDEWLRAHKELVTNPLSAQSMEAIYKSSFMVCLDLDTKPITLEEKSRYAWHGDGI
                     NRFYDKPLQFFVAGNGNSGFLAEHSKMDGTPTLHLNDYVCKQMHSLNVAEFLGQINCS
                     VAQNENKPQYLPFFVTPATRSHIEAAQVGFHKRIGEHHLKVWHYNKYGKNFMKNVGFS
                     PDAFLQQVIQLAIYKYFGKQLPTYEAASTRRFYKGRTETGRSVSTDSAKFVADWENPD
                     VADSQKVASLRSSAKAHSTYLKMASAGHGVDRHFFGLKNMIQPGENMPELFKNPLFIY
                     SSTWLVSTSQLSSEHFDGYGWSQVNDNGFGLAYMLNKDWMHINIVNKPNASGLSVSRL
                     HYYLTQAADEMFELLDSDRKHHSKL"
     gene            complement(<258857..>259906)
                     /locus_tag="KLTH0G03322g"
                     /db_xref="GeneID:8293447"
     mRNA            complement(<258857..>259906)
                     /locus_tag="KLTH0G03322g"
                     /product="KLTH0G03322p"
                     /transcript_id="XM_002555137.1"
                     /db_xref="GeneID:8293447"
     CDS             complement(258857..259906)
                     /locus_tag="KLTH0G03322g"
                     /note="similar to uniprot|Q7LIJ5 Saccharomyces cerevisiae
                     YDR411C DFM1"
                     /codon_start=1
                     /product="KLTH0G03322p"
                     /protein_id="XP_002555183.1"
                     /db_xref="GeneID:8293447"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:C5DLT5"
                     /translation="MISVVRLYLETTTSNRVLSNTSISSLLIARENHQTLQMAVPKKQ
                     SNSNELAQVVSQIPPVTRTLLAGVVAMTIVSSMGIVPREWLLFFLYPTFMKLQLWRMY
                     TSCFLLPMDKMAAVFWMYNLYSYSSHLENAHFYSKNNVDYLFLLWSLIGAIVVSVTAL
                     RLDLSYNLTNSFMGALACIWSIKNWNVTFMFYGLFPLKGKYDPLFQLFLAFVFENHPG
                     GFMLTLIGYCVGYLYVCLDTRTLGPLYGYIAGKTSSYGLADCGHFRAPWWFSAVCEFF
                     GKSKHKVNVIIDKTTSYQGQGHRLGSEKAAAADAARVAAARAERFKTTTVQTNHKTTA
                     SGFFPGKGQRVGSKD"
     gene            <260349..>261050
                     /locus_tag="KLTH0G03344g"
                     /db_xref="GeneID:8293448"
     mRNA            <260349..>261050
                     /locus_tag="KLTH0G03344g"
                     /product="KLTH0G03344p"
                     /transcript_id="XM_002555138.1"
                     /db_xref="GeneID:8293448"
     CDS             260349..261050
                     /locus_tag="KLTH0G03344g"
                     /note="similar to uniprot|Q04031 YDR412W Saccharomyces
                     cerevisiae RRP17 Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0G03344p"
                     /protein_id="XP_002555184.1"
                     /db_xref="GeneID:8293448"
                     /db_xref="InterPro:IPR019186"
                     /db_xref="UniProtKB/TrEMBL:C5DLT6"
                     /translation="MGPRTNRQILTQGKNYVAKQARKFGADEVNFDKDSRLEYLTGFH
                     KRKLERQKKAQDFIKEQDRLAKIEERKQMREQRRKEAEEQMRKFKETMKEVGDYIGSD
                     QEQEEDEQDGKDKEGVDGSASEESWNGFSDDDQENDVKPILKKTKQVYEDDTQVDIEP
                     LEPNENFEYLATLNNVKLEQSKKVLDDSIERAAKYAKFLGMDEKPKKKKKFRYLSKAE
                     RRQNQKKANDNKRRK"
     gene            complement(<261183..>262337)
                     /locus_tag="KLTH0G03366g"
                     /db_xref="GeneID:8293449"
     mRNA            complement(<261183..>262337)
                     /locus_tag="KLTH0G03366g"
                     /product="KLTH0G03366p"
                     /transcript_id="XM_002555139.1"
                     /db_xref="GeneID:8293449"
     CDS             complement(261183..262337)
                     /locus_tag="KLTH0G03366g"
                     /note="similar to uniprot|P16151 Saccharomyces cerevisiae
                     YDR414C ERD1 Predicted membrane protein required for the
                     retention of lumenal endoplasmic reticulum proteins
                     mutants secrete the endogenous ER protein BiP (Kar2p)"
                     /codon_start=1
                     /product="KLTH0G03366p"
                     /protein_id="XP_002555185.1"
                     /db_xref="GeneID:8293449"
                     /db_xref="GOA:C5DLT7"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:C5DLT7"
                     /translation="MVSKIADAPSGFLTLFPLPQRCILLIIVGMWLWLWQITIMHRFF
                     HIDVSQLVLSHDPHEALPQQSATRQTEATRRVVSRLTKIILPWCAATSVLLSECTKIQ
                     AYSPPVWAVCLLNIQSLCQFIFIFATICSYSPMVSRCLRKIMPLGNIEAKPLRLNYIL
                     ITDSLTSYSKPLIDFGFYLCHLVLDPLNEACIISRSPIGTAINLDLAIGSTPVLLRLL
                     QCLREWRRSKYAKDARSSLFNALKYSLHIPIVLCTVYSRSYPTAKPGNHIYWLMLVNS
                     SYSLWWDLTMDWELGIFDFSIHGMNRNEVLRRRKVFPNYMYYFAMCADFALRFVWLWE
                     LLAGRSVFEGEANIFFLQSLEILRRWIWIFIKLEAEAINSDLPEKNYNIE"
     gene            complement(262580..262711)
                     /gene="SNR53"
                     /locus_tag="KLTH0G03388r"
                     /db_xref="GeneID:8293450"
     ncRNA           complement(262580..262711)
                     /ncRNA_class="snoRNA"
                     /gene="SNR53"
                     /locus_tag="KLTH0G03388r"
                     /product="snR53"
                     /note="C/D snoRNA polycistronic Cluster 4 SNR53"
                     /transcript_id="XR_002432209.1"
                     /db_xref="GeneID:8293450"
     gene            complement(262809..262930)
                     /gene="SNR67"
                     /locus_tag="KLTH0G03410r"
                     /db_xref="GeneID:8294186"
     ncRNA           complement(262809..262930)
                     /ncRNA_class="snoRNA"
                     /gene="SNR67"
                     /locus_tag="KLTH0G03410r"
                     /product="snR67"
                     /note="C/D snoRNA polycistronic Cluster 4 SNR67"
                     /transcript_id="XR_002432210.1"
                     /db_xref="GeneID:8294186"
     gene            complement(<263388..>265202)
                     /locus_tag="KLTH0G03432g"
                     /db_xref="GeneID:8294192"
     mRNA            complement(<263388..>265202)
                     /locus_tag="KLTH0G03432g"
                     /product="KLTH0G03432p"
                     /transcript_id="XM_002555140.1"
                     /db_xref="GeneID:8294192"
     CDS             complement(263388..265202)
                     /locus_tag="KLTH0G03432g"
                     /note="similar to uniprot|Q04895 YIR028W Saccharomyces
                     cerevisiae YIR028W DAL4 Allantoin permease"
                     /codon_start=1
                     /product="KLTH0G03432p"
                     /protein_id="XP_002555186.1"
                     /db_xref="GeneID:8294192"
                     /db_xref="GOA:C5DLT8"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:C5DLT8"
                     /translation="MNQKSKTGDKSDAIISNSEQSSDVGQVHDKSENWWTRILTFLEV
                     QKSTREETIKETFLYNFDLRPVEKKRRVWSWFNFVYFWLADCFNINTWQVAATGLQLG
                     LNWWETWLTVWIGYAIPALLIVAIARIGSSYHVSFPIAARASFGVFFSLWPVINRVVM
                     AIVWYSVQTWIAASPISLMLKSIFGYNLPNRIPDHISTPNATTYEFMCFFIFWVCQLP
                     FVYVHPHQIRHLFTVKAALIPFAAFGFLIWALVKSDGKIALDSLVEGPQLTSSERGWA
                     FMRSVLVCIGNFAALIINAPDFSRFSKTKLSATWSQALSVPFFFSITSLIGIIVTSAA
                     YKLYSVNYWSPLDVLDRFLGDGFTRGERAGVFLISLIFAIAQLGTNISANSLSAGTDM
                     TALLPKYINIRRGGFICAALALCITPWNLMSSSNKFTSALSAYAIFLSCIAAVMVADY
                     YVVRRGKIEIQHLFCANKEVSIYMYGNRFGINWRALVAYVVGIAPNMPGFVSTVGDNI
                     HVSAGALRLYYLNYLVGFSISFVVYVGLCRFFPVPGAPVANCLQKSEWMELYPEVEYF
                     EEDREAFFADYSLGVVSSRLGEGDKGDITSAFAVRSQE"
     gene            complement(<266490..>268082)
                     /locus_tag="KLTH0G03454g"
                     /db_xref="GeneID:8293451"
     mRNA            complement(<266490..>268082)
                     /locus_tag="KLTH0G03454g"
                     /product="KLTH0G03454p"
                     /transcript_id="XM_002555141.1"
                     /db_xref="GeneID:8293451"
     CDS             complement(266490..268082)
                     /locus_tag="KLTH0G03454g"
                     /note="weakly similar to uniprot|P53918 Saccharomyces
                     cerevisiae YNL125C ESBP6"
                     /codon_start=1
                     /product="KLTH0G03454p"
                     /protein_id="XP_002555187.1"
                     /db_xref="GeneID:8293451"
                     /db_xref="GOA:C5DLT9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DLT9"
                     /translation="MSQDNRASSSLHNIDYNTEGIDTVTSSDCTLASSDNLQGDRTNE
                     KLSTQAETEAQILPTPLSSKELAEAAQSEEQGGLYASDEYVDPPPDGGYGWVCCACVA
                     VFNFATWGPNTSWGVFLSYFLSSHYFPDATPTDFALIGGLVIGLTLLLLPLASVCMNF
                     FGYKPTLTFAILLEAAAFVASSFAKSVGVLYVTYGVMLGISFGLIFGSSTIIIPGWFL
                     KKRALANGAGHFGVGLGGLVFSFAVRAMIDRTGDHRWAMRMLAAVTLFLNLISLCFVR
                     VRKTAFDQNRKSAGQILKAAFNVSVLKIKALHFCSLWSWLANVGYVILMFSMSNYATS
                     IGMTSQQATVALAVFNGSQAFGRPFMGWFAEAVGRCNATIIIMVYNLIILLPFWFTLT
                     KFRELIPFCIMLGFGAGVGAVNIVPLVADVVGIEKFAAGIGYGMFGNGAGSIFAEVIG
                     LHLRQPSSAKPYLHCQIFVACMYFAGLLCLLPYRELKVQRILTARARNEKYSEETRQR
                     YSRLLEPTFKCYIARTFLVAEA"
     gene            <269142..>270296
                     /locus_tag="KLTH0G03476g"
                     /db_xref="GeneID:8293452"
     mRNA            <269142..>270296
                     /locus_tag="KLTH0G03476g"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="XM_002555142.1"
                     /db_xref="GeneID:8293452"
     CDS             269142..270296
                     /locus_tag="KLTH0G03476g"
                     /note="similar to uniprot|P32611 YEL050C Saccharomyces
                     cerevisiae RML2 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="XP_002555188.1"
                     /db_xref="GeneID:8293452"
                     /db_xref="GOA:C5DLU0"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:C5DLU0"
                     /translation="MFLLRCLEAPTRRFPTCMSFLGTRTLSTSASFWQQEAKVSPTPV
                     TAQMLKIIPNETDLVALEKQDALIKRRRKLSKEITKLKKLKPVSPGLRWYRAPIYPYL
                     HTGRPVRALTVAKRSNGGRNHSGKITVRHRGGGHKRRIRMVDFTRFTPGEQVVQRIEY
                     DPGRSAHIALLKHSATGELSYILACDGLRAGDSVESYRKGVPENLLQEMGGKIDPAIL
                     SVRTAQRGNCLPISMIPVGAIIHNVGITPVGPGKFCRAAGAYARVIAKLQDKNRAIIR
                     LQSGEQRYVALEACATLGVVSNIDHQNLSLGKAGRSRWRGIRPTVRGVAMNKCDHPHG
                     GGRGKSKSKKLSVSPWGQLAKGYKTRRGKHQNRMKVKDRPRGKTGKALRQ"
     gene            complement(<271089..>271919)
                     /locus_tag="KLTH0G03498g"
                     /db_xref="GeneID:8293453"
     mRNA            complement(<271089..>271919)
                     /locus_tag="KLTH0G03498g"
                     /product="KLTH0G03498p"
                     /transcript_id="XM_002555143.1"
                     /db_xref="GeneID:8293453"
     CDS             complement(271089..271919)
                     /locus_tag="KLTH0G03498g"
                     /note="highly similar to uniprot|P32610 YEL051W
                     Saccharomyces cerevisiae VMA8 vacuolar ATPase V1 domain
                     subunit D"
                     /codon_start=1
                     /product="KLTH0G03498p"
                     /protein_id="XP_002555189.1"
                     /db_xref="GeneID:8293453"
                     /db_xref="GOA:C5DLU1"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="UniProtKB/TrEMBL:C5DLU1"
                     /translation="MSANREQVFPTRMTLGLMKAKLKGANQGYSLLKRKSEALTKRFR
                     DITRRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQENVSTARFRVKARQENVS
                     GVYLPQFESYIDEEINDFKLTGLGRGGQQVQRAKEIYSKAVETLVELASLQTAFVILD
                     EVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQQQTAELD
                     ALMKKAKAQRAQEDEASTTSKDASKKPDPKSSAKEPTDAPPSQEAPDLLAEQEDDVIF
                     "
     gene            <272176..>274626
                     /locus_tag="KLTH0G03520g"
                     /db_xref="GeneID:8293454"
     mRNA            <272176..>274626
                     /locus_tag="KLTH0G03520g"
                     /product="KLTH0G03520p"
                     /transcript_id="XM_002555144.1"
                     /db_xref="GeneID:8293454"
     CDS             272176..274626
                     /locus_tag="KLTH0G03520g"
                     /note="similar to uniprot|Q04048 Saccharomyces cerevisiae
                     YDR416W CLF1 sssential splicesome assembly factor"
                     /codon_start=1
                     /product="KLTH0G03520p"
                     /protein_id="XP_002555190.1"
                     /db_xref="GeneID:8293454"
                     /db_xref="GOA:C5DLU2"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DLU2"
                     /translation="MDTGSIARFVTSKEDIAYEYELQNDGDNLVVWKRYLEHKKAQEN
                     DSALAWIYERCCYQFPGSAEMWLEYMTWRISLLSGANSILYAEEFEKCNKLFEKAMYL
                     CHQSVDLWELYLRHVMAQRNLQLIRVLLNKALRHLHLEHHIRVWGMVVEFIENAVLDP
                     RVASEVEEDIDGLVSESFFKTDDQSGVADVWSSHILSRYLQVAEDLEHALYLLGLTQD
                     HTEIIKAYRRHIFDASFSPTTHTAFEFHCTYLQSLEKSSSHSEYIQAMSQCMKLFPEQ
                     KSLLIIRLAKYYIGKADLPAARSTLLDALASTVTSKSFSEIYEFLVKLLEAFAASSIQ
                     HAQIAASSEDREQLESDLAFNMDLLEYLIESHSLLLNDLKLRQNVNDVGTWLERAEFF
                     RSPAEKAKVYTDAITKIDHLKTTTPGSFGELWCCLAQLYTISGKLDSARETYDRGLRV
                     PYRSLKDLENIWCAWAEMELECGRIQASIKLLREALKVPKNAELVVDAFNTGNGAMPA
                     KAITFMSQRLWTLFIDLLESTSESSTGAEETVQAYEQLIALKLATPLNFINYSHFLQE
                     QGQWDQSFKIYERAISIFPGQTRFEIWSLYLQQSLDRKRPTETMRDLFEQALKVVEED
                     IDCPSLFIFCSDFEHSCGLEKRSIDILLRGCRECKSLSAKVTLWDACISSSKERLGAE
                     SSRPLYEECIKMLPNSKATSFALEFAKTEVVLGDYERARAVLRFGANLIHPDRNVQLW
                     DYWGEFELKYGDKSTYKEMLKLKRELASSMKVSTEAVSQRNGNIAFVSSNTQPKNSEA
                     PPTTAQKAENPEEIILDI"
     gene            complement(274759..274840)
                     /locus_tag="KLTH0G03542r"
                     /db_xref="GeneID:8293455"
     tRNA            complement(274759..274840)
                     /locus_tag="KLTH0G03542r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=80.04"
                     /db_xref="GeneID:8293455"
     repeat_region   complement(274900..275161)
                     /rpt_type=long_terminal_repeat
     gene            complement(<275721..>277586)
                     /locus_tag="KLTH0G03586g"
                     /db_xref="GeneID:8293457"
     mRNA            complement(<275721..>277586)
                     /locus_tag="KLTH0G03586g"
                     /product="KLTH0G03586p"
                     /transcript_id="XM_002555145.1"
                     /db_xref="GeneID:8293457"
     CDS             complement(275721..277586)
                     /locus_tag="KLTH0G03586g"
                     /note="similar to uniprot|Q04049 YDR419W Saccharomyces
                     cerevisiae RAD30 DNA polymerase eta involved in the
                     predominantly error-free bypass replication of DNA
                     lesions"
                     /codon_start=1
                     /product="KLTH0G03586p"
                     /protein_id="XP_002555191.1"
                     /db_xref="GeneID:8293457"
                     /db_xref="GOA:C5DLU3"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:C5DLU3"
                     /translation="MSRFKWRDLLDINSPKKAFSSPLACVAHIDVNAFFAQVEQIRCQ
                     YSRDDPVVCVQWNSIIAVSYAAKKFGISRMDTVFDAFKKCEGLMPVHTAVFKKGEDFW
                     QYHDDCGSWHTDESKKLSPELHKVSLDPYRRESRKILKIFSEWCDLVEKASVDEVFLD
                     LGRNVFSLLLIDESQKGFESIRTQFREGSYDLDDYLPGVPKDVEINIEAGDYNPQKRT
                     LYDDWDDVLFCLGSTITKKIRDQIEEVLGYTTSCGIARTKTVAKLASNFKKPNAQTIV
                     RNCNIEDFLDNESLELTSFWSMGGIFGKEVTQLLDLPSERSLKYIRDSWPVSSWELGA
                     HMREKIRKLNSGKEKLYSLDDAQVQQMADKIFQLARGDFKMPFNPRPVIKSMMSNKNL
                     PGNSCKHYVDCLAWLEVFSGDLIGRIKELEQEYERIIVPKTITVMTKTRNYERHTRRT
                     TLTVGGQVKSKDLMEFGTKLIRELESLYGGSDTYYPLTGIAMSLSNFEIHETGRTIVD
                     MFGRQTQVVRKSGEDFTKPEPQSHVSFTKSLRCEPCNIDFDDESLFKEHTDFHYALKL
                     SESLNGAQEDSKNLSLGERRLLFSGKKRPASSIKQNENKKNSQSKSGNIYKYFSK"
     gene            complement(<277904..>278785)
                     /locus_tag="KLTH0G03608g"
                     /db_xref="GeneID:8293458"
     mRNA            complement(<277904..>278785)
                     /locus_tag="KLTH0G03608g"
                     /product="KLTH0G03608p"
                     /transcript_id="XM_002555146.1"
                     /db_xref="GeneID:8293458"
     CDS             complement(277904..278785)
                     /locus_tag="KLTH0G03608g"
                     /note="some similarities with uniprot|P31787 Saccharomyces
                     cerevisiae YGR037C"
                     /codon_start=1
                     /product="KLTH0G03608p"
                     /protein_id="XP_002555192.1"
                     /db_xref="GeneID:8293458"
                     /db_xref="GOA:C5DLU4"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:C5DLU4"
                     /translation="MSADSVDQVFEKAISTIHTLSSLKGYNSLPRPPAEIRTELYALF
                     KQSTEGDVDLVLQRPTVGSDLPEYSVALRKWEAWRTKTGLSKTEAKKQYIQKLISTMR
                     SYATGTLAARELLADLEFLWSQVAHENVGDSEESNSMAMALQDDQQDYKSLRLRREIY
                     ETLFALNESKASSSRDLDVQNKRYKRDPDRGLPRFRKILRWVTIFVCRKLINLFKAMI
                     FQGTVLLAALVLAKRLNLSPLSIDLNIPRNKNFNTTSKGSRYKALSYIRNGLGAAFEY
                     VNRTLHLNLHHIYISVI"
     gene            complement(<279519..>280016)
                     /locus_tag="KLTH0G03630g"
                     /db_xref="GeneID:8293459"
     mRNA            complement(<279519..>280016)
                     /locus_tag="KLTH0G03630g"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_002555147.1"
                     /db_xref="GeneID:8293459"
     CDS             complement(279519..280016)
                     /locus_tag="KLTH0G03630g"
                     /note="highly similar to uniprot|P17079 YEL054C
                     Saccharomyces cerevisiae RPL12A and highly similar to
                     uniprot|P17079 Saccharomyces cerevisiae YDR418W
                     RPL12BProtein component of the large (60S) ribosomal
                     subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_002555193.1"
                     /db_xref="GeneID:8293459"
                     /db_xref="GOA:C5DLU5"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:C5DLU5"
                     /translation="MPPKFDPNEVKFLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKEFKGIKVTVQLRIQNRQATASVVPSASSLVITALKEPPRDRKKEKNVKHSG
                     NLQLEDIIEIAKQMKDKSFGKNLASVAKEILGTAQSVGCRVNYKNPHDIIEAIDAGEI
                     EIPEN"
     gene            complement(<280757..>282958)
                     /locus_tag="KLTH0G03652g"
                     /db_xref="GeneID:8293460"
     mRNA            complement(<280757..>282958)
                     /locus_tag="KLTH0G03652g"
                     /product="KLTH0G03652p"
                     /transcript_id="XM_002555148.1"
                     /db_xref="GeneID:8293460"
     CDS             complement(280757..282958)
                     /locus_tag="KLTH0G03652g"
                     /note="similar to uniprot|Q02197 Saccharomyces cerevisiae
                     YEL053C MAK10 Non-catalytic subunit of N- terminal
                     acetyltransferase of the NatC type required for
                     replication of dsRNA virus expression is glucose-
                     repressible"
                     /codon_start=1
                     /product="KLTH0G03652p"
                     /protein_id="XP_002555194.1"
                     /db_xref="GeneID:8293460"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:C5DLU6"
                     /translation="MKPESIIKDPSFDLFEGTHSLEIDNLKLDSSLLELSPEEKRFDC
                     STPYGGSEEEKLKFVTAVADRLCRSIMVWLAGFQTLPTTVLSCRYVEDAVRRYTDDPS
                     TDLSSCLLQTGNPLFDQVLTSCVVGSCFFVKFVSTLFKAGVVFEEEDLNCNTMGLNML
                     SMVPITTIREHMDRSIALLEAEYKHADQLVLILKLLRNLIEFQDYLPSKAEDLAAPNK
                     QPLLDLMQCAQKLKVYAPVAPEVCTGAFSPGIQKRLSNQFPPRDIVESAGEEYEAYVE
                     LCVDMLKVLAVTSARSASETLQFAFFFNRTRQRHVVARAFFPLYLMRDDQTVLGKYTF
                     NDFSKEHLLDFSLCGTNLAHELLDAPENSALVQKFNEFMQEVSGILFEWYQNTAQNRC
                     RYRQGYNRQLLLWDSLQAQIETFELELEAQGIKDELQDSSSFMPLTTWVFYMKLRAML
                     DFVLKGFELDVYKPWEFFSMFWYAYYLAQHLENCLQRTLGFIEKLITSIHNMNKKLKK
                     LKAGEKKEKLRAKYRWSMENDIPQLNANLKFVTYSLMECTAVKVLSLSQVFHFAVLQS
                     SGLIDSKPPGGNKFTSPEFIHKLRFKTFASIGVPELPSYQVFENSLKDFTIAEPMFTA
                     KLARSLAFTKSELEGAKAAIDTIVHAIHVGDGEPNLSVNTGTRLVKEQADAHYSALLR
                     TFEALVANGQSLQAKLGSVKDGSPAARYHVNVSRPDGASSYFPVLALSENQ"
     gene            <284125..>285540
                     /locus_tag="KLTH0G03674g"
                     /db_xref="GeneID:8293461"
     mRNA            <284125..>285540
                     /locus_tag="KLTH0G03674g"
                     /product="KLTH0G03674p"
                     /transcript_id="XM_002555149.1"
                     /db_xref="GeneID:8293461"
     CDS             284125..285540
                     /locus_tag="KLTH0G03674g"
                     /note="similar to uniprot|P32317 YEL052W Saccharomyces
                     cerevisiae AFG1 Putative ATPase of the CDC48/PAS1/SEC18
                     (AAA) family localized to mitochondria"
                     /codon_start=1
                     /product="KLTH0G03674p"
                     /protein_id="XP_002555195.1"
                     /db_xref="GeneID:8293461"
                     /db_xref="GOA:C5DLU7"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLU7"
                     /translation="MLRQACPNFLKVEGTRCFGLRFNSSLRTPLQEYERLVRAGRLSD
                     DPLQRGVISSLGGLHQSLVEYKPFKIKDPNPLAQVGWRNSKLGRLLLRPKYSTEGIPK
                     GIYLYGDVGCGKTMLMDLFYSTVPPHLTKRRMHFHQFMQYVHRRAHELLNELNLDALA
                     DAKHKDIDTIPFLATEIARQSRVLCFDEFQVTDVADAMILRRLLTALLSRKYGVVLFT
                     TSNRKPDDLYLNGIQRESFVPCIELLKERTEVVNLNSQTDYRKVSRPHSAVYYAPKNG
                     IAYMSQECQQARQQHVEQWYKFFSQMGPHGQATSTADTTAHETLTDFKLRVWGRELNV
                     PKCTPERVAQFTFKQLCGEPLAAGDYLALASYFKCFVITDIPYLSIHVRDEVRRFITF
                     LDAVYDNGGKLATTAAAEFQTLFVEPETILNNYQLKASQSKLESDKASANFFKVDEER
                     FAFARALSRLSQMSTSDWVEK"
     gene            <286341..>292598
                     /locus_tag="KLTH0G03696g"
                     /db_xref="GeneID:8293462"
     mRNA            <286341..>292598
                     /locus_tag="KLTH0G03696g"
                     /product="KLTH0G03696p"
                     /transcript_id="XM_002555150.1"
                     /db_xref="GeneID:8293462"
     CDS             286341..292598
                     /locus_tag="KLTH0G03696g"
                     /note="some similarities with uniprot|P41809 Saccharomyces
                     cerevisiae YDR420W HKR1 Serine/threonine rich cell surface
                     protein that contains an EF hand motif involved in the
                     regulation of cell wall beta-1 3 glucan synthesis and bud
                     site selection overexpression confers resistance to
                     Hansenula mrakii killer toxin HM-1"
                     /codon_start=1
                     /product="KLTH0G03696p"
                     /protein_id="XP_002555196.1"
                     /db_xref="GeneID:8293462"
                     /db_xref="UniProtKB/TrEMBL:C5DLU8"
                     /translation="MYLSVLEVGPIPFLLWTHLLFEYASAGALHARAGVATGSYDISS
                     QSGVRSLSEPTQSIPAETVSSDGRSNFLTSYASSGSTRPVSTGAVSSQGTMGASTTES
                     PRSISYSDLASSLSQATEATSLYLASSSKDVLETSGLSGPLQTRTADASSSRPDTTSA
                     LSSSPTKSISGDTSTTRSSETASAESGAESSPLFSSEILSSMIPQSSGHINTQTSTQP
                     TTRSSAETDVSTQSTEESQTSSPIGITSGQESSTEAGASAQLTEESQTSSPTRTTSGQ
                     ESSTEAGASAQSTEESQTSSPTRTTSGQESSTEAGASAQSTEESQTSSPIGITSGQES
                     STEAGASAQSTEESQTSSPTRTTSGQESSTEAGASAQSTEESQTSSPIGITSGQESST
                     EAGASAQSTEESQTSSPIGITSGQESSTEAGASAQSTEESQTSSPTRTTSGQESSTEA
                     GASAQSTEESQTSSPTRTTSGQESSTEAGASAQSTEESQTSSPIGITSGQESSTEAGA
                     RAQSTEESQTSSPTRTTSGQESSTKAGTSSQSALGTSVHSTTGSPLGGANSYSQSSYS
                     VPRSSDESYPLSQYNPSSTSIFTSEPYGTAATTLSDGEPETITSSFISARPTSTVPSP
                     SITTFISSTTTGSPLPSGTFNSASTSQVVTRSPEGSSIPETSSSSTMSSTSQPSRLSF
                     RTEDMTTMLGFSSGTSEHLSSSRTAGVPTDSGSSSNPGASTSSPNDQTSINSQPVTAT
                     SPQPSYTSLSPTYESRSAQTMTSGALTSVPGEVLPSSLSASSAPLTETPVPGRTDFSQ
                     VTSLYSSVMHSNENPGRSGNLVTSSAAPEVGTTSSLSFITSAYSEISVSSSGPAAISA
                     TPSRVPGSISSSQTPSPSEPVVLMTSQSSQKSQTTAQPSAGVSASQVFLTSSLSQMSS
                     AMSADSLQITTRLSASNTASNTASNTASPSLSETSELRGTTSRVTATTGSVSEASSSS
                     LSHVGIESGSTLVIQPMSSSQIERTFTTSSAATSSIPQASGEVSKLSSILISSSRYKP
                     TGSTSDATRASGTTAFFSSSRSYTIAASTVSAQSTISTGSMGTSENLISTVSSPSSSF
                     EASVKLTSISHGSSQSLTRLHSSKTPVPGSSTPTGALRSSYVESSASNFVAYTTSSST
                     SPGLQTTSSGSRLPEAESTSTKTQASRFSQNSQHPESLTTAFQPISSQSESFGSVQPS
                     RTPSLATVLAPSSTNSEGSTSMDWLPSNIVTASYTGSAHTQSSFDADATATLPQAIMP
                     PTPVTMPPNYSQITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPFSVRASRSNSS
                     TSSVKRDLVGDSGNLLLDNSTLILDKLNWKTSIMNSLSSNVSVSRNGSHNAFRANFSG
                     VAVSSIVPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGASRIYKNPDQSLRDMALL
                     IDSKIPITGIISSDGSGQGSGSSGGSGSSSGSDGTGSSGSSSESDYEDVKNDNSGTLD
                     GYKNFQVKFFTTKRLVIFLPVFIVAVTMWISLGLLFFGSLFRKGSLQGMAGNLEKKWN
                     TDQKTLDNYFGITEFIGKRQSADLEKNLAGSFHNDESSSDAFDDDDLLAVGNGMFFSK
                     STGLTYHVDREGNFFYAGTANKAVLPLKSKSTSKLEASNMVPNGESDPKNEANEANEA
                     KEEGEENEERKENEEKPCSNGEFRDDAEVEEFDVDEDGNVELSVSDLERLSLDEHNSD
                     TIESYNNQQYYKMKQLLQNLNNDDIEGAFSTENEGAAGNISSTGNESKLMPLSSESSK
                     LLVQLSTDDDNLEEYFYSEEAQLEGIGKTTSPQPEPESEDNDDVEDFNIDSDSEEEGE
                     DVNDVHVGEFDELDEVMYRRFSSASGLTRFQGGSSSSNTFISLMQQRNSNMLPFSTHA
                     LGSTSSEGYHEITASDGLQTDSSNFASQSSPEDPVELLGSKPPMSASHTKSAPKRPNR
                     PSSIISLEKDSIIGQAHSKAALNTVRRPKIQPHQKPSNPRETAGPPSRHETIAVERTQ
                     NIKISKKEKSRRSSFRKSVAETLHSANVFSGSTRGRSSTLNDVGPRGHTREELNKIRI
                     SGPIYSENSLG"
     gene            <292858..>295431
                     /locus_tag="KLTH0G03718g"
                     /db_xref="GeneID:8293463"
     mRNA            <292858..>295431
                     /locus_tag="KLTH0G03718g"
                     /product="KLTH0G03718p"
                     /transcript_id="XM_002555151.1"
                     /db_xref="GeneID:8293463"
     CDS             292858..295431
                     /locus_tag="KLTH0G03718g"
                     /note="similar to uniprot|Q04052 Saccharomyces cerevisiae
                     YDR421W ARO80 Zinc finger transcriptional activator of the
                     Zn2Cys6 family activates transcription of aromatic amino
                     acid catabolic genes in the presence of aromatic amino
                     acids"
                     /codon_start=1
                     /product="KLTH0G03718p"
                     /protein_id="XP_002555197.1"
                     /db_xref="GeneID:8293463"
                     /db_xref="GOA:C5DLU9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DLU9"
                     /translation="MKRLATGNDLEVSSQKYRRGYKACLNCRSRKTRCDLGPPDSPRD
                     PPCVRCKRERKECVFLENSKRGGRKRIEWTVDGNTDVNATARFEAEDKYIPVATLKDT
                     TSIKEGSLTPELNSMHNALEFLAKAAGSAAKEDSRSRIPSYERQDKTIREKTYHREES
                     PNQHASGSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLTEKEATRLIDLF
                     FLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEGERSSRNIEV
                     HDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYANDTSLSDI
                     SRRDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMNNSPKIFTALH
                     ITETQTAMNMNQRSILSQSLAEVSLNGHDGDSGLSSACIEEIFRNEDSKRRWKSYTQQ
                     RDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSDAYRDLSNLGTHEKSKLSAADKLLFTP
                     RQRAKVELLRIMSIGYEAIYYKDTKLTLIDHKHKLAVLGILAPMIKGWHNTYKHLLVP
                     FAGGQCPPTRDENKNATYDTPSKIDSESLISDYFYCQLYIYSLALQIEAGTEKDKKPN
                     INELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKYMPVRWAARIIRAVAFVVRCYMT
                     LTGSGLGSDPRATTILAVCVISAEEIIEMIQKAAITLREASPDELHLCSRFSTVLMFL
                     CTEMKRKQHSEPQNSELRRSSSHSLHNPTDAPARMPTTPAENYAATDFAIPAFLETPH
                     PSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMTFENLYNEAMGYEHLPK
                     Q"
     gene            <295985..>297880
                     /locus_tag="KLTH0G03740g"
                     /db_xref="GeneID:8293464"
     mRNA            <295985..>297880
                     /locus_tag="KLTH0G03740g"
                     /product="KLTH0G03740p"
                     /transcript_id="XM_002555152.1"
                     /db_xref="GeneID:8293464"
     CDS             295985..297880
                     /locus_tag="KLTH0G03740g"
                     /note="similar to uniprot|Q04233 Saccharomyces cerevisiae
                     YML006C GIS4 CAAX box containing protein of unknown
                     function proposed to be involved in the RAS/cAMP signaling
                     pathway"
                     /codon_start=1
                     /product="KLTH0G03740p"
                     /protein_id="XP_002555198.1"
                     /db_xref="GeneID:8293464"
                     /db_xref="UniProtKB/TrEMBL:C5DLV0"
                     /translation="MLESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFAL
                     LRRFLNEQLLSDSVLFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLT
                     QDRCYNHENHYLISDSLSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSIISGETE
                     ADPALPAAISSESPASVHLSKVVQEDVPLRTHNSSSRLLIVDNQECASSTDESDDAST
                     ELVLKFEHRGMLGKQRLHPEVRKMASTEEAIDTPSTGVSLRSDDVSSYDGEVLTQTIT
                     RDEDSVSLMIEDDSISELSSVDHSLKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFR
                     LVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLE
                     MNKFFPKILFYSLVMISEEVAADAQDYYPSKPSKSPQPTASNSTISENTLKVQPTLTH
                     SLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEGVVVPLYSATRTN
                     SNKSTAHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLEDSYQSVEGNLMKVRSKSSVK
                     SGLTKTLTLGSLSTVERSKSVPLPSVLKSLSNFDEEALYLKKKVEKFKRKRLTKRKKN
                     EPNCLLM"
     gene            complement(<297935..>300064)
                     /locus_tag="KLTH0G03762g"
                     /db_xref="GeneID:8293465"
     mRNA            complement(<297935..>300064)
                     /locus_tag="KLTH0G03762g"
                     /product="KLTH0G03762p"
                     /transcript_id="XM_002555153.1"
                     /db_xref="GeneID:8293465"
     CDS             complement(297935..300064)
                     /locus_tag="KLTH0G03762g"
                     /note="similar to uniprot|P32578 Saccharomyces cerevisiae
                     YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
                     complex may confer substrate specificity vacuolar protein
                     containing KIS (Kinase-Interacting Sequence) and ASC
                     (Association with Snf1 kinase Complex) domains involved in
                     protein interactions"
                     /codon_start=1
                     /product="KLTH0G03762p"
                     /protein_id="XP_002555199.1"
                     /db_xref="GeneID:8293465"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DLV1"
                     /translation="MGNNPSTANMQNKRVSQLAQEPRGRQDSITSQLFPSRTSGRNPE
                     SKVGWKSRVLHGNRPSASPASTPPVQSPFRKNYTLEVTTESAPYNLKKSISGNPAPPM
                     CTTTHASADESSSSSLRDHLAELSLQNSESQPNRKTSPGLGPAPAPAPVLRSPGPSTP
                     VVKYTKHDAISDQISSITSLKKMLVEGRVGDNIHPPPTSIDIPRRPSAALSDAYFSDD
                     GDDEESLLQGTNDVVINNSVLENAMKRKRGTKKNKGVGASSESHEHISYPGLKKLKPL
                     EHGGDKRDLPHFRAMHPRPSEDNVGPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANE
                     SGFSSQNLTSSDMRDSDDADEDRGPGTHVILNWKDNIVDPKTCKMSIVSKDISSTLNP
                     HKKFSKIPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVN
                     WFEVVEGHDSIEPSRDVISSEDVKLSKDQIAVEQPAPERPALGSDGSSSSNWKGSSRH
                     VERSGTPFSDYTGLCSRSELTKPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANF
                     DGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQ
                     QYPTPDLPVYLDSSFLNAVFSGFQDKTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVG
                     CTTRYEGKFITQIIYTPCYYSNKDGAH"
     gene            complement(<300734..>302443)
                     /locus_tag="KLTH0G03784g"
                     /db_xref="GeneID:8293466"
     mRNA            complement(<300734..>302443)
                     /locus_tag="KLTH0G03784g"
                     /product="KLTH0G03784p"
                     /transcript_id="XM_002555154.1"
                     /db_xref="GeneID:8293466"
     CDS             complement(300734..302443)
                     /locus_tag="KLTH0G03784g"
                     /note="weakly similar to uniprot|P19880 YML007W
                     Saccharomyces cerevisiae YAP1 bZip transcription factor
                     required for oxidative stress tolerance"
                     /codon_start=1
                     /product="KLTH0G03784p"
                     /protein_id="XP_002555200.1"
                     /db_xref="GeneID:8293466"
                     /db_xref="GOA:C5DLV2"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="UniProtKB/TrEMBL:C5DLV2"
                     /translation="MSTVKRQLEASTPPADLPKRKGSKPGRKPLDTEAKNKRTAQNRA
                     AQRAFRERKERKMRELEEQVERLEKVREQSEMESEFLRSQLQMLIAEIQKYRPQQSSD
                     SQVLKYLAEAEERCKAAPVEKRTGRNAARSSISTSNRDDSENASRSRSRSTSLSEHNT
                     LDTSRPQRYSENSSPADQDEAAKINANVQRKMNFTFEYPKDMPPANGAFPSPSGSTST
                     TSNHSFSHRPFSQLSNTPRTSSGSLDFLGDSASNTQSLPKFPTSESGNGDFDFNTHFD
                     EQVSVFCTQMNEVCGTRECPLPQALPPSTAASVTPRPISPIQEEQPELSKPAQAKIPA
                     ADAFLKQAQQQQPPNAWDSPQFGHSGFGMGTEDPTNRWLFPDFSSGNMSSTVRAPSAK
                     IDSVPFIDTSMAFPTDQPDALLPQNSDDVLNQFFEEDPIVSQLTTEESNYDPFKPDLQ
                     PSADSETSKHSVSSCSNDSDPSRAESNASTALTEPNYTIDKTSVPSAVLAAEDADVVP
                     ARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKGVVVNSDDVQSALAK
                     HMS"
     gene            <304242..>305396
                     /locus_tag="KLTH0G03806g"
                     /db_xref="GeneID:8293467"
     mRNA            <304242..>305396
                     /locus_tag="KLTH0G03806g"
                     /product="KLTH0G03806p"
                     /transcript_id="XM_002555155.1"
                     /db_xref="GeneID:8293467"
     CDS             304242..305396
                     /locus_tag="KLTH0G03806g"
                     /note="highly similar to uniprot|P25087 YML008C
                     Saccharomyces cerevisiae ERG6 Delta(24)-sterol
                     C-methyltransferase"
                     /codon_start=1
                     /product="KLTH0G03806p"
                     /protein_id="XP_002555201.1"
                     /db_xref="GeneID:8293467"
                     /db_xref="GOA:C5DLV3"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DLV3"
                     /translation="MSDEAQELRNRQATFAKELHGDDVGSKTGLKALLSKNREAQKEA
                     VTKYLRHWDGKTDKEAEQRRLDDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESF
                     TASVARHEHYLAYKAGIKAGDLVLDVGCGVGGPAREIARFTGANIIGLNNNDYQIAKA
                     KHYAKKFNLADQLDFVKGDFMNMQFEPSTFDKVYAIEATCHAPKLEGVYSEIYKVLKP
                     GGVFAVYEWVMTDKYDENNPEHRKIAYEIELGDGIPKMYPAQVARDALNNVGFEILHD
                     QDLADSDDEVPWYYPLTGEWKYVQTLSDLATFFRTSFIGRKFTTTMVTVMEKVGVAPK
                     GSRDVTLALEEAAVGLVAGGREKLFTPMMLFVARKPEDQSESKSKDKSKK"
     gene            <306065..>307747
                     /locus_tag="KLTH0G03828g"
                     /db_xref="GeneID:8293468"
     mRNA            <306065..>307747
                     /locus_tag="KLTH0G03828g"
                     /product="KLTH0G03828p"
                     /transcript_id="XM_002555156.1"
                     /db_xref="GeneID:8293468"
     CDS             306065..307747
                     /locus_tag="KLTH0G03828g"
                     /note="weakly similar to uniprot|P25346 YCR098C
                     Saccharomyces cerevisiae GIT1 Plasma membrane permease,
                     mediates uptake of the phosphatidylinositol metabolite
                     glycerophosphoinositol"
                     /codon_start=1
                     /product="KLTH0G03828p"
                     /protein_id="XP_002555202.1"
                     /db_xref="GeneID:8293468"
                     /db_xref="GOA:C5DLV4"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DLV4"
                     /translation="MYQRHITSPFVRDLPHSAKELTVGWIPRVKKEVTWGRALVPDEQ
                     DESDRTAGVHGAAGLNSSSDSEMHAADGVSTSAEKTQFLADTTRNNYWAIVTTGAGLF
                     SDGYINNSISTVNACLSQIYGKQYSASNAIQNVSSIAFAGTVVGQLSFGYISDYHSRK
                     VAMIVGTSILILFSILAAGAWGVGTTGTQAGGLFAAITAYRFFLGIGIGSEYPAGSTA
                     AAEASNSLPAGKRNRWFCWFTNFMIDAGFVVSSVVPLILLRICGDNHLQPVWRITIGL
                     GAIPPISLFFLRLRYKESKQFENTRFNRTMPYWRIFKFYWFRLLIVSLIWFQYDLIAY
                     SFSSLSSLILDGILGDNATLTKTFGWNIVFNLFYIPGAFLGAIFADYWGPRVTLVSGV
                     LAQAIIGFIMAGCFEHLKKHIAAFTVVFGIFTALGEFSVGDNIGLLASKTCATPIRGQ
                     YYGIAAAVGKIGAFVGTYIFPAIIKKYGGYGELKVPFWIVSAICCFSAFLALFFLPPL
                     DQDANIMEDQLFLEYLESTGFDLAQLGTLSSDSDVERVTIQDIPKGELPHED"
     gene            <308053..>309474
                     /locus_tag="KLTH0G03850g"
                     /db_xref="GeneID:8293469"
     mRNA            <308053..>309474
                     /locus_tag="KLTH0G03850g"
                     /product="KLTH0G03850p"
                     /transcript_id="XM_002555157.1"
                     /db_xref="GeneID:8293469"
     CDS             308053..309474
                     /locus_tag="KLTH0G03850g"
                     /note="some similarities with uniprot|P28742 Saccharomyces
                     cerevisiae YBL063W"
                     /codon_start=1
                     /product="KLTH0G03850p"
                     /protein_id="XP_002555203.1"
                     /db_xref="GeneID:8293469"
                     /db_xref="GOA:C5DLV5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DLV5"
                     /translation="MSDNIKVSVRLRKPLERESAERVIAQVVSENLIKVEQRAKREET
                     RNFEFDLCCTYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTG
                     SAELPGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLLGANKCRI
                     RERADKTTFVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVE
                     QKENSPLGHVLERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAML
                     AKKKQPRLIPYRDAALTWVLKESLGGNSKTCMIACVSPCDFEETMSTLRYATLARSVK
                     TFAQLNTQETVDGKVQMLAMRQQLDELQGALSRVGDQRLVREQMEKIKLTNQFLEARI
                     ERERRAAVDYYSQYAQASSERDNLVQVLSSIVSSLQSFDGGKIRESLVALKQRSEEIG
                     KQLEADHLEIRGAIEACPSIDLQ"
     gene            complement(<309507..>309907)
                     /locus_tag="KLTH0G03872g"
                     /db_xref="GeneID:8293470"
     mRNA            complement(join(<309507..309737,309800..309822,
                     309895..>309907))
                     /locus_tag="KLTH0G03872g"
                     /product="KLTH0G03872p"
                     /transcript_id="XM_002555158.1"
                     /db_xref="GeneID:8293470"
     CDS             complement(join(309507..309737,309800..309822,
                     309895..309907))
                     /locus_tag="KLTH0G03872g"
                     /note="similar to uniprot|Q02647 Saccharomyces cerevisiae
                     YDR424C DYN2 Cytoplasmic light chain dynein microtubule
                     motor protein"
                     /codon_start=1
                     /product="KLTH0G03872p"
                     /protein_id="XP_002555204.1"
                     /db_xref="GeneID:8293470"
                     /db_xref="GOA:C5DLV6"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /db_xref="UniProtKB/TrEMBL:C5DLV6"
                     /translation="MSMQPVLKASDISPELKNDIFAISLKAVQEFSLEREIAGVVKKE
                     LDVKHGSTWHVIVGRSFGSYVTHEKGHFMYYYIGQLAFLVFKTA"
     gene            <310030..>311811
                     /locus_tag="KLTH0G03894g"
                     /db_xref="GeneID:8293471"
     mRNA            <310030..>311811
                     /locus_tag="KLTH0G03894g"
                     /product="KLTH0G03894p"
                     /transcript_id="XM_002555159.1"
                     /db_xref="GeneID:8293471"
     CDS             310030..311811
                     /locus_tag="KLTH0G03894g"
                     /note="similar to uniprot|Q04053 Saccharomyces cerevisiae
                     YDR425W SNX41 Sorting nexin that mediates retrieval from
                     endosomes"
                     /codon_start=1
                     /product="KLTH0G03894p"
                     /protein_id="XP_002555205.1"
                     /db_xref="GeneID:8293471"
                     /db_xref="GOA:C5DLV7"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:C5DLV7"
                     /translation="MNAFDESDEEDNNPFSGTNHLYASGIAAVHEGQDDFVPPAILTD
                     IQEKEESREELMNQLFGGETSNIVDSQQDSVIGLQSEYREPSLEREQPQSESRIPTFS
                     SQIEDRKIKIIDAGHFRDAYGKYAIGYTIEFAGKQVVRRYSEFDTLRHALYRLLPTVI
                     VPPIPSKHPLIRYFLNPLSAEKDIRIIERRKRLLSLFLSNCYAVEEIREHVVFTKFLD
                     PEQNWRNVINSPPISIIPTNNLLAPPLQPTKPSPLHLLLPNVTLSSNRGEDYEMSEEM
                     LEKERWFKDTEDILKKFEKVLQPLEKTSKQNRVHFQSLASSLAELGAYYNAFSLEGNI
                     LTIKDKLQLVDELSKGIEKVGQAIDVNYVSTEIVSEHVMTLIEEPVAEMLQFIVEARY
                     VLRFRALKMTQFCIVDSTIKKRKARINALQEAQEQMQRLEEALRQNAEQSPTVAQAVK
                     NMDNNGAATAGSASSPNQMPQNKERGTNGWTDLFKSKGSHRPRSSSTAKELAPHLLSD
                     DQRKEEVAKITQELQKLNECFKLITKDILQVNSSVSNSFQHLVSYLKDRFSVIFKSFA
                     HVLLVWLKDSLLAWQNARAMINNIQVT"
     gene            <312025..>313209
                     /locus_tag="KLTH0G03916g"
                     /db_xref="GeneID:8293472"
     mRNA            <312025..>313209
                     /locus_tag="KLTH0G03916g"
                     /product="KLTH0G03916p"
                     /transcript_id="XM_002555160.1"
                     /db_xref="GeneID:8293472"
     CDS             312025..313209
                     /locus_tag="KLTH0G03916g"
                     /note="similar to uniprot|Q04062 Saccharomyces cerevisiae
                     YDR427W"
                     /codon_start=1
                     /product="KLTH0G03916p"
                     /protein_id="XP_002555206.1"
                     /db_xref="GeneID:8293472"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:C5DLV8"
                     /translation="MSQDIDTILSTLRTEADPELAGLFYEFEDFYEQKLWHQLTERLD
                     VFFHDERSLPLRLRVYDTFVSKFQDKINQLKLTNFLLLSLKDNSESQDALDYLTDLQK
                     SFKEMDEKKQRNDGLKSHYSGILLIDIEIARIYLVQGDLVKARDSLDEIETTLEFQDS
                     LPLQVISAFYSTSAEYYLAKKDFNSFYYTSLLYLSTAETLKSYHELSPVKRQQLAYNL
                     CVAALLGDKIYNLGELLNHPIMESISSDPQYEWLSQFLQTLSNGDFDQFDKLSKERVP
                     HVPILSAHESFLRQKICLMTLVESVFVKNIRTLSFDDIAAATHLPKDNVEHLVMRSIS
                     LGLLKGSIDQVNELVTVAWVQPRIINGDQINKMKQRLVEWNEEVSSLGKKIEARGKSI
                     WV"
     gene            complement(<313277..>314026)
                     /locus_tag="KLTH0G03938g"
                     /db_xref="GeneID:8293473"
     mRNA            complement(<313277..>314026)
                     /locus_tag="KLTH0G03938g"
                     /product="KLTH0G03938p"
                     /transcript_id="XM_002555161.1"
                     /db_xref="GeneID:8293473"
     CDS             complement(313277..314026)
                     /locus_tag="KLTH0G03938g"
                     /note="similar to uniprot|Q04066 Saccharomyces cerevisiae
                     YDR428C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G03938p"
                     /protein_id="XP_002555207.1"
                     /db_xref="GeneID:8293473"
                     /db_xref="GOA:C5DLV9"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DLV9"
                     /translation="MAKFEETVTFYRSQQTSPVHCAIVFIHGGAWIDKNNTPHDFDEF
                     SRCLLDLANGNPSFSIYAIEYRLSPAVKHPAHIYDVIENLVKLVEQEGIEELNLMGHS
                     VGATLVWQVLSGIPGLANAESFASSAELKLLRKLLKKCYLVDGIYSLSKLLEEYPSYD
                     YFVSQAFEQIEDYDDPEQSQVIIPLNADIYVIHSYRDELLSPLQSNYLCATLQKLKQP
                     FQSYWSDFGEHNEVYSNAKVAQYILHTMQMH"
     gene            complement(<314167..>315009)
                     /locus_tag="KLTH0G03960g"
                     /db_xref="GeneID:8293474"
     mRNA            complement(<314167..>315009)
                     /locus_tag="KLTH0G03960g"
                     /product="KLTH0G03960p"
                     /transcript_id="XM_002555162.1"
                     /db_xref="GeneID:8293474"
     CDS             complement(314167..315009)
                     /locus_tag="KLTH0G03960g"
                     /note="similar to uniprot|Q04067 YDR429C Saccharomyces
                     cerevisiae TIF35 Subunit of the core complex of
                     translation initiation factor 3(eIF3)"
                     /codon_start=1
                     /product="KLTH0G03960p"
                     /protein_id="XP_002555208.1"
                     /db_xref="GeneID:8293474"
                     /db_xref="GOA:C5DLW0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /db_xref="UniProtKB/TrEMBL:C5DLW0"
                     /translation="MSEVSVPPTQVLENPDGTKTVVSYRVENGKKLRVTQKVREIKVT
                     EKVNKSVASRKHWKKFGAEANSAPGPDYSTTQLGEELLLRLGTSWKKLEEEEEQKAKE
                     AKGGEKLITCRTCGGNHYTMHCPFKDTLGDASAAAASSAAADPAVESEAAAGALETGS
                     IIGGKYVPPSRRAGARDPSSNNNFDAYRDQRERDDAKTLKIMQLNENADENTLRYELL
                     FPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILNADWSKP
                     KVKE"
     gene            <316270..>316482
                     /locus_tag="KLTH0G03982g"
                     /db_xref="GeneID:8293475"
     mRNA            <316270..>316482
                     /locus_tag="KLTH0G03982g"
                     /product="mitochondrial 54S ribosomal protein YmL39"
                     /transcript_id="XM_002555163.1"
                     /db_xref="GeneID:8293475"
     CDS             316270..316482
                     /locus_tag="KLTH0G03982g"
                     /note="similar to uniprot|P36533 Saccharomyces cerevisiae
                     YML009C MRPL39 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL39"
                     /protein_id="XP_002555209.1"
                     /db_xref="GeneID:8293475"
                     /db_xref="GOA:C5DLW1"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C5DLW1"
                     /translation="MAKQKSKNSVIKLLSTAATGFARQITITRGAPLVTQVRYDPVAK
                     RHVLFKEAKKRKVAERKPLDFRRTFK"
     gene            complement(<316665..>319922)
                     /locus_tag="KLTH0G04004g"
                     /db_xref="GeneID:8293476"
     mRNA            complement(<316665..>319922)
                     /locus_tag="KLTH0G04004g"
                     /product="KLTH0G04004p"
                     /transcript_id="XM_002555164.1"
                     /db_xref="GeneID:8293476"
     CDS             complement(316665..319922)
                     /locus_tag="KLTH0G04004g"
                     /note="similar to uniprot|P27692 YML010W Saccharomyces
                     cerevisiae SPT5 Protein that forms a complex with Spt4p
                     and mediates both activation and inhibition of
                     transcription elongation"
                     /codon_start=1
                     /product="KLTH0G04004p"
                     /protein_id="XP_002555210.1"
                     /db_xref="GeneID:8293476"
                     /db_xref="GOA:C5DLW2"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR017071"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="InterPro:IPR024945"
                     /db_xref="UniProtKB/TrEMBL:C5DLW2"
                     /translation="MAEETNQQPSLATEIGNVENPNVKDHQQETGEDQSQLENKLPLT
                     DASTAENREAAQSALGTGQQQVDTDEPKIETNEPSNDEARMSNGETAENAGQQVAESA
                     EQPDTKASEQESSENAESQTGDKKRPRESEDEGSSAATDNQESTGPESKALEDEQAAG
                     EEEGELDDDDDDEDDDDDEDDDDEAGPRKKQRRERNRFLDIEAEVSDDEEDEEDDEES
                     ELVREGFITRGDEEEEETAGPTGRDDRLHRQLDQNLNKSSEEDAQKLAKELRERYGRS
                     SSKQYRAAAQDGYVPQRFLLPSVDTATIWGVRCRPGREKEIVRKLLKKKFNLDKSMGN
                     KKLKIMSIFQRDNYSGRIYIEAPKQSVIEKFTTGVPDIYPAQKLLIPVQELPLLLKPD
                     KSDDVRLEEGSYVRIKRGIYKGDLAVVDQISENNLEVLLKIVPRLDYGKNDEIDADTN
                     TRKQKRPTFAQRPPPQLFNPTMALRMDQANLYKRDDRHFTYRNDDYVDGYLFKSFRIQ
                     YLETKNIQPSVEELARFGSKEGNLDLTTISQTIKKAQAAKVTFQIGDRVEVLSGEQKG
                     SKGFVTRTSMDIIAVNLPQLGMKALEFPISSLRKIFEAGDHVTVVGGDHQGDAGLVLA
                     VKNGQVTFVSDQTRANLTISANNLSKSMDSTPTSSEYALHDIVELSAKNVACVIQAGH
                     DIFKILDDTGKVSTITKGSILKKINTARSRLTTVDNKGREIKIGDTVVEKVGARREGQ
                     VLYIQTQQIFIVSKKITENAGVFVVNPMNVEAVASKDNLIAGVGSMDLSRMNPDVVAK
                     MRPPQQSAQQASVGRDVALGKTVRIRSAGYKGQLGIVKDVNGEKATIELHSKNKHITM
                     DKRKLMYYNKEGGDGITYDELVNRRGRTPNARIGPSYVSAPRNMATGGMPIGAGGPGS
                     SALSGGMTPGWNSFDGGKTPAVNSGGQGGASAWGGASTWGGQGGASTWGGAGQGGGAS
                     AWGGQGAGATSTWGGASAWGNKSSWGGASTWASGGDNNGGVSTWGGDKSSHGGGSVWG
                     NRDGGTSTWGGGTSREANREGGNSTWRNENSGNKSAWGDQGNVSSYGGNSTWGGR"
     gene            complement(<320835..>321644)
                     /locus_tag="KLTH0G04026g"
                     /db_xref="GeneID:8293477"
     mRNA            complement(<320835..>321644)
                     /locus_tag="KLTH0G04026g"
                     /product="KLTH0G04026p"
                     /transcript_id="XM_002555165.1"
                     /db_xref="GeneID:8293477"
     CDS             complement(320835..321644)
                     /locus_tag="KLTH0G04026g"
                     /note="weakly similar to uniprot|P53133 Saccharomyces
                     cerevisiae YGL117W and gnl|GLV|KLLA0B00495g Kluyveromyces
                     lactis KLLA0B00495g"
                     /codon_start=1
                     /product="KLTH0G04026p"
                     /protein_id="XP_002555211.1"
                     /db_xref="GeneID:8293477"
                     /db_xref="UniProtKB/TrEMBL:C5DLW3"
                     /translation="MVELASKISPANQLLFNQIANELSASLTGPTLEFIDVLIESFMY
                     PRGNRSLFASARGETSMESSPTDHQQLYECQDFGHNCLLGMVYARHLLNKIKSQSLTE
                     SPDFAWSLLELLEDTRSTLVHLLKQMSSQIELPMCSEMYRQILSENVFHFRHAFLNFQ
                     ALDCILHQLLETLDKTGLLDEVVFQIDYKTIGAIQRFAADNTQWFEDIMLGSKALKEY
                     LLLQDYRTDYLDQVTATKVPKGVRKAIRSPEFSSFVHARKSRLKISHRKIF"
     gene            <323588..>324118
                     /locus_tag="KLTH0G04048g"
                     /db_xref="GeneID:8293478"
     mRNA            <323588..>324118
                     /locus_tag="KLTH0G04048g"
                     /product="KLTH0G04048p"
                     /transcript_id="XM_002555166.1"
                     /db_xref="GeneID:8293478"
     CDS             323588..324118
                     /locus_tag="KLTH0G04048g"
                     /note="similar to uniprot|Q04231 Saccharomyces cerevisiae
                     YML011C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G04048p"
                     /protein_id="XP_002555212.1"
                     /db_xref="GeneID:8293478"
                     /db_xref="InterPro:IPR014841"
                     /db_xref="UniProtKB/TrEMBL:C5DLW4"
                     /translation="MNRTKSKAYNSVSEFLNPKIPPEIEDDILGAFANYSIESDMTAQ
                     DLPEYFKELQMPTEMTKLVQPQDLCIEGTKVVDFDKLLKTTFHLLIFMNNAEIIDTQW
                     LMLVQGCGRDTQFPQVTLRNHVLSIKDLQKIANSINVDGGHLIDMMSCATQGKRVYIT
                     WMDFAYLLGKLGHLVF"
     gene            complement(<324168..>324797)
                     /locus_tag="KLTH0G04070g"
                     /db_xref="GeneID:8293479"
     mRNA            complement(<324168..>324797)
                     /locus_tag="KLTH0G04070g"
                     /product="KLTH0G04070p"
                     /transcript_id="XM_002555167.1"
                     /db_xref="GeneID:8293479"
     CDS             complement(324168..324797)
                     /locus_tag="KLTH0G04070g"
                     /note="similar to uniprot|P54837 Saccharomyces cerevisiae
                     YML012W ERV25 Protein that forms a heterotrimeric complex
                     with Erp1 Erp2p and Emp24 member of the p24 family
                     involved in endoplasmic reticulum to Golgi transport"
                     /codon_start=1
                     /product="KLTH0G04070p"
                     /protein_id="XP_002555213.1"
                     /db_xref="GeneID:8293479"
                     /db_xref="GOA:C5DLW5"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:C5DLW5"
                     /translation="MQFSILPLLCVLFSTCLALHFDITASSNPEPVCVRDFINEGQLV
                     VVRIETDGSVGDGQVLNLVIRDSNGNEPRRSKDIAGTTNVAFHAARSGAFDICFENHL
                     QVHGRSLKRSVELDVETGSQARDWNKIQSSEKLKPVEVELRRIEELTDEIVDELGYLK
                     AREERLRDTNESTNRRVRNFSLMVICVLVSLGAWQINYLHNYFKAKHII"
     gene            complement(<325076..>328048)
                     /locus_tag="KLTH0G04092g"
                     /db_xref="GeneID:8293480"
     mRNA            complement(<325076..>328048)
                     /locus_tag="KLTH0G04092g"
                     /product="KLTH0G04092p"
                     /transcript_id="XM_002555168.1"
                     /db_xref="GeneID:8293480"
     CDS             complement(325076..328048)
                     /locus_tag="KLTH0G04092g"
                     /note="similar to uniprot|P32898 YDR430C Saccharomyces
                     cerevisiae CYM1 Cytosolic metalloprotease"
                     /codon_start=1
                     /product="KLTH0G04092p"
                     /protein_id="XP_002555214.1"
                     /db_xref="GeneID:8293480"
                     /db_xref="GOA:C5DLW6"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="InterPro:IPR013578"
                     /db_xref="UniProtKB/TrEMBL:C5DLW6"
                     /translation="MLRFRRYASHFNQSKLLRKYPVGGVFHGYEINRVLPVPEMRFVA
                     VDLKHLQTGAQHLHIDRDDRNNVFSVAFKTNPPDASGVPHILEHTTLCGSEKYPVRDP
                     FFKMLNRSLANFMNAMTGHDYTFYPFATANKADFANLRDVYLDATFKPLLKHEDFLQE
                     GWRLEHTNLDDPKSDIVFKGVVYNEMKGQTSSSNYQFWIKFQENIYPSLNNSGGDPQK
                     ITDLQYSDLVSFHSKNYHPSNAKTFTYGSFPLDETLQRLNEEFKLYGKRANRYKELKP
                     LEMNSDVRVTEKGQVDPMLPPDKQLKTSMTWLCGDPADVYGTFLLKVLGNLLMEGHST
                     PLYKQLIESGVGYEFSVNSGVESTTATNFFTVGVQGCSDTILFEQTVKSVFQEALEKP
                     FESDKIEAIIQQLELSKKNQKADFGLQLLYSLVPGWTNKTDPFDHLVFDDILSQFRAD
                     WAAKGDEVFREIIRDQILSKPCFYFSMEADEKYSGMLDSEEARRLETKVSQLDSNDRE
                     VIRERGKQLQAKQNATEDLSCLPSLKIKDIPRAGDSYEIKRADNIFHRISDTNGITYL
                     RLKRSLDRVIPRDLYPYLPIFADCLTSLGTSKEHYSEIEDEMKLHTGGVSAHVAVHSD
                     PITCEPSLNFICEGYSLNHKTERVFDIWRKILVETDIVKHVEKLKVLIRSLAASNTAS
                     VAEGGHAFARNFTGAHLTTAKAINESLSGVEQLKLITYLSTILEKPALFQAEVVDKLN
                     ELKSYVISSEGLEFFTTTDSEKQAIKTDNEIQQFVQTLPEDSPSMTFSSRDYPLLDSK
                     GKHTLIEFPFQVHYSAQSLVGVPYTHRDGASLQVLSNMLTFKHLHREIREKGGAYGGG
                     ATYSALDGLFSFYSYRDPHPLNSLQVFAESGNYVLQNSNWKNDDLNEAKLTIFQQVDA
                     PISPSSEGSILFNYGITDSMRQVRREQLLDVNLEDVRAAAEKYLFKKPSVTAVVGPRI
                     EAEMSDGKWQIKDLQPAK"
     gene            <328845..>330074
                     /locus_tag="KLTH0G04114g"
                     /db_xref="GeneID:8293481"
     mRNA            <328845..>330074
                     /locus_tag="KLTH0G04114g"
                     /product="KLTH0G04114p"
                     /transcript_id="XM_002555169.1"
                     /db_xref="GeneID:8293481"
     CDS             328845..330074
                     /locus_tag="KLTH0G04114g"
                     /note="weakly similar to uniprot|Q01560 YDR432W
                     Saccharomyces cerevisiae NPL3 RNA-binding protein that
                     carries poly(A) mRNA from the nucleus into the cytoplasm"
                     /codon_start=1
                     /product="KLTH0G04114p"
                     /protein_id="XP_002555215.1"
                     /db_xref="GeneID:8293481"
                     /db_xref="GOA:C5DLW7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DLW7"
                     /translation="MENPYFTSPPEAANFFIKARSSTICLATHLKHSFQLNQVHIMSE
                     EYQQPPVEETEQQAPSTIESQGAPAAEASEAAQAAAPVEASDVPESHEAPQARAPAYH
                     DSHNDYNDHRGQPPHRMMDGELSTTRLFVRPFPFDVQDSELNEIFAPFGPMKEVKILN
                     GFAFVEFEEADSAARAIEEVNGKSFANQPLEVVYSKVQPPRYRMILRNLPDGVAWQEL
                     KDLARENNLETTFSSVNTREFDGTGALEFPSEEILEDALQKLNNIEFRGSVITAEKDD
                     NPPPIRRFRGGPRGGGFGGRGGFGGRGGFGDRGGFRGRGGPRGGFGDRGGFRGGRGGR
                     GGFGDRGGFRGRGGPRGGFGDRGGFRGGRGGYGAPRGDSYGAPRGSYGAPRDEYRGRG
                     EGGDYYGSARERSPSRQ"
     gene            complement(<330648..>332408)
                     /locus_tag="KLTH0G04136g"
                     /db_xref="GeneID:8293482"
     mRNA            complement(<330648..>332408)
                     /locus_tag="KLTH0G04136g"
                     /product="KLTH0G04136p"
                     /transcript_id="XM_002555170.1"
                     /db_xref="GeneID:8293482"
     CDS             complement(330648..332408)
                     /locus_tag="KLTH0G04136g"
                     /note="similar to uniprot|Q04228 YML013W Saccharomyces
                     cerevisiae SEL1 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="KLTH0G04136p"
                     /protein_id="XP_002555216.1"
                     /db_xref="GeneID:8293482"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DLW8"
                     /translation="MPVIQHGDQEIHLSHDEEEKLNNFQVITTFPEESLPQIVKLLQD
                     HGWQLEPALSRYFDGNWQENLNPPPVAARPHTPPIPQRPSNPVTPFMFGDTASLVPRL
                     PLVKRLPLDFKEKFRYAGLDKRPEEFSTHPALFLLVLLPKVLFKIGTGIFTLLWSIIS
                     FGFRTEGVNTNHIHRVPESPSENVGSIHETLESIFNGNTELSSLVSSKPFNEVYDECE
                     KEFKFLLVVCLGDVETDEAGARDANSRLFLESILNDPSTLQILREHSENLVIYMRLAQ
                     DMEMWSLTKQLKLRYTPECLLIGNVLNSKDSVNGATRMSVLSRLKVSTLRKFQNSLKI
                     IVERHSAELIVSRSEQEELRMAREIKQMQDQAYQESLKQDQEKEQRRQAAEEEAKLKR
                     EAELIKEMEFKTTQTIQKLRILSFCLEHLESLTSSNITQEKHATLQIRTPNGRRFVKK
                     FTGVSTLEYIYRVAKCFLFLDLESFNKDHVLQCMATKVKEMAQDEDVLCFKDERNIED
                     LRIDSQPEELSQILQNELPKWSTPDCEVELDIDFELVTPFPRFKLPNDKDVLIKDTSQ
                     IWPNGSILVEYLEDAEYESE"
     gene            complement(<332537..>333367)
                     /locus_tag="KLTH0G04158g"
                     /db_xref="GeneID:8293483"
     mRNA            complement(<332537..>333367)
                     /locus_tag="KLTH0G04158g"
                     /product="KLTH0G04158p"
                     /transcript_id="XM_002555171.1"
                     /db_xref="GeneID:8293483"
     CDS             complement(332537..333367)
                     /locus_tag="KLTH0G04158g"
                     /note="similar to uniprot|P49957 YML014W Saccharomyces
                     cerevisiae TRM9 tRNA methyltransferase"
                     /codon_start=1
                     /product="KLTH0G04158p"
                     /protein_id="XP_002555217.1"
                     /db_xref="GeneID:8293483"
                     /db_xref="GOA:C5DLW9"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DLW9"
                     /translation="MAAAREQQFVHEVYNEIAPHFSQTRYKPWPVVTRFLNQQEMGSI
                     GIDVGCGNGKYLNVNPNVFIIGSDRSSGLIECAHALDGKFNVLVADGMQLPHRDATFD
                     FAISIAVVHHWSTRERRVAAINHILSKVRPQGRALIYCWALEQAGSRRGYHEGMEQDV
                     LVPWVLQGKHAKNEQETKSTKKAKPEKPDLSTVAPQDRAAFLAHWREEQQSKRAAENE
                     AQERARREQVDADNANTKYRYYHLYKEGELEEDCVSAGGKVVGAGYEKDNWYVIVERQ
                     "
     gene            <333951..>335507
                     /locus_tag="KLTH0G04180g"
                     /db_xref="GeneID:8293484"
     mRNA            <333951..>335507
                     /locus_tag="KLTH0G04180g"
                     /product="KLTH0G04180p"
                     /transcript_id="XM_002555172.1"
                     /db_xref="GeneID:8293484"
     CDS             333951..335507
                     /locus_tag="KLTH0G04180g"
                     /note="similar to uniprot|Q04080 YDR434W Saccharomyces
                     cerevisiae GPI17 Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex that
                     adds GPIs to newly synthesized proteins"
                     /codon_start=1
                     /product="KLTH0G04180p"
                     /protein_id="XP_002555218.1"
                     /db_xref="GeneID:8293484"
                     /db_xref="GOA:C5DLX0"
                     /db_xref="InterPro:IPR019540"
                     /db_xref="UniProtKB/TrEMBL:C5DLX0"
                     /translation="MSNLWLRRAVAFWFVAVFILAGLPAWYKLTTIYRAPLPSEYIRS
                     IHQNMHSDVHIVIPVYVRSDTYRFPDVHDAIQVQVNELLRSRPSHVQWSLQVLEYDES
                     VVDQDSDYVATLVLDDFAGFTLAYDSKETLVFFNNEAVMANDVPFFAAQTLVEHTFGA
                     EWEEFSGSRPEKNTGSSEMAISYSPNVHLSISLLTGDGRPIGWDIDTTLDNYFTPLRR
                     FLSPLVNFTVDTSIVQFNDLNVGSIHSGENTTWQDLAHTIDLSELSSMNYYKEKSVLN
                     LAIVFPSLEAGELSFVNATSQRPWQTFMVPRWGSLVLNKAPLPDNVRLTEEYLAPVIY
                     NFARELFQFLGLATQSADLTTPYATIDSFKRVTIIKNLEHGAETLWSLTKLTEQFPQM
                     SVPKQVLSDVEKALDLRLQLIELLNNPEKGGDRTWNQALLLSNEFVRVCERAFFHKEM
                     VQQNFFPQEHKIAVYLPLLGPLTVIILSGLLNALREKEGPHVANNSLTEKERLQDDDT
                     TVDSSERSAE"
     gene            <335808..>336875
                     /locus_tag="KLTH0G04202g"
                     /db_xref="GeneID:8293485"
     mRNA            <335808..>336875
                     /locus_tag="KLTH0G04202g"
                     /product="KLTH0G04202p"
                     /transcript_id="XM_002555173.1"
                     /db_xref="GeneID:8293485"
     CDS             335808..336875
                     /locus_tag="KLTH0G04202g"
                     /note="similar to uniprot|Q04226 YML015C Saccharomyces
                     cerevisiae TAF11 TFIID subunit (40 kDa), involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="KLTH0G04202p"
                     /protein_id="XP_002555219.1"
                     /db_xref="GeneID:8293485"
                     /db_xref="GOA:C5DLX1"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DLX1"
                     /translation="MVEPQGPLDTVPEENYPPLLTQNNYWNTKQLINQVISEDQEYVT
                     WKLKDVRTGGTMNAYLNDFMKNEYDQEDGSSAEDIADAHTAEAPLQRVRKRNGGPTGR
                     VSKASPINSVPKNVQFPRDIYDSQLAALPQPRELDQSEQLNLLLTNLDEEQMNRFEVF
                     RRTSLAKNNIKKISSIITNQTVAANINLLLAGVGKIFIGEIVEKAQEVKKRKLAALMA
                     SRFRDKQITAYRLKKILKKLTLMVEGPDASYDDSVDENESDLCEDDEDENLVNEVNTY
                     NRLIRSKINSEASRLGIIRHYNKLVKSFNALDVSVEKFTNCPLLPEHIREAWRLYRAE
                     NDTVPQATWRTQGEGNGWMFR"
     gene            complement(<336901..>337896)
                     /locus_tag="KLTH0G04224g"
                     /db_xref="GeneID:8293486"
     mRNA            complement(<336901..>337896)
                     /locus_tag="KLTH0G04224g"
                     /product="KLTH0G04224p"
                     /transcript_id="XM_002555174.1"
                     /db_xref="GeneID:8293486"
     CDS             complement(336901..337896)
                     /locus_tag="KLTH0G04224g"
                     /note="similar to uniprot|Q04081 YDR435C Saccharomyces
                     cerevisiae PPM1 Carboxyl methyl transferase"
                     /codon_start=1
                     /product="KLTH0G04224p"
                     /protein_id="XP_002555220.1"
                     /db_xref="GeneID:8293486"
                     /db_xref="GOA:C5DLX2"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR016651"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DLX2"
                     /translation="MDRAVQETDYDAFSCKVSAIAKHYLPRQVSGKEKEEGEFVQLHM
                     AYAQGLKSVSRRAYSKVDRAVQSAQPVMNYGTYLRSVAIDEAIACFLKEHVKSGAEAP
                     VQVVNLGCGSDLRMTQMLSQVPHLKWLDLDFKESVALKSRILENNPLFQRELGPSESV
                     ETAGYLTNRYCLTSCDLNDIAQVAEILKKFTTQDCPTLVLSECVLCYMKSAESKALIN
                     CIESFYKMGTWISYDPIGGDDSADKFGKIMQTNLRESRHLEMPTLMVYNSPEKYAQRF
                     NTAPHSTSIVTMWQYYVQSVPDEEKMRLKTLQFLDEIEELEIILSHYILAEASWR"
     gene            <338413..>340404
                     /locus_tag="KLTH0G04246g"
                     /db_xref="GeneID:8293487"
     mRNA            <338413..>340404
                     /locus_tag="KLTH0G04246g"
                     /product="KLTH0G04246p"
                     /transcript_id="XM_002555175.1"
                     /db_xref="GeneID:8293487"
     CDS             338413..340404
                     /locus_tag="KLTH0G04246g"
                     /note="similar to uniprot|P26570 Saccharomyces cerevisiae
                     YML016C PPZ1 Serine/threonine protein phosphatase Z
                     isoform of Ppz2p involved in regulation of potassium
                     transport"
                     /codon_start=1
                     /product="KLTH0G04246p"
                     /protein_id="XP_002555221.1"
                     /db_xref="GeneID:8293487"
                     /db_xref="GOA:C5DLX3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DLX3"
                     /translation="MGNTSSKVSSKKNKVSRDSAPPFARTDTSQSVRSGKSTRSVKSS
                     KSRRSQSSQNAGASGSLDAAGPADPSRATAAADGSGSDAAIEQEPLRATGSFSRRNSV
                     VSGLQPPLSKRGSSSSVFRESANGASTLQNKVHTATYASSTNGDLPPSMIQMAPKSPI
                     LKNSTSIGNLGPNTTYHENAVTDDENDENESHHHRRRSNDSRRYSQKSPVAGSRSNSS
                     SSNRRKSGSHLELPDSSMTSVQPSRTSSHSSAGNHSRKSSFNSSSGNTAYSTPMNSPG
                     VTKNSQDEYFEDSSEAQNDQSLQASRPRSRRNSIDEYPHEVSHSVDVDEDTNASITTK
                     TIKRKKSLRPLDIDETIQKLLDAGYSGKRTKNVCLKNSEIAQICNQVREIFLSQPSLL
                     ELSPPVKIVGDVHGQYADLLRLFTKCGFPPSANYLFLGDYVDRGKQSLETILLLLCYK
                     IKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKIFIDTFNTLPLAAIVAGKI
                     FCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTDSPHEWEDNERGVSYCY
                     NKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMSV
                     SEGLLCSFELLDPLDSAALKQVMKKGRQERKLANQQQQS"
     gene            <340594..>341034
                     /locus_tag="KLTH0G04268g"
                     /db_xref="GeneID:8293488"
     mRNA            <340594..>341034
                     /locus_tag="KLTH0G04268g"
                     /product="KLTH0G04268p"
                     /transcript_id="XM_002555176.1"
                     /db_xref="GeneID:8293488"
     CDS             340594..341034
                     /locus_tag="KLTH0G04268g"
                     /note="similar to uniprot|Q04082 Saccharomyces cerevisiae
                     YDR437W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0G04268p"
                     /protein_id="XP_002555222.1"
                     /db_xref="GeneID:8293488"
                     /db_xref="InterPro:IPR013717"
                     /db_xref="UniProtKB/TrEMBL:C5DLX4"
                     /translation="MVKGVPRREYFGFSQFIFTTCILLLTFVWSLAPTLSAFKTEDAS
                     IRNEIITFTQELVGLLPQRYWIIVFECVVLMAMLFTYLGLWMYNEDVLTAPLDDMRTI
                     TDSRANVVKFASHQEFLDKYAFRESSGVMDLPITEVCRVLYEKD"
     gene            complement(<341187..>342656)
                     /locus_tag="KLTH0G04290g"
                     /db_xref="GeneID:8293489"
     mRNA            complement(<341187..>342656)
                     /locus_tag="KLTH0G04290g"
                     /product="KLTH0G04290p"
                     /transcript_id="XM_002555177.1"
                     /db_xref="GeneID:8293489"
     CDS             complement(341187..342656)
                     /locus_tag="KLTH0G04290g"
                     /note="weakly similar to uniprot|P50109 Saccharomyces
                     cerevisiae YML017W PSP2 Asn rich cytoplasmic protein that
                     contains RGG motifs high-copy suppressor of group II
                     intron-splicing defects of a mutation in MRS2 and of a
                     conditional mutation in POL1 (DNA polymerase alpha)
                     possible role in mitochondrial mRNA splicing"
                     /codon_start=1
                     /product="KLTH0G04290p"
                     /protein_id="XP_002555223.1"
                     /db_xref="GeneID:8293489"
                     /db_xref="UniProtKB/TrEMBL:C5DLX5"
                     /translation="MSLEEFFNENSLGDSAWDEEDINLDAISSPLTNTTSIDVLKHTP
                     LRIATRAPEDHEFHAGFQGAAQTRSPPYIVKFAHLPSQFTGPEIEDLFQTKCTKFIKF
                     KIFWELNKKPSMGVAFKNSNVFDANFTRASKVAFTELYSARDLDKILSYWTEPLKELY
                     EIIVTPADFADFMNYMEKTKLLSEADDPTRPYKPRKDGLKTRSDIKKTKNNPFGTAHP
                     VDEVDPTGDVQVKLSKMRVHDDSKSREVLRGAETKTRPDDAALAAAAAGPEKSAAAPQ
                     PLSYSAMLKKSVDAAASASTPVSLVPTSALGHSEADSNTNIDEDNADGTHQGSSNGDE
                     NDDDQSHSNGNFTFKDNQRKGYQSGTRGRGTGRGGRGGRSDNGGRGDHSERGERGERG
                     ERGERGGYRGRGGSRGGFSRGGDSDRKFDDSRPRGKFQSNREDNPYSVFRPASGFLRE
                     STSSNGSRGGRGGRGSFNGDRGRGGSRGGRGDRRGFTAV"
     gene            <343552..>344778
                     /locus_tag="KLTH0G04312g"
                     /db_xref="GeneID:8293490"
     mRNA            <343552..>344778
                     /locus_tag="KLTH0G04312g"
                     /product="KLTH0G04312p"
                     /transcript_id="XM_002555178.1"
                     /db_xref="GeneID:8293490"
     CDS             343552..344778
                     /locus_tag="KLTH0G04312g"
                     /note="similar to uniprot|Q03730 YML018C Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G04312p"
                     /protein_id="XP_002555224.1"
                     /db_xref="GeneID:8293490"
                     /db_xref="GOA:C5DLX6"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:C5DLX6"
                     /translation="MGIRTNSQKWTLGLIFLGVVVILWVLSSFLINQIFEDGLYRKPF
                     LLTYINTASFVFYLLPTFRAVCANYWATGSFHIRRELVLEEEGPHEERELPLDEEQGA
                     ASAAAGAAAAATTLSPLIPKDSAEAPNDALTGAKLSLRATIQLSGQFCILWFLANLVT
                     NASLSYTSVASQTILSSTSSFFTLLIGSLFHVESVNRVKVLGSVISFVGIVFVTKSDA
                     DNTASAGEVHSAVPYKFHNGISSDNTEAFVIFCGNLLALAGALFYGLYCTLLKWRIRD
                     ETRVNMKIFFGFVGLFTLVLLWPTVVLLHFLGWETFELPPTPQVLAIVLFNCVITFIS
                     DFCWAKAMLLTSPLTVTVGLSTTIPFAMLGDFLFKSRPMSFIYLLGAALICASFFIVN
                     KESEEEFQLDEHQSVA"
     gene            complement(<344829..>345806)
                     /locus_tag="KLTH0G04334g"
                     /db_xref="GeneID:8293491"
     mRNA            complement(<344829..>345806)
                     /locus_tag="KLTH0G04334g"
                     /product="KLTH0G04334p"
                     /transcript_id="XM_002555179.1"
                     /db_xref="GeneID:8293491"
     CDS             complement(344829..345806)
                     /locus_tag="KLTH0G04334g"
                     /note="similar to uniprot|Q03723 Saccharomyces cerevisiae
                     YML019W"
                     /codon_start=1
                     /product="KLTH0G04334p"
                     /protein_id="XP_002555225.1"
                     /db_xref="GeneID:8293491"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:C5DLX7"
                     /translation="MRISGLIWLFTLIGLGNCLEWDDVSDLRDADGIIEVTESNYRKL
                     SQGSRNFYSILYVTTSQVTSGGVYCELCDIFEGNVRKASNAMQQQLPEDVNREAVFFK
                     LDVSQCSSFVKEIGLQTIPHMLIYPPPKDEDSFAWSKSVFYQFQITPESAKDPVLFAD
                     FLAKILNVYFGVARDFDKEEFFQYFIASLACFFVLKKKILPLIPNKAWFFSLLFSLGV
                     VLASVTGLKFTQINNIPLLAKDEKGNIMFFSGGMGWQFGIEIFSVSTMYIAMGSSVIA
                     LIFIPRVKQLNPFLSNAVSLALLALGFYVFAYFTSCFKVKDPGYPFAIL"
     gene            <345922..>346668
                     /locus_tag="KLTH0G04356g"
                     /db_xref="GeneID:8293492"
     mRNA            <345922..>346668
                     /locus_tag="KLTH0G04356g"
                     /product="KLTH0G04356p"
                     /transcript_id="XM_002555180.1"
                     /db_xref="GeneID:8293492"
     CDS             345922..346668
                     /locus_tag="KLTH0G04356g"
                     /note="some similarities with uniprot|Q04087 Saccharomyces
                     cerevisiae YDR439W"
                     /codon_start=1
                     /product="KLTH0G04356p"
                     /protein_id="XP_002555226.1"
                     /db_xref="GeneID:8293492"
                     /db_xref="InterPro:IPR018479"
                     /db_xref="UniProtKB/TrEMBL:C5DLX8"
                     /translation="MSTLIQLLANYYESVIECERIYYEHVNCSKVQQEPMQRDSLLVK
                     ETISLQRQIAQLTADCNQQKRENERLKQVHKTQLALLESKLENARKHSRPKTPDGATR
                     RDKDSKSVHLLSPISKKKPKANGSSNGIAGAHGTPSAGQSNGLRHAIYKNKPTLFDED
                     ASEVAENSNEISFLTSIKGKDKLADIVLPKDTLDSSSDLEEESNDDANTAKKNPEPEQ
                     KQKKRRLTKKRIQRVDSDGENHLLSTQGEQ"
     gene            complement(<346716..>348611)
                     /locus_tag="KLTH0G04378g"
                     /db_xref="GeneID:8293493"
     mRNA            complement(<346716..>348611)
                     /locus_tag="KLTH0G04378g"
                     /product="KLTH0G04378p"
                     /transcript_id="XM_002555181.1"
                     /db_xref="GeneID:8293493"
     CDS             complement(346716..348611)
                     /locus_tag="KLTH0G04378g"
                     /note="similar to uniprot|Q03722 YML020W Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G04378p"
                     /protein_id="XP_002555227.1"
                     /db_xref="GeneID:8293493"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DLX9"
                     /translation="MGSQSSIKSSVSSIKSQNVDRSTPAAAKSIKSGESKDKRATSPP
                     AGWSLWGSRNEGVQQLPSGNQTQGTAGGSAGWWRKPSITSLRTFVKNDPSADQANKDT
                     ATVPEESEEAKTCAEPRKRAWSFWNRKSAECGNEQPAEVLNSPGSSTNIAKPVINEII
                     TGVSDDALLYKKRSKDDTAGEQNLESKNEEQGYSSNILTPQFEILPELTTMASIYSSI
                     GKYGHKWNLLSKEKFQPKSLYRIEPSASIASIRANAKEPVRVLLIGVHGFFPTKMIRP
                     LIGEPTGTSTKFITEAEKAVIRWFREQDTPVEISKIALEREGKVLDRVEFFFEVLKKW
                     ADEINKADFVYFVAHSQGCPVTIILLARLIEAGVIEVDQNGAQSGKKSGQSQRRKIVS
                     VLAMAGVNNGPFYGVDQTLFVRAYSTIESDSMRELFQFQNFHSLQAKKFIQSLRLIIA
                     SNVKVTFVGSINDQLVPLYSSTCLFAHHPNIFKATFIDKDSKTPDFITRIVGIANHLN
                     NLGYDDHGIIKEVSGSLAGTLTGGGHSKIYNEGQVYDLGIKFALQTSELPTPQAVAYK
                     TYQVDELGSNPYHLPWCMRGLLYETGLHIGREQIVDLFHEFDVWEPETKLLKDVKYRL
                     SGLRSKL"
     gene            <348854..>349879
                     /locus_tag="KLTH0G04400g"
                     /db_xref="GeneID:8293494"
     mRNA            <348854..>349879
                     /locus_tag="KLTH0G04400g"
                     /product="KLTH0G04400p"
                     /transcript_id="XM_002555182.1"
                     /db_xref="GeneID:8293494"
     CDS             348854..349879
                     /locus_tag="KLTH0G04400g"
                     /note="similar to uniprot|P12887 YML021C Saccharomyces
                     cerevisiae UNG1 uracil DNA glycosylase"
                     /codon_start=1
                     /product="KLTH0G04400p"
                     /protein_id="XP_002555228.1"
                     /db_xref="GeneID:8293494"
                     /db_xref="GOA:C5DLY0"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="UniProtKB/TrEMBL:C5DLY0"
                     /translation="MSANGTKRLRTEGPPGEGTKKQKTLMEFFGGKKVSPAKKKTDAT
                     TAKVLDTGTVAAAIPKRDGASLHQIGQQDKSEFRKSLTERQLKLLGLELDTLDDEWFA
                     KLVSEFTKPYFLKLKDFVIEQQQTATVFPPPQDVYSWSRLTPFDQVRVVVIGQDPYHN
                     FNQAHGLAFSVKPPTPAPPSLKNIYKELKEHNYADFQIDNKVGDLTHWATQGVLLLNT
                     CLTVRAHNANSHSKRGWEQFTKRVVQLIIEDRKRSGKPIVFLLWGSNAGNLVKGLLGS
                     PPVNFLMLSSVHPSPLSASRGFFGNKHFKKINEWLYDRNEPMIDWSVVPGSKIKEIEN
                     KNLVLDI"
     gene            <350035..>351798
                     /locus_tag="KLTH0G04422g"
                     /db_xref="GeneID:8293495"
     mRNA            <350035..>351798
                     /locus_tag="KLTH0G04422g"
                     /product="KLTH0G04422p"
                     /transcript_id="XM_002555183.1"
                     /db_xref="GeneID:8293495"
     CDS             350035..351798
                     /locus_tag="KLTH0G04422g"
                     /note="similar to uniprot|Q04089 YDR440W Saccharomyces
                     cerevisiae DOT1 Nucleosomal histone H3-Lys79 methylase"
                     /codon_start=1
                     /product="KLTH0G04422p"
                     /protein_id="XP_002555229.1"
                     /db_xref="GeneID:8293495"
                     /db_xref="GOA:C5DLY1"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR021162"
                     /db_xref="InterPro:IPR025789"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DLY1"
                     /translation="MSIETSFETGSAKPDEASSLPVASPSKDGGRTTSHVPKKRVNKS
                     LLSLLNDACKYSAYSEYSMPSGFLRRKGPNSCETTAKGDGLQKETQGSDISSSSISVA
                     VRKQRPASKKRQAELLNNGSNENLQEAATKKRPSRIKKASHQNKRSFKLVSETAHTPE
                     VSMGLQPDVTSSQNDLMDHGILRKELVVSQRANSFIEDPIEHFTCRRDLFDSDALQSK
                     EMFEDELIHSRSLSDPPHVNPNVVKLRSILYPDYEEEYIVDFSTDLSKYNPMSEIGRI
                     IEYTLQIYVPTKFANQLRKKVVQPLNKAFDEQNQKGFIQAVEAFNELVKKIPRADIVE
                     RLRRTKAVPTSFFHSLLHMVYVRTIHPKARSLKEYRAFSNNVYGELLPNFLTAAYAQC
                     GLKPGDIFMDLGSGVGNCVLQAALEFGCSLSFGCELMPSASDLTTTQESELQRRCRLW
                     GLKLCPTQFSLRTSFVNNSTVDELLPKCDVLLINNFIFDAKLNLQIQKLIQVLKPGCK
                     VISLKNLRPFGYTINFDDVGNIMNRLTVKKYDLPENSVSWTHRGGEYYISTVGEDIDE
                     SIFTTHSKGRVRMGRRVKYTR"
     gene            complement(<351969..>352529)
                     /locus_tag="KLTH0G04444g"
                     /db_xref="GeneID:8293496"
     mRNA            complement(<351969..>352529)
                     /locus_tag="KLTH0G04444g"
                     /product="KLTH0G04444p"
                     /transcript_id="XM_002555184.1"
                     /db_xref="GeneID:8293496"
     CDS             complement(351969..352529)
                     /locus_tag="KLTH0G04444g"
                     /note="highly similar to uniprot|P49435 YML022W
                     Saccharomyces cerevisiae APT1 Adenine
                     phosphoribosyltransferase"
                     /codon_start=1
                     /product="KLTH0G04444p"
                     /protein_id="XP_002555230.1"
                     /db_xref="GeneID:8293496"
                     /db_xref="GOA:C5DLY2"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DLY2"
                     /translation="MPNSSVAQELRSALHQYPNFPSKGILFEDFLPIFRSPQLFGKLV
                     KAFKTHFEEKFAGVKIDYIVALEARGFLFGPAVALEIGAGFVPVRKQGKLPGECLHAT
                     YVKEYGSDVFDIQVESIPEGSNVVIMDDIIATGGSALAAGELIEKLGANLLEYAFFME
                     LDFLKGREKLQAPVFTLLTGQEHGLQ"
     gene            <352698..>354323
                     /locus_tag="KLTH0G04466g"
                     /db_xref="GeneID:8293497"
     mRNA            <352698..>354323
                     /locus_tag="KLTH0G04466g"
                     /product="KLTH0G04466p"
                     /transcript_id="XM_002555185.1"
                     /db_xref="GeneID:8293497"
     CDS             352698..354323
                     /locus_tag="KLTH0G04466g"
                     /note="weakly similar to uniprot|Q03718 Saccharomyces
                     cerevisiae YML023C NSE5 Protein required for cell
                     viability"
                     /codon_start=1
                     /product="KLTH0G04466p"
                     /protein_id="XP_002555231.1"
                     /db_xref="GeneID:8293497"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:C5DLY3"
                     /translation="MSILSHGSEKVGVPYNVGLTTESLSVFEVLNSLCVVENYDQLLY
                     YLEARRSALAVPPADVLIVMMTLSVIPDFGAATLEAEMDPYNVGRASLATRSIKLLRH
                     FTDILLSEHAEEENHYSLALLRSQFFIMLDQLSLRGITSTRVRERDFTKRRKTNSGVL
                     LEASPSIFRDDQSPPLLSFKNPYPSYVSCLEHRPEVLKNMPITSKLSQEGEFWNCVGW
                     ALYASLSDDSHIYERSKVWFAVLSVLFDAFEMRNKYSIDSETDPTANNAARLSFIERS
                     PLVALFRSLNSQGLIQAFCDILFLGCSYELAGKLRVHCVYPKELMQVDTYVPKLLART
                     SCKFTQSMSFRHRLLSLFLTMLRSIPEGVEFSKPCLSEAGFVRHLGKVLSSFEDTSQL
                     KQFFSVTNPYEFLDYMPLFAQAAANESLKAFDANYTLSLVEKLANNDLVIEELGNVFE
                     AGFPPLDENYDSRPEQFYSSIEKCDIFLLVILRYWEYIHGAQLKMTRMRCAIRALSVS
                     DQKRLEFAKLRGWDVLHVPSLHDHFLSVLSISR"
     gene            complement(<354359..>358429)
                     /locus_tag="KLTH0G04488g"
                     /db_xref="GeneID:8293498"
     mRNA            complement(<354359..>358429)
                     /locus_tag="KLTH0G04488g"
                     /product="KLTH0G04488p"
                     /transcript_id="XM_002555186.1"
                     /db_xref="GeneID:8293498"
     CDS             complement(354359..358429)
                     /locus_tag="KLTH0G04488g"
                     /note="similar to uniprot|P38931 YDR443C Saccharomyces
                     cerevisiae SSN2 Required for stable association of
                     Srb10p-Srb11p kinase with RNA polymerase holoenzyme"
                     /codon_start=1
                     /product="KLTH0G04488p"
                     /protein_id="XP_002555232.1"
                     /db_xref="GeneID:8293498"
                     /db_xref="GOA:C5DLY4"
                     /db_xref="InterPro:IPR009401"
                     /db_xref="UniProtKB/TrEMBL:C5DLY4"
                     /translation="MEYKETPYRLEDLLTSFYRVENINKINYVQYIPSKPDAQWSIQA
                     ELALRKHNPKILVSLFSRELWCFSINEEELPKLNLDLLGNPPSPEKIGYFTPNISKPN
                     LPTAYAVFLKALRRKIHINICLKSHQRIIPFGNSCLYNTNEKTNKVIHFEPQLFENGD
                     LCISICTKDVNLRSFNTKTINENFMKSNAIYLAPSGIRAYLVSSDIKKCVSPPPKSAS
                     VLLITLLVSHGIDLTKKKDITWVKVTPNLDHLNGYTPSISGYLDPPKATKTAIWPLEL
                     CFSQLADSLVSTQTPPSPRVPDLQGTFDIIDDFIQLKLTSAFKSPGNTCTGASIGTAT
                     GNEALSTGGTYGEQYQAFHKRSQSGSMSAAGPVGYQLGARQSPSINAANLTPANNKPA
                     SHPPDAYINGFLTTPNINESVDANNDDIMLGVSPQKLRSELWSEKKDSDVGFGLKLNT
                     PVENTEISTASEKDDADLDAELFGDDNADDEVPGNSNLKGDENKQVEQGVKDITDEMF
                     DMADESDSPKDKSEVAKQPAVLDLRRSPFKRKYLDIPLEEMTLPSTPLYTDPGAPLPV
                     ETPKDRKKSVFAPLNFNPIIESNVDNKYKNGGKFSFDGGKVEESLKFDVSTANVSSSE
                     DDETGSSADEFDDMFTGGDNFKSTDVNAPTTAFAAESQTGNVPEFVQQDTPPLPIFDN
                     SVNNEKAIRDNSLEMWKFSRDQSSQDFGSPKTHSSSSSARPSQFQIAGNGSNDLLKPN
                     NTNPLLEQTSKSYLPINDNNVDSTNGVDKEIGDSLSPESMPTPESSNSLPFLLRHMPL
                     FSIPDAFFLNNPSLAANDDIPSLLDLLCEQIVFDQGKMGDLKCRTATYNNFEACSDGV
                     VKTTIDDIFSKFQRLHGGELIEEISPIRQPAVYVKKNDEVIKIKSDSEPFSQYLHLKP
                     YKGIKSFKGLFLTTILKNDCLEFLSTMSQIYSSHELGFCELVKLTSADTPGLIYLVNL
                     EESTLSLLSAQIVSYCSTNTLNTMSVPLVVFLPIMSSNLSEVVAMTLKFQFIKNEILS
                     KLPSVKLCLKLIPLDFVKDPLTSIEEYYDFCVGIYNTLPPKSDKFTSIADEVPKKIEF
                     RTIQKTNGQTSHFDVYIHLAYARSVDRNWICAAWSNSNGSENGVKTWYIGNSKNAFED
                     ACNRMWRITLKFASNKYGRVCLVLSRFDSVLPDDELMHWRRLSSTSRNLHLAVVCVGD
                     NTKVSLYDEDRIYPSFKPIFRDGRLSQKIDTSNLDNYEIVDIGSEIHGIVFRSPLHLA
                     NSQHRCAINTGALVRFKAADCDEILDKMEVNLLNCPHSDSTKLLKIILQEFRNLASLN
                     PWFGISKSKDAFVPWHVLAVKKMLRTMVHLKVKDNP"
     gene            <358564..>360450
                     /locus_tag="KLTH0G04510g"
                     /db_xref="GeneID:8293499"
     mRNA            <358564..>360450
                     /locus_tag="KLTH0G04510g"
                     /product="KLTH0G04510p"
                     /transcript_id="XM_002555187.1"
                     /db_xref="GeneID:8293499"
     CDS             358564..360450
                     /locus_tag="KLTH0G04510g"
                     /note="similar to uniprot|Q04093 Saccharomyces cerevisiae
                     YDR444W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G04510p"
                     /protein_id="XP_002555233.1"
                     /db_xref="GeneID:8293499"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DLY5"
                     /translation="MTVSSEEGLLLVDDRLSLKLGQLIRYKITVDKSLLEPHLTSISE
                     LYLAFKNTESALLKPVYLTGPYSFYVDIQPCNYNEWEGYDEEVAFCDDVKPNDEYRAV
                     LKLNNNSRFENSEKFVWQINVVSQLSVTNLPSLRFRLCLTTKPTPEMPKGPVEFPKGV
                     VCEKWDTHRLWNLPPRSPDKPVHLVILTHGIFSNAGCDMVYLKDRIEATASTVGNGSE
                     TSNLIVRGFKGNQGRSSKGVKSNGIALAKYIIETIDNLKIRYDLRYISFVGHSLGGLT
                     QSMAIRYICIERPDIFDSSNGLEPLNFITLASPYLGVAGEVPPFVTAILDIGALGQTG
                     VDLNLNRTFFLRKEGIVRKDQHLGSYKRKPLLEIIPSEPLKSLMHRFKNRTTYANILH
                     DGIVPLRTAALLYLDWKALSDVRGIRKENGKGDKGTPDSTSKNDVTGKIPEESMDKKS
                     ALKYLLPQGAIRRKYKRYSRTQIRNQNEDESKQQGGESGGFTPPPNANPIISAANVIV
                     APLPSQEYFKDPKSREDRIVHDKVYFPDELPPAHYKKRELIKKVIYPNDRIYRVQERI
                     ARQWQETLTWRKVLVSIQPDSHNNIVVRRKFVNAFGWVVIDHLVKEHFGAEGKTQSVS
                     DSRS"
     gene            complement(<360504..>362222)
                     /locus_tag="KLTH0G04532g"
                     /db_xref="GeneID:8293500"
     mRNA            complement(<360504..>362222)
                     /locus_tag="KLTH0G04532g"
                     /product="KLTH0G04532p"
                     /transcript_id="XM_002555188.1"
                     /db_xref="GeneID:8293500"
     CDS             complement(360504..362222)
                     /locus_tag="KLTH0G04532g"
                     /note="similar to uniprot|P32891 Saccharomyces cerevisiae
                     YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
                     pyruvate transcription is heme-dependent repressed by
                     glucose and derepressed in ethanol or lactate located in
                     the mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0G04532p"
                     /protein_id="XP_002555234.1"
                     /db_xref="GeneID:8293500"
                     /db_xref="GOA:C5DLY6"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:C5DLY6"
                     /translation="MFSRCRFVIKGGSRFSTKTSLTNASRSGIRLFSTSPISGPKFLG
                     SAIGFALLSFGLGLAVSSLVIPKQDAQVQTFPLASTTPLEQLDSPRYGSEEDLEKCVD
                     EIRRVVGDELVKNTPVEIDYHTDNGFNPSKPLPHQKPRYIVYPLSTEDVSKIMKIVNQ
                     YNIPVVPYSGGTSLEGHTYSTRPGIVLNTSKMNKILQVNVDDLDAVLQAGVGWQDLNE
                     YLSKHEGMDNLMLGCDCGPGAHVCGMISTNASGIGATRYGSMASNVVSIKAVLADGTV
                     IKTKLRPRKSSAGYNLTGLLVGSEGTLAIVTEVVVKLQVKPGYETVAVVQFPDVNDCT
                     KSMASFFKKGIPLNAVELLDADMMRCVNYSDLVSKKFENLPTLFIKIGGLNKVIVDEY
                     VKEVSAISKSNNCNTFEFARTAEEAEELFFARKNALYIMLDYGFNEISPDAKMWITDC
                     AVPLSRLASTLEQLNDMMKEYPLHHMVLGHGDANLHYDIFYTPDQLEMCKEAVDRMAK
                     LTIENEGTCSGEHGIGSGKRALLELELGKDTISMMRKLKLALDPKRLLNPDKVFKIDP
                     LDASTE"
     gene            <363047..>363904
                     /locus_tag="KLTH0G04554g"
                     /db_xref="GeneID:8293501"
     mRNA            <363047..>363904
                     /locus_tag="KLTH0G04554g"
                     /product="KLTH0G04554p"
                     /transcript_id="XM_002555189.1"
                     /db_xref="GeneID:8293501"
     CDS             363047..363904
                     /locus_tag="KLTH0G04554g"
                     /note="weakly similar to uniprot|Q04110 Saccharomyces
                     cerevisiae YDR446W ECM11 Non-essential protein of unknown
                     function GFP fusion protein is present in discrete
                     clusters in the nucleus throughout mitosis may be involved
                     in maintaining chromatin structure"
                     /codon_start=1
                     /product="KLTH0G04554p"
                     /protein_id="XP_002555235.1"
                     /db_xref="GeneID:8293501"
                     /db_xref="InterPro:IPR029178"
                     /db_xref="UniProtKB/TrEMBL:C5DLY7"
                     /translation="MDDIKQEPTTRLDLFGSSPAKTPPIVEKIREENNSRSALKEKTV
                     NIQAILKKPTPVDEQRDQKASKRFQNHESPSISAPTSAIKEHKQPVVKAEPSSISLTH
                     PAPTFEQDLAQSPTAKKQKRAQTPSSIPLLKQEVAPLTPNMPPARKQTKENSKAKTSA
                     RVLSSDPGPYKPVVSALHEVNPNVETREYYCEVFQEVQNNTERSACVDFAKMDLKSWI
                     SAGQVLQQEHAAILGRLVEARMRLNSKFKVITDLINDRAAALNAQGGILDQKLRRIQD
                     LGKEILDII"
     gene            complement(<364039..>364744)
                     /locus_tag="KLTH0G04576g"
                     /db_xref="GeneID:8293502"
     mRNA            complement(join(<364039..364446,364742..>364744))
                     /locus_tag="KLTH0G04576g"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_002555190.1"
                     /db_xref="GeneID:8293502"
     CDS             complement(join(364039..364446,364742..364744))
                     /locus_tag="KLTH0G04576g"
                     /note="highly similar to uniprot|P02407 Saccharomyces
                     cerevisiae YML024W RPS17A and to uniprot|P14127
                     Saccharomyces cerevisiae YDR447C RPS17B Ribosomal proteins
                     51 (rp51) of the small (40s) subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_002555236.1"
                     /db_xref="GeneID:8293502"
                     /db_xref="GOA:C5DLY8"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="InterPro:IPR018273"
                     /db_xref="UniProtKB/TrEMBL:C5DLY8"
                     /translation="MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRMCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPAVSALDLSHSKGVLNV
                     DNQTADLVKNLGLKLPLSVSNVSAQRERRYRRRN"
     gene            <365673..>366980
                     /locus_tag="KLTH0G04598g"
                     /db_xref="GeneID:8293503"
     mRNA            <365673..>366980
                     /locus_tag="KLTH0G04598g"
                     /product="KLTH0G04598p"
                     /transcript_id="XM_002555191.1"
                     /db_xref="GeneID:8293503"
     CDS             365673..366980
                     /locus_tag="KLTH0G04598g"
                     /note="highly similar to uniprot|Q02336 Saccharomyces
                     cerevisiae YDR448W ADA2 Transcription coactivator
                     component of the ADA and SAGA transcriptional adaptor/HAT
                     (histone acetyltransferase) complexes"
                     /codon_start=1
                     /product="KLTH0G04598p"
                     /protein_id="XP_002555237.1"
                     /db_xref="GeneID:8293503"
                     /db_xref="GOA:C5DLY9"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR016827"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:C5DLY9"
                     /translation="MSNKFHCDVCSSDCTNRVRISCAECPEYDLCVPCFSQGLYNGNH
                     RPFHNYKIIETNSYPILCEDWGADEELALIKGSQTLGLGNWQDVADHIGNRTKEEVDE
                     HYTKYYLNSPYYPIPDITQNIDIPQEQFLNDRRRRIERFRGQPLQPPRKPIASVPSCH
                     EVQGFMPGRLDFETEFENEAEGPVKDMVFEPDDQPLDIEVKLIILDIYNSRLTTRAEK
                     KRLLFENGLMEYRKLQGIDKKRSKESKDLFNTLKAYARIMTPRDFEEFSKDVLEELRC
                     RSRIHQLQEWRSNGITTLEAGLKYERDKQARIMTLERFGSSLHSSSNGNGNGRHRVSS
                     AHRANADYGQNYNEAASRKKALTTGDIQHGADFGLLSGEEQQLCIQLKILPKPYLAIK
                     EVMFRELLRAGGNMKKKTCRELLNIDPAKANRIYDFFQSQRWL"
     gene            complement(<367028..>368365)
                     /locus_tag="KLTH0G04620g"
                     /db_xref="GeneID:8293504"
     mRNA            complement(<367028..>368365)
                     /locus_tag="KLTH0G04620g"
                     /product="KLTH0G04620p"
                     /transcript_id="XM_002555192.1"
                     /db_xref="GeneID:8293504"
     CDS             complement(367028..368365)
                     /locus_tag="KLTH0G04620g"
                     /note="similar to uniprot|Q02354 Saccharomyces cerevisiae
                     YDR449C UTP6 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="KLTH0G04620p"
                     /protein_id="XP_002555238.1"
                     /db_xref="GeneID:8293504"
                     /db_xref="GOA:C5DLZ0"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ0"
                     /translation="MSSKARYYLEQAIPEVDDLINKGLFTKNEVSTIMKKRTDFEHRL
                     NSRGSRIKDYEKYIEYESALEKLRQKRVKRILEGVKTNSVSDWSIEQRIQFIFQRGCN
                     KFPKDLKFWSLYLNHLKSRGHKTSYRKIHNVYNQLLKLHPTNIDIWVSCAKYEYEVHA
                     NFKSCRTVFQTGLRFNPDSPQLWHEYVKFELNFITKLINRRRVLGLINEREQELDMQA
                     QQQEARAQAESDSEEGTESTGISTGDAMKDKLNELPEADMDMLGNEDTNPALRGDIAL
                     TIFDLAMKSLGKSFLERHKGYYAVIDSKPDADLNAAAVKYLFDISMSYIALFHEFPDL
                     QRDYLTNHVLQYWKSNPYDVQLDKAMPDLYVKLLTLEITLNLRYTDIEKLDVDQLQLS
                     VNKFVAYKSKVSEDLRRQLTLSFVSYLQERILSRMDKDEDPRYKILNAIIKKL"
     gene            <368885..>369649
                     /locus_tag="KLTH0G04642g"
                     /db_xref="GeneID:8293505"
     mRNA            <368885..>369649
                     /locus_tag="KLTH0G04642g"
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /transcript_id="XM_002555193.1"
                     /db_xref="GeneID:8293505"
     CDS             368885..369649
                     /locus_tag="KLTH0G04642g"
                     /note="similar to uniprot|P51998 Saccharomyces cerevisiae
                     YML025C YML6 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /protein_id="XP_002555239.1"
                     /db_xref="GeneID:8293505"
                     /db_xref="GOA:C5DLZ1"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ1"
                     /translation="MRGIRMQSSQSKALSGAALPPAFTLATLRSFPSLEPLTFVPVPA
                     SVLDAPLRRDILWKAVVYENDNKRVGSSNPPGRSENGYSRRKLLPQKGSGKARAGDAN
                     SPTRHNGARALARSAPNDYTTKLPQKVYSQAFINALSYQYRRGNLFIIGGTHSLCETH
                     DLDVNELEVLPTSLENDDGELVFEKFLQEHELQKQNLLFVINAPRGGLFRYSEPFKEN
                     VNIVQKEFVDVNDILKARRIFIELEALEYLAVTHSI"
     gene            <370304..>370954
                     /locus_tag="KLTH0G04664g"
                     /db_xref="GeneID:8293506"
     mRNA            join(<370304..370350,370561..>370954)
                     /locus_tag="KLTH0G04664g"
                     /product="40S ribosomal protein S18"
                     /transcript_id="XM_002555194.1"
                     /db_xref="GeneID:8293506"
     CDS             join(370304..370350,370561..370954)
                     /locus_tag="KLTH0G04664g"
                     /note="highly similar to uniprot|P35271 Saccharomyces
                     cerevisiae YML026C RPS18B and highly similar to
                     uniprot|P35271 Saccharomyces cerevisiae YDR450W RPS18A
                     proteins component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S18"
                     /protein_id="XP_002555240.1"
                     /db_xref="GeneID:8293506"
                     /db_xref="GOA:C5DLZ2"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ2"
                     /translation="MSLVIQEQGSFQHILRLLNTNVDGNIKIVYALTTIRGVGRRYAN
                     LVCKKADVSLQKRAGELTQEELERIVQIMQNPTQYKIPAWFLNRQKDVNDGKDYHNLA
                     NNLESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRKRA"
     gene            complement(<371252..>372379)
                     /locus_tag="KLTH0G04686g"
                     /db_xref="GeneID:8293507"
     mRNA            complement(<371252..>372379)
                     /locus_tag="KLTH0G04686g"
                     /product="KLTH0G04686p"
                     /transcript_id="XM_002555195.1"
                     /db_xref="GeneID:8293507"
     CDS             complement(371252..372379)
                     /locus_tag="KLTH0G04686g"
                     /note="similar to uniprot|P34161 Saccharomyces cerevisiae
                     YML027W YOX1 Homeodomain-containing transcriptional
                     repressor binds to Mcm1p and to early cell cycle boxes
                     (ECBs) in the promoters of cell cycle- regulated genes
                     expressed in M/G1 phase expression is cell cycle-regulated
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0G04686p"
                     /protein_id="XP_002555241.1"
                     /db_xref="GeneID:8293507"
                     /db_xref="GOA:C5DLZ3"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ3"
                     /translation="MLPPINSLLQEHRGERSQSEPCSPFFSPARLNSFKLDDKGVIKL
                     PPLLGQTPRQPCTPAPMARTLAPVQDLNVIGISTPRASLKRAQSCSSVIESSPIFAHR
                     SVPETPDAPVTNKPAHTRAMTPNSLTKTPAADHRKAFAFITHSQDTFPSKEPSIDNAP
                     LARRKRRRTSKHELNILQSEFEICPTPDKQKRAELSKRCCMSEKAIQIWFQNKRQSVK
                     RQQKATSSDTSAPSTERPEAHTVTPLATRTLRPGHAFKQDPATPSSSILDTSNLVLES
                     VPPSDVAYCSPTLSKQQSHQQLGRGQALTFRLKNDTKTLTPIRTSPNNRVNKLINGNK
                     RPSPSSDNISPTRKSKCTFKAYQDTHKRSALEEVNVNILRS"
     gene            <373469..>375484
                     /locus_tag="KLTH0G04708g"
                     /db_xref="GeneID:8293508"
     mRNA            <373469..>375484
                     /locus_tag="KLTH0G04708g"
                     /product="KLTH0G04708p"
                     /transcript_id="XM_002555196.1"
                     /db_xref="GeneID:8293508"
     CDS             373469..375484
                     /locus_tag="KLTH0G04708g"
                     /note="similar to uniprot|Q04119 Saccharomyces cerevisiae
                     YDR452W PPN1 Vacuolar endopolyphosphatase with a role in
                     phosphate metabolism functions as a homodimer"
                     /codon_start=1
                     /product="KLTH0G04708p"
                     /protein_id="XP_002555242.1"
                     /db_xref="GeneID:8293508"
                     /db_xref="GOA:C5DLZ4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR012358"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ4"
                     /translation="MSEKKAEYETRSSNCRQWRLRTLLYIILAFPLLVVVCVKKEQLI
                     HMLRAPSGQRLSVEEVPSEQLAGHLEALGLSPDSSVKVVRFSNGKSQKLRGRFLHITD
                     IHPDPLYKTGSSIENVCHRGRPEGKKDEATRFGTAMAGCDSSMDLMEYTLKWIENNLR
                     DKIDFVVWTGDNIRHDNDRNNPRTEAEIFDMNSKLTKRFEAMFRNPDSVDPRDFDVSI
                     VPSVGNNDVFPHNLFSLGPTLQTREFYNMWANLIPEDQQRAFARDTSFFVEVIPGKLA
                     VLSINTLYLYKANPLVDNCNSKKQPGYQLLLWLGYVLEELRERGMKVWLTGHVPPLPK
                     NFDQSCYDKYTLWTNEYRDVIIGGLYGHMNMDHFVPVDGKKSWKSVEASTNTVKRALD
                     DEDFSFEFNEDDGEVLESAIEASDVRLMGAKPVNKNAYMDSVREGFYKKVASRMGKVG
                     ANKKKGKKDKKKKKKKKKHPKDTSVERYSIVNIAGSVIPTFNPAFRVWEYNTTGLEEG
                     VTQEALNSFKPWDAFFRQLESQIEYDVSNKAEASAWDGLSSILRGSKKKKVDKTIPKR
                     MPSNLKPGPGYAPQLFSPTRFVQYYADLDVIDKEYKKALKLGASEEEAAESAFKYQVE
                     YCSDSEPYSMKSLLAQDYIDLAVKLAHDDTLWEKYTERAFCSTGYDG"
     gene            complement(<375576..>376166)
                     /locus_tag="KLTH0G04730g"
                     /db_xref="GeneID:8293509"
     mRNA            complement(<375576..>376166)
                     /locus_tag="KLTH0G04730g"
                     /product="KLTH0G04730p"
                     /transcript_id="XM_002555197.1"
                     /db_xref="GeneID:8293509"
     CDS             complement(375576..376166)
                     /locus_tag="KLTH0G04730g"
                     /note="highly similar to uniprot|P34760 Saccharomyces
                     cerevisiae YML028W TSA1 and to uniprot|Q04120
                     Saccharomyces cerevisiae YDR453C TSA2 Thioredoxin-
                     peroxidase"
                     /codon_start=1
                     /product="KLTH0G04730p"
                     /protein_id="XP_002555243.1"
                     /db_xref="GeneID:8293509"
                     /db_xref="GOA:C5DLZ5"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ5"
                     /translation="MVAQVQKPAPAFNKTAVVDGVFDEVSLDKYKGKYVVLAFVPLAF
                     TFVCPTEIVAFSDAAKRFEDLGAQVLFASTDSEYSLLAWTNVARKDGGLGPIDIPLVA
                     DTNHSLSRDYGVLIEEAGVALRGLFLIDPKGIVRHITINDLPVGRNVEEALRLVEAFQ
                     WTDKNGSVLPCNWTPGAATIKPDVEGSKEYFNAHGK"
     gene            complement(<377984..>380380)
                     /locus_tag="KLTH0G04752g"
                     /db_xref="GeneID:8293510"
     mRNA            complement(<377984..>380380)
                     /locus_tag="KLTH0G04752g"
                     /product="KLTH0G04752p"
                     /transcript_id="XM_002555198.1"
                     /db_xref="GeneID:8293510"
     CDS             complement(377984..380380)
                     /locus_tag="KLTH0G04752g"
                     /note="similar to uniprot|Q03714 Saccharomyces cerevisiae
                     YML029W USA1 Protein that interacts in the two- hybrid
                     system with the U1 snRNP-specific protein Snp1p may have a
                     role in pre-mRNA splicing"
                     /codon_start=1
                     /product="KLTH0G04752p"
                     /protein_id="XP_002555244.1"
                     /db_xref="GeneID:8293510"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ6"
                     /translation="MRYLAGSAINFSVWTPEPCATNIFVRAPPQATVARLLQYVHWQL
                     SQRSESPLLPTEEYCLVLDDQPLTLSTPLQTVSAHSGGVIKLKMQRNDGILKESGTSL
                     GYHGESDFAQTNVEFQLNVLSTDKLMSRLERGVSLNSTLAKLKKAAIGHLNDYETHNV
                     RNLCSIKQHTVQDLVGFDILGRLHPTYLTTDDSNNDLRLYDLLGFDFSPDKFGSCCVM
                     FRTRHDQELEDGISVRFISEASLTMDRMVVSTETTVHEMKEFICTVYGHTLRLTPADV
                     KLVYKGQLLQEANSTGQPSKVLEYISESRGAKVHVFINQEYTEPGPGFWNELFNSSER
                     FTFMSRSASENVSISAEEPRRTTSETNRPASMPSIQTPNAVHTSENLTQFPNSAVSVA
                     DEFTPARYDFFTESGYHIERTGERFERVLISGSEHFIPPNAFEPTVSIVKIAGIETEL
                     LPDEFSLSGGSLCLSTQAIKRIEDQLGVKLAHSVVVSLGPTPTSSSPHPSAGQAIIVP
                     ETRRMARIRQWVETIMRTVYLLLRNSVFYFVIFFQLVSFLPSFYFFLGIALIVLKAVW
                     STTEIWDMWRDLLWGEQADKLGEEEQVMLREILNTKPFDKQFYTRFTGNQAVTEALID
                     RLQNDLELREKLSGEFQLDYTESLQISVPKLFESCTATQFDQVGPESLTELFEPILNE
                     VAGHLDNTAGLSGAGKESLKLLRAYAYQQSKLPWYKGAIRWVSHKSSSLYNGGLVEWL
                     MPERVPRTRRGAGIRQVLHIIWDLLKLSCLFVLIVLPKFQIQAADMANRVATDEEHQD
                     "
     gene            complement(<380741..>381223)
                     /locus_tag="KLTH0G04774g"
                     /db_xref="GeneID:8293511"
     mRNA            complement(<380741..>381223)
                     /locus_tag="KLTH0G04774g"
                     /product="KLTH0G04774p"
                     /transcript_id="XM_002555199.1"
                     /db_xref="GeneID:8293511"
     CDS             complement(380741..381223)
                     /locus_tag="KLTH0G04774g"
                     /note="similar to uniprot|Q03713 Saccharomyces cerevisiae
                     YML030W"
                     /codon_start=1
                     /product="KLTH0G04774p"
                     /protein_id="XP_002555245.1"
                     /db_xref="GeneID:8293511"
                     /db_xref="GOA:C5DLZ7"
                     /db_xref="InterPro:IPR007667"
                     /translation="MSHLPSSFDGAEQDVDEMTFLEKMTFHCKQQPLVPLGTLATTVA
                     VILAAQNVRSGNKRKAQKYFRWRVGLQGATLVALVAGSFIYGTSQKERQSKEDALREK
                     AKLREKLWIQELERRDEETQLRKKRAELARSRAKELEQETQGLQQELRDLQAKTSSSK
                     "
     gene            complement(<381434..>381991)
                     /locus_tag="KLTH0G04796g"
                     /db_xref="GeneID:8293512"
     mRNA            complement(<381434..>381991)
                     /locus_tag="KLTH0G04796g"
                     /product="KLTH0G04796p"
                     /transcript_id="XM_002555200.1"
                     /db_xref="GeneID:8293512"
     CDS             complement(381434..381991)
                     /locus_tag="KLTH0G04796g"
                     /note="similar to uniprot|P15454 Saccharomyces cerevisiae
                     YDR454C GUK1 Guanylate kinase, converts GMP to GDP;
                     required for growth and mannose outer chain elongation of
                     cell wall N-linked glycoproteins"
                     /codon_start=1
                     /product="KLTH0G04796p"
                     /protein_id="XP_002555246.1"
                     /db_xref="GeneID:8293512"
                     /db_xref="GOA:C5DLZ8"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ8"
                     /translation="MSRPIVISGPSGTGKSTLLKKLFNEFPNKFGFSVSSTTRSPRPG
                     EVNGTHYNFVTVEQFKEMIADGKFIEWAQFSGNYYGTTIASVNEVTNSGKRCILDIDM
                     QGVKAVKKTDLNARFLFIAPPSVDSLRERLTGRGTETPESLQKRLDAATAEMDYAQTG
                     AHDKIIVNDEVDVAYAQMKEFIFSE"
     gene            <383522..>385360
                     /locus_tag="KLTH0G04818g"
                     /db_xref="GeneID:8293513"
     mRNA            <383522..>385360
                     /locus_tag="KLTH0G04818g"
                     /product="KLTH0G04818p"
                     /transcript_id="XM_002555201.1"
                     /db_xref="GeneID:8293513"
     CDS             383522..385360
                     /locus_tag="KLTH0G04818g"
                     /note="similar to uniprot|Q04121 Saccharomyces cerevisiae
                     YDR456W NHX1 Endosomal Na+/H+ exchanger"
                     /codon_start=1
                     /product="KLTH0G04818p"
                     /protein_id="XP_002555247.1"
                     /db_xref="GeneID:8293513"
                     /db_xref="GOA:C5DLZ9"
                     /db_xref="InterPro:IPR004709"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR018422"
                     /db_xref="UniProtKB/TrEMBL:C5DLZ9"
                     /translation="MSTTFTQLVLGLAFRGALCWAKGVNTDPDDQEGVLPGDEDPPAG
                     TLPGDEVSPVTEEIFSSWALFIMLFLLISALWSSYFLTQRRIKAVHETVLSIFYGMVV
                     GLIIRLSPGHYIQDAVTFNSSYFFNILLPPIILNSGYELNQVNFFNNIVSILVFAIPG
                     TFISSVVLGVILYIWTALGLESIDISFVDALSVGATLSATDPVTILSIFNAYKVDPKL
                     YTIIFGESLLNDAISIVMFETCQKFHGKPAKFSSFFEGIGLFLMTFTVSLLIGVMIGI
                     LVALLLKHTLIRRYPRIESCLVLLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYFN
                     MSRRTQITVKYIFQLLAQLSENFIFIYLGLSLFTEVELVYKPLLIIITGISICVARWC
                     AVFPLSNFVNWLYRVKARRSMGIYGNDAAIPDEIPYQYQMMTFWAGLRGAVGVALAMG
                     LQGEFKFTLLATVLVVVVLTVIIFGGTTAGMLEVLGIKTGCIDENDESDDEFDIEMPK
                     PITLATGPIASYTDEVPSVEPISVPISTATATNPLSSDTVQSSSRVSLDKQHLRETLS
                     TIFSADSQWFTNFDEQVLKPVFLDSDNSQSGKKSDSSTPNIMGNRK"
     gene            complement(<385459..>387246)
                     /locus_tag="KLTH0G04840g"
                     /db_xref="GeneID:8293514"
     mRNA            complement(<385459..>387246)
                     /locus_tag="KLTH0G04840g"
                     /product="KLTH0G04840p"
                     /transcript_id="XM_002555202.1"
                     /db_xref="GeneID:8293514"
     CDS             complement(385459..387246)
                     /locus_tag="KLTH0G04840g"
                     /note="similar to uniprot|P32500 Saccharomyces cerevisiae
                     YML031W NDC1 Nuclear envelope protein with multiple
                     putative transmembrane domains"
                     /codon_start=1
                     /product="KLTH0G04840p"
                     /protein_id="XP_002555248.1"
                     /db_xref="GeneID:8293514"
                     /db_xref="InterPro:IPR019049"
                     /db_xref="UniProtKB/TrEMBL:C5DM00"
                     /translation="MESSVIPSPLSSRYSYHAIFSDVCKTRFSHLVARLLFSMAVCIG
                     ALASALAQRGASKWERTLSAPGKGILVYVGMLTVVLARKNYLHVRLPGYSSALSQAYW
                     QLCSGQALVQLAVHILSSICIASALRDTVTGALQPQRVFGYRLAVWLLVPGLYTAQHV
                     AFDLGRLAFRYGAQHQHPQQFIITRIHNVFAKCGVLAIAVALVLPVGSLYLGPRTSSL
                     GVAGTFQCVILAFMIFVIWDLVNLAFNAYLSIGCLHKGKPISSLSSTPMETLISGLSS
                     KKPFTKLTAFQELSYRATSPNIQLRLPIYHTRHRNVYIWPSILKECLNTIESTNSNVS
                     AFMKSVEQQQESLRKPTANRPESLDERLNENGLFGNDYVITSSSQSRLPGSPPTSETL
                     THRITLQNNNIFARGNGDTVGSSPFQFSDVANNPILTRQTTITDIVGDCLRQLKDTFF
                     GFFFPVQDEDSSPQLSLFELWRVSKKMQAEKLVPLPVCYAECVIALMGLLIKSLEEDP
                     KGGVVSSVGEVLKILERSVGSLGGFAEWKDSLVSRETATPDVVTILYDLSINAFLEIV
                     LGYNELLNNVYLDEDVVKLSKWVLEICNE"
     gene            <387372..>388811
                     /locus_tag="KLTH0G04862g"
                     /db_xref="GeneID:8293515"
     mRNA            <387372..>388811
                     /locus_tag="KLTH0G04862g"
                     /product="KLTH0G04862p"
                     /transcript_id="XM_002555203.1"
                     /db_xref="GeneID:8293515"
     CDS             387372..388811
                     /locus_tag="KLTH0G04862g"
                     /note="similar to uniprot|P06778 Saccharomyces cerevisiae
                     YML032C RAD52 Protein that stimulates strand exchange by
                     facilitating Rad51p binding to single-stranded DNA anneals
                     complementary single-stranded DNA involved in the repair
                     of double-strand breaks in DNA during vegetative growth
                     and meiosis"
                     /codon_start=1
                     /product="KLTH0G04862p"
                     /protein_id="XP_002555249.1"
                     /db_xref="GeneID:8293515"
                     /db_xref="GOA:C5DM01"
                     /db_xref="InterPro:IPR004585"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:C5DM01"
                     /translation="MIEKSLIHVGIKSARPIGVSQAAMDASKTNGSSTEDIQAKLDKK
                     LGPEYISKRVGFGANRVAYIEGWKAINLANQIFGYNGWSTEVKSITIDFMDERQGKFC
                     IGCTAIIRVTLSDGTFREDIGYGTVENERRKSSAFERAKKSAVTDALKRSLRAFGNAL
                     GNCLYDKSFLAKIDKVKFDPPDFDEGNLYRATDEFAENSRAGDSSRGAPTGLPVGTPR
                     SDHEARGPPYKRRNINQTPNVVPLPAPARELQPQHAQQPQPPSDQDPDELLDDSFMFS
                     DELQDDDIIAAGEAQPTTPALDRPVESHPNPQAQVQTPVAFVTAKAAPNLQNKAPVPP
                     GSVFDPKFRAQSIRHTVDQTTSAHVKTSVLRERGLPNNRSAIYNQYAPKGKLIGDTNT
                     AQDSSVPPRERQPILPAVASTATTTNITHHEASAKEVQNNGYANAGQPNGTSVHAGNV
                     IPPAVSSPAATVRSVGKPKAHHPNVRNPL"
     gene            <389220..>398984
                     /locus_tag="KLTH0G04884g"
                     /db_xref="GeneID:8293516"
     mRNA            <389220..>398984
                     /locus_tag="KLTH0G04884g"
                     /product="KLTH0G04884p"
                     /transcript_id="XM_002555204.1"
                     /db_xref="GeneID:8293516"
     CDS             389220..398984
                     /locus_tag="KLTH0G04884g"
                     /note="similar to uniprot|Q7LIK7 Saccharomyces cerevisiae
                     YDR457W TOM1 Temperature dependent Organization in Mitotic
                     nucleus"
                     /codon_start=1
                     /product="KLTH0G04884p"
                     /protein_id="XP_002555250.1"
                     /db_xref="GeneID:8293516"
                     /db_xref="GOA:C5DM02"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR010309"
                     /db_xref="InterPro:IPR010314"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025527"
                     /db_xref="UniProtKB/TrEMBL:C5DM02"
                     /translation="MVTLTKLEKFRKEEKAKGFKPLLDDLTQCSEAEFVKKLTNIITW
                     DRSRDDLYIWIPVLNRIDDILNRLLAHYNYKSTNRKTQPVKLIIMSAEDETVTKELLW
                     FTCRLLNNTCNRSLYSSLDVMTNLLNCPNYVVKLGAMKVAAIVGEQQVIARQKIDSKN
                     LLSNKELKRKTLDLALALPSSTTDDRMDHFALVDLFFDKKQYPTKWSKIDFSYYAAAP
                     KVYLTQGALNKTGTGSVKRFIMNAEELSSLSLQQVFDKGMAEIPAESWFDFSLQATVA
                     KAFSDSTYENLQLRNLIIQTKFNAIALANVIYIPAQVSSQLFEVDPYAFNNLTDFISL
                     SEQKLPKDLRVDALFSLECISLKHIWCSDIVRNLGGNMSHGLLFQILRYIAKLLRDNN
                     SKELDEEYNVRFFYLVSNLADVKTLQESMLAAGLIPNLLEIISIKDCAYKRTLASATH
                     LLEVFIDDADATTEFIGNNGFNILIGCVNEEVNFALEHPEFGEPPKYPVVYYSISFRQ
                     LGYIRSLLKLVLKLLKTDSGDRIRNLIDSPILLSLNQILENRPVFGYTLVTYALDVVQ
                     TILNTEPTIYSVLVESKTIPYIIDNFKHFLGPSGELLCLLPEVISALSLNNDGLKQVK
                     EKGLINCLFEIMTTPELAKIMSWDDSAIDLGTSIDELARHYPELKPVIEDCFYKTVKA
                     LPSIISFSHPYVYRSTISNGEFYHSRDETVVDNEEGGSEIESGEVQVPAAVLDCFSAV
                     FYGMTLENVSWASLAEKVDIKDLLKVIIIERPPYDYVGSQTLLNFSDILKHFDDERRN
                     YALPALLSLLSEKLDGVKDFLEYNFEKPYVLSTPYEVLDETLRKLTVINVLLYVITDI
                     YINIASLFPIRVLQIMEFFEQNGFNLIVKLRHLFQRSALEELYMRNRLPASVTAETTM
                     RPIGNTPPLTIYASKPSKNDPKDDKTSAKFKNTLQDRQLFIKMQSWTSMLFRCFLRLT
                     HARKMTVEASDRALEIRIFDTTVNEIVKMMDLKYLLSHLGYFLVVFNFNTFVFTFPNV
                     TTSVGGTVQTIPALLFYQAGGFKIYYEAIKLLFANLQKFNDVENIEKFDYIKDSEDIL
                     TASALINALSFFNKCIQMETMENIRNTKEYYPYDEVYYNLTSALIIPIKVLSLGLVDE
                     LVNEFSILEQGTRRLPYSVFKQLLTMIKNIFNSTAEGEDHDLYELRWDLMPPSHRKIE
                     MLKSCGIEEDIAKNYLEEQKDDLPIHVKPDVFSDGEWETYKALRETGKWKTDLSLLEP
                     QYKNFSTASDLSEMRSSFYANGFEDRILQLLPMYPKLINAISHMILQLLQEAEEPPKK
                     VLGKLLQMMRGIDLSDASVLAPVIHLFGILLNDKAMYEKSEDFIHEFVQYLQQSLRPE
                     FVNSAWFSKALYVYEIIFAKSEAPRLDPLPDGIEEGVNTPCPPLFKAFTISSDAKSKI
                     FDSLIRVHEISDFYSALAISRILILYTRDEHYSHEVPQSGILSKILKTIGIFQKSEKI
                     NYLESSFLLLARRCFETSEIVSSLIQYELSRAFTTRAIGDSKENSRDLTGLVSEKANV
                     VMRDPASFVNCLCETARFEDFVRPDKLENLIVRRYLSERDEEMSDANSQADGKLSLSN
                     RTGIVHLLLSQLMAAYKKDWTSEPVKEESVEDTKKKDDVDVARNPVCAYMIFLLKVLI
                     ELVGSYKQSKLEFLTFNKRNMYVESPKPRTTALNFVLYQLLDTGGRDQDKHYVERKEV
                     IGKLARDLVVSFVSSVQDKEVQKQDPKIVNPDMTYIRKFTIEAVTKALKSVAKSPKTL
                     EANVSKLYGWLHLVTSFLVSERSYLHSVLDSNKTYVDKYQIGKLMLDMNVPSTIADCM
                     ASLDLNYPFSKKLFNKSVEPLNAINEIRSRFSDLFKLENTDEDDEVEDESEKEEHSDM
                     FRNSALGMYDVEDIEEDDDDDASLIGEDEDIAFVEGEDGEIEVVFSEDERGHHHGGSS
                     SSDGMNDSDQIDDSEGSMDYGLDGESLDMDIASGESSNSDIGNGGDGIESDDSSYYTD
                     HEGPLEYVHIDDGAPAPVIDVELDSSELAESDWESRLSDLSGSDWESGLSELSGSEDG
                     SSEENFNDETHPGSRWLADEVDMDDDSDEEGRGVFTGIQHVFSPEPQYFRVHGENHRG
                     HRGPHHHSSRRADFMMATPMSLSTGSRGTRGILMNPLGPSGLEEVENGILNQLTSTGS
                     SSRPRNELPHLSDILFSGEFFDEKSSVGIVLKSTTARWSDIFDMFYDSKIYANNVIPT
                     IIGRIFQPSSDLYVRKREEALEKEKAEKLQREENLRKQSEFKKRKLEEMHTDGSDEGE
                     NEEEEDEEEGQEHLPPIYVNIGGEEVNIAGTDIDPEFLDALPDDMRAEVFAQHIRERR
                     AEALDQTVDSREIDADFLESIPENLREEILEQEAAESRFSRLMGSLNDEENAESSGDV
                     GEENDADESPDSKKKKPEKIYFSPLVDRSGISAIMRSLFISQPYLAREVYHELFYRLC
                     SSKQNRSDIMNILMLILTEGINDHQSLERIYNLISNRALGIAKSTSARMLPLDCTPLS
                     VANQTIEVLQNLLETDNRLKFFFITEHENLLINKTPLKNKKDIFTKNMKWPINYLFSL
                     LDKKIITDETVLLDLLTRILQIITKAISAIAKNENSQKKFTVPDIETKHLEAVVSIVK
                     LDACNTKVFQQTLNIMTHLSVIKGAQDIFTKELCTLAIQTVEVLKTDLSNLDSEIGEV
                     EIGTEINYETFQKFTVPSSEQAKLLKVLTAIDYIHTNKKKAGDIDVEKLMGLYDQIKL
                     GGVWTSLGHCLEKFDEKPALSSSANILLPLIESLMVVCKHSKTRDSRDVLKYQAKKSD
                     FSEVAAENIFFAFTDLHKKLLNQMIRSNPKLMSGPFALLVKNPKILDFDNKRYYFIAK
                     LRSGAQEKPKLSISVRREQVFLDSYRSLFFKSNEDIKNSKLEITFKGEAGVDAGGITR
                     EWYQVLSRQMFNPDYALFLPVASDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAICDQ
                     CFLDCHFSREVYKNILSKPVALKDMESLDLDYYKSLIWILENDITDIIEETFSVETDD
                     YGEHKVIDLIEDGHNVPVTEQNKQEYVKKIVEYKLHTSVKEQMDNFLLGFYAIIPKDL
                     VSIFDEQELELLISGLPDIDVDDWKNNTNYVNYTPTCKQISYFWRAVRSFDSEERAKL
                     LQFVTGTSKVPLSGFKELTGVNGISKFSIHRDYGSTERLPSSHTCFNQLDLPAYDSYE
                     TLRGSLLLAINEGHEGFGIA"
     gene            complement(<399246..>399485)
                     /locus_tag="KLTH0G04906g"
                     /db_xref="GeneID:8293517"
     mRNA            complement(<399246..>399485)
                     /locus_tag="KLTH0G04906g"
                     /product="KLTH0G04906p"
                     /transcript_id="XM_002555205.1"
                     /db_xref="GeneID:8293517"
     CDS             complement(399246..399485)
                     /locus_tag="KLTH0G04906g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G04906p"
                     /protein_id="XP_002555251.1"
                     /db_xref="GeneID:8293517"
                     /db_xref="UniProtKB/TrEMBL:C5DM03"
                     /translation="MSDARDFLRVTKNAGARHVVSGALGFVVGVSLASFVAVRIVDRT
                     RKELEWTDSMTELTRSVRNLETHVKNLEHDYAGRK"
     gene            complement(<399807..>402215)
                     /locus_tag="KLTH0G04928g"
                     /db_xref="GeneID:8293518"
     mRNA            complement(join(<399807..400323,400504..>402215))
                     /locus_tag="KLTH0G04928g"
                     /product="KLTH0G04928p"
                     /transcript_id="XM_002555206.1"
                     /db_xref="GeneID:8293518"
     CDS             complement(join(399807..400323,400504..402215))
                     /locus_tag="KLTH0G04928g"
                     /note="some similarities with uniprot|Q03707 Saccharomyces
                     cerevisiae YML034W SRC1 Protein with a putative role in
                     sister chromatid segregation potentially phosphorylated by
                     Cdc28p green fluorescent protein (GFP)- fusion protein
                     localizes to the nuclear periphery"
                     /codon_start=1
                     /product="KLTH0G04928p"
                     /protein_id="XP_002555252.1"
                     /db_xref="GeneID:8293518"
                     /db_xref="GOA:C5DM04"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="UniProtKB/TrEMBL:C5DM04"
                     /translation="MEEDYLGESFEPKSLRVAQLRRVLVEHGVRVQSHLKKAELCELF
                     EKHIKAKREQLLRERESGQVVKIEKATDSSFSHEASSEKSGSPFSDVNDFQNDENARP
                     RKRKIEEESTGRKKSGKKSKKRASAEPARAKKQESKDNTSSPLVNKLRSKSPSKKSPL
                     KPLAIEAFESSSSSSSDAASSSSDDLDFSLRRKAASPDLSKLKVSPEFAKKLAKASSS
                     QGSNRSQSSRGASRESEMETTPQRLSASADKSSVRESSEPKDRSFKDLPSFAPEGKVK
                     GESKEEEPSGASTPTRGPSAQSSHQSSPHLSVPDFKEVAGDAGSEGPSSPDKKFSAEE
                     DETVESSEAEEDEESISVENLSEQQDESNTSKSRSSIKTNIKEAKESAKEFLLEKAKE
                     HPVPQRAWLRALGKGIWNLSVFLMVMIPILFGLWYREERIQIGYCGHEINLPTFENTN
                     DSPLLIALENFLDNHRPQCLPCPENAICYPYMKIKCRPDYVVTQSKWSLQGIFPVSDY
                     CAKDTKRQKLIAEVVRKSLELLRTKNANVKCGEGANDFESGITEEDLYEIFFESRAPS
                     ISDEDDIPAESHDLSQQEEHIQPLRKDRLFRSTSKKYIGLKCKFEKEVHQTYQRFKYV
                     IWIAFALTVIIKTVTFKLRSHFKRQQRTEALTQQVVAKLQKSAKESSESRPPYMSTVQ
                     LRDVLLSDVVDLKLKNKLWNSVIKKLEHNNTNVKSRLMELHGEIMKCWEWVGPLQEED
                     QD"
     gene            <402472..>404772
                     /locus_tag="KLTH0G04950g"
                     /db_xref="GeneID:8293519"
     mRNA            <402472..>404772
                     /locus_tag="KLTH0G04950g"
                     /product="KLTH0G04950p"
                     /transcript_id="XM_002555207.1"
                     /db_xref="GeneID:8293519"
     CDS             402472..404772
                     /locus_tag="KLTH0G04950g"
                     /note="similar to uniprot|P15274 Saccharomyces cerevisiae
                     YML035C AMD1 AMP deaminase tetrameric enzyme that
                     catalyzes the deamination of AMP to form IMP and ammonia
                     may be involved in regulation of intracellular adenine
                     nucleotide pools"
                     /codon_start=1
                     /product="KLTH0G04950p"
                     /protein_id="XP_002555253.1"
                     /db_xref="GeneID:8293519"
                     /db_xref="GOA:C5DM05"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="UniProtKB/TrEMBL:C5DM05"
                     /translation="MLGRSLEDMSNLSLVKEVSHENSSEPSSGAGESEGQARRLDLDK
                     LSLEDEEDPAAEPTNFSFLEDKKLYEHDSKREALNHLQQASQSPKGGRRLSVSAQMAL
                     PEPPSLQFAQDNDRHVSARYKMGMVLGEEQQFSDVLSSELVDLYSKVQDCRRLRDKYQ
                     ILSLQKHPHQNPKNLPSWKIYPSPPKPSYSAETKTVIKVENKPDSEVFDFSKIEIPGE
                     DPDWDFQANSDDAYTVVSSSDPQNVLAEVPTLRQYYKDLDTMVTISSDGPAKSFAFRR
                     LQYLEARWNLYSLLNEYEENSVSKKNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKY
                     KLRHSGDEKVIHRDNKVLTLDEVFKSLNLSGYDLSIDTLDMHAHKDTFHRFDKFNLKY
                     NPIGESRLREIFLKTDNYINGTYLAEITRQVLSDLENSKYQNCEYRISIYGRSIDEWD
                     KLASWVIDNKVISHNVRWLIQVPRLYDIYKKTDTVKSFNDIIRNLFLPLFEVTKNPQS
                     HPKLHVFLQRVIGFDSVDDESKVDRRFHQKYPKPSLWDSPQNPPYSYYLYYLYSSMTS
                     LNQWRAKRGFNTFVLRPHCGEAGDPEHLISAYLLAQGISHGILLRKVPFVQYLYYLDQ
                     VGIAMSPLSNNALFLTYDKNPLPFYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQ
                     IYKLSNVDMCELARNSVLQSGWESKIKRHWIGKNFLTEGIDGNDVEKTNVPDIRINYR
                     HETLSTELELIEHYARFKVKEGESTE"
     gene            complement(<404787..>405890)
                     /locus_tag="KLTH0G04972g"
                     /db_xref="GeneID:8293520"
     mRNA            complement(<404787..>405890)
                     /locus_tag="KLTH0G04972g"
                     /product="KLTH0G04972p"
                     /transcript_id="XM_002555208.1"
                     /db_xref="GeneID:8293520"
     CDS             complement(404787..405890)
                     /locus_tag="KLTH0G04972g"
                     /note="similar to uniprot|Q03289 Saccharomyces cerevisiae
                     YDR459C likely functions in pathway(s) outside Ras"
                     /codon_start=1
                     /product="KLTH0G04972p"
                     /protein_id="XP_002555254.1"
                     /db_xref="GeneID:8293520"
                     /db_xref="GOA:C5DM06"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:C5DM06"
                     /translation="MGFLSTGSVRLEEHLWFRCITPVVVLGLLTNATWSFCHQLCYNA
                     IYRKFGQRSVAIGLMVGEVVLVLILIGIWFQMVLIGPGKQPKLLPFKIMPEDESDTDS
                     EAKESSQGTQMSTNPPRIYQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYC
                     VWIGTVVGRKNYRLFVQFAFYFWAFAIFVIVSTASFLPKIIRSQPHVPRVNPNILIMM
                     GLCGMATLMVGPLFLAHTYYMMVNRTSLEIIATKRRSRATNTWLCYYNAVDGIRYVFE
                     FKALEAQDFWNKRNIWTNLKEFLGDNYLMWFIPFGTNIKYSHPHSSDVAEVLGPYQEK
                     CGERLRDELQHRIEAGNYVAAFKAFGDRSMGEN"
     gene            <406086..>407054
                     /locus_tag="KLTH0G04994g"
                     /db_xref="GeneID:8293521"
     mRNA            <406086..>407054
                     /locus_tag="KLTH0G04994g"
                     /product="KLTH0G04994p"
                     /transcript_id="XM_002555209.1"
                     /db_xref="GeneID:8293521"
     CDS             406086..407054
                     /locus_tag="KLTH0G04994g"
                     /note="highly similar to uniprot|P89104 Saccharomyces
                     cerevisiae YDR460W"
                     /codon_start=1
                     /product="KLTH0G04994p"
                     /protein_id="XP_002555255.1"
                     /db_xref="GeneID:8293521"
                     /db_xref="GOA:C5DM07"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015877"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C5DM07"
                     /translation="MIVDDDEKKDMCPICKTDRYLSPDMKFLVNPECYHKICESCVDR
                     IFSLGPAQCPYEGCDKILRKNKFKTQVFDDVNVEKEVDIRKRVFNVFNKTLDDFEGDL
                     KAFNKYLEEVEDIVYNLDNGIDVANTEEKLRTYEDLNKQLIMANMKRSRQDLDNFEQR
                     QKFEKEMKLKKRQLERQIEEEELANREWARKEIVNQLSTADDAEDVIAHVKKTVKLKK
                     SSARRKLEELNKVLKNNPYMTVSNGLMKKKESVPFTPFNGDRDLNKRYTLSESQYNDP
                     FIKSLQTKKEYIASGFRADYVYDRMLTEAFMGLGCIIKEELRTSVK"
     gene            complement(<407187..>407651)
                     /locus_tag="KLTH0G05016g"
                     /db_xref="GeneID:8293522"
     mRNA            complement(<407187..>407651)
                     /locus_tag="KLTH0G05016g"
                     /product="KLTH0G05016p"
                     /transcript_id="XM_002555210.1"
                     /db_xref="GeneID:8293522"
     CDS             complement(407187..407651)
                     /locus_tag="KLTH0G05016g"
                     /note="similar to uniprot|Q03705 Saccharomyces cerevisiae
                     YML036W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G05016p"
                     /protein_id="XP_002555256.1"
                     /db_xref="GeneID:8293522"
                     /db_xref="GOA:C5DM08"
                     /db_xref="InterPro:IPR013926"
                     /db_xref="UniProtKB/TrEMBL:C5DM08"
                     /translation="MPYESIPQFDTRGVCVSLFRDVKNIEELRSKVGTMPFAVIDASC
                     VCCREQLFSAVYKALIEWKYNRLRTKALHSECILSLSPTSNIGEAFRRFGIKEGTRNI
                     ICLAVVGKNETQTSELFDVVDGEEVELSDENLGSMFDLEMIKKVCWPLKVFQ"
     gene            <407809..>408963
                     /locus_tag="KLTH0G05038g"
                     /db_xref="GeneID:8293523"
     mRNA            <407809..>408963
                     /locus_tag="KLTH0G05038g"
                     /product="KLTH0G05038p"
                     /transcript_id="XM_002555211.1"
                     /db_xref="GeneID:8293523"
     CDS             407809..408963
                     /locus_tag="KLTH0G05038g"
                     /note="weakly similar to uniprot|Q03703 Saccharomyces
                     cerevisiae YML037C"
                     /codon_start=1
                     /product="KLTH0G05038p"
                     /protein_id="XP_002555257.1"
                     /db_xref="GeneID:8293523"
                     /db_xref="UniProtKB/TrEMBL:C5DM09"
                     /translation="MDDTADVWTEVLEEKKVAPPTGPQVASHVFSAPMPKASEELESM
                     MGVAMPQLESGARKPAGEDMNLYGLLDMVPKGRKLLAELLSGPHTTGDVFQHYDKSAI
                     HRKLADKVDQWITEEEAQGKESNRNLAGLRGEYSSAIFSWSSANKNKERVASAGKKSA
                     SPSTGSQKTVNEQLYSKAYAAISGLIAQKRDEERRRERERAAASKPPASPAVFKADPL
                     QKFEARALPREHKKKPKQEKHKRSSILWFWKGGPQKSKDQAGRLRDDHRDAKPASEPG
                     ITSTPRASSDSTPRPRSESQTPEASASSVSASQTPQTYLPPSPPHTGASPAGASSDEE
                     SLFGDFESSTGLQAVDAPVTPPVAPEHTGTGAAQAMLSFAPLQPKKRDNS"
     gene            <409563..>410006
                     /locus_tag="KLTH0G05060g"
                     /db_xref="GeneID:8293524"
     mRNA            <409563..>410006
                     /locus_tag="KLTH0G05060g"
                     /product="mitochondrial 54S ribosomal protein YmL28"
                     /transcript_id="XM_002555212.1"
                     /db_xref="GeneID:8293524"
     CDS             409563..410006
                     /locus_tag="KLTH0G05060g"
                     /note="similar to uniprot|P36527 Saccharomyces cerevisiae
                     YDR462W MRPL28 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL28"
                     /protein_id="XP_002555258.1"
                     /db_xref="GeneID:8293524"
                     /db_xref="InterPro:IPR019192"
                     /db_xref="UniProtKB/TrEMBL:C5DM10"
                     /translation="MSSPWSNNSRKLSQPVLQFVRGKRTKAKGALSPAVQRVITQLSV
                     MSAGRKQPKMLKLSREDLIKHQTIQNCWSMYQRELREKRNEQLRLQYKSTEKAMTLLE
                     QLDPELFEAANASEAGKRFPLELKVPTEFPPDQVWYYNYKPKEEQ"
     gene            <410389..>411501
                     /locus_tag="KLTH0G05082g"
                     /db_xref="GeneID:8293525"
     mRNA            <410389..>411501
                     /locus_tag="KLTH0G05082g"
                     /product="KLTH0G05082p"
                     /transcript_id="XM_002555213.1"
                     /db_xref="GeneID:8293525"
     CDS             410389..411501
                     /locus_tag="KLTH0G05082g"
                     /note="similar to uniprot|Q03697 Saccharomyces cerevisiae
                     YML038C"
                     /codon_start=1
                     /product="KLTH0G05082p"
                     /protein_id="XP_002555259.1"
                     /db_xref="GeneID:8293525"
                     /db_xref="GOA:C5DM11"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:C5DM11"
                     /translation="MARTILGYIAGWYVCSIALSLYNKWMFDPERGLSVPYPILVTMM
                     QQWILWGISWVYLKSKGIEQVVEQSRQQRWKFYLKFIIPAALATAGDIGLANVSFKFI
                     TLTIYTIVKSSSIAFVLLFGCLFRTEMFHWRLACIVAVMFAGVAMMVYRPRSDGGGPA
                     DEHIVLGVMLVLGSSMLSGLRWVYTQLVLRKVDANVDPSVGEKKKKSPVETIHQLTPV
                     MGLALLVTTLAVEKPFPAVFHSPLLQIEDHTSALSLVRGFFLLLTPGVLVFLLVVCEF
                     GILQHAQVLTLSVAGVCKEVITILASMLVLRETLSGFQNWLGMGVILLDVCYYNFYRF
                     SQKKGASQESSDDASEVLLQEFELESNKQIPELQKV"
     gene            <412304..>413920
                     /locus_tag="KLTH0G05104g"
                     /db_xref="GeneID:8293526"
     mRNA            <412304..>413920
                     /locus_tag="KLTH0G05104g"
                     /product="KLTH0G05104p"
                     /transcript_id="XM_002555214.1"
                     /db_xref="GeneID:8293526"
     CDS             412304..413920
                     /locus_tag="KLTH0G05104g"
                     /note="similar to uniprot|Q00947 Saccharomyces cerevisiae
                     YDR463W STP1 and uniprot|P38704 Saccharomyces cerevisiae
                     YHR006W STP2 Transcription factor"
                     /codon_start=1
                     /product="KLTH0G05104p"
                     /protein_id="XP_002555260.1"
                     /db_xref="GeneID:8293526"
                     /db_xref="GOA:C5DM12"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DM12"
                     /translation="MPYVSLLKPSQNKILVSIAEKVKEFFRNLADFVVAGDGNSKDAK
                     KDVEEGINEAEEVKNSPEKSRSLFPAQNNVDKSLELAPTIVPCALDLSTLQSPISMTK
                     TPEGHLDWQLMAPSMTGDAAGPNGPPSFAPTLNSPESIECKTEDDEHGCSDKDQKRFV
                     CHYCNAKFYIRGYLTRHIKKHAVEKAYYCPYFNADAPKDQRCHTTGGFSRRDTYKTHL
                     RSRHFICPKGVRSQEKAKSSGRCAHCNEQFDKTDDWIKSHVEAGECKGLPDGFKVAVK
                     SSRKTGKLKMIKTSNGHSRFISTQQCVIEPSVMHNKEALEATAIVIDQSKNNGNPLES
                     TVLTTNDNKIMLNSEHFQGASKTKKNNKVSPKKPEVASLDGPQDSFFNYPNSQASLGT
                     AQPHLQSYPFSQVTPVKETSLDEGCLSMDPSPTEDAGLEAVNSSSSASSRVSFHDHNV
                     KDNQASSMPYPNAHDDFFQFPLDIDQCPMNPMYYERPVQSHNEGLASEGSQINETLNK
                     QMDAVVLSERHFRENQQYLNFYNYTFDSHL"
     gene            <414405..>419042
                     /locus_tag="KLTH0G05126g"
                     /db_xref="GeneID:8293527"
     mRNA            <414405..>419042
                     /locus_tag="KLTH0G05126g"
                     /product="KLTH0G05126p"
                     /transcript_id="XM_002555215.1"
                     /db_xref="GeneID:8293527"
     CDS             414405..419042
                     /locus_tag="KLTH0G05126g"
                     /note="some similarities with uniprot|P38904 Saccharomyces
                     cerevisiae YDR464W SPP41 appears to control expression of
                     spliceosome components PRP4 and PRP3 negative regulator of
                     prp genes"
                     /codon_start=1
                     /product="KLTH0G05126p"
                     /protein_id="XP_002555261.1"
                     /db_xref="GeneID:8293527"
                     /db_xref="InterPro:IPR021386"
                     /db_xref="UniProtKB/TrEMBL:C5DM13"
                     /translation="MSEDQEELNLNELVGNLLAAHNEEAEAPQLEQGSLDELDEIPEL
                     PEQTGSQDAELGDDDLAAVVAQAIGGMEEPESQRSAEATTELHGDQIQELSEEKDQPQ
                     SKEEEWAQILQQGLLQESQQQHPDQLEESLNTGDGANENLDHEDEALRRAILDSLQAL
                     SVGENQGVPTKSHDEPKVKHKSKSKDTHKDKSKEKKSKKKDAKKPTKKKSSKKKKDSL
                     KKNKEAPKSSSLTRQGGDDDILNFEDVIKGFMEQGAVEPADQETTNASGRRTAGTGDA
                     TDAETQAFVEATLRAFESELLSGTTSAPSTKTKSTQKKPLLAEDRSVVASTHGHKTTR
                     IPSHNSSASSSKKKSSESSKKKKSSKGDSRRKEGYNEDDFSRALAEMVNQVVNTSISD
                     VQPRVLTQPEGPLVPQGALPHTAVEPASDQQNTERTEAADAMGGAGDISMLNNSQLLQ
                     EHESFGADSTSNTFPPSGASAGTQVGNEVLDTALPEGGSISRNPDVDLVSLTEGLDLN
                     QIMQNAMALAFQGQSGEQMNQSAVDDFNRQLGGINLSQLLDSSIGSTKAKKKAAKASK
                     KKDATEKSSSKLQSPKKHSSKSKKHGVSNQELAAALEAGSFSIPGFTQGLPKTLLTAK
                     PEKLASSKKSTSAPQVSERQWRKKFKAAATEAAAKARRQRMDRNKAQRSKMKEERRIA
                     RQDKQLKKKERQEKEEAERKELEIIVAKGPPYPPDLRLTKRGRPKKPFRRYTAEEMKK
                     RASMPSLIDTESSKRVKKDRKKKERKPKKIPLSALRKIPLFNFIKKQMPLGLQSRLND
                     IDGTLARIPLGGSRELPSRENTHPLLSSALQNHLFNSLQNAVFDDKTAEREHEIETVE
                     TQKTIIHREKCSFHPPWAIPEHPPFVLPTARRKKRGEDVDGSLRKSSKDRKHRSKSKG
                     ANFVSGSKIIPASLFPIINTLKAAAMARAAAGATPEEASRHLGNMLRTARMTIAQTLA
                     NARGQGNRNYGSLKNFDDIKQMQEKDQALKKIPIFSLSSIKAIKDDSKKDSSQTAEPS
                     TIPQNDDSKAVPAVNEVSSNTGEMQPETTSSPPKQVSSEAVADEKEVSEHDPTAAIGS
                     RLTSPSDKEDQVSPPPKIGLRQNDEDHEAVKSQSSVDSDEKYLVGKNQAEEISQNAEP
                     KKAESEGQGSAPKEVSSDLTKPQTGITLIKTETGVRLPPEEDGPRANSKEGLSQPDDE
                     LPAEIKSELTRAINDLIIPYPKVKKRYTKTPPVLNLEGLVPPGSIPLFKSENSDIRTI
                     GGQRETTNTANIDTTTKRANPAKQPSVVETKYEFSLPTKNIRGEPLRAISILRRAKDY
                     LTGEELTKLKKCITNERKRKWREANAKKNKNHDLRARLKKRANALFGEQDSTAKSEWC
                     ETEYTKRAVKVENESGEALAQGSSEPTTSVSDAEVLNMIASTFNKESVSRSIEKDIND
                     EANLILADKKPTKKRTTAPTRKPIKIDAETTVPASDALHEGNNFRENNTKIAGEPNAG
                     EPIDPIFMQMGKRGREEGHENDTNGAKRAKTKGCLGANILRRPAYINLENK"
     gene            complement(<419176..>420786)
                     /locus_tag="KLTH0G05148g"
                     /db_xref="GeneID:8293528"
     mRNA            complement(<419176..>420786)
                     /locus_tag="KLTH0G05148g"
                     /product="KLTH0G05148p"
                     /transcript_id="XM_002555216.1"
                     /db_xref="GeneID:8293528"
     CDS             complement(419176..420786)
                     /locus_tag="KLTH0G05148g"
                     /note="highly similar to uniprot|P10614 Saccharomyces
                     cerevisiae YHR007C ERG11 Lanosterol 14-alpha-demethylase
                     catalyzes the C-14 demethylation of lanosterol to form 4
                     4''-dimethyl cholesta-8 14 24-triene-3-beta-ol in the
                     ergosterol biosynthesis pathway member of the cytochrome
                     P450 family"
                     /codon_start=1
                     /product="KLTH0G05148p"
                     /protein_id="XP_002555262.1"
                     /db_xref="GeneID:8293528"
                     /db_xref="GOA:C5DM14"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:C5DM14"
                     /translation="MESGSSSVVEKFVGKGIEAAKVALTWFLALPIAQQASLLIAAPF
                     LYVITWQILYSMRRDRVPLVFYWIPWVGSAVSYGMRPYEFFAECQKKYGDVFSFMLLG
                     RVMTVYLGPKGHEFVLNAKLADVSAEAAYTHLTTPVFGKGVIYDCPNSRLMEQKKFVK
                     GALSTDAFRSYVPMISEEILQYFRDSKNFEMNKHNSGAINVMETQPEMTIFTASRSLL
                     GKEMRQMLNTDFAYLYSDLDKGFKPINFVFSHLPLEHYRKRDHAQRTISGTYMKLIQK
                     RKQNNDIKDRDLIDSLLKNSTYKDGTPMTDQEIANLLIGVLMGGQHTSAATSAWLLLH
                     LAERPDLQEELYKEQMEVLNNGKDELTYEALQKMPLLNQTIKETLRMHHPLHSIFRRV
                     ERNLSVPNTPYVIPRGHFVLVSPGYCHLQDEYFPKANTFDPHRWDNDYQSSYATGEEV
                     DYGFGKISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVILSTYIRTVKWKFTPNMHGVP
                     KPDFQSMVTLPLCPAEVEWEKRNPQQTL"
     gene            complement(<421413..>422624)
                     /locus_tag="KLTH0G05170g"
                     /db_xref="GeneID:8293529"
     mRNA            complement(<421413..>422624)
                     /locus_tag="KLTH0G05170g"
                     /product="KLTH0G05170p"
                     /transcript_id="XM_002555217.1"
                     /db_xref="GeneID:8293529"
     CDS             complement(421413..422624)
                     /locus_tag="KLTH0G05170g"
                     /note="similar to uniprot|Q03305 Saccharomyces cerevisiae
                     YDR465C RMT2 Arginine methyltransferase ribosomal protein
                     L12 is a substrate"
                     /codon_start=1
                     /product="KLTH0G05170p"
                     /protein_id="XP_002555263.1"
                     /db_xref="GeneID:8293529"
                     /db_xref="GOA:C5DM15"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DM15"
                     /translation="MASLHELLTLKTLPVDGTYVAELTRLLKSGIPATYTIEQVAAHE
                     AGQDEADDTGSNTTPLHVLLRSLPDELSEEECQVVLRLMDVLFEFGAGWNFLDYENKS
                     PGDLLVEQGYSCGHPLYERVVEAGVCAELLLRKLNDDIEFIEGPEDEDEEDEETEEPA
                     AAETTADATAEADEKHGAPARDTAEHQDAYLKADLEYTDGSLVTKENKDGVMMDWETD
                     IMRLARDSMFKHCGSGAVVLNIGFGMGIIDTFIQERGPAKHYICEAHPDVLVHMRSEG
                     WYDKPNVVVLEGRWQDSLSALLDEGTVFFDAIYYDTFSEHYSDMLELYDTIVGLIKPE
                     GLFSFFNGLGADRQVCYDVYKRIVELDVRNYGMDCKYTIVPLPQNPDWAGVRRSYFAC
                     DRYYHPEIRFA"
     gene            complement(<422844..>423530)
                     /locus_tag="KLTH0G05192g"
                     /db_xref="GeneID:8293530"
     mRNA            complement(<422844..>423530)
                     /locus_tag="KLTH0G05192g"
                     /product="KLTH0G05192p"
                     /transcript_id="XM_002555218.1"
                     /db_xref="GeneID:8293530"
     CDS             complement(422844..423530)
                     /locus_tag="KLTH0G05192g"
                     /note="similar to uniprot|P00447 Saccharomyces cerevisiae
                     YHR008C SOD2 Manganese-containing superoxide dismutase"
                     /codon_start=1
                     /product="KLTH0G05192p"
                     /protein_id="XP_002555264.1"
                     /db_xref="GeneID:8293530"
                     /db_xref="GOA:C5DM16"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="InterPro:IPR019833"
                     /db_xref="UniProtKB/TrEMBL:C5DM16"
                     /translation="MFSRRIVQKAPGFAAVLGRRTKVTLPDLDWDFGALEPHISGQIN
                     ELHYSKHHQTYVNGFNAATEQFGELTEKLTGDAQQDAPLARKLAALQQNIKFHGGGFA
                     NHCLFWKNLAPESQGGGEAPAGALGRQIESQFGSLDKLQALTNAKLAGVQGSGWAFIV
                     KNAENGGQIEVVQTYNQDTVSGPLTPLVAIDAWEHAYYLQYQNRKADYFKAIWNVINW
                     KEAERRFDAA"
     gene            <423793..>425754
                     /locus_tag="KLTH0G05214g"
                     /db_xref="GeneID:8293531"
     mRNA            <423793..>425754
                     /locus_tag="KLTH0G05214g"
                     /product="KLTH0G05214p"
                     /transcript_id="XM_002555219.1"
                     /db_xref="GeneID:8293531"
     CDS             423793..425754
                     /locus_tag="KLTH0G05214g"
                     /note="weakly similar to uniprot|Q03306 Saccharomyces
                     cerevisiae YDR466W"
                     /codon_start=1
                     /product="KLTH0G05214p"
                     /protein_id="XP_002555265.1"
                     /db_xref="GeneID:8293531"
                     /db_xref="GOA:C5DM17"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DM17"
                     /translation="MASKRTPESYVFLEKLGQGSYSTVFRAVERANGLRNYAIKVCSK
                     KHIIRERKVKYVTVEKDLLNLLAGGGHPGVVRLFCTFHDTDNLYYVLEFVSGGELLGL
                     VRRMGRLPEEWCRRIASQLVDTVDYMHAKGVIHRDLKPENVLLSQEGRIVITDFGAAC
                     CASEGGSAPGAADRAASFVGTAEYVSPELLLHSQCSFGSDVWALGCIIYQLTQGAPPF
                     RGDTELQSFEKIVALDYRWVYAAPPLIVALVQSILVLDPLQRPSAKQLKQNPWFTSVN
                     WDDRTALWKGIWEVPNKGKSGSAHLPNAPSGPDAPAGGIRVTRRKPVQAKSTDAIVEW
                     RKKLGLGPGALPSPPASAGGDIPKFGGPVHRTVSPAPAPSPAPSAASPAPVSVRTTSP
                     APAPRTINPTPRAIHPTPRPSLPAPRSVSSTSAPRTPPLAAPPVFVKRDIVSILEIPY
                     DPSQRSITLAGYSKVEDSGITAFVTENKTNILKHSANHIVALDVKGLLSCQGPNQPVR
                     SMVSVSDPDLSMYDFEFDEVNGKGFLILEKFKSKLWFLSAASSEQALPVKLRSINKDK
                     PWVECFFAARKMVAEAESSKPKPTRPSSASRPTSATKSRPKQKINSSPRMVVSSSRYE
                     VLHTLSGSGVKGGDATSGASAAFKSLTKK"
     gene            complement(<425913..>427391)
                     /locus_tag="KLTH0G05236g"
                     /db_xref="GeneID:8293532"
     mRNA            complement(<425913..>427391)
                     /locus_tag="KLTH0G05236g"
                     /product="KLTH0G05236p"
                     /transcript_id="XM_002555220.1"
                     /db_xref="GeneID:8293532"
     CDS             complement(425913..427391)
                     /locus_tag="KLTH0G05236g"
                     /note="similar to uniprot|P38758 Saccharomyces cerevisiae
                     YHR009C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G05236p"
                     /protein_id="XP_002555266.1"
                     /db_xref="GeneID:8293532"
                     /db_xref="GOA:C5DM18"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:C5DM18"
                     /translation="MSPSTHTVDQIEFLSRPSGKAEGKHHIVIVGAGIIGVCIAYYLT
                     RHPSFDPKKHHITVLESKRVAGGASGKAGGLLATWAFPQQIVPLSFQLHQELSDEFDG
                     ENQWDYRRLTTVSLEADVQHVSEATDKDDANSTKSADSRSHTLSTRKKNKEPRSSVPK
                     KKRCAQTTRSDRDGSDGDDESDDEDNDELESKEMGPEGLQESYSMGANQPPAPVLPED
                     LNWIRTQLVRDWSSLGGADSTAQVHPYKFTHFILHEAMKTGAVDLILGKVNEIKFNDV
                     GCASGISYIPTSDDYDGEPDAVETLEAQQIVLAMGPWTSKILPDCPISGLRAHSITIK
                     PSTGTVSPYAIFTELKIAHNNYFSPEMYARKDEVYVCGEGDTLVELPETSDAVEVVRE
                     KCDELYHYVSKLSPNLSQGHILKRQACYLPVLNVPTSSGPLIGETNMEGLYVASGHSC
                     WGINNAPGTGKIMSELLLDGAAKSADISALDPGLYFDASVLD"
     gene            complement(<428402..>429025)
                     /locus_tag="KLTH0G05258g"
                     /db_xref="GeneID:8293533"
     mRNA            complement(<428402..>429025)
                     /locus_tag="KLTH0G05258g"
                     /product="KLTH0G05258p"
                     /transcript_id="XM_002555221.1"
                     /db_xref="GeneID:8293533"
     CDS             complement(428402..429025)
                     /locus_tag="KLTH0G05258g"
                     /note="similar to uniprot|Q03322 Saccharomyces cerevisiae
                     YDR468C TLG1 member of the syntaxin family of t- SNAREs
                     tSNARE that affects a Late Golgi compartment"
                     /codon_start=1
                     /product="KLTH0G05258p"
                     /protein_id="XP_002555267.1"
                     /db_xref="GeneID:8293533"
                     /db_xref="GOA:C5DM19"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5DM19"
                     /translation="MDDPFEQVLNDTREQASRLAQYLDAGHELDQEVRDILEDLEETV
                     RELDSSIMVMRREGFVDNATILARENRMQDLKRELARLKTHMTSSSRSAQGDGSPETS
                     EDPSSPRNNLLQEQMMEEQDQHLDTIHQTMQNLHLQASTMGQELEDQGMLLEEMDGGV
                     DNVMSKLSRGRRQLEWVYEKNKEKYNDCCIGLLIVALIVLLVLAFVL"
     gene            <429527..>429799
                     /locus_tag="KLTH0G05280g"
                     /db_xref="GeneID:8293534"
     mRNA            <429527..>429799
                     /locus_tag="KLTH0G05280g"
                     /product="KLTH0G05280p"
                     /transcript_id="XM_002555222.1"
                     /db_xref="GeneID:8293534"
     CDS             429527..429799
                     /locus_tag="KLTH0G05280g"
                     /note="some similarities with uniprot|Q03323 Saccharomyces
                     cerevisiae YDR469W"
                     /codon_start=1
                     /product="KLTH0G05280p"
                     /protein_id="XP_002555268.1"
                     /db_xref="GeneID:8293534"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:C5DM20"
                     /translation="MDPEQAPKQESPQPFNADRVDFAETIGGSHTRKYLNQHVTPALL
                     EGMRLVAKNKPSDPLRYLGEYLIKAGEDQDQPTNSSSQPNGSASQN"
     gene            complement(<429872..>431287)
                     /locus_tag="KLTH0G05302g"
                     /db_xref="GeneID:8293535"
     mRNA            complement(<429872..>431287)
                     /locus_tag="KLTH0G05302g"
                     /product="KLTH0G05302p"
                     /transcript_id="XM_002555223.1"
                     /db_xref="GeneID:8293535"
     CDS             complement(429872..431287)
                     /locus_tag="KLTH0G05302g"
                     /note="similar to uniprot|Q03327 Saccharomyces cerevisiae
                     YDR470C UGO1"
                     /codon_start=1
                     /product="KLTH0G05302p"
                     /protein_id="XP_002555269.1"
                     /db_xref="GeneID:8293535"
                     /db_xref="GOA:C5DM21"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DM21"
                     /translation="MDEVNTHQQLRPYYDPNTFNAGYSSVFKPDQGVIDNHGFSIASR
                     LNIVSQSKSKVTKKLRESGMLSQLTTGLKNPSRDPESSAEEAQKSLADMEWSDLLNWR
                     SWRAIGTQLLEQFLKRYFRHLIQQPFEVARFLLQVGEFNLIKPDDRSKITLEVEEEKA
                     DDSVEDDEEEIEYFPRADIGNQAEEIEGSASHQHHTEHSVPTLTKKIQPESLHTMDML
                     NSVMDEEGTRGLWRANNTTFIYNFLSVTLDAWFTGLLSPVFQVPDPFFIDIVHSTDTQ
                     KSVILTISASVFTGLVLLPVDIIRTRLTITSVKVGDRSLRNLLRKWSWRQHAFNLPLD
                     LVLLKVGDSVATTLFSKLTSVTLYHLFNIDKYSQTMWYNTLEFMSKMVELFVRLPIEN
                     LSRRAQTWYLLRGKARDPFPVHEDNMIIIPRKYKGVWATLQERERTHELWRGWRLGLL
                     SMLCGYGLKMMNLEALEEERF"
     gene            complement(<431556..>432425)
                     /locus_tag="KLTH0G05324g"
                     /db_xref="GeneID:8293536"
     mRNA            complement(<431556..>432425)
                     /locus_tag="KLTH0G05324g"
                     /product="KLTH0G05324p"
                     /transcript_id="XM_002555224.1"
                     /db_xref="GeneID:8293536"
     CDS             complement(431556..432425)
                     /locus_tag="KLTH0G05324g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G05324p"
                     /protein_id="XP_002555270.1"
                     /db_xref="GeneID:8293536"
                     /db_xref="UniProtKB/TrEMBL:C5DM22"
                     /translation="MSEQAPDEKVPSSGSGLSEISRASSEDAAVNGAYGSEDARDVPP
                     SPIEGYQEDLGEVVVGIRHLLDGNESLNSQVSQMDLRLTQTQLNLEGLVTRSTNNNKH
                     LKSLLMSSQDVRRLEELIQQLARQQDAAVAAQEHAREREPPEHGAAAEVQRLNEELGR
                     FKEQHGSLEALGLQVVAKKQELAVLETRCASATARLHERAEDLQKLRQDHLELDMRID
                     YALREKYKAVETNLALSAATFTQAGRPPVTKMNRITSMLRNQHTNGRRVVSLNVADNY
                     GFTPSNNSDDGSD"
     gene            <433074..>433824
                     /locus_tag="KLTH0G05346g"
                     /db_xref="GeneID:8293537"
     mRNA            join(<433074..433104,433445..>433824)
                     /locus_tag="KLTH0G05346g"
                     /product="60S ribosomal protein L27"
                     /transcript_id="XM_002555225.1"
                     /db_xref="GeneID:8293537"
     CDS             join(433074..433104,433445..433824)
                     /locus_tag="KLTH0G05346g"
                     /note="highly similar to uniprot|P38706 Saccharomyces
                     cerevisiae YHR010W RPL27A and to uniprot|P38706
                     Saccharomyces cerevisiae YDR471W RPL27B proteins component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L27"
                     /protein_id="XP_002555271.1"
                     /db_xref="GeneID:8293537"
                     /db_xref="GOA:C5DM23"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:C5DM23"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKAHPFGHALVA
                     GIERYPLKVTKRQGAKKVAKRTRIKPFIKVINYNHLLPTRYTLDVEGFKSVVSTETFE
                     EPSQREEAKKVIKKAFEERHQAGKNQWFFTKLNF"
     gene            <434086..>435414
                     /locus_tag="KLTH0G05368g"
                     /db_xref="GeneID:8293538"
     mRNA            <434086..>435414
                     /locus_tag="KLTH0G05368g"
                     /product="KLTH0G05368p"
                     /transcript_id="XM_002555226.1"
                     /db_xref="GeneID:8293538"
     CDS             434086..435414
                     /locus_tag="KLTH0G05368g"
                     /note="similar to uniprot|P38705 Saccharomyces cerevisiae
                     YHR011W DIA4 Probable mitochondrial seryl-tRNA synthetase"
                     /codon_start=1
                     /product="KLTH0G05368p"
                     /protein_id="XP_002555272.1"
                     /db_xref="GeneID:8293538"
                     /db_xref="GOA:C5DM24"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="UniProtKB/TrEMBL:C5DM24"
                     /translation="MQLRALSTTACRALRKPQFDVKGISGRLEAYLHSIKARQLLASP
                     QLSAELQNLPKQENELKLLNQQFARIQTARKDIEREIKEDKSKMLQSRHRLQELKTEA
                     QAVAADLKHMQDKVQETCMSLPNLIHGDVPLTEPQVLQWLSPQSEFRPDPKRDHHDIM
                     VRKELVDFRSAATVTGNSWYYLINDGALLEQALVSYATKKARDRGFIMCNPPSIAKNE
                     VIDACGFRPRDMNGEQQIYHLADTQWGLTATAEIALAGLGIDAVLDLSRGSKKLCGVS
                     RSYRAEAGARGKDTRGLYRVHEFTKVELFCWARPDDSDQMLEELRQFQTELVEELGLP
                     AKVLNMPANDLGAPAYRKYDIEVWMPGRGSFGEITSTSNCTDFQSRRMNTKFKDPVTG
                     KSSHVHTLNGTAMAVPRVIMALVENFYDPVSNLIAVPAPLVPYMDGKTHI"
     gene            <435603..>436429
                     /locus_tag="KLTH0G05390g"
                     /db_xref="GeneID:8293539"
     mRNA            join(<435603..435650,435707..>436429)
                     /locus_tag="KLTH0G05390g"
                     /product="KLTH0G05390p"
                     /transcript_id="XM_002555227.1"
                     /db_xref="GeneID:8293539"
     CDS             join(435603..435650,435707..436429)
                     /locus_tag="KLTH0G05390g"
                     /note="similar to uniprot|P38759 Saccharomyces cerevisiae
                     YHR012W VPS29 Protein involved in vacuolar protein
                     sorting"
                     /codon_start=1
                     /product="KLTH0G05390p"
                     /protein_id="XP_002555273.1"
                     /db_xref="GeneID:8293539"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR024654"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DM25"
                     /translation="MLLLALSDAHIPERAIKDLPQKFKKLISVPNKIQQVVLLGNCTK
                     SYSFLKFVNQISSNVVVVRGEFDNKTVAREEIPLNTIIKQGDFTIGCCNGYTVVPKSD
                     PLSLLTLARQLDVDIVLWGGTHNVEAYTLEDKFFINPGTCTGAFNPDWPLPDASNDST
                     LEASADSSEPQTQASEGSTDNANDATVPAQDGKSDQDDVANKEDEDTDSEIDDFEVDG
                     RCIPSFCLLDIQGSTCTLYIYTYVDGEVKVDKVVYNKK"
     gene            436757..436863
                     /gene="SNR13"
                     /locus_tag="KLTH0G05412r"
                     /db_xref="GeneID:8293540"
     ncRNA           436757..436863
                     /ncRNA_class="snoRNA"
                     /gene="SNR13"
                     /locus_tag="KLTH0G05412r"
                     /product="snR13"
                     /note="C/D snoRNA monocistronic SNR13"
                     /transcript_id="XR_002432211.1"
                     /db_xref="GeneID:8293540"
     gene            complement(<437130..>437813)
                     /locus_tag="KLTH0G05434g"
                     /db_xref="GeneID:8294185"
     mRNA            complement(<437130..>437813)
                     /locus_tag="KLTH0G05434g"
                     /product="KLTH0G05434p"
                     /transcript_id="XM_002555228.1"
                     /db_xref="GeneID:8294185"
     CDS             complement(437130..437813)
                     /locus_tag="KLTH0G05434g"
                     /note="similar to uniprot|P07347 Saccharomyces cerevisiae
                     YHR013C ARD1 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat-shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="KLTH0G05434p"
                     /protein_id="XP_002555274.1"
                     /db_xref="GeneID:8294185"
                     /db_xref="GOA:C5DM26"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DM26"
                     /translation="MPVTIRRATIEDMLCMQNANLNNLPENYLFKYYMYHILSWPEAS
                     FVATTTDDVGGPADATLEELAACCEGPVSATKGDPCYVRSGEKLVGYVLAKMNDDPSQ
                     PSEALTGHITSLSVMRTYRRMGVAEKLMRQALFALSEVYRAEQVSLHVRQSNRAALHL
                     YRDTLEFEVLKVEKSYYQDGEDAYAMKKTLDTEALQPANFQRGAEQDDLDSDLLEDLV
                     REGVAEVEA"
     gene            <437841..>438806
                     /locus_tag="KLTH0G05456g"
                     /db_xref="GeneID:8293541"
     mRNA            <437841..>438806
                     /locus_tag="KLTH0G05456g"
                     /product="KLTH0G05456p"
                     /transcript_id="XM_002555229.1"
                     /db_xref="GeneID:8293541"
     CDS             437841..438806
                     /locus_tag="KLTH0G05456g"
                     /note="similar to uniprot|Q03337 Saccharomyces cerevisiae
                     YDR472W TRS31 Component of the targeting complex (TRAPP)
                     involved in ER to Golgi membrane traffic"
                     /codon_start=1
                     /product="KLTH0G05456p"
                     /protein_id="XP_002555275.1"
                     /db_xref="GeneID:8293541"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:C5DM27"
                     /translation="MLTEAWNFPKSFTFLLLKLQRASAKHNNTNLVLYRMSHKIINPS
                     TSVAPANAAGSTGYDYTIGPQQTLPNTSAQSVASTLAGTRSVYHESLHPGAHGSHVSV
                     AAYAFLFQEMVSQARNASKTVSEIELRLHRHGYHIGLRLLELLKFRSSVTPGSGRSFF
                     HKAGGPAAATAGDAASGAGNASGAVGASGASSLGNAQDESLASNITTMKRRDLRLLEV
                     LQFVHGPVWRYLFDRASDDLVKSSERENEYMIIDNTPSITRFISSTNVQCDFFVCGII
                     EGVLDLASFPCTVTAHSVPEDKFNRRVVFVIRFDQEVLEREALRF"
     gene            complement(440161..440242)
                     /locus_tag="KLTH0G05478r"
                     /db_xref="GeneID:8293542"
     tRNA            complement(440161..440242)
                     /locus_tag="KLTH0G05478r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=80.04"
                     /db_xref="GeneID:8293542"
     gene            <440283..>442022
                     /locus_tag="KLTH0G05500g"
                     /db_xref="GeneID:8293543"
     mRNA            <440283..>442022
                     /locus_tag="KLTH0G05500g"
                     /product="KLTH0G05500p"
                     /transcript_id="XM_002555230.1"
                     /db_xref="GeneID:8293543"
     CDS             440283..442022
                     /locus_tag="KLTH0G05500g"
                     /note="weakly similar to uniprot|Q12433 Saccharomyces
                     cerevisiae YOR023C AHC1 Ada Histone acetyltransferase
                     complex component protein of the Ada histone
                     acetyltransferase complex"
                     /codon_start=1
                     /product="KLTH0G05500p"
                     /protein_id="XP_002555276.1"
                     /db_xref="GeneID:8293543"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DM28"
                     /translation="MSIRRHLKFMYRKLMKLRRTASIISHEHTTELPGVMAIPNLRSR
                     GQPRSSSVDMRSTEQDVGEEPADAPQVLFMDNQDVGNRTGHPPPSYYQVATPKSPHEL
                     SLVDESEERPESIVGSVHHESEESERLKYETAKREILDLLNLHIMLSNNEHNEIDTEL
                     GRVEAQMKVLEHMHKDKDLLEKVNQHQEELYQRSRDNFLNKKEAEASQSPTNISFGFL
                     FGEAPSSNASQGNYFYHTRSKSSHNITNAYQSRLRPANNGTMDMRLTGGKQPNKGDQP
                     PAAGSSGNEFDLARPPLLNQHHRRNYSSTCLTSNSGVVGSNEKNEPIFKRPDGILVII
                     ACSFCERSGFTSAQGIVNHVRLKHAKTYSSQPLAVLNNQHVLPKTLQPPEVMQQFKEL
                     HLDPSNDYLPNILNPQAGASANTNSDRKNSTRELSPKSKYLATHSPSKAAKKSTKHLK
                     KLYNRDDFKDIVDYVSEAQRDLDAILKQQSESEANFESDDPDAKDLQGPRSSSRSSTK
                     SSFAARSSPENTNERKRSSSPEMDAKKRHKPAEKKVRPDAIALMNIPERDKRSSHYNL
                     RAKSKLRGHSRYE"
     gene            <442156..>444135
                     /locus_tag="KLTH0G05522g"
                     /db_xref="GeneID:8293544"
     mRNA            <442156..>444135
                     /locus_tag="KLTH0G05522g"
                     /product="KLTH0G05522p"
                     /transcript_id="XM_002555231.1"
                     /db_xref="GeneID:8293544"
     CDS             442156..444135
                     /locus_tag="KLTH0G05522g"
                     /note="similar to uniprot|Q12204 Saccharomyces cerevisiae
                     YOR022C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G05522p"
                     /protein_id="XP_002555277.1"
                     /db_xref="GeneID:8293544"
                     /db_xref="GOA:C5DM29"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DM29"
                     /translation="MQKRLLCGVYRSCRYVSTKPEGSNVRWFYATDLPIRKPFEPKYA
                     IGDKEPCKFLPFSRNDSMRLERMNQLMGAEESKRSPNYQAVPVNEDYLFEVNLSKREI
                     KPAFWEGPVYEVRRGIWFNSDHKPLRNDLTTELEKYRQELLADKNNPPGCQGGKERQY
                     RDVFALSSKHKEGKMVLYADEKTAFILPDLYGGKLQLNWLRSNMAQAVQFGAYKVVRG
                     ADSECSIGEAVKGNVDAEVKETTRSLGKVTDLINWQLLGSLSGLNPFSSKSEDANKVM
                     EQEIEADYARENESKKTWRSNHRDVDHLVFCIHGIGQNLGKKYQYVNFAHTVNVLRSN
                     LKKMYHQSDQLKNKSKDKGFEDWQENCRTQVLPITWRNKIGFNTDDAEFNSEDPSLPT
                     LNDITPDGVRPLRKILGDVVLDLLLYGEPHYKHRIMKEVTSQLNHVYRLYRSRNPNFD
                     GQVHIMGHSLGSLLLFDILANQDRYPLDFEVHNFFSIGSPVGVFKLIQKTRIGQQKNS
                     RGKFEELKCHNYFNIYHMCDPVAYRVEPLVDRCFANFQPTYVPHWSSNDIAAKVLEIG
                     GSLISSDPTKEGSTTKMTDRQIKMLNKLNYTGRVDYSFLPNFLEVDLISAIKAHVSYF
                     EEMDLAAFILKQVLSKHRRVETDLAVQKRSAVQTD"
     gene            <444244..>444882
                     /locus_tag="KLTH0G05544g"
                     /db_xref="GeneID:8293545"
     mRNA            <444244..>444882
                     /locus_tag="KLTH0G05544g"
                     /product="KLTH0G05544p"
                     /transcript_id="XM_002555232.1"
                     /db_xref="GeneID:8293545"
     CDS             444244..444882
                     /locus_tag="KLTH0G05544g"
                     /note="highly similar to uniprot|Q12314 Saccharomyces
                     cerevisiae YOR021C"
                     /codon_start=1
                     /product="KLTH0G05544p"
                     /protein_id="XP_002555278.1"
                     /db_xref="GeneID:8293545"
                     /db_xref="InterPro:IPR007364"
                     /db_xref="UniProtKB/TrEMBL:C5DM30"
                     /translation="MKYIIEHMEQGFSEWVTLEYAQIIRDLGASNLILSSLPEGTKES
                     DIPLKLREMGLQWTTRPLTEINEVFPELPKLKEQRVCLLDPRAKTDLEPSDAQTYDYF
                     VFGGILGDHPPRDRTKELMNAYPNLLVGKRLGDKQMTTDTAIRTTQIIIERQTRFEDI
                     KFIDYPEFRFNKNEATEMPFRYVLDGEGKPILPQGMLELIKKDSEQSLDDLL"
     gene            complement(<444962..>445453)
                     /locus_tag="KLTH0G05566g"
                     /db_xref="GeneID:8293546"
     mRNA            complement(join(<444962..445151,445380..>445453))
                     /locus_tag="KLTH0G05566g"
                     /product="KLTH0G05566p"
                     /transcript_id="XM_002555233.1"
                     /db_xref="GeneID:8293546"
     CDS             complement(join(444962..445151,445380..445453))
                     /locus_tag="KLTH0G05566g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G05566p"
                     /protein_id="XP_002555279.1"
                     /db_xref="GeneID:8293546"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:C5DM31"
                     /translation="MLVPKRILLASAIKPAQGDEVERCLTIQPHVLAIATIASTVGVA
                     AYSMSGSKAEAAPQPASAMSTQESGGLDVEKLIDNYLKQSEKN"
     gene            <446144..>446461
                     /locus_tag="KLTH0G05588g"
                     /db_xref="GeneID:8293547"
     mRNA            <446144..>446461
                     /locus_tag="KLTH0G05588g"
                     /product="KLTH0G05588p"
                     /transcript_id="XM_002555234.1"
                     /db_xref="GeneID:8293547"
     CDS             446144..446461
                     /locus_tag="KLTH0G05588g"
                     /note="highly similar to uniprot|P38910 Saccharomyces
                     cerevisiae YOR020C HSP10 Mitochondrial matrix
                     co-chaperonin that inhibits the ATPase activity of Hsp60p"
                     /codon_start=1
                     /product="KLTH0G05588p"
                     /protein_id="XP_002555280.1"
                     /db_xref="GeneID:8293547"
                     /db_xref="GOA:C5DM32"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:C5DM32"
                     /translation="MSTLIKSAKSIVPLLDRVLVQRVKAEAKTASGLYLPEKNVQKLN
                     QATVLAVGPGFTDSNGNKVTPQVQPGDNVLIPQFGGSSIKLKDDEEVILFRDSEILAK
                     LNE"
     gene            complement(<446541..>447809)
                     /locus_tag="KLTH0G05610g"
                     /db_xref="GeneID:8293548"
     mRNA            complement(<446541..>447809)
                     /locus_tag="KLTH0G05610g"
                     /product="KLTH0G05610p"
                     /transcript_id="XM_002555235.1"
                     /db_xref="GeneID:8293548"
     CDS             complement(446541..447809)
                     /locus_tag="KLTH0G05610g"
                     /note="similar to uniprot|Q03338 Saccharomyces cerevisiae
                     YDR473C PRP3 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="KLTH0G05610p"
                     /protein_id="XP_002555281.1"
                     /db_xref="GeneID:8293548"
                     /db_xref="GOA:C5DM33"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:C5DM33"
                     /translation="MRARKEKGNSSSRDGNSARFGAGLDIDIHPALLSENLNLIKHRD
                     NPYLSRERFDTVASKVSKRYSRGLKFRTPGVLAKELDEKRAWLAKERELQKEQDNLRK
                     AKVRAGELPDESIGEQNYLITDVPQIEWWDAIYVQSPEDWTIKTKYSKSYGTMDEDSD
                     DEQDSESESPSVRYVQHPVPVQAAEHAPSKPKIYLVKREQKKIRRNRRKLLQEEHEQK
                     IKLGLEPKPAPKVKLSNMMSVYQNNENITDPTSWEQTVKAQAEERHQKHVETNIRRHY
                     EAKEQKKEKAQEAPPAQAELHCRVFRFSSLRNPKIRFKLAKNSRQLGLRGVCLRVGDG
                     AGIIVVIGSEKNCRFYSKLVLQRIDWTQSYVDKDSQQFVDCSGDEAELLWEGVVKDTR
                     FRGWFMKECRDESELQAVLSQFDADWLLRV"
     gene            complement(<447986..>450211)
                     /locus_tag="KLTH0G05632g"
                     /db_xref="GeneID:8293549"
     mRNA            complement(<447986..>450211)
                     /locus_tag="KLTH0G05632g"
                     /product="KLTH0G05632p"
                     /transcript_id="XM_002555236.1"
                     /db_xref="GeneID:8293549"
     CDS             complement(447986..450211)
                     /locus_tag="KLTH0G05632g"
                     /note="some similarities with uniprot|Q99248 Saccharomyces
                     cerevisiae YOR019W"
                     /codon_start=1
                     /product="KLTH0G05632p"
                     /protein_id="XP_002555282.1"
                     /db_xref="GeneID:8293549"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DM34"
                     /translation="MTDFDEKNSKPSDAGGSRKNKSSGKSEGIEARDNLKVPNKDSGA
                     SLFLSSVSFDTVPLLAGVACEESHEPCCNDHSLDYTEDEFYDNESTVDFAHHYDGGDR
                     LVVPFTRFSGSQLRGQSNASISMINSTVDGLDGIYVGKDGKITRTDYPTRPTIVNDAI
                     VINRAHKDWPALWSTRRQQIEQRVHSPAAHFVFPEILFPSEKPTALSASDGYTPLSKE
                     EKRKALVISKKVGFPNSPRTLLCHISGRKHTWTPLDWLLKKFSHDVDHLVIIANIPKM
                     SNHRSRSRSRSRSAAPRSESADGPRDKTQHKHEHWLEWASGYDAAVIKETLNDILRYV
                     TTILPKNRAVKVTVEIVIGRIQKIVTDAINVYSPDLIVMSSLRYKPNESIVKWRSRKT
                     IDRFCQTCPVPIVLVPVRKMKDLEDEILNELRVMKGFSKVGEKEGVQIQNPARGDKDI
                     SQESQKFQPPETASKQSSSQSLSDDERSDTESMNSSIASSGVTDSRLQRKLADFRKNA
                     QNEIDKIERNPHLDHDQKLISKVDAITESSLRFTNRLDEMNYSTESFAELKRVFTGDG
                     KPQTGGHRKSMLDVLGPSEKVKKIKTPSIKVEESTSPSRKSQIKFAPEVKSRDGRDRI
                     FPPDSRPIERTLSYDLALRPESSQGTSSSSRDMDLRKVRSASGLKPTKSAGSSSSDYL
                     KKKSKGFFSFFKVPESNSNSPASSAVSSRRSSVGSESSGIVVGTPHKKKRSRFFGFVK
                     P"
     gene            complement(<450410..>451244)
                     /locus_tag="KLTH0G05654g"
                     /db_xref="GeneID:8293550"
     mRNA            complement(join(<450410..451090,451167..>451244))
                     /locus_tag="KLTH0G05654g"
                     /product="KLTH0G05654p"
                     /transcript_id="XM_002555237.1"
                     /db_xref="GeneID:8293550"
     CDS             complement(join(450410..451090,451167..451244))
                     /locus_tag="KLTH0G05654g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G05654p"
                     /protein_id="XP_002555283.1"
                     /db_xref="GeneID:8293550"
                     /db_xref="GOA:C5DM35"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DM35"
                     /translation="MLGVECLKQWATSIWQYILSIFYQKELNIVIVGLQNSGKTSLTT
                     VLLGRPFEQDTIPTLGMRMEQFSLGLNVVRIFDLAGQHRFHHIWKRYFERADLIIYVI
                     DLSDLTNWQECKRTLHQVIVDTNRDGIPMLILGNKIDLINIPDISKGVNDRKNQKRSA
                     ADLSAIEQWKYMAPLLRNYEFEDIPTYQLEDSNLYVLKNVETLSKELGIDLKNGILYM
                     PESQIYLDRDLAVFTISCKDGEYVQDVLNWVNQL"
     gene            complement(<451458..>452087)
                     /locus_tag="KLTH0G05676g"
                     /db_xref="GeneID:8293551"
     mRNA            complement(<451458..>452087)
                     /locus_tag="KLTH0G05676g"
                     /product="KLTH0G05676p"
                     /transcript_id="XM_002555238.1"
                     /db_xref="GeneID:8293551"
     CDS             complement(451458..452087)
                     /locus_tag="KLTH0G05676g"
                     /note="similar to uniprot|Q03362 Saccharomyces cerevisiae
                     YDR476C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G05676p"
                     /protein_id="XP_002555284.1"
                     /db_xref="GeneID:8293551"
                     /db_xref="InterPro:IPR019595"
                     /db_xref="UniProtKB/TrEMBL:C5DM36"
                     /translation="MVSGSSPEGIVAHMNKSHKIALEDYLFAYGHVRMDEKIAHVRLE
                     SISLTHMTILFNHFDVEFEIEKVILFEPPLKEWSEARPRLAEMAKAAAKKRGYSHVQV
                     NEMSYPNSLVDYVIVLFVFFPLACYMRRDLLNYVPFVGPYFDNDALLLGIQLAAFAIH
                     FLECIFLLKPKLDFYRVPTDFLIEWYLFGMLEGYGPVRRFDELAKGKVH"
     gene            <453530..>455323
                     /locus_tag="KLTH0G05698g"
                     /db_xref="GeneID:8293552"
     mRNA            <453530..>455323
                     /locus_tag="KLTH0G05698g"
                     /product="KLTH0G05698p"
                     /transcript_id="XM_002555239.1"
                     /db_xref="GeneID:8293552"
     CDS             453530..455323
                     /locus_tag="KLTH0G05698g"
                     /note="similar to uniprot|P06782 Saccharomyces cerevisiae
                     YDR477W SNF1 Protein serine/threonine kinase required for
                     release from glucose repression invertase expression
                     sporulation and for expression of catabolite- repressed
                     genes when glucose is limiting regulates Adr1p- dependent
                     transcription primarily at the level of chromatin binding"
                     /codon_start=1
                     /product="KLTH0G05698p"
                     /protein_id="XP_002555285.1"
                     /db_xref="GeneID:8293552"
                     /db_xref="GOA:C5DM37"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:C5DM37"
                     /translation="MSSHSTGYAHHSTHHHHHSSHGQDQRIGKYQIIKTLGEGSFGKV
                     KLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDE
                     IVMVIEYAGNELFDYIVQRDKMSEREARRFFQQIISAVEYCHRHKIVHRDLKPENLLL
                     DEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILY
                     VMLCRRLPFDDESIPILFKNISNGIYTLPKFLSPGAANLIKRMLIVNPLNRITIHEIM
                     EDEWFKVDIQPYLIPPDLKSETDEHRQEGEHPDGGEEGEEVDDSLVTMLSKTMGYDRD
                     EIYEALESEEDNPALKEIRDAYLLIKENKSLIDDLKSNKDQSNELDTFLSQSPPTYDQ
                     RPHRSSSSSGPSSSRNHRHMRKSQQRTYQSPFVDQQKDEDSTIAILPSSLPQIHRANM
                     LAEGSPAATKISPLSTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAQWAKPSEDD
                     LWTIRVRWKYDMRQPTNEKIPDLMKMVIQLFQIEANNYLVDFKFDGWESSYGEFTPAA
                     NEDEMSTFSAYPFLHLTTKLIMELAVNSQGG"
     gene            <455630..>457123
                     /locus_tag="KLTH0G05720g"
                     /db_xref="GeneID:8293553"
     mRNA            <455630..>457123
                     /locus_tag="KLTH0G05720g"
                     /product="KLTH0G05720p"
                     /transcript_id="XM_002555240.1"
                     /db_xref="GeneID:8293553"
     CDS             455630..457123
                     /locus_tag="KLTH0G05720g"
                     /note="similar to uniprot|P53687 Saccharomyces cerevisiae
                     YOR025W HST3 Member of the Sir2 family of NAD()-dependent
                     protein deacetylases involved along with Hst4p in
                     telomeric silencing cell cycle progression radiation
                     resistance genomic stability and short-chain fatty acid
                     metabolism"
                     /codon_start=1
                     /product="KLTH0G05720p"
                     /protein_id="XP_002555286.1"
                     /db_xref="GeneID:8293553"
                     /db_xref="GOA:C5DM38"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DM38"
                     /translation="MPCLILSQESFDEKVPSSLSKRVANRPDLKTSKLRHLSITEPSE
                     KDKELLKQVNKQISKSRKILVLTGAGISCNAGIPDFRSSSGCYELVKQEYPDAAIRSG
                     QEMFDISLFREEQKICIFATFMEKLYSSARVAQPTRTHRFIAHLKNRGKLLRCYTQNI
                     DGLEENLGLEMSSERDCDTSMANQWRNLDVVQLHGDLNRLSCTQCFKTFNWNRGLSRC
                     LRSGQLPSCPRCEDSSTQRSLMGKRNTGSIGLLRPNIVLYGENHPSCEFITQGLNLDI
                     ARGRPDLFFIMGTSLKVDGVKKLVRNFSKQVHDRNGLVVLINKTRIGDCNWHGIIDYQ
                     ILSDCDAWVDHLKEDIPEFFKTQQQVEKARQLKRENSILRKRQREERKLTPPSTPSRK
                     KATAQKSVKSEIHKSNDGASTPEDSCPTLFTKGERTSQESVLLKLQIEDQKSEPLSLL
                     DASSLPSLGGDNSMSNHTDTTIEDDPTDIDEDLPISSYSTLSRKQTV"
     gene            complement(<457246..>458775)
                     /locus_tag="KLTH0G05742g"
                     /db_xref="GeneID:8293554"
     mRNA            complement(<457246..>458775)
                     /locus_tag="KLTH0G05742g"
                     /product="KLTH0G05742p"
                     /transcript_id="XM_002555241.1"
                     /db_xref="GeneID:8293554"
     CDS             complement(457246..458775)
                     /locus_tag="KLTH0G05742g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G05742p"
                     /protein_id="XP_002555287.1"
                     /db_xref="GeneID:8293554"
                     /db_xref="GOA:C5DM39"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DM39"
                     /translation="MMKTADEVKFENNEAANRSKSRLAGILRSFSSAGSYSKRKVPTI
                     SNPRAEFPFAKPNLSAKRDRVFLDVLQDYLPNEPAQSAGSAARSRFLNIYRGEIVQLL
                     EPAPNNLVKVRLVNRLGQGLVPARCVAVNVELTPSKMAQQGSQEDLEVSEPGSPTLSQ
                     KLESEPETESESESPKPQAPASGLNAVEKCQVVGIHMWENRILYRIDCIMRSGHRRAL
                     SRFYQDFYSLQLQLRDRMVEEGIEDPQEVLPGLPSPSRKVDDSKVTNRLDVFNEYLHQ
                     IISSEHISQSIKRDVVLDKWLSLRPGDLVKTQRGSLYKVNEAASESREDFTWESLDPS
                     TSIDALDRDLSPLPTDWNLGALGGPKAKPPIPRAPSLTDMPVRRKPLMKLSADSAPTT
                     PITNTLAKCLTPTSAPPSPEQVGTDHVKVKILHKDDCYAAKCTLSELESYEKLDSLCR
                     SKLKSCLTSADCPLTISYVNDKKEPLELSREIFDDVLPKLVLAASGSIVTKLTFRVVA
                     A"
     gene            <459416..>459970
                     /locus_tag="KLTH0G05764g"
                     /db_xref="GeneID:8293555"
     mRNA            <459416..>459970
                     /locus_tag="KLTH0G05764g"
                     /product="KLTH0G05764p"
                     /transcript_id="XM_002555242.1"
                     /db_xref="GeneID:8293555"
     CDS             459416..459970
                     /locus_tag="KLTH0G05764g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G05764p"
                     /protein_id="XP_002555288.1"
                     /db_xref="GeneID:8293555"
                     /db_xref="UniProtKB/TrEMBL:C5DM40"
                     /translation="MRAECRRKDVTSVEPSTKQAVARAPDPRRIWACGSGAGRTAGRP
                     SECMRASDGAPVSRRRRARGARRSSWMVTDVHVCITCAQEALDESPSAFLLSNRRYNI
                     STARASEGPLRSTLARARCFPKANRGAVDFVYGDSDYKGAVTNVFVYFRPFAPGTHVF
                     KIASQLVFQKMIYKICGFLRKLWA"
     gene            complement(<460135..>460995)
                     /locus_tag="KLTH0G05786g"
                     /db_xref="GeneID:8293556"
     mRNA            complement(<460135..>460995)
                     /locus_tag="KLTH0G05786g"
                     /product="KLTH0G05786p"
                     /transcript_id="XM_002555243.1"
                     /db_xref="GeneID:8293556"
     CDS             complement(460135..460995)
                     /locus_tag="KLTH0G05786g"
                     /note="highly similar to uniprot|P47137 Saccharomyces
                     cerevisiae YJR096W"
                     /codon_start=1
                     /product="KLTH0G05786p"
                     /protein_id="XP_002555289.1"
                     /db_xref="GeneID:8293556"
                     /db_xref="GOA:C5DM41"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DM41"
                     /translation="MSSTSVPRAYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAG
                     YRHLDTAVLYGNEREVGEGVEKWLKEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQE
                     CLDKVRPLGYIDMLLIHSPLSGTRRRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDEL
                     LAWEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPLTHGYKIKHPNVVRVA
                     EEVGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVYDFELSPEQITFLDQPQAYE
                     PTDWECTNEP"
     gene            complement(<461330..>462355)
                     /locus_tag="KLTH0G05808g"
                     /db_xref="GeneID:8293557"
     mRNA            complement(<461330..>462355)
                     /locus_tag="KLTH0G05808g"
                     /product="KLTH0G05808p"
                     /transcript_id="XM_002555244.1"
                     /db_xref="GeneID:8293557"
     CDS             complement(461330..462355)
                     /locus_tag="KLTH0G05808g"
                     /note="highly similar to uniprot|P33303 Saccharomyces
                     cerevisiae YJR095W SFC1 Mitochondrial succinate-fumarate
                     transporter transports succinate into and fumarate out of
                     the mitochondrion required for ethanol and acetate
                     utilization"
                     /codon_start=1
                     /product="KLTH0G05808p"
                     /protein_id="XP_002555290.1"
                     /db_xref="GeneID:8293557"
                     /db_xref="GOA:C5DM42"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DM42"
                     /translation="MSSRKNSSHPAINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRA
                     QEIAEHARRAPGFVSTARDIARQEGFLAFYKGLGAVVIGIIPKMAIRFTSYEFFRTLL
                     ADPGSGAVSTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHVRYVPLAAELAGAAS
                     PHTASLAGASTATANVPAAPKYRNAIQAAFVIVKEEGPRALYRGVSLTAARQATNQGA
                     NFTVYSTLKTRLQEYHQTDMLPSWETSLIGLLSGAVGPFSNAPLDTIKTRLQKDKSVS
                     KDSGWARIVAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYELIREQLEGLAA
                     SRKLATS"
     gene            complement(<462889..>463567)
                     /locus_tag="KLTH0G05830g"
                     /db_xref="GeneID:8293558"
     mRNA            complement(join(<462889..463165,463566..>463567))
                     /locus_tag="KLTH0G05830g"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_002555245.1"
                     /db_xref="GeneID:8293558"
     CDS             complement(join(462889..463165,463566..463567))
                     /locus_tag="KLTH0G05830g"
                     /note="highly similar to uniprot|P49631 Saccharomyces
                     cerevisiae YPR043W RPL43A Protein and to YJR094W-A
                     uniprot|P49631 Saccharomyces cerevisiae YJR094W-A RPL43B
                     Protein, components of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_002555291.1"
                     /db_xref="GeneID:8293558"
                     /db_xref="GOA:C5DM43"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C5DM43"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHSRYDCSFCGK
                     KTVKRGAAGIWTCSSCKKTVAGGAYTVSTAAAATVRSTIRRLRDMAEA"
     gene            464121..464193
                     /locus_tag="KLTH0G05852r"
                     /db_xref="GeneID:8293559"
     tRNA            464121..464193
                     /locus_tag="KLTH0G05852r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8293559"
     gene            <464597..>465337
                     /locus_tag="KLTH0G05874g"
                     /db_xref="GeneID:8293560"
     mRNA            <464597..>465337
                     /locus_tag="KLTH0G05874g"
                     /product="KLTH0G05874p"
                     /transcript_id="XM_002555246.1"
                     /db_xref="GeneID:8293560"
     CDS             464597..465337
                     /locus_tag="KLTH0G05874g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G05874p"
                     /protein_id="XP_002555292.1"
                     /db_xref="GeneID:8293560"
                     /db_xref="UniProtKB/TrEMBL:C5DM44"
                     /translation="MLRSGRKLARAPAAGKTPKRASAAKTTRGRGRRALRRAARRARS
                     GSASATDRRPVTEEAAVEARGYGRGPDAPSPGGPPPDFLDEYVHWDLADATAISGLVH
                     TQPVHAAPALAPALALLDRLDELASRSVSPAFSAFSDRLQDSLPELQLPPPPLEATAH
                     VPKNPPFQLQELIEVASHIAEPSQHFKPRPARAPRAAARSPRDSFVSYISHKLSRYCG
                     YLAADSHYHDKLRLQEITYRFSKTDFRR"
     gene            <465707..>466480
                     /locus_tag="KLTH0G05896g"
                     /db_xref="GeneID:8293561"
     mRNA            <465707..>466480
                     /locus_tag="KLTH0G05896g"
                     /product="KLTH0G05896p"
                     /transcript_id="XM_002555247.1"
                     /db_xref="GeneID:8293561"
     CDS             465707..466480
                     /locus_tag="KLTH0G05896g"
                     /note="similar to uniprot|P38782 Saccharomyces cerevisiae
                     YHR058C MED6 RNA polymerase II transcriptional regulation
                     mediator RNA polymerase II mediator subunit"
                     /codon_start=1
                     /product="KLTH0G05896p"
                     /protein_id="XP_002555293.1"
                     /db_xref="GeneID:8293561"
                     /db_xref="GOA:C5DM45"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="UniProtKB/TrEMBL:C5DM45"
                     /translation="MSAPQLDELQWKSPEWIQSFGLRTDNVLDYFAESPFFDRTSNNQ
                     VAKMQQQFAQPRPAGQVAPSMSLEDPDPHRRSILSTYMVHALWEQELRKLKGVEYILA
                     YVREPDFWIIRKQNRTGPTAVSPLQDYYIIGANVYQAPSVFKIVQSRLLSSNLHLSKA
                     LSSLRRMTEFQPSQGGHFVKTSYQATPSSSQQPMTVASTSNAANSAANTGPATANGQS
                     GLTGTADPIGLAGQPSATMNQAQMDKLLATSMKSSPAYL"
     gene            <466729..>467355
                     /locus_tag="KLTH0G05918g"
                     /db_xref="GeneID:8293562"
     mRNA            <466729..>467355
                     /locus_tag="KLTH0G05918g"
                     /product="KLTH0G05918p"
                     /transcript_id="XM_002555248.1"
                     /db_xref="GeneID:8293562"
     CDS             466729..467355
                     /locus_tag="KLTH0G05918g"
                     /note="similar to uniprot|P35176 Saccharomyces cerevisiae
                     YDR304C CPR5 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) of the endoplasmic reticulum catalyzes the
                     cis-trans isomerization of peptide bonds N- terminal to
                     proline residues transcriptionally induced in response to
                     unfolded proteins in the ER"
                     /codon_start=1
                     /product="KLTH0G05918p"
                     /protein_id="XP_002555294.1"
                     /db_xref="GeneID:8293562"
                     /db_xref="GOA:C5DM46"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DM46"
                     /translation="MLALRLIASVFAFFVCVRAASDAVVTHKVYFDIQHGDKNVGRIV
                     LGLFGNVAPKTVQNFYELSTSEDPSMGYLNSTFHRIISNFMIQGGDFTDHSGIGGKSI
                     YGNTFEDESFELKHDKPGRLSMANRGRNTNGSQFFITTVPTPWLDGRHVVFGEVIDGM
                     DVVEYLDSVPTGRGDKPKEVVKIVACGEVETVPVREQLKEEAGIRDEL"
     gene            <467678..>468493
                     /locus_tag="KLTH0G05940g"
                     /db_xref="GeneID:8293563"
     mRNA            <467678..>468493
                     /locus_tag="KLTH0G05940g"
                     /product="KLTH0G05940p"
                     /transcript_id="XM_002555249.1"
                     /db_xref="GeneID:8293563"
     CDS             467678..468493
                     /locus_tag="KLTH0G05940g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G05940p"
                     /protein_id="XP_002555295.1"
                     /db_xref="GeneID:8293563"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /db_xref="UniProtKB/TrEMBL:C5DM47"
                     /translation="MLRISSKTRFLPGWALRTRKLNTLVNISSRKSGSFGGPFSQLPE
                     FTPLQDSILISLPSSCTVYTKTDKVSVISADPNVNENPVIFKDAVPGSGFSRLFTREE
                     PINAMLVSSTPMSNVLVLELDDYNEGWYLADPQNSVICYSGDLTFASDGRHLVGRGVV
                     AVSGEGPVYQLQLGENESIIVSPDAILGHDKKVRLETSVLGSHAGIPEIIKKSLSQYA
                     QSYLDTLNITWHKLFAKSRTFYQATGPGTLLLQTSFVPETKVFTDDDLSKALK"
     gene            complement(<468537..>469193)
                     /locus_tag="KLTH0G05962g"
                     /db_xref="GeneID:8293564"
     mRNA            complement(<468537..>469193)
                     /locus_tag="KLTH0G05962g"
                     /product="KLTH0G05962p"
                     /transcript_id="XM_002555250.1"
                     /db_xref="GeneID:8293564"
     CDS             complement(468537..469193)
                     /locus_tag="KLTH0G05962g"
                     /note="similar to uniprot|Q06636 Saccharomyces cerevisiae
                     YDR302W GPI11 ER membrane protein involved in a late step
                     of glycosylphosphatidylinositol (GPI) anchor assembly
                     involved in the addition of phosphoethanolamine to the
                     multiply mannosylated GPI intermediate human PIG-Fp is a
                     functional homolog; GPI11 ER membrane protein"
                     /codon_start=1
                     /product="KLTH0G05962p"
                     /protein_id="XP_002555296.1"
                     /db_xref="GeneID:8293564"
                     /db_xref="GOA:C5DM48"
                     /db_xref="InterPro:IPR009580"
                     /db_xref="UniProtKB/TrEMBL:C5DM48"
                     /translation="MPPRMRVAPKKTVSFSDDENMTRARQLNSKKHQTDIYGPPVYVK
                     KSLLTVPVHLVALLYYYIKLSEDFDDVRLLYGLIPMQIAYLAAQFNRSTVYGHKILKL
                     KLSLVPISLGAALLLTLPCMLIIILMGAPVRMLLRETWLLAAHCCFLAFPAVYSVFNC
                     DFKVGIFKKYFISIAIGCWISCIVIPLDWDRDWQQWPTPLIVGAYAGAFVGYSLCPYL
                     "
     gene            complement(<469719..>473642)
                     /locus_tag="KLTH0G05984g"
                     /db_xref="GeneID:8293565"
     mRNA            complement(<469719..>473642)
                     /locus_tag="KLTH0G05984g"
                     /product="KLTH0G05984p"
                     /transcript_id="XM_002555251.1"
                     /db_xref="GeneID:8293565"
     CDS             complement(469719..473642)
                     /locus_tag="KLTH0G05984g"
                     /note="similar to uniprot|Q06632 Saccharomyces cerevisiae
                     YDR301W CFT1 Functions in cleavage of 3'-ends of pre-mRNAs
                     prior to polyadenylation 23.5% identical to the 160-kDa
                     subunit of mammalian cleavage and polyadenylation
                     specificity factor (CPSF-160) Component of pre-mRNA
                     cleavage factor II (CFII) 150-kDa protein associated with
                     polyadenylation factor 1 (PF I)"
                     /codon_start=1
                     /product="KLTH0G05984p"
                     /protein_id="XP_002555297.1"
                     /db_xref="GeneID:8293565"
                     /db_xref="GOA:C5DM49"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="UniProtKB/TrEMBL:C5DM49"
                     /translation="MNIYNEIFDATQVSHALLGHFTSEKTEQLIVAKTNILSVYTTED
                     GKLVLLHEFKLHGQITGMALVPQMEGPLDCLVVSTGKAKLSLVRFDPSMPMCLETLSL
                     HYYEAEFTRKNLIELAKTSKLRLDPERRCVLLFNSDVLALLPLNINEEDEDDNQEPTH
                     QAKKRKVENGDARRLAKQSSVLHVSDLSAELKNVVDIQFLNSFSQPTLAVLYQPRLAW
                     SGNDKVAGKGSMRLMAITPHEKKNTTIYQVKELPHDVHTIIPLANSCVLVGVNEIVSV
                     DNTGAIQSTIQLNSFSPKFTGSKQIDNSSLEVMFTEPIVWASAMVSKDREILILMDHK
                     ADMYSITLQSEGRLLIDFTLVRLPIVNDIFKDQNLPTCIVALSGGIRLKTCQFFIGFS
                     SGDAVVVKSNNLRSAFESQYREAIELPNDEDEDYDALYGDDEDLARPVNDNKATVETA
                     VPFEIELMDSLINVGPITSICTGRVSSINATIEGLPNPNRNELAIVSTSGHDSGTYLN
                     VMEPSVRPLVQQALKFTSVTKIWNLKIRKKDKYLVTTDSGAEKSDVYEIGAKIASIKP
                     KHFKRNVTTVEIAILGGGKRIVQVTTKAVYLFNLGFKKLMTISFDFEVVHVSILDPFI
                     LLTNSKGEIKIYELDSKHRKKLTKVPLPEVLEEMIITSGAILKSSICNQFMIGLENAD
                     KDQLLFTFVGADNQIIMFPKEHHDRVFQLNGVDMLSEMLYVSTYQLPEEIVPDPSIKQ
                     VMINKLGKDKKEEFLTILTFGGEIYMYRKTGNKFFKSMQSNDLQITGAPGNAYAKGVS
                     AIERIAHYVKYYNGYSIILITGSTPYMIVKEDYSTPKIFKFANIPLVSLAPWGTDSVL
                     CVDDIKNARIVTLDTTFSYGNRLPVKRVPIEDPLNYYGCLNNVAYHERSGMYIVSYTK
                     EIEYEAISEEGEKTVGSDDSVPHARGFQSGVLLLNPKSWNIIDKADYEKNSLINDMKT
                     MLIQTNSRTRRKREYLVVGNTFVRDEDIGTMGSFCLYDITEVVPEPGKPDTNYKLKQI
                     FYEEFRGAVSSVCEISGRFLISQSQKVLVRDVQEDNSVVPVAFLDVPVFVTDSKSCGN
                     LLIIGDAMQGFQFVGFDAEPYRMIPLGKSVSKFEVMSLEFLVNNGSIYFLVSDRSNIL
                     HILKYAPDEPNSLSGQKLVHCTSFNLHSTNTCMKLLLKNDEFPTLGEPPAFQAIGAQT
                     DGSLFNVVPLSESSYRRLYMVQQQLIEKDVHLCGLNPKMERLQNDFYQLGHLMRPMLD
                     FTVIKSFATLPLNKRKQIAAKAGRQADFEIWRDLINVEYSTRSLC"
     gene            <474346..>475611
                     /locus_tag="KLTH0G06006g"
                     /db_xref="GeneID:8293566"
     mRNA            <474346..>475611
                     /locus_tag="KLTH0G06006g"
                     /product="KLTH0G06006p"
                     /transcript_id="XM_002555252.1"
                     /db_xref="GeneID:8293566"
     CDS             474346..475611
                     /locus_tag="KLTH0G06006g"
                     /note="similar to uniprot|P32264 Saccharomyces cerevisiae
                     YDR300C PRO1 Gamma-glutamyl kinase catalyzes the first
                     step in proline biosynthesis and to YHR033W uniprot|P38690
                     Saccharomyces cerevisiae YHR033W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06006p"
                     /protein_id="XP_002555298.1"
                     /db_xref="GeneID:8293566"
                     /db_xref="GOA:C5DM50"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:C5DM50"
                     /translation="MSTSYTIVIKLGSSSLVDEKTKEPKLSTMAMVVETVVRLRRNGH
                     RVVLVSSGGIAVGLKTLNLERRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQI
                     LITRNDIVDWTQYKNAQNTIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAAL
                     CGADYLFLLTDVDCLYTDNPRTNPEAKPILVVPATSQVSEGTLGVKTSSGSGSDVGTG
                     GMTTKLIAAELATNAGVNTIIMKSTEPSNISKVVSYMQSRESATTSANGDIEELQKLE
                     LLSLQEGDVPLHTRFVADKKQMHLKNREFWMLHGLVSKGAIIIDRGAHAALTRKNKAG
                     LLPAGVIEVEGNFHEHECIDLKVGARLENGELDPACELETIGRARCNYTSLEISKIKG
                     LQSDQIENVLGYADSEYVAHRENLAFPPH"
     gene            complement(<475975..>477033)
                     /locus_tag="KLTH0G06028g"
                     /db_xref="GeneID:8293567"
     mRNA            complement(<475975..>477033)
                     /locus_tag="KLTH0G06028g"
                     /product="KLTH0G06028p"
                     /transcript_id="XM_002555253.1"
                     /db_xref="GeneID:8293567"
     CDS             complement(475975..477033)
                     /locus_tag="KLTH0G06028g"
                     /note="similar to uniprot|P38768 Saccharomyces cerevisiae
                     YHR034C PIH1 Protein of unresolved function may function
                     in protein folding and/or rRNA processing interacts with a
                     chaperone (Hsp82p) two chromatin remodeling factors (Rvb1p
                     Rvb2p) and two rRNA processing factors (Rrp43p Nop58p)"
                     /codon_start=1
                     /product="KLTH0G06028p"
                     /protein_id="XP_002555299.1"
                     /db_xref="GeneID:8293567"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:C5DM51"
                     /translation="MAFLLRALDSSGGDQAPASLCVEPQAAFTIKSKLVSCSGGHYSL
                     GAKIFINVCHDDQIPMPEVPFSPSVVYPLIMSNQWEIPIVTSAARVDQDKKGEQCYVC
                     DCCVNTTCMQWVRKDLQLREILVEWCVESCELRLRAEISREHLAFPKLRLKGDRIPPL
                     EVLTEDLAADFRKEAQELAEVRDPATLLELRRGLADEDEDSGPLNVLNGTDESSSTPP
                     LPPLFPAPAVRPLIEEVGDCGAAHATAASASTSHPVRIPAPGPRRSLSFDVHMGRPVD
                     RPQARLKVQVQSELASLDDYFVAYRSRDNSLIISHNDTQHYFPKEIAIALPHALASQE
                     LELSTSFDSGSRTMAIYL"
     gene            complement(<478755..>480350)
                     /locus_tag="KLTH0G06050g"
                     /db_xref="GeneID:8293568"
     mRNA            complement(<478755..>480350)
                     /locus_tag="KLTH0G06050g"
                     /product="KLTH0G06050p"
                     /transcript_id="XM_002555254.1"
                     /db_xref="GeneID:8293568"
     CDS             complement(478755..480350)
                     /locus_tag="KLTH0G06050g"
                     /note="similar to uniprot|Q66RD8 Saccharomyces cerevisiae
                     YDR299W BFR2 Essential protein possibly involved in
                     secretion multicopy suppressor of sensitivity to Brefeldin
                     A"
                     /codon_start=1
                     /product="KLTH0G06050p"
                     /protein_id="XP_002555300.1"
                     /db_xref="GeneID:8293568"
                     /db_xref="GOA:C5DM52"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /db_xref="UniProtKB/TrEMBL:C5DM52"
                     /translation="MAKSISDQIAAIANEPAVPDYDIEDEDVFQHREHSGDELSESED
                     DTQAKSHYVSVGKSRLRDQGIALKDEKYSGQKGSRKALSEGQSEGESEVDSESEIESE
                     SESEIETENKRRGSEPADESDGSSNSESDGKSDDGGDSESSEDSADEGVSADQGDERR
                     RRLAALVQRDARDAVARLSDTTRRDAAKGLAVLQQTREFDRILDARIKLQKAVAAANR
                     LPVSAQAWDGHLRESETNAALLSETMRLLEKVLAQTLDFRAELQDAAPTGSDAAATRK
                     RTFSDLCEDSRGLDAKLREFRVAVLSKWSQRVAAASGQSVLAASKFKAIHQPAHVQVE
                     TQLADMPRLLRRTALNRRDVAPLGQSEHNIAGGGDVSNDTPAISDGPEPDIPRDFDAN
                     ARRGRTADTTTDSYVFDDEDFYRVLLNDLVDKKVAGASGDSAVAITSRATANKKLHKN
                     VDTKASKGRKLNFTVQEPIANYEAPANGGLRWSDEQIDEFCAGLLGQRVSFAEDEKEE
                     DRDATEETADGELLQADGIRLFG"
     gene            <480649..>481269
                     /locus_tag="KLTH0G06072g"
                     /db_xref="GeneID:8293569"
     mRNA            <480649..>481269
                     /locus_tag="KLTH0G06072g"
                     /product="KLTH0G06072p"
                     /transcript_id="XM_002555255.1"
                     /db_xref="GeneID:8293569"
     CDS             480649..481269
                     /locus_tag="KLTH0G06072g"
                     /note="similar to uniprot|P09457 Saccharomyces cerevisiae
                     YDR298C ATP5 Subunit 5 of the stator stalk of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis homologous to bovine subunit OSCP (oligomycin
                     sensitivity-conferring protein)"
                     /codon_start=1
                     /product="KLTH0G06072p"
                     /protein_id="XP_002555301.1"
                     /db_xref="GeneID:8293569"
                     /db_xref="GOA:C5DM53"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR026015"
                     /db_xref="UniProtKB/TrEMBL:C5DM53"
                     /translation="MFSKLFTRSLATASKSVKPPIQLFGLDGTYATALFTAAAKTTSV
                     EAASKSLSQLTETVTKDSKLTSILANPALSANDRAIVVDTLAKSQPNIDQSVANLLKV
                     LGENNRLSLFPDVSIQFTKLTDAYNGLIQATVTTAQPLDSKLFKRVEKALAGSKLVGQ
                     GKTLKLENVVDPEIQGGLIVEVADRTVDLSISSKINKLNQLLKEAV"
     gene            complement(<481476..>482489)
                     /locus_tag="KLTH0G06094g"
                     /db_xref="GeneID:8293570"
     mRNA            complement(<481476..>482489)
                     /locus_tag="KLTH0G06094g"
                     /product="KLTH0G06094p"
                     /transcript_id="XM_002555256.1"
                     /db_xref="GeneID:8293570"
     CDS             complement(481476..482489)
                     /locus_tag="KLTH0G06094g"
                     /note="similar to uniprot|P38992 Saccharomyces cerevisiae
                     YDR297W SUR2 Sphingosine hydroxylase has a role in
                     sphingolipid metabolism catalyses the conversion of
                     sphinganine to phytosphingosine"
                     /codon_start=1
                     /product="KLTH0G06094p"
                     /protein_id="XP_002555302.1"
                     /db_xref="GeneID:8293570"
                     /db_xref="GOA:C5DM54"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:C5DM54"
                     /translation="MDMTNATYLGFSGQKGSFSFMDSDVAPEVTIRPKESLLPWLSDG
                     CLSLALPVIAYWSFSMMFHAIDTLRLAEQFRIHPSQEVASRNKAGRMEVLREVLFQHF
                     LQTVTGGLLVYFDPEPTTGFEARAMWEWKRALPFWVPNQAIYYGYMYGISLIKVFVGF
                     CIIDSWQYWLHRLMHNNKTLYKMYHSRHHRLYVPYAYGALYNSPAEGFLLDTLGTGIA
                     AIVTKLTHREQIALFTFATLKTVDDHCGYALPWDPFQWIFPNNAVYHDIHHQQFGIKT
                     NFAQPFFTLWDQLCGTKFHGLEQYEKAQRRITIDKYKEFLKEREAEKQAKIDQGFGNK
                     KDN"
     gene            complement(<482874..>483518)
                     /locus_tag="KLTH0G06116g"
                     /db_xref="GeneID:8293571"
     mRNA            complement(<482874..>483518)
                     /locus_tag="KLTH0G06116g"
                     /product="KLTH0G06116p"
                     /transcript_id="XM_002555257.1"
                     /db_xref="GeneID:8293571"
     CDS             complement(482874..483518)
                     /locus_tag="KLTH0G06116g"
                     /note="similar to uniprot|Q06630 Saccharomyces cerevisiae
                     YDR296W MHR1 Protein involved in homologous recombination
                     in mitochondria and in transcription regulation in nucleus
                     binds to activation domains of acidic activators required
                     for recombination-dependent mtDNA partitioning"
                     /codon_start=1
                     /product="KLTH0G06116p"
                     /protein_id="XP_002555303.1"
                     /db_xref="GeneID:8293571"
                     /db_xref="InterPro:IPR024629"
                     /db_xref="UniProtKB/TrEMBL:C5DM55"
                     /translation="MVAPARFRTAQWLKKAGFAPQVFLFRNLESGQVIYSQVPVFNQH
                     QIDALFQRPDWANKKPSTRRDIWRCMAVVDLRSYEEGVHVYQNLCRLRYLRDVTQVKK
                     ADALRKKNEDGHVWYSAQYRPTYTQEAVADLREALSKAGVAQGQIHWEDRWRMGDVEK
                     HWSPVLPQLQHSVISRLGNSAREQSVIMRELGERAKQEFAKLRERENAARELSV"
     gene            <483715..>485712
                     /locus_tag="KLTH0G06138g"
                     /db_xref="GeneID:8293572"
     mRNA            <483715..>485712
                     /locus_tag="KLTH0G06138g"
                     /product="KLTH0G06138p"
                     /transcript_id="XM_002555258.1"
                     /db_xref="GeneID:8293572"
     CDS             483715..485712
                     /locus_tag="KLTH0G06138g"
                     /note="weakly similar to uniprot|P38769 Saccharomyces
                     cerevisiae YHR035W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06138p"
                     /protein_id="XP_002555304.1"
                     /db_xref="GeneID:8293572"
                     /db_xref="GOA:C5DM56"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="UniProtKB/TrEMBL:C5DM56"
                     /translation="MITPCFAVIPTSRLEAEQQLPYLLEPSHVDVLYESKVDGTEART
                     QYQICGFCGAAIMDKCVIFENQWVCGFCNKYNTLLEKPRSSSYISEVPESTEGQHMGE
                     GNAQVLLVDLDTDGAEELGNLINSILSCLENCPNARFGLVTLCDGQATVYTPSGSQTL
                     SSDDPTTLSKAKNLDIEFFRGKIQGSSPLWLDQNQTLNLIKTLSFKPSPMHNQRPKRA
                     TGLGLILASLYHSGSDFPTVVTAFISGPCTSGPGKVVPKSKKHHIRQHYDLESNRDKY
                     FYPARSFYQSLIRTLSVNCFIACLDQVGIVEMAPLLVSVSQFDTFNDESFRVLSRNCI
                     HNVSVDHQITVFASKGLLVDGCLGPVSRLDATQPVYSDTPSGVSGTNRWRCRASGLSL
                     SLAFSFQIDTTATKEESHDKTPAHLAIQIHDLFQDQGKRYVKVDTIVICTTNNSATSA
                     TRSVPKSFDHIAALGCLMKQIAYDQFFKNHTNAFSLQQWRIKIDKLAARHSKVQSKHF
                     SEFLEMIYRLKWTVLLQKRNTSPDEAAVFQHTILSQDSNICGLLCKPKVIIFTNESQF
                     EPSNLNEQLLTAREAMCVDFGTSIMVRYLEDDSLIVKAEQFAQSLAQNNPLAPKVQKT
                     RIKGSQDRYFISKLLPQGGLNTEDMSLEQFSANIRRMSQCM"
     gene            <485950..>487806
                     /locus_tag="KLTH0G06160g"
                     /db_xref="GeneID:8293573"
     mRNA            <485950..>487806
                     /locus_tag="KLTH0G06160g"
                     /product="KLTH0G06160p"
                     /transcript_id="XM_002555259.1"
                     /db_xref="GeneID:8293573"
     CDS             485950..487806
                     /locus_tag="KLTH0G06160g"
                     /note="similar to uniprot|Q06629 Saccharomyces cerevisiae
                     YDR295C"
                     /codon_start=1
                     /product="KLTH0G06160p"
                     /protein_id="XP_002555305.1"
                     /db_xref="GeneID:8293573"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="UniProtKB/TrEMBL:C5DM57"
                     /translation="MSDSKGLQDTYYLPIGLTSLQKDLVEILISIHTKSLLQYCKSDA
                     LSSFPECKSDTELVLPPLSAAQLTGMLAVNIRAAANHPCLLVEHYMPRQLLLMEPGER
                     LIRASDKFRKMAMLLNSIFTRDRKRFPQPMHITILSHSVKELDIIEGYLLGKPIKLKR
                     ISGTSLFNEKHLYSDADTSSSTPVPTPTHTKDEYEYGEKKFKSRPSDTSDWLFLATTT
                     HLSRAADLLDDYNIDMVIGFDPLIDENLESFERMRRNGKHVPLIKLLVKDSPDHYVLA
                     HSKTNGHEGDLFLDSLLHFVHNRHEIVEQRQTEWIGDFVEEILSGNSQASLKLPPCNL
                     ANGEKNASLLDDLVNYTGHMKLSGGVFDLKAVNQDLDLKLYQNKIMDLIVRRLIECEQ
                     AYAVRQEQVLGKRLRETMRQNEIDQIKVESGQMYKKLKEGEGPLNDSTKRLNKAQNDV
                     TKLKEQQEQIEQRRLALQTVAEDGNASEQLALKQEKLMNLRAELNTLIQENSRQAAAN
                     DELRLQYQARSSEAANESLVLKTLQKNRDELKARLEGPTVSINSSGALEQESRLREEL
                     VRVVQQSHFLQGYIKRIQKQYPINGSQSSKKPATAPGNSRTRSSRSSAPVYT"
     gene            <488096..>489781
                     /locus_tag="KLTH0G06182g"
                     /db_xref="GeneID:8293574"
     mRNA            <488096..>489781
                     /locus_tag="KLTH0G06182g"
                     /product="KLTH0G06182p"
                     /transcript_id="XM_002555260.1"
                     /db_xref="GeneID:8293574"
     CDS             488096..489781
                     /locus_tag="KLTH0G06182g"
                     /note="similar to uniprot|Q05567 Saccharomyces cerevisiae
                     YDR294C DPL1 Dihydrosphingosine phosphate lyase regulates
                     intracellular levels of sphingolipid long-chain base
                     phosphates (LCBPs) degrades phosphorylated long chain
                     bases prefers C16 dihydrosphingosine-l-phosphate as a
                     substrate"
                     /codon_start=1
                     /product="KLTH0G06182p"
                     /protein_id="XP_002555306.1"
                     /db_xref="GeneID:8293574"
                     /db_xref="GOA:C5DM58"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DM58"
                     /translation="MFGGTEDSKLPRWGSWISSVQEILAKQLQENLPFFILATLLIYK
                     ATSCIWYYVGGFGIKESSRMLRNRIGRPIFKIITSSFILKSSVDKEVEKSLRAVESSL
                     MKDDARLKNFDQLPTDGLQDQTVLEELDLSQKVLAHSDWEGGKVSGAVYHGGQELIHL
                     QSQAFEKCCVANQLHPDVFPAVRKMESEVVSMILKMFHAPEVTGCGTTTSGGTESLLL
                     ACLSAKMFALRQKSISKPEIIVPVTAHAAFNKAAYYFGLKLRHAPLDPKTFKVDLKRV
                     RRLINSNTVLIVGSAPNFPHGIVDDIEGLGQLAERYKIPLHVDCCLGSFVIAFMEKAG
                     YRDIPAFDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNRELRMNQYYLLSDWVGGLYG
                     SPTLAGSRPGALVVGCWATMLRMGEKGYINSCKEIVSTARELKKFIHEEIPELCIIGD
                     PLCSVVAFTSDQIDVHELSDKLAKQGWHLSALQNPPALHLAVTWLTRPALPELMRTLQ
                     EVVKELSSEPNKKPSSDGTSALYGVAGSVKTSGVVDRLLVGFLDTLYKTKRDY"
     gene            <490065..>491297
                     /locus_tag="KLTH0G06204g"
                     /db_xref="GeneID:8293575"
     mRNA            <490065..>491297
                     /locus_tag="KLTH0G06204g"
                     /product="KLTH0G06204p"
                     /transcript_id="XM_002555261.1"
                     /db_xref="GeneID:8293575"
     CDS             490065..491297
                     /locus_tag="KLTH0G06204g"
                     /note="similar to uniprot|P38770 Saccharomyces cerevisiae
                     YHR036W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0G06204p"
                     /protein_id="XP_002555307.1"
                     /db_xref="GeneID:8293575"
                     /db_xref="GOA:C5DM59"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:C5DM59"
                     /translation="MDEFSKLSLADPSTTVQEEDLQAILSLNICEDDSKPIGNKAQLS
                     QKIMDKFMPHVPSSPSPLRQAVLVDEIHDEMDIDAKEESDTERSEINSAFIENDLLHE
                     SEAEEEEPAQTASPNSKAVIKALLSPTKLGVAAATKLDDYSSESSVPAATPATDGQAS
                     HLQKSTEITGVELPQETLETLRQRSQYSPIQISINNNHYYYPPESQYIEESGIRKRSL
                     KLPDPWSPQSHPASRGSYLFTSYLQIFLNLLTALIYFSFVMIFMRAIKADLRSEWQTT
                     KLELVHESLQCRIHYNANKCERATRVPALEKQCDDWEKCMGRNNELFFRARSAISARL
                     IGDTLNSFIEPLGWKTLGVVLAGLAIWCFSSNFILGFARAKSYYGDEQNQRSSHRPCA
                     HQGIPSGNLLQNNDQLQE"
     gene            <491936..>493657
                     /locus_tag="KLTH0G06226g"
                     /db_xref="GeneID:8293576"
     mRNA            <491936..>493657
                     /locus_tag="KLTH0G06226g"
                     /product="KLTH0G06226p"
                     /transcript_id="XM_002555262.1"
                     /db_xref="GeneID:8293576"
     CDS             491936..493657
                     /locus_tag="KLTH0G06226g"
                     /note="highly similar to uniprot|P07275 Saccharomyces
                     cerevisiae YHR037W PUT2 delta-1-pyrroline-5-carboxylate
                     dehydrogenase"
                     /codon_start=1
                     /product="KLTH0G06226p"
                     /protein_id="XP_002555308.1"
                     /db_xref="GeneID:8293576"
                     /db_xref="GOA:C5DM60"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DM60"
                     /translation="MLSRALLIRQSKRCVAQLSHVKPPKQITNEPVKPFSNKDILDWD
                     LLRASISKFNSASLDVPLVINGKRIYHNEGSRQFFQQTNPAKHSQVLANVTQASKQDV
                     RDAIQAAKSAKEKWYKMPFYDRAAVFLKAADLISTKYRYDMLAATMLGQGKNVYQAEI
                     DCITELADFFRFNVKYATELYNQQPCESSPGVWNKAEYRPLEGFVYAVTPFNFTAISG
                     NLIGAPALMGNTVVWKPSQAASLSNFLLLTVLEEAGLPHGVVNFVPGNPVDITNEVLA
                     DEEFSALHFTGSTAVFKQLYGKIQSGVVNNLYRDYPRIVGETGGKNFHLVHPSASLPH
                     AVLSTLRGAFEYQGQKCSAASRLYLPKSQSTEFLENLVGTLESVKTVNTSASKINGGD
                     LHGFVGPVIHQQSFEKLANAIEEAKKDPELEILCGGKYDKSNGWFVEPTIIKTTNPLH
                     KFMSTEFFGPVLTVYEYPDSEFSQICETIDKTTAYGLTGAVFARDREAIILADEKLKY
                     SAGNFYINDKCTGAVVGQQWFGGARMSGTDDKAGGSNILSRFVSIRNVKENFYELNDF
                     KYPSNYE"
     gene            <494464..>498141
                     /locus_tag="KLTH0G06248g"
                     /db_xref="GeneID:8293577"
     mRNA            <494464..>498141
                     /locus_tag="KLTH0G06248g"
                     /product="KLTH0G06248p"
                     /transcript_id="XM_002555263.1"
                     /db_xref="GeneID:8293577"
     CDS             494464..498141
                     /locus_tag="KLTH0G06248g"
                     /note="similar to uniprot|P24276 Saccharomyces cerevisiae
                     YDR293C SSD1 Protein with a role in maintenance of
                     cellular integrity interacts with components of the TOR
                     pathway ssd1 mutant of a clinical S. cerevisiae strain
                     displays elevated virulence"
                     /codon_start=1
                     /product="KLTH0G06248p"
                     /protein_id="XP_002555309.1"
                     /db_xref="GeneID:8293577"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="UniProtKB/TrEMBL:C5DM61"
                     /translation="MSSSDRKNEDRFVATTGGRKNPKQIHIAHRRSASELTNLMIEQF
                     TLQRQLEIVQAQQQQLIAQQQQLAQQSGQYLNPVGSGNASLGAPGGPIPSFVPQPPHP
                     HYNAPSPSPSQGNRSRSHSRNSSGYYNNNEFAPPGHRKTGSQSSVYGHSRRHSLGLSE
                     AKKAAAEEQAKRASGSGISIKIDDAEKSESVESPLSNAIEQSTYKFPANTGDAQRGTT
                     PQTSRTSHMSPQKSFQFPSVPSNNKENREEFSNVSTPNRNANAKGKDVSGINNNWRLQ
                     QQPTPQSNQNTPSHPFHHKKSQSREAPFGGLEPPPVFQPGHRSRNSNASTHSFGSGNN
                     GSNQNGRKSLFAPYLPQANIPELIEEGRLVCGILRVNKKNRSDAWVSTDGVLDADVYI
                     CGSKDRNRALEGDLVAVELLMVDDVWGSKKEKEEKKRRKDANNQQDILNSNDDYHNDA
                     SSRMANPTNSSSSFGSTEKEDQSSPSKGSVKRKGSLKQRPTQKKNDDVEVEGQSLLLV
                     EEEEISDSYKPLYAGHVVAVLDRIPGQLFSGTLGLLRPSQQANNEAHKPQKPKIVWFK
                     PTDKKVPLIAIPTEQAPKDFVENADKYSNKLFVASIKRWPITSLHPFGTLVSQLGEIN
                     EPETEIDAILRDNNFLSDEYLDPHDRSKERSTFQPTPLSEENIQSRKIFLNTTAVFET
                     DSLSDLALHTKVLDDGSLEVGCHILDVTAHIEEGSSLDRRARKRSSGVFIPQKVVHLL
                     PQTLNDALTLKEGKTSATISVVHRFDKSFKVLSTWIGETLITPESSITFQEINEQVSS
                     GSLSRFVSQIQDVATALCRKRLSSPSVSLKPELCLLESLDDEKVKVDLNIFQSSAATS
                     IVTEIERHVNSIVAETIYQKLGDLAFLRRQSKPIATKLASFEKKVTKLGYEVDITDSQ
                     SLLSSILAIEDEATRTGVEILLFKALSRAKYFVAGKVESDQYDHFALNLPLYTHFTAP
                     LRRYADHVVHRQLKSVLNDSSYKENDDSLKITSEYCNFKKDCAHHAQEQAIHLLLCKT
                     INDMGNSTGQILTMATVLQVYESAFDVFIPEFGIEKRVHGDQLPLIKAEYDGTNRVLE
                     LYWQAGVDSATFVPADEKNPKSYRNSIRNKFKSASNEIASIQYQKTLEGENLLTEELA
                     GQLSNLHIDPPALKMPDPRKDTEPLERFLKTAVTRTEGDKDIQVIRELQQVPILLRAE
                     VGMALPCLTVRTLNPFQSRKD"
     gene            <498404..>499123
                     /locus_tag="KLTH0G06270g"
                     /db_xref="GeneID:8293578"
     mRNA            <498404..>499123
                     /locus_tag="KLTH0G06270g"
                     /product="KLTH0G06270p"
                     /transcript_id="XM_002555264.1"
                     /db_xref="GeneID:8293578"
     CDS             498404..499123
                     /locus_tag="KLTH0G06270g"
                     /note="similar to uniprot|P38771 Saccharomyces cerevisiae
                     YHR038W RRF1 Ribosomal Recycling Factor 1 originally
                     characterized as FIL1 a Factor for Isocitrate Lyase
                     expression mitochondrial ribosome recycling factor"
                     /codon_start=1
                     /product="KLTH0G06270p"
                     /protein_id="XP_002555310.1"
                     /db_xref="GeneID:8293578"
                     /db_xref="GOA:C5DM62"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="UniProtKB/TrEMBL:C5DM62"
                     /translation="MLASVKLVSPLYRVLSQKGVQFRQFQTCYNLLKKASKKSGKGKI
                     DEEEPTEVVDVKQYVLKAKTQFSVTLDLHKKKLSEIRAGSASPSIFDKLSVGKENSKF
                     TDVATTSMKGKNSLIVTVFDPKDTKSVVSSILAAGLNLNPEKIPNNDQQLKISLPPPT
                     TETRKQTCKQLKEVFEEFKNSANKNSLGHIRGDILKQLKNIDKKNDSVKKVIQDLDKL
                     HKEYTNTLQEQLKQAEKNVLG"
     gene            complement(<499189..>501111)
                     /locus_tag="KLTH0G06292g"
                     /db_xref="GeneID:8293579"
     mRNA            complement(<499189..>501111)
                     /locus_tag="KLTH0G06292g"
                     /product="KLTH0G06292p"
                     /transcript_id="XM_002555265.1"
                     /db_xref="GeneID:8293579"
     CDS             complement(499189..501111)
                     /locus_tag="KLTH0G06292g"
                     /note="similar to uniprot|P38694 Saccharomyces cerevisiae
                     YHR039C MSC7 Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the endoplasmic
                     reticulum msc7 mutants are defective in directing meiotic
                     recombination events to homologous chromatids"
                     /codon_start=1
                     /product="KLTH0G06292p"
                     /protein_id="XP_002555311.1"
                     /db_xref="GeneID:8293579"
                     /db_xref="GOA:C5DM63"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DM63"
                     /translation="MSQIYLNSSMLRQLNHTVQAYFSDWIKMQQLTFNHTKLANSQAA
                     MKTNSTTFLVTLLVAFVLYRWLFPACQRVRQKPAKFELPLPEAAQKNWKGKRLFPASL
                     SNSESPNRIQCYCPATGQYLGSYPSMTEQDIDTLVSKATKAQLKWRETSFEERIRVLL
                     SLQEYIIENQDSIARVACRDSGKTMLDASMGEILVTLEKLQWIIKNGQSALQPSKRSG
                     PSNFFMKWYKGAEVRYEPLGVVGALVSWNYPFHNLLGPIIAAIFTGNAIVIKCSEQVV
                     WSSEFFAALCRKCLEANGFDPDIIQLCYCSPPSATDDAANYYSSHPGLKHLTFIGSKP
                     VAHHVLTAAAKSLTPVVVELGGKDALIALDSVKDINALSSIIMRGTFQSSGQNCIGIE
                     RVIVSAQNYDKLVSLLEQRVGQLRLGSDIDNLEDVDMGAMISDNRFEQLENMIKDAVA
                     KGARLLHGGSRYTHPNYPQGHYFQPTLLVDVTPNMEIAQNEVFGPILTVMRASDTNDC
                     IRLANSAPFGLGGSVFGNDYAECNYVANHLNTGNVAINDFATFYVCQLPFGGINGSGY
                     GKFGGEEGLTGLCNAKSVCYDKLPFISTQIPKPLDYPIKSNASAWNFVKSLNTGAYTT
                     STWKRIKSVISLAKEA"
     gene            complement(<501371..>501807)
                     /locus_tag="KLTH0G06314g"
                     /db_xref="GeneID:8293580"
     mRNA            complement(join(<501371..501712,501805..>501807))
                     /locus_tag="KLTH0G06314g"
                     /product="KLTH0G06314p"
                     /transcript_id="XM_002555266.1"
                     /db_xref="GeneID:8293580"
     CDS             complement(join(501371..501712,501805..501807))
                     /locus_tag="KLTH0G06314g"
                     /note="similar to uniprot|P48836 Saccharomyces cerevisiae
                     YHR039C-A VMA10 Vacuolar H+ ATPase subunit G of the
                     catalytic (V1) sector"
                     /codon_start=1
                     /product="KLTH0G06314p"
                     /protein_id="XP_002555312.1"
                     /db_xref="GeneID:8293580"
                     /db_xref="GOA:C5DM64"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:C5DM64"
                     /translation="MSQPNGIATLLKAEKEAHEIVSKARQYRQEKLKQAKSDAATEIN
                     AYKQKKEQELKDFEAKNAGGVGGLEKDAEGKVQVEIQEIQKIGKDKKKNVVKLLVDAV
                     TTPVAEVHVNAA"
     gene            <502078..>503202
                     /locus_tag="KLTH0G06336g"
                     /db_xref="GeneID:8293581"
     mRNA            <502078..>503202
                     /locus_tag="KLTH0G06336g"
                     /product="KLTH0G06336p"
                     /transcript_id="XM_002555267.1"
                     /db_xref="GeneID:8293581"
     CDS             502078..503202
                     /locus_tag="KLTH0G06336g"
                     /note="similar to uniprot|P38772 Saccharomyces cerevisiae
                     YHR040W BCD1 Essential protein required for the
                     accumulation of box C/D snoRNA"
                     /codon_start=1
                     /product="KLTH0G06336p"
                     /protein_id="XP_002555313.1"
                     /db_xref="GeneID:8293581"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:C5DM65"
                     /translation="MHEEIKLIAPNRDRSVGRDMTTATCEICKEHAHKYKCPKCSKKT
                     CSVACIKEHKSRDSCSGTSAEPTGYVSREKLKAADTSEETNVMVQRDYNFLLGMNRQL
                     ELLKRDGKVKNKRVLGTHHRSQPQQKWPRLEQPSKVIRRGVYCILVPRGMQRSLLNKS
                     KWDKPLDMFVWSIEWCLFSEEGKIEFVHTNHRNKETDPLLECVGKAVYEQCVRLYQLE
                     ALPDDCTRQARIDSLSAGGLEFFMKHLPQDQQNFADSKQLIPVDPAKSLGETFRDKTV
                     IEYPTIFIAKNRQHLGDGYSLFGSKSEDPSSTDDSEDTSSDAASTSSSSSDSDDEEPQ
                     EASSKQPTSSNLVESSKEDADEDDDEDDYTPGISLDFLVE"
     gene            complement(<503325..>504866)
                     /locus_tag="KLTH0G06358g"
                     /db_xref="GeneID:8293582"
     mRNA            complement(<503325..>504866)
                     /locus_tag="KLTH0G06358g"
                     /product="KLTH0G06358p"
                     /transcript_id="XM_002555268.1"
                     /db_xref="GeneID:8293582"
     CDS             complement(503325..504866)
                     /locus_tag="KLTH0G06358g"
                     /note="weakly similar to uniprot|P21147 Saccharomyces
                     cerevisiae YGL055W OLE1 Fatty acid desaturase required for
                     monounsaturated fatty acid synthesis and for normal
                     distribution of mitochondria"
                     /codon_start=1
                     /product="KLTH0G06358p"
                     /protein_id="XP_002555314.1"
                     /db_xref="GeneID:8293582"
                     /db_xref="GOA:C5DM66"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5DM66"
                     /translation="MNDAIPEFDYTEIVRSRDSQNVEPVANSPQLSEASKITKKRKRD
                     PQLVHLLKKVSFQSTLLCVVLPLFSLFKLILSKPEWNGKLLKCLAVYMFISQVSLVAG
                     YHRFFTHAAFQCDLMVQSIFAILGGSCGLGSILDFSSQHLAHHHYVDTERDPHACVVH
                     GWLFAQWGHKLFHGNRKSARAVQECRNTLESTAKASTSKVETNYISSPSYALLRWQDE
                     NYAEILVLTIILIPCILAKFCKVPFFSGVFYLGLVRMSIIQQQWLLIGSLCHTKRFPL
                     ASQPFDDSRSAVDLPFGTIMDLLTFGESNHNFHHEFPGDYRNGPGKYQWDPAKFAILV
                     LYYLGLVGKLHSAGQDQIEKCLVQQQQKLLDDERSKLQWGIPLDKLPIMPAEVFVRMA
                     KQEFQEHRRALVAIEGVVHDVTPFIHDHPGGVALVETSIGKDATQAFNGAVYLHSQAA
                     RNLLATMRIAVIGSGHMGIESTVWEKHILESSNWKNDTKGREIVRNKQQVTFTNKNHY
                     AAGAA"
     gene            <505411..>507171
                     /locus_tag="KLTH0G06380g"
                     /db_xref="GeneID:8293583"
     mRNA            <505411..>507171
                     /locus_tag="KLTH0G06380g"
                     /product="KLTH0G06380p"
                     /transcript_id="XM_002555269.1"
                     /db_xref="GeneID:8293583"
     CDS             505411..507171
                     /locus_tag="KLTH0G06380g"
                     /note="similar to uniprot|P32916 Saccharomyces cerevisiae
                     YDR292C SRP101 Signal recognition particle (SRP) receptor
                     - alpha subunit contain GTPase domains involved in
                     SRP-dependent protein targeting interacts with SRP102p"
                     /codon_start=1
                     /product="KLTH0G06380p"
                     /protein_id="XP_002555315.1"
                     /db_xref="GeneID:8293583"
                     /db_xref="GOA:C5DM67"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007222"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR015284"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DM67"
                     /translation="MIDQFVVFTLKGQVLYHFNPQGRKLAENHINKVISHLITSPSKK
                     EESGKYLLFKLDNFAAACFIGKQPPLVYLVTYAAQDLELNQEAEQVLDLGFGLWDSLK
                     LNNSVLQNLSGKGVKNRHNYTWILEGCDSNLNKFDEYFRAKFSVIKPGKAKGKPSVEG
                     NASKGSSLTGSKNNKKTVQNAKTRKWGRDGIIEETNVGDSSALDFSELNEEARASSLA
                     EVDKEAFGTFTEKGEFLINEIDELLNKNKAEASKKGQSTGGAFGFLQKHLLGNKKITK
                     EDLSKVLEKFRQKLISKNVAPEAADHLTSRVSQDLVGSTTANWTSVELTARDSLQKSL
                     TEILTPGVSVDLLREIQQKTGKNGKKTPYIFSVVGVNGVGKSTNLSKLAFWLLQNNLR
                     VLVVACDTFRSGAVEQLRVHVENLAQLTDEAHIRGSKNRRGKSGNDHIELFEAGYGGS
                     DLVTKIAKQAIKYASDQNFDVVLMDTAGRRHNDPTLMSPLKPFADQAKPDKIIMVGEA
                     LVGTDSVQQAKNFNAAFGKERNLDFFIISKCDTVGEMLGTMVNMVYATGIPILFVGVG
                     QTYTDLRTLSVEWAVDTLMS"
     gene            complement(<507209..>510427)
                     /locus_tag="KLTH0G06402g"
                     /db_xref="GeneID:8293584"
     mRNA            complement(<507209..>510427)
                     /locus_tag="KLTH0G06402g"
                     /product="KLTH0G06402p"
                     /transcript_id="XM_002555270.1"
                     /db_xref="GeneID:8293584"
     CDS             complement(507209..510427)
                     /locus_tag="KLTH0G06402g"
                     /note="highly similar to uniprot|Q05549 Saccharomyces
                     cerevisiae YDR291W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06402p"
                     /protein_id="XP_002555316.1"
                     /db_xref="GeneID:8293584"
                     /db_xref="GOA:C5DM68"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DM68"
                     /translation="MVEIEESTDVDQKDVRIRELQKIFFRLNTFYTFLMSRKHVITTF
                     DTLKKPIEKDIRRSLEPIDLARIACLLPRNVVFKYMDSNQFQTETKVFDFNRGGFQQK
                     SSDIFELKPENDGTDASEDPQVLVFEFTDGNMTRNQSRYEFKTQVSMPDFSPESMRKM
                     IYKRKRLFDTSLKAFLAKQKVTNRDPWSVLTAEASAVVPERKVFEDPIEAMINSKDSA
                     HSRVVLDPENNMTRLSMSTLLKKLEMSELYNNQIVSHMIIPERSAHYGELNFELAPEA
                     MAAFEHDSFYSHQADAINSIHEGKNVIVTTSTSSGKSFIYQLSAIDILLKDPQATFMY
                     IFPTKALAQDQKRAFQVLLSKIPKLSHIIVDNYDGDTEQEKRGYVRKNARVIFTNPDM
                     VHASILPNHPNWRHFLLHMKLVVVDELHMYKGLFGSHVALVMRRLVRLCQGYYGNNDV
                     RFISCSATLKHPVDHMKNIFGIEDVTLIHEDGSPRGEKHLVVWNPPVLPQHMRRRENF
                     IQESAKILVQLVLENVRTIAFCYVRRVCELLMKEVRTIFKEMNRLDLLNEVMSYRGGY
                     SPSDRRKIEQEMFHGNLKAVISTNALELGVDIGGLDAVLMCGFPLSLANFHQQSGRAG
                     RRNRDSMTLVVASDSPVDQHYVSHSEVLRDGENTDLFQELVLDFENVLILEGHIQCAA
                     FELPIVIQRDKAYFEAKILEKTCEERLHHDSNGYHTHNKFLPWPAKLVSLRGSEKDQY
                     AVVDITNGRNVVIEEIEATRTSFTLYDGGIFIHQGYPYLVKEFNPDEHYAKVQRVDVD
                     WTTSQRDFTDVDPQEIQMIRSLEDSDVPVYFGKIQTTIVVFGYFKVDKYKRILDAVET
                     HNPPVIIDSKGLWIDIPPNSVNLCKQKQLNVAGGIHAAQHAIMGLLPAFIVAGVDEIQ
                     TECKAPEKEFAERQTQRKRPARLIFFDSKGGQYGSGLSIKAFEHMDVILEGALKRVEE
                     CPCDYGCPECVAAAFCKENSLVLSKPASLIILHAILGHPESSYIDQIQEGPEPNMPDI
                     KVETIVPASASVKFSPDVQIIDVRSAQRTSDQSSLIKNEELT"
     gene            <510561..>511622
                     /locus_tag="KLTH0G06424g"
                     /db_xref="GeneID:8293585"
     mRNA            <510561..>511622
                     /locus_tag="KLTH0G06424g"
                     /product="KLTH0G06424p"
                     /transcript_id="XM_002555271.1"
                     /db_xref="GeneID:8293585"
     CDS             510561..511622
                     /locus_tag="KLTH0G06424g"
                     /note="similar to uniprot|Q05543 Saccharomyces cerevisiae
                     YDR289C RTT103 Regulator of Ty1 Transposition regulator of
                     Ty1 Transposition"
                     /codon_start=1
                     /product="KLTH0G06424p"
                     /protein_id="XP_002555317.1"
                     /db_xref="GeneID:8293585"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:C5DM69"
                     /translation="MSFSQEQLTSKLNALDETQESIVSASKWLLSQYKEASQVAQCWR
                     QFILKSSTNTRRKLLAIYLANDVIQQSKHKRVGEFGTAFGAIMPEVLGKVYPEFTQEL
                     QRKVKRVVDIWRERQVFSDSVFKELYPQLKQSKRPTEPRALPLDIAPEIKRLVEVFAK
                     LTKCQSSTFAAKTRFDTSLEALDPNSVVYLENYKTVQKVGQAAKDSLDKSVSYRKQAI
                     KELQIMLNFQEEQMKQDQSLISEIDQVLISKDPASATSDPLGETDLLPTYEASDGSDS
                     DSDRSIGGEGEPPRKRQSLGTDSNELKRAKTETGTIDEVRTEEYETEAYEPTPAEVAA
                     NSSLAVTSSIQDLLSKLAN"
     gene            complement(<511652..>512361)
                     /locus_tag="KLTH0G06446g"
                     /db_xref="GeneID:8293586"
     mRNA            complement(join(<511652..512279,512351..>512361))
                     /locus_tag="KLTH0G06446g"
                     /product="KLTH0G06446p"
                     /transcript_id="XM_002555272.1"
                     /db_xref="GeneID:8293586"
     CDS             complement(join(511652..512279,512351..512361))
                     /locus_tag="KLTH0G06446g"
                     /note="similar to uniprot|P34162 Saccharomyces cerevisiae
                     YHR041C SRB2 RNA polymerase II holoenzyme/mediator
                     subunit"
                     /codon_start=1
                     /product="KLTH0G06446p"
                     /protein_id="XP_002555318.1"
                     /db_xref="GeneID:8293586"
                     /db_xref="GOA:C5DM70"
                     /db_xref="InterPro:IPR013921"
                     /db_xref="UniProtKB/TrEMBL:C5DM70"
                     /translation="MHSTVIFSEKATPASITEFHDILSNDLVSIKEKWSFEFKTYRLT
                     VKNLPQGSSKLMHVITFTNRDNQSVIIKNNSAIVTSPATEGVQPSLTLNGCSAGTLDT
                     FDNLLASKLSNLWTQRQNIKGDFGSTFKTTELTVRATNVFSYGGFKGLLIELECEDDV
                     SDGEFEQRVMKIRHLLDDMLTGEYRVCSASMDPKNRNLICDLAFQYVKVLEV"
     gene            complement(<513119..>518251)
                     /locus_tag="KLTH0G06468g"
                     /db_xref="GeneID:8293587"
     mRNA            complement(<513119..>518251)
                     /locus_tag="KLTH0G06468g"
                     /product="KLTH0G06468p"
                     /transcript_id="XM_002555273.1"
                     /db_xref="GeneID:8293587"
     CDS             complement(513119..518251)
                     /locus_tag="KLTH0G06468g"
                     /note="similar to uniprot|P15442 Saccharomyces cerevisiae
                     YDR283C GCN2 Protein kinase phosphorylates the
                     alpha-subunit of translation initiation factor eIF2
                     (Sui2p) in response to starvation activated by uncharged
                     tRNAs and the Gcn1p-Gcn20p complex"
                     /codon_start=1
                     /product="KLTH0G06468p"
                     /protein_id="XP_002555319.1"
                     /db_xref="GeneID:8293587"
                     /db_xref="GOA:C5DM71"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR016255"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024435"
                     /db_xref="UniProtKB/TrEMBL:C5DM71"
                     /translation="MAPGSFTLDQNYELQKNELEAIKCIYMDDFTDKTVQKSSWDKHP
                     LIQFEISLRSTDQEPAESSLTLDVTLPAKYPQEPPVISFKNIQNVLGSYLASIKAEIN
                     EIHKRSKGREEIIFEITSLVQEKLDEAQSSANTQSLEDERLQRIEDEKKKLEEEESKR
                     KEDVKVERLKEQKLIDEIVRKEMEKRQDDDLSFKPDSTIDFNPPIDWITSGEAYVFPK
                     MIRAKLPNNSFYKFKAVVNPQQIKLSNDLLGFSKQFLVKPYIPPESPLANTLASSDIM
                     DNFFYLLTIVTLDNPYFNTNNGKKDISNLEKELDSLLHVRHDNINRLYAFAVERTGRS
                     NSSYAWKIRILNEYSPLSLVGDVVDSVGYVNIATARGWVLRLIEGLESLHKQGVVHKS
                     VNLQTVTLAKDADFGTTIPKLLHSGYGYTILNLISAHPSKTGPKIEMIEQPWVAPELI
                     RFNNSKPQRKTDVWELGVLFVQTINGADTVVKFPTPQEFLSNVPMDESLFDFLQKLLE
                     PDLKKRFGPLELLPMKFLRTNLDPTINKNLFPDSTSISAMNSSAALASGPEPRSSMSL
                     STTSGDIRRRSFNVSSRYSSTNPSSNSRYATDFEEIAVLGKGAFGQVVKARNALDSRY
                     YAVKKIRHSEEKLSSILSEVMLLASLNHQYVVRYYAAWLEEDTQEQAIASSDSEETDS
                     IETSEIEDYTESSTFNSTGQAFNNGWDFISNSLQASNYPEIVFANSSSENEEEKEKEY
                     ESEDFESSEGGSCARTSADFSLDEQKRSDGKGHQGQQTRRKGVFSAGACTGTHDMRQG
                     AKHDSGKDDKVAPRYAGKETQAERRFSRRGGKSTLFIQMEYCENRTLFDLIHNENLSA
                     QREEYWKLFREILDALSYIHSQGIIHRDLKPMNIFIDESRNIKIGDFGLAKNVNKPVD
                     LLRMDSHMSAASAEDLTSAVGTALYVAVEVLSGSGNYNEKIDMYSLGIIFFEMVYSFN
                     TGMERVNDIKKLRSSSIEFPSDFDDTKLAVEKKIIKQLLDHDPKKRPDAKTLLRSGLL
                     PVKHQDDVIKEALRNLADPSSPWQQQVKESLFAQPYSVTNDILFDNHKVFSTPFNQLL
                     KSQMMEEIVKIFKRHGGIENNEPPMIFPKAPVYSTQNVYEVLDKGGSVLQLQYDLTYP
                     MARYISKGPNCVSKQYRVQYVYRPPQHAQPSTEPRRFVEVDFDIITPPNSETPLYDAE
                     SIKVIDEIIIQLPIFGKTNTIFAVNHADILESVFNFCSIDKAQRSLVSHMLSQVGFAK
                     TFKDVKNELKSVLNISSTSLNDLELFDFRLDFESARKRLQKVMMDSPFLAKVEESLQY
                     ISKVINFLKPLKVSRNIIICPISNYNWGFYKGNIMFQAIYDDDKSRSLIAAGGRYDSL
                     ISLIARPSGGKINNIQRAVGFNLAWETILAVAQNYFKLATGKSTKKRSSLMKDVPLEW
                     KPMRCEVLVSSFSKTILNTIGVETLNQLWKAGISADFVHSCYTVDDVVSAAQRDGVNW
                     IILIKQQKYSAPSNKRKYKPLKVKKLGSELDVDLDFDEFLAIYQQEAESKFISSDFPQ
                     ILESNPVSPDDKRWEDFTSTEESQDGASDTSAIGKTAQKVVYIPNMATRAKKSNKKDK
                     WVYEDSARNASRAIISSLSTAPIFAVDAVRDETLEIISVTSLAQKDEWLRKIFGVGNN
                     SAPRSFATSIYNNLAKEASKGGKWAIVHCDKTGKSCVVDLQR"
     gene            complement(<518510..>519388)
                     /locus_tag="KLTH0G06490g"
                     /db_xref="GeneID:8293588"
     mRNA            complement(<518510..>519388)
                     /locus_tag="KLTH0G06490g"
                     /product="KLTH0G06490p"
                     /transcript_id="XM_002555274.1"
                     /db_xref="GeneID:8293588"
     CDS             complement(518510..519388)
                     /locus_tag="KLTH0G06490g"
                     /note="similar to uniprot|Q05521 Saccharomyces cerevisiae
                     YDR284C DPP1 Diacylglycerol pyrophosphate (DGPP)
                     phosphatase zinc-regulated vacuolar membrane- associated
                     lipid phosphatase dephosphorylates DGPP to phosphatidate
                     (PA) and Pi then PA to diacylglycerol involved in lipid
                     signaling and cell metabolism"
                     /codon_start=1
                     /product="KLTH0G06490p"
                     /protein_id="XP_002555320.1"
                     /db_xref="GeneID:8293588"
                     /db_xref="GOA:C5DM72"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5DM72"
                     /translation="MGVNRLTFGMERVSRYAVLRKWKISDALLCVLFFLINIPIYHAD
                     PFQRQFYVNDPTLSHPHATTQRVNENALLAYSLALPAIVIIVVTLLIADPKHKVYLLY
                     VSLLGLILSWTFTSLLTDYLKNWIGRPRPDFIARCKPKKGTPLDTLVTAADVCMTKNL
                     PRLMDGFRSTPSGHSSESFAGLGYLYLWLSGQLLTENPKVGYWRSIVAYGPLIGAATI
                     AISRTEDYRHHFVDVLLGSLIGLVIAYKTYFRNFPALSSEIPFKPLLDDSDVSLEAFH
                     AINEVQDEEATPLREA"
     gene            complement(<522210..>522536)
                     /locus_tag="KLTH0G06534g"
                     /db_xref="GeneID:8293590"
     mRNA            complement(<522210..>522536)
                     /locus_tag="KLTH0G06534g"
                     /product="KLTH0G06534p"
                     /transcript_id="XM_002555275.1"
                     /db_xref="GeneID:8293590"
     CDS             complement(522210..522536)
                     /locus_tag="KLTH0G06534g"
                     /note="similar to uniprot|Q05530 Saccharomyces cerevisiae
                     YDR286C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06534p"
                     /protein_id="XP_002555321.1"
                     /db_xref="GeneID:8293590"
                     /db_xref="InterPro:IPR008554"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DM73"
                     /translation="MLFIRRFHAASALANYAHVNLTLFSKANCGLCDKAKGVLSQVLA
                     EKPYADIGVKIIDIDEPQNKEWWTKYCLDVPVLHIENTKNPGSLSKIFHKLDVDQVKH
                     QVQDSQ"
     gene            <523037..>523927
                     /locus_tag="KLTH0G06556g"
                     /db_xref="GeneID:8293591"
     mRNA            <523037..>523927
                     /locus_tag="KLTH0G06556g"
                     /product="KLTH0G06556p"
                     /transcript_id="XM_002555276.1"
                     /db_xref="GeneID:8293591"
     CDS             523037..523927
                     /locus_tag="KLTH0G06556g"
                     /note="similar to Saccharomyces cerevisiae YDR287W
                     inositol monophosphatase and to YHR046C uniprot|P38710
                     Saccharomyces cerevisiae YHR046C INM1 Inositol
                     monophosphatase, involved in biosynthesis of inositol and
                     in phosphoinositide second messenger signaling"
                     /codon_start=1
                     /product="KLTH0G06556p"
                     /protein_id="XP_002555322.1"
                     /db_xref="GeneID:8293591"
                     /db_xref="GOA:C5DM74"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:C5DM74"
                     /translation="MALTKEQLKDIETSLVDLASKEVGPLLKEKAGTQFDAFDDKANQ
                     VDLVTAVDKKIEAIIKESLNKLYPDFKFVGEETYQPGTTEIGKEPTFIVDPIDGTTNF
                     IHGYPYSCTSLGLVENGVPVVGVVYNPHLNMMFHASKDNGARLNGEPIKVPERDLTLQ
                     QSIIALEAGSERSSGSSGDDNFDIKQATYKNLLSDKGGYIHGSRSCGSAAMNMCLVAT
                     GKLDAYWEGGCWAWDVCAGWCIVTECGGMVVGGNPNAWEVPVDERCYLAVRGGCTNPS
                     QKTFVENFWSHVAGKLKYHW"
     gene            <524220..>525146
                     /locus_tag="KLTH0G06578g"
                     /db_xref="GeneID:8293592"
     mRNA            <524220..>525146
                     /locus_tag="KLTH0G06578g"
                     /product="KLTH0G06578p"
                     /transcript_id="XM_002555277.1"
                     /db_xref="GeneID:8293592"
     CDS             524220..525146
                     /locus_tag="KLTH0G06578g"
                     /note="similar to uniprot|Q05541 Saccharomyces cerevisiae
                     YDR288W NSE3 Essential protein of unknown function"
                     /codon_start=1
                     /product="KLTH0G06578p"
                     /protein_id="XP_002555323.1"
                     /db_xref="GeneID:8293592"
                     /db_xref="InterPro:IPR002190"
                     /db_xref="UniProtKB/TrEMBL:C5DM75"
                     /translation="MSDSESEVNDYGNEKTIVVAKRVLRRFLSLCESQSTIISRTKLS
                     TIIREVSSEENTRTVKFGAIYKAMNSLLQNSFGYQLWGLYSKPPKNTKGGKRPVPSRD
                     HTPEINEINSGGGAVNLKERAQFFMLVSELPKAPTAFRSLLLEEGTKLYDDRIVDDDY
                     IGNDLSMLPEDSFENAVATDESLVAQGLTFVVLVLILFSKNSILHQELVQHLLKFGIP
                     QDGQKIPVLDITLNDFLSLLIKREYIHRTDERAQDGAQEVSFYRIGRKTQLEFDKKSL
                     LAMCFKIMEPDAAQMAQLEKSIDLSIADAYGV"
     gene            <525647..>527719
                     /locus_tag="KLTH0G06600g"
                     /db_xref="GeneID:8293593"
     mRNA            <525647..>527719
                     /locus_tag="KLTH0G06600g"
                     /product="KLTH0G06600p"
                     /transcript_id="XM_002555278.1"
                     /db_xref="GeneID:8293593"
     CDS             525647..527719
                     /locus_tag="KLTH0G06600g"
                     /note="similar to uniprot|P16603 Saccharomyces cerevisiae
                     YHR042W NCP1 NADP-cytochrome P450 reductase involved in
                     ergosterol biosynthesis associated and coordinately
                     regulated with Erg11p"
                     /codon_start=1
                     /product="KLTH0G06600p"
                     /protein_id="XP_002555324.1"
                     /db_xref="GeneID:8293593"
                     /db_xref="GOA:C5DM76"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5DM76"
                     /translation="MPLGLDTLDFAVLCALALAVSAYLGRDTLKQLFASNDESIRVNS
                     DSRDIVQTLKDNNKNYLVLYGSQTGTAEDYAKKFAKELAAKFSLRVMCADVEKYDLHD
                     LNELPEGVVVSFFISTYGEGDFPDGAVPFEDFLNSLNSDDLNNLRYTLFGLGNSTYEF
                     FNGAGKKTHKLLSEAGATILGKYGEADDGAGTTDEDYLGWADSLLEILKTELSLDEHE
                     QKFEPSFHYSVLESGVTDKVSLGEPTTQYLPDGELTFSPDGRQTGPFDPSYPFVAPIV
                     KSKELFNSDDRNCIHAEFDISGSNLKYSTGDHLALWPSNSDEKVEQFLSCFGLDSSVV
                     FDLKPLDTTVEVPFPVPTTIGAAVRYYLEITGPISRQFFSSLVQFAPNDKLKDRLNEI
                     SKDKDEFAKSITAKYLNLADALLYLSDGAKWNSVPWNFLAESVPRLQPRYYSISSSSL
                     SEKQTISVTAIVENMPNPSSEKAEPVTGVATNLLRHVQLSQNNENVKSSNLPVHYDLA
                     GPRNLFSSHKLPVHVRRSAFRLPSNPATPVIMIGPGTGVAPFRGFIRDRVKFAEQQSN
                     VNLGKHLLFYGSRDQNDFLYQEEWPEYSKKLGGSFELIVAHSRLPGKPKCYVQDKIKE
                     RDQEVFDLISKKGAFIYVCGDAKGMAQGVHATLVDIISKHSNVDKAEATEMLKLFKTS
                     GKYQEDVW"
     gene            <527870..>529048
                     /locus_tag="KLTH0G06622g"
                     /db_xref="GeneID:8293594"
     mRNA            <527870..>529048
                     /locus_tag="KLTH0G06622g"
                     /product="KLTH0G06622p"
                     /transcript_id="XM_002555279.1"
                     /db_xref="GeneID:8293594"
     CDS             527870..529048
                     /locus_tag="KLTH0G06622g"
                     /note="similar to uniprot|Q05648 Saccharomyces cerevisiae
                     YDR282C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06622p"
                     /protein_id="XP_002555325.1"
                     /db_xref="GeneID:8293594"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:C5DM77"
                     /translation="MLRCFTFSRTFPTNVQLLVPKRILSFTVKILQANNEIGTSKVRS
                     VKVPRGSLSAAKNLRRSFLPNKKGTHSQMVVNNPNTNKLAYFLKTKPCTTVTTSESYD
                     LNKVISSLNASGYHAISLVPDEIITFKYFYNGCHSDIMVLGNSGTVVAWGLEESFVFE
                     NILPLIEHGRVNPLTEECVESEDLDFLQVENAEDLEKVRQITNRSAPESFVEGDLIIV
                     NAIDSDLGLLDKAAFSSGMSRSTRLAVLEHLLEAHIEKSRKFTELLSQGKKLSLTESE
                     VLQSTGSLFLIRGKLNLYSELIETPDLYWSEPQLERIYKQMSRSLDIQPRISILNTKL
                     DYATEESRAFMAVLNEKKSTHLEWIIIYLITVEVFFELHHYYERYWVDSKEDCVRTTS
                     "
     gene            complement(<530734..>531651)
                     /locus_tag="KLTH0G06644g"
                     /db_xref="GeneID:8293595"
     mRNA            complement(<530734..>531651)
                     /locus_tag="KLTH0G06644g"
                     /product="KLTH0G06644p"
                     /transcript_id="XM_002555280.1"
                     /db_xref="GeneID:8293595"
     CDS             complement(530734..531651)
                     /locus_tag="KLTH0G06644g"
                     /note="highly similar to uniprot|Q05636 Saccharomyces
                     cerevisiae YDR280W RRP45 Ribosomal RNA Processing Putative
                     3'->5' exoribonuclease component of exosome complex of
                     3'->5' exonucleases"
                     /codon_start=1
                     /product="KLTH0G06644p"
                     /protein_id="XP_002555326.1"
                     /db_xref="GeneID:8293595"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DM78"
                     /translation="MAKEVEIPAAESKFVIECLRQNLRLDSRKFDEFRSVEIELGDDY
                     GDVTVTMGKTKVHCRISCTITQPYEDRPFEGLFFISTETSPMAGPQFENGNNTGEDEV
                     LCSRIIEKAVRRSGALDVEGLCIVAGSKCWAVRADVHFLNCDGGFIDASCIAVMVGLL
                     HFKKPDVSVSGEQVTIHPVDEREPVPLGVLHVPICVSFSFFNPEDAEENIKGESNSEI
                     CIIDATLKEELLRDGTLTVTLNKNREVVQVSKAGGLPMDALTLMECCHKAYKITEAIT
                     DQINNVLKADATARNQYAAILSSENARES"
     gene            complement(<532420..>533409)
                     /locus_tag="KLTH0G06666g"
                     /db_xref="GeneID:8293596"
     mRNA            complement(<532420..>533409)
                     /locus_tag="KLTH0G06666g"
                     /product="KLTH0G06666p"
                     /transcript_id="XM_002555281.1"
                     /db_xref="GeneID:8293596"
     CDS             complement(532420..533409)
                     /locus_tag="KLTH0G06666g"
                     /note="similar to uniprot|Q6Q5R1 Saccharomyces cerevisiae
                     YDR279W RNH202 Ribonuclease H2 subunit required for RNase
                     H2 activity"
                     /codon_start=1
                     /product="KLTH0G06666p"
                     /protein_id="XP_002555327.1"
                     /db_xref="GeneID:8293596"
                     /db_xref="GOA:C5DM79"
                     /db_xref="InterPro:IPR019024"
                     /db_xref="UniProtKB/TrEMBL:C5DM79"
                     /translation="MSKRIIALSKECNCEELHIFELPHSTNINSKSKLRLFCSDDKIY
                     QIKRQMFSKGCAYNKTRDASNEKYHYCSDSKPLKSGILTNADERRDGWLLEDGYFEFT
                     TKYDLCFSLCGALFSKAKSQDENEYQQEPRQFNELELESRFLMTRDLHETLIDNHDKG
                     WSNIPTRILQNSLQQLCDTIEEGGDTYYKMTPSKITKWLANKAVKVSRSLPASIPLQK
                     DLPEQVAGHAKLVFACNILISLVPQPAYQNLIQYSDEEVNFAKAFQEYRKYLQDQAVK
                     EREQQLQINAAMKVGMGNGNTKKKALVTKRPVVTKKVTKVSKGAIDGFFSKKK"
     gene            <533755..>535428
                     /locus_tag="KLTH0G06688g"
                     /db_xref="GeneID:8293597"
     mRNA            <533755..>535428
                     /locus_tag="KLTH0G06688g"
                     /product="KLTH0G06688p"
                     /transcript_id="XM_002555282.1"
                     /db_xref="GeneID:8293597"
     CDS             533755..535428
                     /locus_tag="KLTH0G06688g"
                     /note="similar to uniprot|P38775 Saccharomyces cerevisiae
                     YHR045W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06688p"
                     /protein_id="XP_002555328.1"
                     /db_xref="GeneID:8293597"
                     /db_xref="UniProtKB/TrEMBL:C5DM80"
                     /translation="MLYVSLKLITTISLVVVASVWFGSKLVINSRRDLHPIALNGQAN
                     VGPTRKEKETAVYRNFTVPPGFPLSTGLGLSMGYKLRNGNFGDIWSNIMSLSAENFVE
                     LSGQEYSVKKINAISKCLSKYVVQHSESGRLGIAAPIFELPGFTISIAGLMSSLNDVI
                     PVFLSSVPRSKQELDILAIDSWTTFHQMNGSHKWYKIVIVCNDHSGQPPQTIPPNVVT
                     WKDIVSNQEEDTVFEYEPPKDNSDDTKLLAIVSSPWNLSTSFSHMALVSSVSAFIKSF
                     PMDNELSGKDHLTVVIEEATKYYYPIQVWTKILTTLLHGGSASLLYAEPKQVDLQSCI
                     NEKTSLLQIDSSSPLLDSILQSSTAVLQELKLSWALSLLSEGIFTPSALSCSAFHNIR
                     CLFLSTTVLDARAVTAMEMPSRKVQTKAKNSRSTLTLNKLRALIGSRLVVELYSPFMV
                     MGPIACTNFFDYRILPDSVDSRLSHYGPISTSLEAKLVEDEHRPELQSSKRQGMLCIR
                     GFTIGKPVEPERLERALQIVEKFDGGEGWMPMLGVYGLFGKDGCFYEFK"
     gene            complement(<535474..>536352)
                     /locus_tag="KLTH0G06710g"
                     /db_xref="GeneID:8293598"
     mRNA            complement(<535474..>536352)
                     /locus_tag="KLTH0G06710g"
                     /product="KLTH0G06710p"
                     /transcript_id="XM_002555283.1"
                     /db_xref="GeneID:8293598"
     CDS             complement(535474..536352)
                     /locus_tag="KLTH0G06710g"
                     /note="highly similar to uniprot|P38710 Saccharomyces
                     cerevisiae YHR046C INM1 Inositol monophosphatase involved
                     in biosynthesis of inositol and in phosphoinositide second
                     messenger signaling INM1 expression increases in the
                     presence of inositol and decreases upon exposure to
                     antibipolar drugs lithium and valproate"
                     /codon_start=1
                     /product="KLTH0G06710p"
                     /protein_id="XP_002555329.1"
                     /db_xref="GeneID:8293598"
                     /db_xref="GOA:C5DM81"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:C5DM81"
                     /translation="MSLDLRSIEDYLCSLAKEKVGPIIKAKSGTQHVYDAKSGSRAVD
                     IVTAIDKQVEKLIWTNVKEKYPDFKFVGEESFVPGETTITDEPTFIIDPIDGTTNFVH
                     DFPFSCTSLGLALNKEPVVGVIYNPHLDLLVSASKNNGVRVNGKTFDFSAKTKEMGPL
                     TLKTSVVALQPGSAREGSNFQTKMRTYEALLSCDEGFVHGFRNLGSSAMTLAYICLGY
                     LDSYWDGGCYSWDVCAGWCILKETGGRIVGANPGEWDVPVDNRTYLAVRACESSKQQE
                     QYIEDFWACVKGSLKY"
     gene            complement(<536547..>539135)
                     /locus_tag="KLTH0G06732g"
                     /db_xref="GeneID:8293599"
     mRNA            complement(<536547..>539135)
                     /locus_tag="KLTH0G06732g"
                     /product="KLTH0G06732p"
                     /transcript_id="XM_002555284.1"
                     /db_xref="GeneID:8293599"
     CDS             complement(536547..539135)
                     /locus_tag="KLTH0G06732g"
                     /note="highly similar to uniprot|P32454 Saccharomyces
                     cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
                     yscII and to YHR047C uniprot|P37898 Saccharomyces
                     cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase"
                     /codon_start=1
                     /product="KLTH0G06732p"
                     /protein_id="XP_002555330.1"
                     /db_xref="GeneID:8293599"
                     /db_xref="GOA:C5DM82"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:C5DM82"
                     /translation="MSSETPDREVLPTYVTPVHYDLTVEPNFETFKFDGRVKIDLTVN
                     DGKQHRVQLNTVEIDIHSARIGDREAVEWEADSESQVTTIIFPKGVFEGQSQVTLDLA
                     FTGSLNDNMAGFYRAKYTDKATGATKYMATTQMEPTDARRAFPCFDEPNLKATYAITL
                     VSDPKFTHLSNMDVKSESVKDGKKYTLFNTTPKMSTYLVAFIVAELNYVENNDFRIPV
                     RVYATPGDEKHGQFAADLTAKTLAFFEKTFGIKYPLPKMDNVAVHEFSAGAMENWGLV
                     TYRVVDLLLDRENSTLQRVQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMS
                     WYSCNEFEPEWKVWEQYVSDNLQSALMLDSLRSSHPIEVPVKRADEINQIFDAISYSK
                     GSSLLRMISKWLGEDVFIKGVSQYLNKFKYGNAKTDDLWDALAAASGKDVRQVMNIWT
                     KKVGFPVVTVAEEGEKLTFTQNRYLTTKDVKPEEDKTIYPVFLALKGENGVDHSLALD
                     QRSKEVTLKDTDFFKVNADQAGLFITSYSDERWAKLGKQADLLSVEDRTGLVADAKAL
                     STSGYTSTTNFLELISQWKSESSFVVWEQMINSLSSLRATWIFEPEEVNEALDEFTRQ
                     LISSKASELGWEFKKSDSFATQRMKVEIFSTACSAKDSAVVEAALEMFDKYSSGDKNA
                     IPALLKPVVFNVAAQKGGLKYYEKLYHIYKNPSSTDEKISALRCLGRFEDPQLIKRTL
                     GYLFDGIVLAQDIYIPMQGLRRHPAGIKALWSWIKENWAELTKRLPPGLSMLGSVLQV
                     SSSGFTSMEAVEEIKGFFKDKSTKGFDQGLAQALDTVTSKAQWINRDRETINRYLKEH
                     GYYKNK"
     gene            <541019..>542461
                     /locus_tag="KLTH0G06754g"
                     /db_xref="GeneID:8293600"
     mRNA            <541019..>542461
                     /locus_tag="KLTH0G06754g"
                     /product="KLTH0G06754p"
                     /transcript_id="XM_002555285.1"
                     /db_xref="GeneID:8293600"
     CDS             541019..542461
                     /locus_tag="KLTH0G06754g"
                     /note="similar to uniprot|P38776 Saccharomyces cerevisiae
                     YHR048W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06754p"
                     /protein_id="XP_002555331.1"
                     /db_xref="GeneID:8293600"
                     /db_xref="GOA:C5DM83"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DM83"
                     /translation="MTSVSESELETEAKKEQFEVVLEPDDPENVETQMRNANKWFVAL
                     LVTVTSADITMTSSCWSLAQADIRRRFHISRELSVLGLSLYIFGMGVGPLLLSPLSEL
                     YGRKPTFISSLSLSICFLFLTAWGPNIGAVFVGRFLSGFFGSAFLSVAGGVISDMFSK
                     HQIGIPMTIYTTAAFTGPAIGPLISGALSKHSYRWTFVVMIIESALFLALFVVAFKET
                     YKPVLLLRKAKRLREETGDDRYCAPLERIRRETSLPKAILLSASRPFGLLTRDPMMGV
                     LCFYTGLTLAIIYMFFIAFPLVFGSLYSFTTMELGVSYMGMLVGIVLVAPTSLWFQRR
                     YAQKVINSGGQQVPELRFEPLFYGAFLTPIGLMIFAWTSYSHVHWIAPIIGTAVFGAG
                     VFFVFTGVFNYTVDAFRLYSASAMACNSFVRSMMAGVFPLFTTQMYEGMGVNWASFLL
                     AMVSIAMIPVPFLFTRYGAYLRSKSPYAWD"
     gene            <543396..>544106
                     /locus_tag="KLTH0G06776g"
                     /db_xref="GeneID:8293601"
     mRNA            <543396..>544106
                     /locus_tag="KLTH0G06776g"
                     /product="KLTH0G06776p"
                     /transcript_id="XM_002555286.1"
                     /db_xref="GeneID:8293601"
     CDS             543396..544106
                     /locus_tag="KLTH0G06776g"
                     /note="highly similar to uniprot|P38777 Saccharomyces
                     cerevisiae YHR049W"
                     /codon_start=1
                     /product="KLTH0G06776p"
                     /protein_id="XP_002555332.1"
                     /db_xref="GeneID:8293601"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DM84"
                     /translation="MSAPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDGPT
                     TLERKDLPFEMDDEKWQATVDAQLNKSWFFHSDISKELDLTTAIQTVSDHIKANGPYD
                     GIVGFSQGAAVAAIITNRITQLVPDHPPFKVSLIFSGYSFTEPDPEHEGQLRITEKFK
                     QDFTPAPESPTKMLFVYGASDQAVPATRSKYLQEIYASSSPENVKAFEHPGGHMVPNK
                     KDIIRPIVDEICSAVQSQ"
     gene            <544397..>545965
                     /locus_tag="KLTH0G06798g"
                     /db_xref="GeneID:8293602"
     mRNA            <544397..>545965
                     /locus_tag="KLTH0G06798g"
                     /product="KLTH0G06798p"
                     /transcript_id="XM_002555287.1"
                     /db_xref="GeneID:8293602"
     CDS             544397..545965
                     /locus_tag="KLTH0G06798g"
                     /note="similar to uniprot|P38778 Saccharomyces cerevisiae
                     YHR050W SMF2 Divalent metal ion transporter"
                     /codon_start=1
                     /product="KLTH0G06798p"
                     /protein_id="XP_002555333.1"
                     /db_xref="GeneID:8293602"
                     /db_xref="GOA:C5DM85"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:C5DM85"
                     /translation="MSAYAPVRRSEANEDDVPRPSLAEEPGVKQSNRLVAIIRKYGRF
                     IGPGLMVSVSYMDPGNFSTAVAAGSAHRYKMLFSVLVANLLAAFWQCLCAKLGAVTGL
                     DLAQNCRRHLPPNLNLALYILAEVAIIATDLAEVVGTAISLNILFNVPLAFGVVLTVV
                     DVLIVLMAYKPNGSLKLIRWFEMFVSLLVVATVVCFTIELFSVSISNVGDVFKGFLPS
                     KAVVADDGIYLSLAILGATVMPHSLYLGSGVVQPRLRNYDISNGHYKPNETDVDNNHD
                     NYRPSFDAINDTLNFTIAELLVSLFTVALFVNCSILIVAGATLYGTSENAVDADLFSI
                     YDLLCKSLSKAAGTVFVLALLFSGQSAGIVCTLSGQMVSEGFLNWSVAPALRRSLTRA
                     VAITPCLILVLVAGRRGLSGALNASQVVLSLLLPFVSAPLLYFTSNKEIMRVEVANNC
                     YYDMRDVGIPLQDLCENAEDNTSDAVPETQPKYVDMSNSMFTTVCAVVLWVCISGLNF
                     YLLASFSVGQETHL"
     gene            <546219..>546851
                     /locus_tag="KLTH0G06820g"
                     /db_xref="GeneID:8293603"
     mRNA            <546219..>546851
                     /locus_tag="KLTH0G06820g"
                     /product="KLTH0G06820p"
                     /transcript_id="XM_002555288.1"
                     /db_xref="GeneID:8293603"
     CDS             546219..546851
                     /locus_tag="KLTH0G06820g"
                     /note="similar to uniprot|P36054 Saccharomyces cerevisiae
                     YKL159C"
                     /codon_start=1
                     /product="KLTH0G06820p"
                     /protein_id="XP_002555334.1"
                     /db_xref="GeneID:8293603"
                     /db_xref="GOA:C5DM86"
                     /db_xref="InterPro:IPR006931"
                     /db_xref="UniProtKB/TrEMBL:C5DM86"
                     /translation="MATNTLIITSDKKDVTQGETADQVRKFLESQVLTRYSVTRADAM
                     QLVALPSLQRLILVCPSVEIAQEAMTAKARHPDLESLQFRFSVADTTLDSRKQYLKLP
                     PKQSMFLVSPPTSPPPEFDYSRLEETPNREKGLAPVSHHSQTSAAQPAEQALLSTGHY
                     VLLETPRASITLDCCTRDTDAGDEPATDHVSVSGVRTGMPPRSIFDDVED"
     gene            <547158..>547610
                     /locus_tag="KLTH0G06842g"
                     /db_xref="GeneID:8293604"
     mRNA            <547158..>547610
                     /locus_tag="KLTH0G06842g"
                     /product="KLTH0G06842p"
                     /transcript_id="XM_002555289.1"
                     /db_xref="GeneID:8293604"
     CDS             547158..547610
                     /locus_tag="KLTH0G06842g"
                     /note="similar to uniprot|P00427 Saccharomyces cerevisiae
                     YHR051W COX6 Subunit VI of cytochrome c oxidase which is
                     the terminal member of the mitochondrial inner membrane
                     electron transport chain expression is regulated by oxygen
                     levels"
                     /codon_start=1
                     /product="KLTH0G06842p"
                     /protein_id="XP_002555335.1"
                     /db_xref="GeneID:8293604"
                     /db_xref="GOA:C5DM87"
                     /db_xref="InterPro:IPR003204"
                     /db_xref="UniProtKB/TrEMBL:C5DM87"
                     /translation="MFSRTLLRSVRVNRSLLSRQGSSAVRAMPKLAQFQAIRKYSDHY
                     ENETFEEFTSRYEKEFEQAYDLFEVQRVLNNCFSYDLVPAPAVVEKALRAARRVNDLP
                     TAIRVFEALKYKVENEDQYKAYLEELKDVREELGVPLKEELFTEEEAH"
     gene            complement(<547911..>548354)
                     /locus_tag="KLTH0G06864g"
                     /db_xref="GeneID:8293605"
     mRNA            complement(<547911..>548354)
                     /locus_tag="KLTH0G06864g"
                     /product="KLTH0G06864p"
                     /transcript_id="XM_002555290.1"
                     /db_xref="GeneID:8293605"
     CDS             complement(547911..548354)
                     /locus_tag="KLTH0G06864g"
                     /note="similar to uniprot|P36053 Saccharomyces cerevisiae
                     YKL160W ELF1 Protein of unknown function deletion inhibits
                     Brome mosaic virus expression"
                     /codon_start=1
                     /product="KLTH0G06864p"
                     /protein_id="XP_002555336.1"
                     /db_xref="GeneID:8293605"
                     /db_xref="InterPro:IPR007808"
                     /db_xref="UniProtKB/TrEMBL:C5DM88"
                     /translation="MGKRKKSSRGPAKRVVQKLDLTFNCLFCNHEKSITCTLDKKNGI
                     GSLSCKVCGQNFQTHINALSQPVDVYSDWFDAVEEVNAGKVSESEGESDSASDYESDS
                     DAEQVDKRRAQIDSDEEEISEDEDAIGSSKRGRGKIVDSDEDEDD"
     gene            <548680..>549906
                     /locus_tag="KLTH0G06886g"
                     /db_xref="GeneID:8293606"
     mRNA            <548680..>549906
                     /locus_tag="KLTH0G06886g"
                     /product="KLTH0G06886p"
                     /transcript_id="XM_002555291.1"
                     /db_xref="GeneID:8293606"
     CDS             548680..549906
                     /locus_tag="KLTH0G06886g"
                     /note="similar to uniprot|P38779 Saccharomyces cerevisiae
                     YHR052W CIC1 Core interacting component 1 ribosome
                     biogenesis protein"
                     /codon_start=1
                     /product="KLTH0G06886p"
                     /protein_id="XP_002555337.1"
                     /db_xref="GeneID:8293606"
                     /db_xref="GOA:C5DM89"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="InterPro:IPR028365"
                     /db_xref="UniProtKB/TrEMBL:C5DM89"
                     /translation="MAKSTPVKKRGGSKSTTPVSTPPVKTKKESRSGTPASTAGSTPV
                     STPSKKKKRAKKPATSVKVQEAAKPKEPETVVPKDRINKAVQELSKFTSKKQEDSTQL
                     LDDDDELDKQVELIAVNTGSFTGNRKVFKPKQFKIEHSIFKPWKKASETSVKDFKTLL
                     ILRDQDAVKVSEDEIYDQLRDSGITIDTVIPGADLKTKYKSFEKRRAFIQDFSLILAD
                     DSVVTTLPKLLGGKAYEKVSTTPVPIRTNKKGVFSLTILSNSIKKVFEHSLPAKMPRG
                     TTLSVHLGNLNWFTADELTQNILTVVEQLVKEFQVRSVFLKSNKSPVLPLYYNQAVLD
                     DLAKQTKEDSKDTATRKVTIDGTELELSAFEAALMEIANPDELDKVFAGRINRAKKRA
                     AESEEESAPDSKKAKA"
     gene            <550439..>551524
                     /locus_tag="KLTH0G06908g"
                     /db_xref="GeneID:8293607"
     mRNA            <550439..>551524
                     /locus_tag="KLTH0G06908g"
                     /product="KLTH0G06908p"
                     /transcript_id="XM_002555292.1"
                     /db_xref="GeneID:8293607"
     CDS             550439..551524
                     /locus_tag="KLTH0G06908g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G06908p"
                     /protein_id="XP_002555338.1"
                     /db_xref="GeneID:8293607"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DM90"
                     /translation="MEAPMNLDEVVNSFKNRVDQLSRDWDAIKSSFVGSQDEELKQLK
                     VKFDLIQEQNSVILIDLYQLKKFLNLEDNNYNNVFSTVLDSPAGALHFPTASSERYAE
                     NAVPATSGVTYLGSVEQPRIHDTQSALRTQQLYSSASSKIQEKHPVHLHSLWSEIHSP
                     LINDEISYWKKTRSPMSPQLFSHLRQQNPKPTINDENDATEYLGLSKLIGVETPSKNP
                     REKTHGKLQMKPLNSSLLKSGQTPCSSRHLRYAKDAKDISAYVLKMSGNPKTVGDMYY
                     EYEHQLRPQILEFEKRYGKGQISRLPKVRTYQRRRALINEIEKFARREGKSIEEAVQY
                     FEEIRTQNKKTVPWLYNNLNRILQKYC"
     gene            complement(<551719..>553536)
                     /locus_tag="KLTH0G06930g"
                     /db_xref="GeneID:8293608"
     mRNA            complement(<551719..>553536)
                     /locus_tag="KLTH0G06930g"
                     /product="KLTH0G06930p"
                     /transcript_id="XM_002555293.1"
                     /db_xref="GeneID:8293608"
     CDS             complement(551719..553536)
                     /locus_tag="KLTH0G06930g"
                     /note="similar to uniprot|P38767 Saccharomyces cerevisiae
                     YHR032W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06930p"
                     /protein_id="XP_002555339.1"
                     /db_xref="GeneID:8293608"
                     /db_xref="GOA:C5DM91"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:C5DM91"
                     /translation="MAPPSKQFTHTTGERRSSVIHSSGIIKGGIFAPVDYIPQEENAI
                     GDVDSDDGENRYESLLDSNNAYTLQGEGLSSYGATSDSNNGASKRSSSRNSYSRDLLE
                     EERDLLLDNKLISDDGPLNSVPEEEEEQIRQTWEDALNSGKIISTTYRRECQVLMKNA
                     FPLIFTFVLQNSLSLASVFTTSHLGIKELGGITLGSMTANITGFAAIQGLCTCLDTLC
                     SQAYGAKNYHLVGILLQRCALITIIFFTPILCIWWLWSEAILAALIPERELCRLAANY
                     LKVVALGVPGFVFFECGKRFLQCQGIFHASTIVLLFCAPFNAVMNYMLVLDKRFGIGY
                     LGAPISVAVNYWLMALGLLLYTMFTNHKINPRKCWSGTIKPNQIFKNWRKMFSLALPG
                     IVMVEAEFLGFEILTIFASHLGTRELGAQSIVSTIASLAYQVPFSISISTSTRVANFI
                     GASLYQNCIATCKVSLLLSAVASCFNMTIIYAYRVPLANAFSKEPDVVNLVVSVLPLL
                     AFMQIFDAFNACTAGCLRGQGQQKIGGYINVLAFYCVGIPMSYFLTFNCGLGMAGLWY
                     GITSALVFMSIFQSYAVFSCNWKEAIQAAKSRNSEGSRV"
     gene            <553981..>556062
                     /locus_tag="KLTH0G06952g"
                     /db_xref="GeneID:8293609"
     mRNA            <553981..>556062
                     /locus_tag="KLTH0G06952g"
                     /product="KLTH0G06952p"
                     /transcript_id="XM_002555294.1"
                     /db_xref="GeneID:8293609"
     CDS             553981..556062
                     /locus_tag="KLTH0G06952g"
                     /note="similar to uniprot|P38766 Saccharomyces cerevisiae
                     YHR031C RRM3 DNA helicase involved in rDNA replication and
                     Ty1 transposition structurally and functionally related to
                     Pif1p"
                     /codon_start=1
                     /product="KLTH0G06952p"
                     /protein_id="XP_002555340.1"
                     /db_xref="GeneID:8293609"
                     /db_xref="GOA:C5DM92"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028880"
                     /db_xref="UniProtKB/TrEMBL:C5DM92"
                     /translation="MFSQRSKRTKSSHDSSKTGPKSHISSSDAPTMRQKTVTSFFAKK
                     TRRLVGTSSLAAEPHKSVLMGRKPLFESQGSFDEENRDEELKHMLNEKPLNNFKSLSR
                     SPSSLSTSSGQVTATQASLTSFGSSQHFVKYSPFSSSFTEGLDGGMVSSTQRAPEKRP
                     PPSHFSFSLNKKIKSSRAGPSTSQSLTKASGSNPQLDLTKEQRQVIDLIVSQRKNVFY
                     TGSAGTGKSIVLRELVRQLRARYGDAAVAVTASTGLAAVNIGGMTVNRFSGINIGIGS
                     VQKLAAQVKRNKTNSERWKRTSVLIIDEVSMIDGRFLDKMDFVARDVRRVHDKPFGGI
                     QLVMTGDFFQLPPVADRDRSVPKPPFCFESKVWRQAIDKTICLTQVFRQKDQELVDLL
                     NSIRFGVINTKVAQQIRSFEREVNYSDGIMPTELYPTRREVEMSNKRMLDRLPGDVKV
                     FHAQDQATSDNPYLLKILDSLMVEKNIALKEDAQVMMIKNMDETLVNGSVGKLLFFTT
                     ELLHQKMLELFPATKLSDPDLVLDMRLVSRCIGVASQNYPPDIKAAINQRPLHRTEQL
                     SLLLKVAEREDKGLAFPFIRFTTPSNGFRYELILPAEFTIDVPAQKTSVSRTQLPLIL
                     CWALSIHKAQGQTIDRLKVDLKKVFEEGQVYVALSRAVSKERLQIVNFDPRVIKANEK
                     VKSFYQTLEVL"
     gene            <556626..>558125
                     /locus_tag="KLTH0G06974g"
                     /db_xref="GeneID:8293610"
     mRNA            <556626..>558125
                     /locus_tag="KLTH0G06974g"
                     /product="KLTH0G06974p"
                     /transcript_id="XM_002555295.1"
                     /db_xref="GeneID:8293610"
     CDS             556626..558125
                     /locus_tag="KLTH0G06974g"
                     /note="highly similar to uniprot|Q00772 Saccharomyces
                     cerevisiae YHR030C SLT2 Suppressor of lyt2
                     serine/threonine MAP kinase"
                     /codon_start=1
                     /product="KLTH0G06974p"
                     /protein_id="XP_002555341.1"
                     /db_xref="GeneID:8293610"
                     /db_xref="GOA:C5DM93"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DM93"
                     /translation="MVESLERHTFKVFNQDFTVDKRFQLIKEIGHGAYGIVCSARFVE
                     AAEETNVAIKKVTNVFAKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFSPDNSFN
                     GLYLYEELMECDIHQIIKSGQPLTDAHYQSFIYQILCALKYIHSADVLHRDLKPGNLL
                     VNADCQLKVCDFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWS
                     CGCILAELLGGKPIFKGKDYVDQLNRILQVLGTPPEETLERIGSKNVQDYIHQLGYIP
                     KVPFVTLYPRANAQALDLLERMLTFDPQKRITVEEALEHPYLSIWHDPADEPVCAEKF
                     DFNFESVNEMEDLKQMILDEVRDFRRFVRQPLIEEEQNQQEQQNQQEQQQLHQQQLEQ
                     ERQSQRFMANEPTITDPYADGDFKQHVLFSQPPSVSAELHDQFIGIHSDNLPGHDTDF
                     PPRPQENLLMSPMGLEGAGDTNSLEPAGSLDDFLDLEKELEFGLDRKFP"
     gene            <558369..>559241
                     /locus_tag="KLTH0G06996g"
                     /db_xref="GeneID:8293611"
     mRNA            <558369..>559241
                     /locus_tag="KLTH0G06996g"
                     /product="KLTH0G06996p"
                     /transcript_id="XM_002555296.1"
                     /db_xref="GeneID:8293611"
     CDS             558369..559241
                     /locus_tag="KLTH0G06996g"
                     /note="similar to uniprot|P38765 Saccharomyces cerevisiae
                     YHR029C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G06996p"
                     /protein_id="XP_002555342.1"
                     /db_xref="GeneID:8293611"
                     /db_xref="GOA:C5DM94"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="UniProtKB/TrEMBL:C5DM94"
                     /translation="MTITVPFKQVDVFTSKLFKGNPVAVVNFLDVEESSITQDTLQSI
                     ARWTNLSETTFLFKATDPKSDYKLRIFTPMCELPFAGHPTVGSCQAYLEFSGRDAVGN
                     IYQQCGVGVVELTVEDKKISLKGPPPKVMEVPSAETSDYEGSLSAEFFQKPMLLDVGP
                     KWIVGLMRDPQSCYELEPDFSKMKASTIKYGAIGLVVAGKYPGEDKYEMRAFAPGDGV
                     LEDPVCGSGSLALAAYLQQLNNYESNYEFEIYQGRRLYRDGKVSAKIEHLGGEVEYFI
                     GGEAITIVNGEISV"
     gene            <559864..>562326
                     /locus_tag="KLTH0G07018g"
                     /db_xref="GeneID:8293612"
     mRNA            <559864..>562326
                     /locus_tag="KLTH0G07018g"
                     /product="KLTH0G07018p"
                     /transcript_id="XM_002555297.1"
                     /db_xref="GeneID:8293612"
     CDS             559864..562326
                     /locus_tag="KLTH0G07018g"
                     /note="similar to uniprot|P18962 Saccharomyces cerevisiae
                     YHR028C"
                     /codon_start=1
                     /product="KLTH0G07018p"
                     /protein_id="XP_002555343.1"
                     /db_xref="GeneID:8293612"
                     /db_xref="GOA:C5DM95"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DM95"
                     /translation="MFSEVSDLESSECASSIRKKRFNSRLPQLGLLTLLVWGSVVFLK
                     TLNSTIHGEPGFRRLPTDCPQVTEDGLLKVSFENVRNFTFNPTLQTVQWIGGLNSPSE
                     DMGLFLSVENGSYVIKSVYDQEYSRLLLKGKEFSYKNQNFTVDHLQASPNLNQMLIRS
                     NTVKHWRHSTFGSYFLFDTETSSFNFIGDNIAKAEWSPNSVDIAYVKENDLYVYSSKK
                     HATVSRVTDDGSAQVFNGKPDWVYEEEVLEGDSAMWWSPEGEYLAFFRINETEVQEFP
                     IPYFSQHEDDLYPEVRLIKYPKSGSPNPSVKLMIYSLENDKTTAVAAGNESSLITEVL
                     WVGSSKILCKATDRCSDILSVVLADARVEGKHEVSRIESSEDSWWEITHDTMHIPKDE
                     SRGREQDGYIDLVPHDGYNHLAYFSPTNRSKPSFLTRGSWEVVDGPAGFDQDTNDVYF
                     VATKKSSTERHLYRVNLHKPYELTEITDTSKEGLFSVSFSSGMRFALLSYLGPDTPYQ
                     KILDLKSTSSDTHARGNVVGKTLYYLEENEVLRNRLHQYAVPEKTFRELNLGEDENGQ
                     DILVNSYEILPNDFDPTLRNHYPVFFYAYGGPNSQQVIKAFSVGFNQVVASQLDAIVV
                     VVDGRGTGFKGKQFRSLVRDNLGDFEARDQIAAAKLYSEKSFVDSEKISLFGWSYGGY
                     LTLKTLEKDAGQTFKYGMSVAPVTDWRLYDSVYTERYMHTPQDNMSGYNRSKVHNATA
                     LGRSRRFLLMHGSGDDNVHFQNSLRFLDLLDLANVENYDMHVFPDSDHSIRYHNANTI
                     VYDKLLSWARQAFNGDFVTGFY"
     gene            <562722..>565646
                     /locus_tag="KLTH0G07040g"
                     /db_xref="GeneID:8293613"
     mRNA            <562722..>565646
                     /locus_tag="KLTH0G07040g"
                     /product="KLTH0G07040p"
                     /transcript_id="XM_002555298.1"
                     /db_xref="GeneID:8293613"
     CDS             562722..565646
                     /locus_tag="KLTH0G07040g"
                     /note="similar to uniprot|P38764 Saccharomyces cerevisiae
                     YHR027C RPN1 Non-ATPase base subunit of the 19S regulatory
                     particle of the 26S proteasome may participate in the
                     recognition of several ligands of the proteasome contains
                     a leucine-rich repeat (LRR) domain a site for protein?
                     protein interactions"
                     /codon_start=1
                     /product="KLTH0G07040p"
                     /protein_id="XP_002555344.1"
                     /db_xref="GeneID:8293613"
                     /db_xref="GOA:C5DM96"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /db_xref="UniProtKB/TrEMBL:C5DM96"
                     /translation="MVEESSQREDKQAQPSNGSQQALKDEKVAKTQNNKKEEVEELSE
                     EDLKLKNNLETLVERLSEDDASLYEPSLIQLKELIRDSTSSMTAVPKPLKFLRPSYPQ
                     LCGVYDKWTDKKLKSLMADALSVLGMTYSDEGKRDSLKFRLLSDEKNIESWGHEYVRH
                     LALEIGGVYNEQVEKEAGDSSEASPEPSKSSIDFDVSKESLIQLSLEIVPYFLKHNGE
                     ADAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPPPDDVFFLQTAYSIYLSE
                     SQLTEALALAIRLDDESLIRAVFDATTNAVVHKQLAYILSAQKSSFEYENVQDIIGNT
                     HLSEHFLFLAKELNLTVPKVPEDIYKSHLDNSSKGVFAGTGLDSAQQNLAASFVNGFL
                     NLGYCSDKLILGDDNWVYKTKGDGMTSTVASIGSIYQWNLDGLQQLDKYLYVEETEVK
                     AGALLGIGLSACGIHDGDVEPALLLLQDYVTNSDKKISTASILGLGIAFAGSRNDELL
                     GLLLPIAADTSLPIETSAMASLALAHAFVGTCNGDITAAIVDNLLERTASELKTEWTR
                     FITLALGILYMGQGDQVEDVLETISAVDHPITSAIEVLINVCAYTGTGDVLLIQDLLH
                     RLTPKNKEAEEEREDDEEDVEFAESINDELTDALNIGKSDEPPATADAEDKMDVDESN
                     KDQSKNDKEEDTKKKEEEEKKEEEDEKEFALIDELTYSVLGIAMIAMGEEIGKEMSLR
                     HFSHLMHYGNEHIRKTVPLAIGLLSASDPQMKIFDTLSRFSHDPDLDVSMNSIFAMGL
                     VGSGTNNARLAQLLRQLASYYSREQNALFITRLSQGLIHMGKGTMTFDVFNDAGVLNK
                     VALASLLTVLVGLVTPSFMLDHHYLFYYLNSGVRPKYILTLNEDGEPIKVNVRVGQAV
                     DTVGQAGKPKTITGWITHSTPVLLGHGERAELETSEYISYASRLEGVVILRKNPDYRE
                     EE"
     gene            complement(<565809..>566447)
                     /locus_tag="KLTH0G07062g"
                     /db_xref="GeneID:8293614"
     mRNA            complement(<565809..>566447)
                     /locus_tag="KLTH0G07062g"
                     /product="KLTH0G07062p"
                     /transcript_id="XM_002555299.1"
                     /db_xref="GeneID:8293614"
     CDS             complement(565809..566447)
                     /locus_tag="KLTH0G07062g"
                     /note="similar to uniprot|P23968 Saccharomyces cerevisiae
                     YHR026W PPA1 Subunit c'' of the vacuolar ATPase which
                     functions in acidification of the vacuole"
                     /codon_start=1
                     /product="KLTH0G07062p"
                     /protein_id="XP_002555345.1"
                     /db_xref="GeneID:8293614"
                     /db_xref="GOA:C5DM97"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:C5DM97"
                     /translation="MSSKSESSMGISLPSFRQWLRLLVITVAVWYAGKKLFTGHGEDI
                     NFGRFLSKTSPYMWANLGICMCIGLSVVGAAWGIFITGSSIIGAGVRAPRITTKNLIS
                     IIFCEVVAIYGLIMAIVFSSKLTVASKETLFSKSNLYTGYSLFWAGLTVGLSNLICGV
                     AVGITGATAAVSDAADSSLFVKILVIEIFGSVLGLLGLIVGLLMAGKAVEFQ"
     gene            complement(<566748..>567821)
                     /locus_tag="KLTH0G07084g"
                     /db_xref="GeneID:8293615"
     mRNA            complement(<566748..>567821)
                     /locus_tag="KLTH0G07084g"
                     /product="KLTH0G07084p"
                     /transcript_id="XM_002555300.1"
                     /db_xref="GeneID:8293615"
     CDS             complement(566748..567821)
                     /locus_tag="KLTH0G07084g"
                     /note="highly similar to uniprot|P17423 Saccharomyces
                     cerevisiae YHR025W THR1 homoserine kinase"
                     /codon_start=1
                     /product="KLTH0G07084p"
                     /protein_id="XP_002555346.1"
                     /db_xref="GeneID:8293615"
                     /db_xref="GOA:C5DM98"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DM98"
                     /translation="MPRSFKISVPASSANIGPGYDVLGIGLALFLTLEVEIDPKAAND
                     TNSDPNNCKLSYTEDSEGFDSVPLRSDENLITRTALYVLRCNNIRSFPSGTKVHIHNP
                     IPLGRGLGSSGAAVVAGVMLGNEVGQLGYSKQRMLDYCLMIERHPDNITAAMMGGFVG
                     SFLRDLTPAEMERREIPLSEVLGSPSGGEDTGLVPPSPPTDIGRHVRYNWNKDIKCIA
                     IIPNFEVSTADSRGVLPQAYTAKDLVFNLQRLAVLTTALTQSPPNPDLIYPAMQDRVH
                     QPYRKTLIPGLTEILSSVTPSTYPGLLGICLSGAGPTILALAVGNFDDIAQEIMNRFS
                     KNNVACNWKLLDLAYNGAEVTQA"
     gene            <568012..>569487
                     /locus_tag="KLTH0G07106g"
                     /db_xref="GeneID:8293616"
     mRNA            <568012..>569487
                     /locus_tag="KLTH0G07106g"
                     /product="KLTH0G07106p"
                     /transcript_id="XM_002555301.1"
                     /db_xref="GeneID:8293616"
     CDS             568012..569487
                     /locus_tag="KLTH0G07106g"
                     /note="similar to uniprot|P11914 Saccharomyces cerevisiae
                     YHR024C MAS2 Larger subunit of the mitochondrial
                     processing protease essential processing enzyme that
                     cleaves the N-terminal targeting sequences from
                     mitochondrially imported proteins"
                     /codon_start=1
                     /product="KLTH0G07106p"
                     /protein_id="XP_002555347.1"
                     /db_xref="GeneID:8293616"
                     /db_xref="GOA:C5DM99"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C5DM99"
                     /translation="MFRARAPLQKAFRRRFCSKGGAENFEMSKLKNGVSVATSNVPGH
                     FSALGLYVGAGSRYETKNLRGCTHIMDRLAFKSTEHTSGRQMAETLELLGGNYQCSSS
                     RETMMYHASVFNRDVEKMFSLMAETVRFPKISEEELEEQKLTAQYEIDEVWNKHDLIL
                     PELLHVTAYSGETLGSPLLCPRELIPSISKYYLNDYRRKFYTPENMVAAFVGIPHEEA
                     VSYAEKYFEDMAPGNGRPTIKPAHYTGGETCIPPGPVFGNLPELFHIQIGFEGLPIGH
                     SDIYALATLQTLLGGGGSFSAGGPGKGMYSRLYTHVLNQHFFVENCMAFNHSYSDSGI
                     FGISASCVPQAAPYMAEIIAQQFANTFATDKLKLTEEEISRAKNQLKSSLLMNLESKL
                     VELEDLGRQVQLHGRKIPIEEMISSIEKLTVEDIRRTAEAVFTGKVNNKGEGTGRATV
                     VMQGEREAFGDVEGILKHYGLGNYEKFNTSALKTSKKKGWF"
     gene            complement(<569563..>575151)
                     /locus_tag="KLTH0G07128g"
                     /db_xref="GeneID:8293617"
     mRNA            complement(<569563..>575151)
                     /locus_tag="KLTH0G07128g"
                     /product="KLTH0G07128p"
                     /transcript_id="XM_002555302.1"
                     /db_xref="GeneID:8293617"
     CDS             complement(569563..575151)
                     /locus_tag="KLTH0G07128g"
                     /note="similar to uniprot|P08964 Saccharomyces cerevisiae
                     YHR023W MYO1 Type II myosin heavy chain required for
                     wild-type cytokinesis and cell separation localizes to the
                     actomyosin ring binds to myosin light chains Mlc1p and
                     Mlc2p through its IQ1 and IQ2 motifs respectively"
                     /codon_start=1
                     /product="KLTH0G07128p"
                     /protein_id="XP_002555348.1"
                     /db_xref="GeneID:8293617"
                     /db_xref="GOA:C5DMA0"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR027401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMA0"
                     /translation="MQSVWIPDAEQVFVQAEFVGEKTVRNKQNKDEKWAVVRRDGREQ
                     EIPAGQVFAVNPGTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINP
                     YSNIRIYTQDYISLYHGSPKEDNKPHIFAVAEEAYQNLLSQRRDQSILVTGESGAGKT
                     ENTKKILQYLASITSEDKLSPDTSHESFERKILQSNPILESFGNAQTVRNNNSSRFGK
                     FIKIEFDELGKINGAHVDWYLLEKSRIIQQSPRERNYHIFYQMLSGMSAQDLRKYGLE
                     SNSIKDYGFLRNSNSSIPGVDDTQDFHTLLTSFNVVGFTGIEVQAVMTCIAIILHIGN
                     IEFVSERAEQASISGSVEVLCKLLGVTEVDFKVAVLRPKAKAGKDWVSQSKNALQARF
                     ILNSLSRSLYENLFAHIVQKINSNLDHGSMTENYIGLLDIAGFEIFKHNSFEQLCINY
                     TNEKLQQFFNHHMFVLEQNEYLKENVQWNFVDYGKDLQSTIDLIEKKDQNPGVLPLLD
                     EESILPKSTDESFYSKLDTFCNDKSSKFKRSKKDKCFILKHYAGDVEYNVEGWLSKNK
                     DPLHENLLQVLSSSENDLIKQFYHDKDSRGGSFKTTSIRHRSQLNSLLDRLSSTEPHF
                     VRCIIPNDKKKAHDFNRSLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYKVLTD
                     EYRFSNNSKKNCEIVLSSLHLDPSVFKVGNSKLFFKAGVLASLEAKKESRISDMMSRL
                     NAMINGSNVRRSTSHKLKKLQAAQVLSSAFKTYDNLMGDHWFNLYVKIKPLLESTQEI
                     SKTRKIAEQVKSLESKLKIVESKNEKLQQEKENISAELKAVREKLAAETENLEKRQND
                     LRLVASKEAELNLKLEESQKIRDQFAAEKEALEKAHASLQGELTRSNEEASKSHSSFQ
                     SLQNEKVQLEQKISELRKQVDKSERSQKNMDSDKNGLLDQIKLLKSSISEKDRITGEL
                     KEKLSASDKELERSLQGLEKKFTSTSKRLTSLVEENKSLRETVDRAKKEQNELHNGLQ
                     AKEKELRRLNERSDQNQTLIASLNKERADLAAEHEKILNEAKELRKEASGYKKRYQEL
                     EETCSSLKDDLKRSLQEPKSNSGEDGDSSVDLKKFQSLEEQLVREKSLTKFLNERLVD
                     SSSSRPQSRSLLELQTAHSVSGEDIYKACDELKQELRETSYRLEKEINNKKDLISKLR
                     FTETRLASASFEIQTMSSQLKKLKSIINDANLNVNLEEVLGQIEPVEINHEKLILEVE
                     YLKGQLEAQKIARLDAENAASALHTKFRQIQRSDSSSDIFRLKYEASEQRVKSLESKM
                     TAYPLRDRTNTASREIFTHRESISKYEEDLRFYRLENYKLQDLLVESEKQINALNKCV
                     KKNQADRVVLGEQLTRAMKDLEVTERQNALLATSSKNHKVQYESCIDDLHATEEQLKD
                     VIHALRQSEDDIKTMTAIIERLKSQNRQKDKQLWELETRNNTLESETEEKAIDNDKLC
                     SRIQVLTDDLSHFKDRLRLAEDKTQFLEEIEKLKADLDLSLRGETELKKEVSSLNYSL
                     ESLKIDSDAKINDLLSQTNHYEQVVGSLIEERDAASAIQKELEENLKHLQGKVEVLND
                     SIKSLLDEKRQLEHQNDDLKTRLEQSKATFGATEKERENAFGKVSALEKSMELQRKQN
                     DRNEALVEQLQASVSEAKSQLAIEKDKNIVLHEENQSFGKSNNQLRERLTALEAKLED
                     TSEKEAWLSKVQELEVLVAKESDSKFEEMKRAKSLERTVAELKAVNEKQAETINMAND
                     DRLEFSNELSEKIERLAALEKHIAKQEIDMKRIERDKTYQDERILHLQSEVELWKEKY
                     SDLSTRREKISVHASEEVFI"
     gene            <575971..>577893
                     /locus_tag="KLTH0G07150g"
                     /db_xref="GeneID:8293618"
     mRNA            <575971..>577893
                     /locus_tag="KLTH0G07150g"
                     /product="KLTH0G07150p"
                     /transcript_id="XM_002555303.1"
                     /db_xref="GeneID:8293618"
     CDS             575971..577893
                     /locus_tag="KLTH0G07150g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G07150p"
                     /protein_id="XP_002555349.1"
                     /db_xref="GeneID:8293618"
                     /db_xref="UniProtKB/TrEMBL:C5DMA1"
                     /translation="MCARMEPRCGEVCEEMSETDAMTEHVSVFTPVGHAGAPLPHDYF
                     QDAEYGNCRSSISSSTQDWCRADPGRCCDNEASGVMSRLPTELKTQITSKLSQYDLVN
                     VARAWPAFREAATASLHEKVVVDAHYSYLKDDCERATYIKTRYNLKKFLQLAATGCEP
                     GAGVGPLVRSFEIVNLPDGMSHAEARALVCGGLPAMTGLSKFYCDIDALALPPQILKL
                     MPNKHELQSLAVNVDLRHMCEDFGRFEQIRKLSVSPFCDSRKLASFLSQILVPGVVEN
                     LSTLRMARETASLLKKNATQSLVVTGYMLDNGAARPDASEGQAQGLALLSQLDLDFWK
                     FLDRITAQGTRLSSLTSLEVDDVNVVPEDCGRVARGLALDKLEFLSLTNVREFQVLPA
                     VDYEVRDFTSLALEHLRPSFLLGVAPRLRCLRKLKLDYREPIMDSGPEFLRLLKSDAH
                     TALEELDVSIHWDETKLAMWPSWHALARRYVAAIAAYGASLRKLSLVAYQDSKFYEQP
                     KRIPADLLPQLAACSSLRSLRVHGEFMQLAGSPGSLLPLIAQLRHLQDLDLVGKTAPQ
                     HMGLMVVHDGVLDRWYRVIHVAIALARANSSLRLVRVDKCLFECRRDGTVTPRTTDSD
                     AWFDARTRVQMSAGDF"
     gene            <578557..>579714
                     /locus_tag="KLTH0G07172g"
                     /db_xref="GeneID:8293619"
     mRNA            <578557..>579714
                     /locus_tag="KLTH0G07172g"
                     /product="KLTH0G07172p"
                     /transcript_id="XM_002555304.1"
                     /db_xref="GeneID:8293619"
     CDS             578557..579714
                     /locus_tag="KLTH0G07172g"
                     /note="some similarities with uniprot|P01120 Saccharomyces
                     cerevisiae YNL098c"
                     /codon_start=1
                     /product="KLTH0G07172p"
                     /protein_id="XP_002555350.1"
                     /db_xref="GeneID:8293619"
                     /db_xref="GOA:C5DMA2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMA2"
                     /translation="MSMLLYDLGPPENAVPREFDLSSSRIALVGDRGCGKTSLALRWC
                     YGSLHSTGAREHLTSEDICHRRFLRPALRQSRTWAEYFELQMRLRSNFSGDGSDAGRS
                     ASFDSAAMSQLDYGFGAGNSATSNELRLRHKDTLDVQVLEGADFEQIDYSELAALQTF
                     QTDGFMLCFDVTNAKSFETVQLMYQQVWKLRGDDVPMVLCALKADVAQEERAVDPEQV
                     AELCDELGIDIDISFFEVSAFEDFNINEVFYRLLREIELRKDTLRRTRLASKDMVSEE
                     SGTMTATTLALDHSAVGETSAAELDDETIPTLPACTAPPAASKAAVSAPVLSGSPDAS
                     PASNAPCATPAPALSTKCSTRSSRPRNTTRAPPIRGGSAAPKTKHACCVIC"
     gene            complement(<579918..>580442)
                     /locus_tag="KLTH0G07194g"
                     /db_xref="GeneID:8293620"
     mRNA            complement(<579918..>580442)
                     /locus_tag="KLTH0G07194g"
                     /product="KLTH0G07194p"
                     /transcript_id="XM_002555305.1"
                     /db_xref="GeneID:8293620"
     CDS             complement(579918..580442)
                     /locus_tag="KLTH0G07194g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0G07194p"
                     /protein_id="XP_002555351.1"
                     /db_xref="GeneID:8293620"
                     /db_xref="UniProtKB/TrEMBL:C5DMA3"
                     /translation="MPARNRQNVCKVALVATPEMCVCVRVCEAILAAQSELRTRMRRA
                     TKALCNHVTCAVSMPRTMQRTHAALAFAEHLRPLSALPPLMQVTVVGVCVCRVAVLPM
                     CGAPDGATDEGSDRNCSITILPKLSYLGLGSCLDSCLGSCLGSCLSFVFYVSLRLQVI
                     GNIPNFLQCQNQEE"
     gene            <581090..>581806
                     /locus_tag="KLTH0G07216g"
                     /db_xref="GeneID:8293621"
     mRNA            join(<581090..581092,581561..>581806)
                     /locus_tag="KLTH0G07216g"
                     /product="40S ribosomal protein S27"
                     /transcript_id="XM_002555306.1"
                     /db_xref="GeneID:8293621"
     CDS             join(581090..581092,581561..581806)
                     /locus_tag="KLTH0G07216g"
                     /note="highly similar to uniprot|P38711 Saccharomyces
                     cerevisiae YHR021c RPS27B ribosomal protein and to
                     uniprot|P35997 Saccharomyces cerevisiae YKL156w RPS27A,
                     Protein component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S27"
                     /protein_id="XP_002555352.1"
                     /db_xref="GeneID:8293621"
                     /db_xref="GOA:C5DMA4"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:C5DMA4"
                     /translation="MVLVQDLLHPSPATEARKHKLKALVQGPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCATVLCTPTGGKAKLSEGTSFRRK"
     gene            complement(<582101..>584224)
                     /locus_tag="KLTH0G07238g"
                     /db_xref="GeneID:8293622"
     mRNA            complement(<582101..>584224)
                     /locus_tag="KLTH0G07238g"
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /transcript_id="XM_002555307.1"
                     /db_xref="GeneID:8293622"
     CDS             complement(582101..584224)
                     /locus_tag="KLTH0G07238g"
                     /note="similar to uniprot|P36056 Saccharomyces cerevisiae
                     YKL155C RSM22 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM22"
                     /protein_id="XP_002555353.1"
                     /db_xref="GeneID:8293622"
                     /db_xref="GOA:C5DMA5"
                     /db_xref="InterPro:IPR015324"
                     /db_xref="InterPro:IPR016522"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMA5"
                     /translation="MSLRLALVQSCRAHISYSSMVRFRLAFPTSYTRILKRFKGTGAS
                     FSRQDLDVFTMDKQGGGTRGAAGFVVEDNQLGNEEVVDRDELLRNEYVSSFRKGQGTL
                     PPGTNSREARLLPETITGRAPRDQIELNPTVSQAIRNNILSLHMPGNLRRSAGSGFVE
                     LKQSKVHRAARTNMEVDSHIASLFLQNYGSIFQSLSELKKRLGDKFKPDRILDVGYGP
                     ATGIIALNDLMGPDFRPYSKEAVILGHIEMQKRAKILLSRQANEAPNDPNIYSDAEAA
                     ETDQIEVDNDLVGEVMTKKIKTVTKLRDSVPSSKSYDLIILTHQLLKAEEKFPIEVDM
                     NIEWYLKMLAPGGHIILIERGNPMGFEIIARARQVMLRPENFAEEHGKIPRPWTKGIS
                     TEVFNKREVGSSHETPQKDLSTDFFERAPEDEEVSGAKKVQESSQPGEPSGESYFLKV
                     VAPCPHHKKCPLQIGKPQYYDYGEGRDLKFCNFQKSVLRPKYAIELKKGRVLATPWQN
                     NAEAVGIKGMAKPGTGRPHGRNFEILSYSYLIMERSPADDETVQRINMERSQQQDKYG
                     VGSLGDNTPSTWPRIIRQPLKRKGHVVMDMCGASGQLEKWTVPRSFSKEIYHDARKAM
                     KGDLWGLEAKTKTRGMGDLNVGRLEKVEGEKIREAKRQMKRKDREMKQAVDNVDYGDP
                     LSYEETVDTMAAMYGSEFEKSHKKP"
     gene            <584359..>585205
                     /locus_tag="KLTH0G07260g"
                     /db_xref="GeneID:8293623"
     mRNA            join(<584359..584541,584609..>585205)
                     /locus_tag="KLTH0G07260g"
                     /product="KLTH0G07260p"
                     /transcript_id="XM_002555308.1"
                     /db_xref="GeneID:8293623"
     CDS             join(584359..584541,584609..585205)
                     /locus_tag="KLTH0G07260g"
                     /note="similar to uniprot|P36057 Saccharomyces cerevisiae
                     YKL154W SRP102 Signal recognition particle (SRP) receptor
                     beta subunit involved in SRP-dependent protein targeting
                     anchors Srp101p to the ER membrane"
                     /codon_start=1
                     /product="KLTH0G07260p"
                     /protein_id="XP_002555354.1"
                     /db_xref="GeneID:8293623"
                     /db_xref="InterPro:IPR019009"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMA6"
                     /translation="MLELSNSVLVALLVALISSAVLLIVQKNSANVIPGYKVSNRDPT
                     FIIAGPTYSGKTGLFNLLTTDGHKPTVMSQEPNVAEDYMLPSTAKSFRFKLMEFPGHF
                     KLRYRLYDTLKDSTSLKGLIFVVDSTVDPQKLTETAEFLYEILGLTERFPDGVDILIA
                     CNKSESFSSRPPLKIRDALEKEIGKIIERRVKSLASVKKADTTSGVEDEDGAPPQSVE
                     FQSNHEFRFDALDGNVDAMDGSVLKGQIEKWECWIDERAVN"
     gene            585670..585741
                     /locus_tag="KLTH0G07282r"
                     /db_xref="GeneID:8293624"
     tRNA            585670..585741
                     /locus_tag="KLTH0G07282r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=69.00"
                     /db_xref="GeneID:8293624"
     gene            <585983..>591001
                     /locus_tag="KLTH0G07304g"
                     /db_xref="GeneID:8293625"
     mRNA            <585983..>591001
                     /locus_tag="KLTH0G07304g"
                     /product="KLTH0G07304p"
                     /transcript_id="XM_002555309.1"
                     /db_xref="GeneID:8293625"
     CDS             585983..591001
                     /locus_tag="KLTH0G07304g"
                     /note="similar to uniprot|P47054 Saccharomyces cerevisiae
                     YJL039C NUP192 Essential structural subunit of the nuclear
                     pore complex (NPC) localizes to the nuclear periphery of
                     nuclear pores homologous to human p205"
                     /codon_start=1
                     /product="KLTH0G07304p"
                     /protein_id="XP_002555355.1"
                     /db_xref="GeneID:8293625"
                     /db_xref="GOA:C5DMA7"
                     /db_xref="InterPro:IPR021827"
                     /db_xref="UniProtKB/TrEMBL:C5DMA7"
                     /translation="MMEWATAPFEVVYTSIETDTFDTSKYEEVLPDLKTLNVLDGKAK
                     NSASRAQLEKGQIKVPSGDTYQINQEFAIAAITLSDELNLDELLTAEIMLQNCDLDSV
                     SENSVISLVNDAKVAFYVRRQYILQIVSFITNCCSSEDKVYIDLVSDGTLAKNIIPAF
                     KQIESQLGEIKVLVNKSAILESYDTFAQQNVRFRRDFLLKEYDTLSQILYGLVKNGTL
                     MKKDMLLELINCASMMDSGDFFIIYFLPALFLAISQLHLLPDGHVREMHQTLLLELES
                     DTISVQPVKASLIFAFLAFFIGWCKAAPSQRAKSFNFATDVDEPMTKAVELGAIEQLM
                     AFAADTSELDKDESIELFYDIRSLLERHIPRLYLKQLVDGDQPSPDAINNQRLLTNAS
                     MSQQSLSFFLSAFHHLLQVVITDCAFLLTKMKDAEEDSLLSGEDLFLDEISAKADLER
                     FFITVHYFYAFRPDYSAVFWQDKESNAYGFIEWAMKCTDTLMRSCVFMMLSSLSFGPE
                     NSANVYHYVNLNANLSWNTVSQLISDYIVKISELERKLLDGQQRDREEQDPTTIALKT
                     GLNEEVIILLSSLYTLIGCVAHDLNEGAKAQLSSLFTDILFEFVKVDTPLVGAALKVL
                     SNLVPYDELERSKFWFNLDSWIFKGFRLTISDDSYREAFESILTHFQDITGFLQLLNS
                     LLKVRTKSTNGYLEFGLLQFPPKLGHGYRKLGIWPYFDYVFHGILAQSNKLPNPAERA
                     AIHKPILEILSSALSSFDYSVILNSIPSGSNLDELVVTDNFLTYAMESSTTAVLNYLF
                     EENVFKNLLQNASFGVEKMGSITEEDCQSLALPCLALSTINQVLTIQETYVEELCPIV
                     KKSASKNYFIPKDFGLHGLRSFYDAISFDLPLIVGIGLYVGHTNYKIASNSLDILDKI
                     STEMKGRDSQAIVKDKLLSVFDSVDESARIKQAFINQLQTSITNYESFSIKMRILDFI
                     SKNLSYTDKQPTVAHFLLGLQIGNTISLGPDLSTFVTSGCSVLTSIIYLLQSSLMVLS
                     SEEIEFLPAKLASSSMEILLKLCKNSATSKIVLRHMSESDFFETILARDPKVDVNTRW
                     SGEVFAGNSAGDSLGFIKQTSTGAFLSFLSYRSFALQYLSLDIHGLSGESLKSRIKSR
                     IDLLISNYLQPPRLFSFLDALNFDARPSPHETLKGLKVLSGINFNLPSLQKVTPCTEL
                     IYDCSELESLIRLRTQFLGKHLPLNFHEETITNKETLDRISGAEAATIEKHLTDYMSF
                     EQFKSLQLSLLHSWVQLVQVVVLDGALPQVSISDFILRLFEAIVPKINDYVELDVCYS
                     EELVSLCVFLYDLYQKDQKLNNGEHTADGRLIALFLACINGIRSPLSTLALRSDFYIL
                     ANRFLVSIMKEVNTAKQVLKTLKLTSERLVEVVCNDAISGEGSSRITGILFLDSLVQI
                     AGLNKVNFVLESLVKSNMLLLISHSIKTTDDLLSSGLEGITLDNLLYELTAFKSTIHF
                     LIRIAESRSGAQALVENEIFRVIESCEFLEADPDLGLELIFTEVRTQESQAVRVTFSL
                     DKSLNLSKDACGLSLFEIIVPVFQLMTSILISMGSANKPVLKKTRNLLIHFRKLVQGV
                     LKRDALIEGSDEKHLDRSNSEGLQKLVKLVVLLCTLTGYNGGSQKNGLDPKIYTLPQS
                     YGNK"
     gene            complement(<591049..>593816)
                     /locus_tag="KLTH0G07326g"
                     /db_xref="GeneID:8293626"
     mRNA            complement(join(<591049..593741,>593816))
                     /locus_tag="KLTH0G07326g"
                     /product="KLTH0G07326p"
                     /transcript_id="XM_002555310.1"
                     /db_xref="GeneID:8293626"
     CDS             complement(join(591049..593741,593816))
                     /locus_tag="KLTH0G07326g"
                     /note="similar to uniprot|P14907 Saccharomyces cerevisiae
                     YJL041W NSP1 Essential component of the nuclear pore
                     complex which mediates nuclear import and export"
                     /codon_start=1
                     /product="KLTH0G07326p"
                     /protein_id="XP_002555356.1"
                     /db_xref="GeneID:8293626"
                     /db_xref="GOA:C5DMA8"
                     /db_xref="InterPro:IPR007758"
                     /db_xref="InterPro:IPR026010"
                     /db_xref="UniProtKB/TrEMBL:C5DMA8"
                     /translation="MSFQFNLNSNSSANFGGNSPFGSASAPTKDQNSQSSGFSGFSSN
                     PSTNAQQTSGNTPGFGASQGQQGSLFGKPLGGTTPAFGSSSAPKPFGSLGGSSPFGAQ
                     PATTTPANENDKKESQSTGFNLGGNTASANNAKPTAPFSFGTTPAATGKDDKPLFGGA
                     SSASPFQFGAASNQGTSAPAQSSTNKPTLNFGSSSNSKPAFSFGAASASDAKSGLGDT
                     TKTLESAAQTSSAGSKSPFTFGASTAKSTETNASSGPGTSTVEKKDDAKPAFSFGGTS
                     GTNTAAPKSSPSLNFGGSAANKKEESKPAFSFGTAASEKKEEPMPAFSFGGTSSTTKE
                     DSKPAFSFGGAPSDKKEDSKPAFSFGEAANNKKEDPKPAFSFGATASDKKENPKPALS
                     FGGATADKTEASKPELSLGGTTTNKNEVSKPAFSLGTASSDIKEDPKPAFSFGTANND
                     KKEEAKPAFKLGGLGEKKDEPKSTFAFGAPGEKSADKPVSSKPETNDGNASSKPSLGF
                     LAGSENKSGGKPAFSFGKSAESTNASDKRVGFGNSSEQGNKLGAGTSEASKGSFNFGG
                     LGAQQQKSDANKGGSLSFGAKDPKQDKENKSFGFSNSSGTGSDSKPSATGFSFGQNKE
                     SATSSKPSGFSFGAKDKDKEEKDAPKTTLSFRKDTDGSSTSKPSNFGFGSKKEAEKKD
                     GTQREAAPSSTGTEAQKPIEIQPVSLDNKTLDDLVTKWTSQLGGSVDHFATYADKVKE
                     WDQVLMLGGEQIGQLYSDALVAEQTQNRVDQSLQYIERQQSELETFLDNYEKKAEGLL
                     SGVLSNSNGSTGNINDQKRQQAYQTAEILDDNLNSLSMNLSALISEINQVSDTFNKAT
                     NMSVTNEDENTQLIKLLNSHLDALKSLDNSSDLLEQKLTKL"
     gene            complement(<594100..>598065)
                     /locus_tag="KLTH0G07348g"
                     /db_xref="GeneID:8293627"
     mRNA            complement(<594100..>598065)
                     /locus_tag="KLTH0G07348g"
                     /product="KLTH0G07348p"
                     /transcript_id="XM_002555311.1"
                     /db_xref="GeneID:8293627"
     CDS             complement(594100..598065)
                     /locus_tag="KLTH0G07348g"
                     /note="similar to uniprot|P43638 Saccharomyces cerevisiae
                     YJL042W MHP1 Microtubule-associated protein involved in
                     assembly and stabilization of microtubules; overproduction
                     results in cell cycle arrest at G2 phase"
                     /codon_start=1
                     /product="KLTH0G07348p"
                     /protein_id="XP_002555357.1"
                     /db_xref="GeneID:8293627"
                     /db_xref="UniProtKB/TrEMBL:C5DMA9"
                     /translation="MSGTLDSPDTLDIEKPVKKRFSDSLHVDWLSRNSYVNGTPEAQV
                     EEFKKTGDMGKQAPKAKDPVPEGNSNSRRRSDADDTLESRVLGPNRILRERRRSVSSQ
                     NEFGVAPSYSALNPYDTGTTIRRTKSLSMNSNGHIEEPKREKGGFFRSLFGRRKKDDS
                     KSTNTNTKPALRRSSFSAPIKEVEPPNPPRSAPANIGEDSVSVTRDGANMPPVRRSKT
                     APISTENVEVRLDEFLQHCREHPLDSDTKKSSSSRATRTSKPEIPRHKATFSIDDNLS
                     PTEPSSETQTHFDAKGRPIPPHPSKSDLLPALKRSERTQHHKGKLKRTNTNTSSTTNK
                     FGAFLKRVTSHTEEHSHSSKQSLTDSESDSSDEDLPQISEDQRPAFIPGLEDIKPLKK
                     VSFATNTYFNDPPQQICSKNPRKGEVEVKSDGSVIIHRLTPEEKREILQKTSSGIVVG
                     GSGHLKLLSDPSVSEEEAKRNEEKKPSVPKEDGSQVLNNEEDVGRGGQGGDSVAHENN
                     QDTEEDVKVSKSASEVTIDKPMVSRRSMSSLGSSITVNEVEQETPFPPTNMKIPHDIV
                     YTRCCHLREILPIPATLKQLKKGSTDPIPLLQMRNPKPSLIEVLSFSDFLSISPVLCL
                     SLDGVNLSIKMLKTILCSLMHKKEFEKLTLRNTPLDHEGWRILCYFVSQCESLNSLDL
                     TMVPGIAINVQKPSKSSLKSRDIRMTCDMNDRKNMNWNLLAASLVSGNGLEEIIASGA
                     KMPLKEFKNFIELGCAHTQRLGLAYNELSLDQCCVLAEWLAQSKVTGIDIGFNDLRGK
                     LGPFSATVINKMRQTKNIFKYISLNCTNLEVSENSSSENSDVLKLISVLAYCEDLKLL
                     DISNNPKLFPHVTNHLTNYLPVFVNLIRLHMDNNSIPSTSIVEIAEVLPTCQKLTHVS
                     IRGSKLDYASGCALVAAMRKSSSLLTLDLDCDNLPNKIRDKISLYSMKNMEAALNKVD
                     KSTSPEMSDTLACLQKELSDLLTEKPVKQEEIQVAAQSFLHRLSRARSFINKVTEDLF
                     KLRVEGNLSTEGKDTLIRFCFIDATFERGLKLLAQRYSNLSFSSGSLCANSKTGTDAG
                     PEMRASGLPLKKETSSATLSSKHFSDSGHAALLPFHYPPIESSDPADDEVEIKWDSPD
                     TEDQHARDQLREEGRILRGTRGIMGRVQSASNQGTSDDRECHITLDQKALRKAASELD
                     SEQIKEFILSNDISSVAGVLEDLKSRGISLNDIFKKRHDRSDSNNQASVDCEKSSNSD
                     NAVVGVQANLEEEKQRLANSGPALDSESSSEDEREGEAIDRVYDEVLDNIQRVRTNTE
                     S"
     gene            <598519..>599649
                     /locus_tag="KLTH0G07370g"
                     /db_xref="GeneID:8293628"
     mRNA            <598519..>599649
                     /locus_tag="KLTH0G07370g"
                     /product="KLTH0G07370p"
                     /transcript_id="XM_002555312.1"
                     /db_xref="GeneID:8293628"
     CDS             598519..599649
                     /locus_tag="KLTH0G07370g"
                     /note="weakly similar to uniprot|P32806 Saccharomyces
                     cerevisiae YJL044C GYP6 GTPase-activating protein (GAP)
                     for the yeast Rab family member Ypt6p involved in vesicle
                     mediated protein transport"
                     /codon_start=1
                     /product="KLTH0G07370p"
                     /protein_id="XP_002555358.1"
                     /db_xref="GeneID:8293628"
                     /db_xref="GOA:C5DMB0"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5DMB0"
                     /translation="MERSGKIEHLVQRYGTREELIKRGVWRGELYRAEEATFLDRGWC
                     WKTLLLDREDELLVTELVPVPTNFEDTGCNYAEAGRLGVRKLTTELVQDHPLMEEDDR
                     LKESISVEETLDIVRLDISRLLLDPVFSDPECKAEMVQILYNYVAHNHTSYKQGYHEL
                     CGAVYLQMLEEEGETRKLNTLNIFNKLMAQVRPVFYEETALLQFSKQKFDAVFKLTAP
                     MLRHLLTAHHGLDHAVWLIRWTRLLFLREFDTAYVLRIWDHLLTFTVPVQDLVACCTV
                     VLLIAVTQDLYACEDQGEVISILLHYPQDKLINCVDLMKHSASLYELYVTRQYSDMRG
                     LGENLCKVYNRSWYEKQTQVADHNRLRLEERLKRRVEQRLRK"
     gene            complement(<599733..>600476)
                     /locus_tag="KLTH0G07392g"
                     /db_xref="GeneID:8293629"
     mRNA            complement(<599733..>600476)
                     /locus_tag="KLTH0G07392g"
                     /product="KLTH0G07392p"
                     /transcript_id="XM_002555313.1"
                     /db_xref="GeneID:8293629"
     CDS             complement(599733..600476)
                     /locus_tag="KLTH0G07392g"
                     /note="highly similar to uniprot|P00950 Saccharomyces
                     cerevisiae YKL152C GPM1 Tetrameric phosphoglycerate mutase
                     of the glycolytic pathway converts 3-phosphoglycerate to
                     2-phosphoglycerate"
                     /codon_start=1
                     /product="KLTH0G07392p"
                     /protein_id="XP_002555359.1"
                     /db_xref="GeneID:8293629"
                     /db_xref="GOA:C5DMB1"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DMB1"
                     /translation="MPKLVLVRHGQSEWNEKNLFTGWVDVRLSAIGEKEAARAGELLK
                     EKNVKPDILFTSKLSRAIQTANIALSAADRLWIPTVRSWRLNERHYGALQGKDKAATL
                     AEYGEEQFTTWRRSFDVPPPTIADSSEYSQTNDERYKDVDPSAVPKTESLALVIDRLL
                     PYWQDTISKELLEGKTVMIAAHGNSLRALVKHLEGISDTDIAKLNIPTGIPLVFELDE
                     KLKPTKPSYYLDPEAAAAGAAAVANQGKK"
     gene            complement(<601376..>602332)
                     /locus_tag="KLTH0G07414g"
                     /db_xref="GeneID:8293630"
     mRNA            complement(<601376..>602332)
                     /locus_tag="KLTH0G07414g"
                     /product="KLTH0G07414p"
                     /transcript_id="XM_002555314.1"
                     /db_xref="GeneID:8293630"
     CDS             complement(601376..602332)
                     /locus_tag="KLTH0G07414g"
                     /note="similar to uniprot|P36059 Saccharomyces cerevisiae
                     YKL151C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G07414p"
                     /protein_id="XP_002555360.1"
                     /db_xref="GeneID:8293630"
                     /db_xref="GOA:C5DMB2"
                     /db_xref="InterPro:IPR000631"
                     /db_xref="InterPro:IPR017953"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DMB2"
                     /translation="MLSRMSHKEILQLAKTAVIPPLKPEFHKGQCGRVCVIGGCEDYT
                     GAPYFSAHSAALFGADLTHVMCELNAAPVIKSYSPNLMVHPYLRETGVGETPFDKIQG
                     LLDRMHVCVVGPGLGRDQQMLESVVKILEYLATKHKGETPVVLDADGLFLVSDETYSR
                     KVCDLLRSFKPGRVVLTPNVVEFKRIIERLGVKSGEDVARELQCVVVQKGGDDQIWYD
                     EGVVKCSSPGSNKRVGGQGDTLTGVIATMLAFSRATHDFKIWEPSKKIEWMQMVVASC
                     YVGSAITRECSHMAFERHGRAMQTTDVNDRVGDAYDALLGVK"
     gene            <603006..>603884
                     /locus_tag="KLTH0G07436g"
                     /db_xref="GeneID:8293631"
     mRNA            <603006..>603884
                     /locus_tag="KLTH0G07436g"
                     /product="KLTH0G07436p"
                     /transcript_id="XM_002555315.1"
                     /db_xref="GeneID:8293631"
     CDS             603006..603884
                     /locus_tag="KLTH0G07436g"
                     /note="highly similar to uniprot|P36060 Saccharomyces
                     cerevisiae YKL150W MCR1 Mitochondrial NADH-cytochrome b5
                     reductase involved in ergosterol biosynthesis"
                     /codon_start=1
                     /product="KLTH0G07436p"
                     /protein_id="XP_002555361.1"
                     /db_xref="GeneID:8293631"
                     /db_xref="GOA:C5DMB3"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C5DMB3"
                     /translation="MFSRVLRSRSAIPLAVGSVTIAAAFYHSTLIRNEPLKTFTGDDS
                     WVELPIAKIEEVSHDTRRFIFSLPQEEQVSGLVVASALLAKLQTPKGSNVIRPYTPVS
                     DVSTKGHIEFVIKHYNGGKMTEMLFDKKPSDTVAFKGPIPKWEWKPNSFDSITLLGAG
                     SGITPLYQLVHHISQDPKDKTKVHLLYGNKTPNDILLKRELDAIQAKYPDQVKIHYFV
                     DKAEGSFDGHTGFITKEYLEKNVPKASEKNQVFVCGPPPFMKAYSGPKASPKDQGELT
                     GILKDLGFTKESVFKF"
     gene            complement(<603959..>605119)
                     /locus_tag="KLTH0G07458g"
                     /db_xref="GeneID:8293632"
     mRNA            complement(<603959..>605119)
                     /locus_tag="KLTH0G07458g"
                     /product="KLTH0G07458p"
                     /transcript_id="XM_002555316.1"
                     /db_xref="GeneID:8293632"
     CDS             complement(603959..605119)
                     /locus_tag="KLTH0G07458g"
                     /note="similar to uniprot|P24309 Saccharomyces cerevisiae
                     YKL149C DBR1 RNA lariat debranching enzyme involved in
                     intron turnover required for efficient Ty1 transposition"
                     /codon_start=1
                     /product="KLTH0G07458p"
                     /protein_id="XP_002555362.1"
                     /db_xref="GeneID:8293632"
                     /db_xref="GOA:C5DMB4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007708"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DMB4"
                     /translation="MNVAIGVLSKKKECNYRAVMTHLRIAVQGCAHGELVNIYNHVAR
                     QYASEMPDILIVLGDFQSLRDEDDMDSIAVPDKYKKLGDFPKYFTGELEAPLLTIFIG
                     GNHENMRGLAELPRGGFVAKNIYYMGYSGSIVVQGVRISGLSGIYKSHDFERPRASLS
                     QIKAEGWGRHVRNMYHVRKTDVLPLFMLTQTDIMLSHDWPNGIAHHGDLKKLLKQKPF
                     FKRDIFNNDLGSPVNWQLLRKLTPCWWLSAHLHVKFEAQVALNKRARNESTENTDSNE
                     IDLGLDDDEDDGDDDANIETSEKTNFLALDKCGRNRKHMEIITVEADTSHPTFHPEAV
                     QIYVDPEFVANQQFLEKNPPKSRLEHISFESLRERRGELGEIDWESYRLNYA"
     gene            complement(<605253..>607166)
                     /locus_tag="KLTH0G07480g"
                     /db_xref="GeneID:8293633"
     mRNA            complement(<605253..>607166)
                     /locus_tag="KLTH0G07480g"
                     /product="KLTH0G07480p"
                     /transcript_id="XM_002555317.1"
                     /db_xref="GeneID:8293633"
     CDS             complement(605253..607166)
                     /locus_tag="KLTH0G07480g"
                     /note="highly similar to uniprot|Q00711 Saccharomyces
                     cerevisiae YKL148C SDH1 Flavoprotein subunit of succinate
                     dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which couples the
                     oxidation of succinate to the transfer of electrons to
                     ubiquinone"
                     /codon_start=1
                     /product="KLTH0G07480p"
                     /protein_id="XP_002555363.1"
                     /db_xref="GeneID:8293633"
                     /db_xref="GOA:C5DMB5"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR011281"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="InterPro:IPR015939"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:C5DMB5"
                     /translation="MLSVRQMKLSTSRRLFSRTSRALRAFAANGDVDGQNSAPFGGQY
                     QVVDHEYDCLVVGAGGAGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGN
                     MHKDNWKWHMYDTVKGSDWLGDQDSIHYMTREAADSIIELEHFGVPFSRTEEGRIYQR
                     AFGGQTKENGKGGQAYRTCAVADRTGHALLHTLYGQALRHNTHFFIEYFALDLLVHNG
                     EVVGVIAYNQEDGTIHRFRAHKTVIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPL
                     QDLEFVQFHPSGIYGSGCLITEGARGEGGFLVNSEGERFMERYAPTAKDLACRDVVSR
                     AITMEIREGRGVGPEKDHMYLQLNHLPASVLKERLPGISETAAIFAGVDVTKEPIPIL
                     PTVHYNMGGIPTKWTGEALTVDEEGNDQVIPGLMACGEAACVSVHGANRLGANSLLDL
                     VVFGRAVAHTVADTLQPGLPHKPLPSDLGKESIANLDKLRNATGSKPTSQIRLAMQKA
                     MQADVSVFRTQESLDEGVRNVGAIDESFEDVGTTDRSMIWNSDMVETLELQNLLSNAR
                     QTAVSAANRKESRGAHAREDYPERDDKEWMKHTLSWQKHPQGNVELGYRSVIATTLDE
                     SECPPVLPTVRAY"
     gene            <608628..>610433
                     /locus_tag="KLTH0G07502g"
                     /db_xref="GeneID:8293634"
     mRNA            <608628..>610433
                     /locus_tag="KLTH0G07502g"
                     /product="KLTH0G07502p"
                     /transcript_id="XM_002555318.1"
                     /db_xref="GeneID:8293634"
     CDS             608628..610433
                     /locus_tag="KLTH0G07502g"
                     /note="similar to uniprot|P36062 Saccharomyces cerevisiae
                     YKL146W AVT3 Vacuolar transporter exports large neutral
                     amino acids from the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="KLTH0G07502p"
                     /protein_id="XP_002555364.1"
                     /db_xref="GeneID:8293634"
                     /db_xref="GOA:C5DMB6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DMB6"
                     /translation="MPVNLRNSPQNSAPDLARSQSSRRPSAVAPKMSVSSSSDQHTLD
                     IVSRNLVNPPDNPAAASFNPLQLQGGDITRELYRWQDHNQEPGSEFPAGRLEAPRHRR
                     SISFSGSITSHGSLQQPEMSAEQIRAPQGFRRSFLVNKSLQENNGVPNFMARNFFEFL
                     TLYGHFAGQDLSEDEDEGEDQDGAIEDEETALVGRRARHRISHRQPHKSSTFKAVLLL
                     LKSFVGTGVLFLPRAFHNGGWAFSTTCLLACGVISYYCFVLLINTKLKKNVNGYGDLG
                     AAVYGRNMELAILGSIVLSQIGFVAAYAVFTATNLQVFFSSVFHWEASMVFWLAVQLL
                     LYLPLSLTRNIAKLSGTALLADLFIMFGLLYVYYYCSRYVAHNGVASDSMLVFNKNDW
                     TLFIGTAIFTYEGIGLLIPIQESMKHPEKFNKCLLGVMVSVSIAFILCGLLCYSAFGS
                     SVETVILLNFPRKSAMTASVQLLYALAIMLSTPLQLFPIIRILETSIFPKNASGKYNP
                     RVKWMKNYFRIGIVLANTLIAWLGANDLDKFVSIVGSFACIPLIYIYPPMLHYKAFSN
                     GGGSKLSLGCDVAIASFGVAVMTYTTYQAVRLWFI"
     gene            <610689..>612260
                     /locus_tag="KLTH0G07524g"
                     /db_xref="GeneID:8293635"
     mRNA            join(<610689..610802,611037..>612260)
                     /locus_tag="KLTH0G07524g"
                     /product="KLTH0G07524p"
                     /transcript_id="XM_002555319.1"
                     /db_xref="GeneID:8293635"
     CDS             join(610689..610802,611037..612260)
                     /locus_tag="KLTH0G07524g"
                     /note="highly similar to uniprot|P33299 Saccharomyces
                     cerevisiae YKL145W RPT1 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates required for
                     optimal CDC20 transcription interacts with Rpn12p and the
                     E3 ubiquitin-protein ligase Ubr1p"
                     /codon_start=1
                     /product="KLTH0G07524p"
                     /protein_id="XP_002555365.1"
                     /db_xref="GeneID:8293635"
                     /db_xref="GOA:C5DMB7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMB7"
                     /translation="MPPKEDWEKFKAPAEEEKQEEKPNVPLTEGDIQVLKTYGAAPYA
                     DKLKETEKDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTK
                     IIKPEASDESPADEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH
                     IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGI
                     DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
                     RTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN
                     RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS
                     TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN"
     gene            complement(<612418..>613044)
                     /locus_tag="KLTH0G07546g"
                     /db_xref="GeneID:8293636"
     mRNA            complement(<612418..>613044)
                     /locus_tag="KLTH0G07546g"
                     /product="KLTH0G07546p"
                     /transcript_id="XM_002555320.1"
                     /db_xref="GeneID:8293636"
     CDS             complement(612418..613044)
                     /locus_tag="KLTH0G07546g"
                     /note="highly similar to uniprot|P35718 Saccharomyces
                     cerevisiae YKL144C RPC25 RNA polymerase III subunit C25"
                     /codon_start=1
                     /product="KLTH0G07546p"
                     /protein_id="XP_002555366.1"
                     /db_xref="GeneID:8293636"
                     /db_xref="GOA:C5DMB8"
                     /db_xref="InterPro:IPR004519"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="UniProtKB/TrEMBL:C5DMB8"
                     /translation="MFILSKISDLVRVPPDQFHRHTKAAIFHQLNNKYANKVIPHLGL
                     CITIYDLLEVREGQLKPGDGAAYINTTFRALVFKPFVGEIITGWISQCTAEGIKVSLL
                     GVFDDIFIPQKMLFEGCYFSPDDNAWVWPMDEETKLYFDVNEKIRFRVEQEVFVDVKP
                     KSPKEREAEEQMEQNEDSEEKPKIEKPPAYALLGSCQTDGMGLVGWWE"
     gene            <613460..>614911
                     /locus_tag="KLTH0G07568g"
                     /db_xref="GeneID:8293637"
     mRNA            <613460..>614911
                     /locus_tag="KLTH0G07568g"
                     /product="KLTH0G07568p"
                     /transcript_id="XM_002555321.1"
                     /db_xref="GeneID:8293637"
     CDS             613460..614911
                     /locus_tag="KLTH0G07568g"
                     /note="similar to uniprot|P34078 Saccharomyces cerevisiae
                     YKL143W LTV1 Protein required for growth at low
                     temperature"
                     /codon_start=1
                     /product="KLTH0G07568p"
                     /protein_id="XP_002555367.1"
                     /db_xref="GeneID:8293637"
                     /db_xref="InterPro:IPR007307"
                     /db_xref="UniProtKB/TrEMBL:C5DMB9"
                     /translation="MSSKGAFNRNNAQKFAVVHRPHDDPHFHDPEVGGHVLVPVNDPK
                     ANRAQVKAKSPLTRNVVGQSARQSRKPTNDHVGEAALYGIGFDDSNYDYTKHLKPIGT
                     DPENSFLINASKPAEKPQTAKKLNVEDLFVEPEYKESSKKNESMFQRGVAKREYLIQQ
                     QDIEEDLRGFKPDLNPALREVLEALEDEAYVVNKDIVVEKPKKKKTAAEETESIFGAE
                     ETGDEDIFAELLMSGQAGDADEFEQEFDEWDMENLEDYEDEHYNNELQQFQNIENLED
                     LQNIDYQADVARFKQHKSRAGPEDGWDSVDEFEDDGASLSAASIEEEEQDQLGDLPDL
                     SASKNKNAKQKKRKDRRKKGAMSDVSGFSMSSSAIARTEVLTVLDDKYDRIISGYENY
                     EQEQEEEEEQSYQPFDMANERADFESMLDDFLDNYELESGGRKLVKKSKEIDRLKNAA
                     DEVSKGKLSQRRLKERSKGGVDGITGSLSSLKF"
     gene            <615156..>615812
                     /locus_tag="KLTH0G07590g"
                     /db_xref="GeneID:8293638"
     mRNA            <615156..>615812
                     /locus_tag="KLTH0G07590g"
                     /product="KLTH0G07590p"
                     /transcript_id="XM_002555322.1"
                     /db_xref="GeneID:8293638"
     CDS             615156..615812
                     /locus_tag="KLTH0G07590g"
                     /note="similar to uniprot|P35719 Saccharomyces cerevisiae
                     YKL142W"
                     /codon_start=1
                     /product="KLTH0G07590p"
                     /protein_id="XP_002555368.1"
                     /db_xref="GeneID:8293638"
                     /db_xref="InterPro:IPR012917"
                     /db_xref="UniProtKB/TrEMBL:C5DMC0"
                     /translation="MSDEVAKLKSQVEELQQLVKKQNLLISKTGQSVLELQLAKQKTD
                     VEEFDSKFAGAKSGKHAASHGDNTDYATNEDLVQLVGELQGQLDSIEERSIRRLVNST
                     KSEKRDYLAPLPNADGEIPSATDSIFPESLEDFENITNVKLFKLAKYYELLPPSLKEQ
                     EKFEDYLEGKLDNFHINDMTDEDVEKELKNFSEDQLVEAFNDVARYLGVKSRRGTDIW
                     "
     gene            complement(<615951..>617963)
                     /locus_tag="KLTH0G07612g"
                     /db_xref="GeneID:8293639"
     mRNA            complement(<615951..>617963)
                     /locus_tag="KLTH0G07612g"
                     /product="KLTH0G07612p"
                     /transcript_id="XM_002555323.1"
                     /db_xref="GeneID:8293639"
     CDS             complement(615951..617963)
                     /locus_tag="KLTH0G07612g"
                     /note="similar to uniprot|P47077 Saccharomyces cerevisiae
                     YJL010C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0G07612p"
                     /protein_id="XP_002555369.1"
                     /db_xref="GeneID:8293639"
                     /db_xref="GOA:C5DMC1"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /translation="MGKPRGRKLLKKHHTEGEEASHVEPQPYDTNDTIPEKISSGSNG
                     EPNTFFGVLDTQELEYFKQAESTLAVDTFENAEEKEQFISSVIEETKNKELKLATSQI
                     CSKLMERIILAGSNQQLKAIFRSFNGFFYGLACQKYSSHVLETLFVRGAAMVEKELLT
                     PSFDEPGATEDGDDVYSPMEDLFLYMLNEITPSVRGMISHKYASHVFRLLILILSSKT
                     LPSTTMSNSALRSKRSKIARKMIDLKDNEDFDKTYKTPDSFKVKLREILSSLYKELTG
                     GVDLGSSNFKNISVTSMMKVRELCIDPVASPVLQLIIQVEGIFDRDRSFWHLIFSSSE
                     EKNAKEEAFVEYLLSDPVGSHFLENVISFTRAKYTERLYKMYMRDRILKLSKRDLTGA
                     FVVQALLKHLRQNDVKSILNDIVPELSLIVNSNMEFCISILDASIQHGDYLKEEIVLQ
                     LIKKFYPEGLEDRNILESCLSLNSSTLGNTRDDWPTAEERRRSLFLEKLIDYDDRFLN
                     ITIESLLALPEERLLQMCYHGVFSHVVEHVLQVKRVDKIKRKRLLNVFCTDIVNLSCN
                     AYGSHLVDKLWDFTAQLPMYKERIATSMAGDSEKVKNSVYGRQAWKNWSMDKFLRKQF
                     DWKRLIREQQQELFPDATPLQPGGDAGTKRKGDKPSYNRPEKKFRR"
     gene            complement(<618184..>619878)
                     /locus_tag="KLTH0G07634g"
                     /db_xref="GeneID:8293640"
     mRNA            complement(<618184..>619878)
                     /locus_tag="KLTH0G07634g"
                     /product="KLTH0G07634p"
                     /transcript_id="XM_002555324.1"
                     /db_xref="GeneID:8293640"
     CDS             complement(618184..619878)
                     /locus_tag="KLTH0G07634g"
                     /note="highly similar to uniprot|P47079 Saccharomyces
                     cerevisiae YJL008C CCT8 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="KLTH0G07634p"
                     /protein_id="XP_002555370.1"
                     /db_xref="GeneID:8293640"
                     /db_xref="GOA:C5DMC2"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DMC2"
                     /translation="MSLKLPQNPNAGLFKQGYNSYLNADGQINKSISAIREIHQMCLT
                     SMGPCGRNKIIVNHLGKIIITNDAATMLRELDIVHPAVKVLVMATEQQKIDMGDGTNL
                     VLILAGELLNVSEKLIGLGLSPVEIIQGYNMAKNFTLKELDNLCVQEVTDKHSKQELV
                     KIMKPVISSKQYGSEDILSDLVAEAVSHVLPSKSNSFNVDSIRVVKIMGGSLANSEVV
                     KGMVFNREPEGHVKSLPPGQKHKVAVFTCPIDISTTETKGTVLLHNAQEMLDFTKGEE
                     KQLNEMIKEIADAGVNCVVAGNGVNDLALHYLNRYNILVLKVPSKFELRRICRVCGAT
                     PMPRLGAPTPEEMGVVETVKTIEIGGDRVTVFKQEDDEVTRTATIILRGATQNNLEDI
                     ERAIDDGVSAIKGLMKPDGGKLLPGAGATEIELVSKITQFGERTPGLLQLAIKQFAVA
                     FEVVPRTLAETAGLNVNEVLPNLYAAHTSAAADGESAGDNVYYGVDIDGDNQEGVKDV
                     REENIFDLLAVKKFAVNVATEAATTILSIDQIIMAKRAGGPQVPKGPKPGNWDQDD"
     gene            620210..620282
                     /locus_tag="KLTH0G07656r"
                     /db_xref="GeneID:8293641"
     tRNA            620210..620282
                     /locus_tag="KLTH0G07656r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=73.99"
                     /db_xref="GeneID:8293641"
     gene            <620405..>622822
                     /locus_tag="KLTH0G07678g"
                     /db_xref="GeneID:8293642"
     mRNA            <620405..>622822
                     /locus_tag="KLTH0G07678g"
                     /product="KLTH0G07678p"
                     /transcript_id="XM_002555325.1"
                     /db_xref="GeneID:8293642"
     CDS             620405..622822
                     /locus_tag="KLTH0G07678g"
                     /note="similar to uniprot|P47061 Saccharomyces cerevisiae
                     YJL029C VPS53 Required for Vacuolar Protein Sorting Vps53p
                     is a hydrophilic protein that is peripherally associated
                     with the late Golgi and forms a stable complex with Vps52p
                     and Vps54p."
                     /codon_start=1
                     /product="KLTH0G07678p"
                     /protein_id="XP_002555371.1"
                     /db_xref="GeneID:8293642"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:C5DMC3"
                     /translation="MAIDLPTYDAVTALKTILSSEESLQSIDDLILATRAAKLQIEDE
                     ITVGSTTSQPELEDPKERESFGSLFEEISEVAVLSKGTERTISQLTKDISYLDNAKRN
                     LTQSTNLFQNLKLLSDSYFQCQHFLSLRDFKAMRAPFAVMSGLVSSFHQYKSVDEIGK
                     LVARISRLQAETHAQIKKAFEGLLDQKSSQGDISDETVLREGACELLESSPGAKSELI
                     DWCVRKMLYDIREIFQLDDEAGSLENLPRRYAYFKKVLNNFNAEFSRFFPKSWNLSLE
                     LTKGFYDTTASDLKVLLERELRDHPSIDLFMSSLQTTLEFEKYIDVKFSNRLHNEKGT
                     EKISRCFEPYLTLWISHQEALMNSKILGYMAEDKLSQSSESLVLPSSADLFRTYRFLL
                     TQTLELVDSGSGRDTILFELAKFFNTWLKTYYGKVLQPLLLPPGSKIENKEEATIYTL
                     LVLNTADYCSTTTRQLVEKLSEYLTVENDISQLFDKVLSHYGALISSGMEIILNSIVA
                     PDLNFIWREFDNTDWKSVEVEDYSRYMVTMKDILRDDQSTIRKIVGRFNREVYSWNFM
                     DKLIELLFSGFLNCILRLLEPIPPFATLNKPRKLQLAQVINVGEQLQLDAEHMRQTLN
                     FWTDDMASLINGSNASYKRLKKHIDQKCENLVKFLKLLVVPIDPPETYQENYAAITGN
                     NKNILSWCYILTLKGFPWDLAEWKKLFAAFQNASGDFNASPLPVFEGCQRALLQFEQN
                     MSSATDPTWRRFIHQELGMDTPNSVQSSSASSASPSSPTQRLNAGKFNGNIKNLMSNT
                     GFFGRGN"
     gene            complement(<622904..>623503)
                     /locus_tag="KLTH0G07700g"
                     /db_xref="GeneID:8293643"
     mRNA            complement(<622904..>623503)
                     /locus_tag="KLTH0G07700g"
                     /product="KLTH0G07700p"
                     /transcript_id="XM_002555326.1"
                     /db_xref="GeneID:8293643"
     CDS             complement(622904..623503)
                     /locus_tag="KLTH0G07700g"
                     /note="highly similar to uniprot|P40958 Saccharomyces
                     cerevisiae YJL030W MAD2 Component of the spindle-assembly
                     checkpoint complex which delays the onset of anaphase in
                     cells with defects in mitotic spindle assembly forms a
                     complex with Mad1p"
                     /codon_start=1
                     /product="KLTH0G07700p"
                     /protein_id="XP_002555372.1"
                     /db_xref="GeneID:8293643"
                     /db_xref="GOA:C5DMC4"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR027097"
                     /db_xref="UniProtKB/TrEMBL:C5DMC4"
                     /translation="MASSLSLKGSTRIVTEFFEYSINSILYQRAVYPPEDFVTVRKYD
                     LNLLKTHDDELKSYIRQILLQVHRWLLGGKCNKLVLCIVDKSTCDIVERWEFDVQHNG
                     QESYTEQTKEVENAETQKQIRALMRQITASVTFLPELEENDNYTFNVLAYTDANAKVP
                     LEWADSDSMDIPDGERVEFRSFSTNNHKIRTQVSYKMNI"
     gene            complement(<624767..>625741)
                     /locus_tag="KLTH0G07744g"
                     /db_xref="GeneID:8293644"
     mRNA            complement(<624767..>625741)
                     /locus_tag="KLTH0G07744g"
                     /product="KLTH0G07744p"
                     /transcript_id="XM_002555327.1"
                     /db_xref="GeneID:8293644"
     CDS             complement(624767..625741)
                     /locus_tag="KLTH0G07744g"
                     /note="similar to uniprot|P46962 Saccharomyces cerevisiae
                     YJL006C"
                     /codon_start=1
                     /product="KLTH0G07744p"
                     /protein_id="XP_002555373.1"
                     /db_xref="GeneID:8293644"
                     /db_xref="GOA:C5DMC5"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:C5DMC5"
                     /translation="MSGTFQTQIMLSRPYLTREQIKRAQQNTISDRRVYNQKRISVFK
                     YLCDMCVQFKFPRRTLETAMYFYQRFYLFNKFETELCYDVATSCLFLSCKQVETMKKV
                     ADLATVSLRLRSIVKVSPELLDNCKKRIFQMELRILETCCFDYRVNNSVHIDDLLVKI
                     GKDLKLSHEVCYLAWLIAFDALKLEILLMVPQHTIAIAVLKIACELTEGVSWPNVRYS
                     LFESDELSVGEAYFDIINFFINVFDLSDLRAHVPNNLRNVGIETFIELKKQAGLEKGL
                     KEPENVSSDPYVVKERDFTIQERRYVLYGKRISDENKPIKQETKKEKV"
     gene            complement(<626094..>628388)
                     /locus_tag="KLTH0G07766g"
                     /db_xref="GeneID:8293645"
     mRNA            complement(<626094..>628388)
                     /locus_tag="KLTH0G07766g"
                     /product="KLTH0G07766p"
                     /transcript_id="XM_002555328.1"
                     /db_xref="GeneID:8293645"
     CDS             complement(626094..628388)
                     /locus_tag="KLTH0G07766g"
                     /note="highly similar to uniprot|P20448 Saccharomyces
                     cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
                     helicase high-copy number suppression of a U14 snoRNA
                     processing mutant suggests an involvement in 18S rRNA
                     synthesis"
                     /codon_start=1
                     /product="KLTH0G07766p"
                     /protein_id="XP_002555374.1"
                     /db_xref="GeneID:8293645"
                     /db_xref="GOA:C5DMC6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMC6"
                     /translation="MAKKGKTSTAARKQLRQKEDAYIKELETKIEEFDPKTSRGELFK
                     DLPLSHQTLKGLRDSAFIKMTEIQKMSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEK
                     LYREKWTEFDGLGALIISPTRELAMQTYEVLTKIGRYTSFSAGLVIGGKEVKFELDRI
                     SKINILVGTPGRILQHMDQAVGLNTSNLQVLVLDEADRCLDMGFKKTLDAIVMNLPPV
                     RQTLLFSATQSQSLADLARLSLTDYKSVGTAEVKDDSNSSATPDTLQQSYISVELPDK
                     LDILFSFIKTHLKCKMIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETL
                     DKFSRAQHTCLFATDVVARGIDFPAVDWVVQADCPENVDTYIHRVGRSARYGKQGKSL
                     VMLTPQEEEGFLKRLKQRHIEPNKLTIKQSRKKSIKPQLQSLLFQDPELKYLGQKAFI
                     SYVRSIFIQKDKEVFKFEELPTEEFANSLGLPGAPKIKMKGMKSVEKAKELKNTSRQL
                     LSLSKANDDGEIINQNKEVRTKHDKMFNRKNQTVLSEHYLNITKAQADEDEEDGFMTM
                     KRQDHEIKEEELPQLIAPTSKRAMRKATSKKASMAGKGNPSKLVFDEDGHARPIYELE
                     GEEDFHKKGDAEEQKNAFLLKETETMTHVDVEDKKLAKAKRQEKKRKRLEAMRREAEA
                     GMDQESSDDQEGGYQVAVGTGNLSDDMVSDDDEDRRPDKRRRFPERIEESEDRRAGSG
                     HIVEIEQPETLEDLESLTSRLIQS"
     gene            <628748..>629386
                     /locus_tag="KLTH0G07788g"
                     /db_xref="GeneID:8293646"
     mRNA            <628748..>629386
                     /locus_tag="KLTH0G07788g"
                     /product="KLTH0G07788p"
                     /transcript_id="XM_002555329.1"
                     /db_xref="GeneID:8293646"
     CDS             628748..629386
                     /locus_tag="KLTH0G07788g"
                     /note="similar to uniprot|Q07930 Saccharomyces cerevisiae
                     YLR016C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G07788p"
                     /protein_id="XP_002555375.1"
                     /db_xref="GeneID:8293646"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C5DMC7"
                     /translation="MRQQELGKRGLDLETAGALQPKRFRSQRASDLPRKAILPIFGPS
                     GLLELESHSKKGIQLQHVEPHDSISPNAYFEKYKIPIRKQTHFQALLYSEKDEAYHEK
                     FDLLERSNYLVGRRVREDPESEDEQENKETVLADIPIREETCSKQHCVIQFREREGIL
                     KAYVIDLDSSNGTLLNDVALPRARYVELKNEDVLKFSADESDTCYFLIFVAA"
     gene            complement(<629597..>631633)
                     /locus_tag="KLTH0G07810g"
                     /db_xref="GeneID:8293647"
     mRNA            complement(<629597..>631633)
                     /locus_tag="KLTH0G07810g"
                     /product="KLTH0G07810p"
                     /transcript_id="XM_002555330.1"
                     /db_xref="GeneID:8293647"
     CDS             complement(629597..631633)
                     /locus_tag="KLTH0G07810g"
                     /note="highly similar to uniprot|P16474 Saccharomyces
                     cerevisiae YJL034W KAR2 ATPase involved in protein import
                     into the ER also acts as a chaperone to mediate protein
                     folding in the ER and may play a role in ER export of
                     soluble proteins regulates the unfolded protein response
                     via interaction with Ire1p"
                     /codon_start=1
                     /product="KLTH0G07810p"
                     /protein_id="XP_002555376.1"
                     /db_xref="GeneID:8293647"
                     /db_xref="GOA:C5DMC8"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DMC8"
                     /translation="MFLNRSRNGWLVSFAAIVYALFLVALPLTSQSKSSSVFARAADD
                     AESYGTVIGIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVSFTDDERLIGDAAKN
                     QVAANPLNTIFDIKRLIGLKYNDKSVQRDIKHLPFKVVNKNNRPNVQVTVKGEEKTFS
                     PEEISAMILGKMRQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNILRIV
                     NEPTAAAIAYGLDKTSEEHQIIVYDLGGGTFDVSLLSIEGGVFEVQATAGDTHLGGED
                     FDYKLVRHFAQLFKKKHGIDVTNNNKAMAKLKREAEKAKRSLSSQMVTRIEIDSFVDG
                     IDFSESLTRAKFEEMNLDLFKRTLKPVEKVLADAGVNKEDIDDIVLVGGSTRIPKVQS
                     LLESFFNGKKASKGINPDEAVAWGAAVQAGVLSGEESVEDIVLLDVNALTLGIETTGG
                     VMTPLIKRNTAIPTKKSQIFSTAVDNQPTVMIQVYEGERAMAKDNNRLGQFELTGIPS
                     APRGVPQIEVTFALDANGILKVSATDKGTGKSNSITITNDKGRLSQEQIEKMVEDAEK
                     FASEDAEVRAKIEARNQLENYAHSLKNQVNGELADKFEEDDKETLLDAVNDVLEWMED
                     NSDSAAAEDFKEKFESLSQVAYPITSKLYGSAGATGQEDMDDEDDDDYFDHDEL"
     gene            <632433..>633185
                     /locus_tag="KLTH0G07832g"
                     /db_xref="GeneID:8293648"
     mRNA            <632433..>633185
                     /locus_tag="KLTH0G07832g"
                     /product="KLTH0G07832p"
                     /transcript_id="XM_002555331.1"
                     /db_xref="GeneID:8293648"
     CDS             632433..633185
                     /locus_tag="KLTH0G07832g"
                     /note="similar to uniprot|P47058 Saccharomyces cerevisiae
                     YJL035C TAD2 tRNA-specific adenosine-34 deaminase subunit
                     Tad2p"
                     /codon_start=1
                     /product="KLTH0G07832p"
                     /protein_id="XP_002555377.1"
                     /db_xref="GeneID:8293648"
                     /db_xref="GOA:C5DMC9"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C5DMC9"
                     /translation="MSLDSYVHFMRMATKLARYALDHGETPVACIFVHTPADQVVAYG
                     MNDTNRSLTGIAHAEFMGIEQIQSKFGAQDTSIFKDITLYVTVEPCIMCASALKQLGI
                     QKVVFGCGNERFGGNGSILSIQKDSCTAPQNKHISVPGILRKEAIMLLRYFYVRENER
                     SPKPKAKANRKLDVSTFPPIDWSLYLTREEFKDILGSEYLSHYDEKLDLSKTVDWGLI
                     DGNYDDFFLNIKQQCDQFSLQVPKKLKQENCR"
     gene            complement(<633221..>634486)
                     /locus_tag="KLTH0G07854g"
                     /db_xref="GeneID:8293649"
     mRNA            complement(<633221..>634486)
                     /locus_tag="KLTH0G07854g"
                     /product="KLTH0G07854p"
                     /transcript_id="XM_002555332.1"
                     /db_xref="GeneID:8293649"
     CDS             complement(633221..634486)
                     /locus_tag="KLTH0G07854g"
                     /note="similar to uniprot|P47057 Saccharomyces cerevisiae
                     YJL036W SNX4 Sorting NeXin"
                     /codon_start=1
                     /product="KLTH0G07854p"
                     /protein_id="XP_002555378.1"
                     /db_xref="GeneID:8293649"
                     /db_xref="GOA:C5DMD0"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DMD0"
                     /translation="MVESLNAGLPRQLSIIVSDPQKQRGEQGKSSFYVTYQISTKTDD
                     KSYHEAHFKNRPHDAAAANEANIIVVHRRYSDFLLLQSILSQDHATCVIPPLPDKKVF
                     QYIAGDRFSQSFTQKRCHSLQNFLRRISQHPTLSQSQVLMTFLVSSDWEAYRRSLSGS
                     LGNNKEEVSDTFMNAFKTVHNQSEEFVEIKEKSDKLDHNVSKIDKIFHRVVKKQDSIS
                     EDYSKFSAHLQELQELVASNSSEDDELRSKVKLFNHGISQLSYGLKDLSKFLDYEYIV
                     DLKDLEHYIDSVNQTVRLKDQKQIDYEELSDYLTRSINEKSNLISGYGGGNFFTSKLE
                     ELAGINQEAARREKISKLETKITSLTTEVDSAKEVADAFEREALKEVGIFEEIKTKEL
                     KASLASLADSQIEFYKKMLDTWTKVEEGL"
     gene            complement(<635270..>636652)
                     /locus_tag="KLTH0G07876g"
                     /db_xref="GeneID:8293650"
     mRNA            complement(<635270..>636652)
                     /locus_tag="KLTH0G07876g"
                     /product="KLTH0G07876p"
                     /transcript_id="XM_002555333.1"
                     /db_xref="GeneID:8293650"
     CDS             complement(635270..636652)
                     /locus_tag="KLTH0G07876g"
                     /note="similar to YLR015W, uniprot|P43132 Saccharomyces
                     cerevisiae YLR015W (BRE2)"
                     /codon_start=1
                     /product="KLTH0G07876p"
                     /protein_id="XP_002555379.1"
                     /db_xref="GeneID:8293650"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DMD1"
                     /translation="MKITTIPYQSDTDFTYQGEDEHQDRPQLPAFLELSDGLIKPEDI
                     PLNRRNFIYTPCSANVLFPELKYSTTEYPFEQPGLNYMDRADDLCLAPGSNDTVAVQK
                     SLGWRTGRCDACIKEGTVYWEVEIVNGGVPDSQGAESLKLVKDKLNSTPHVRVGVSRR
                     EASLEAPVGFDAYGYGIRDFCLESVHDGKLQQMLPVSQIKAGDRLGFLLHLPPIQEQV
                     IQAQSYTKFKIDALSSYEAGAGSNASANADGPLRKKAKKLNREFQKELLREQEHSNVV
                     RDQIAIRYKNQLFFEATDYVKTTKPEYYTSDRRERHDYYTLQDSYLKVFLNGKELGTA
                     FEKLNPFLPPFSEIKYNEKLNFNYWKNEAGFGDADNLKSGHDAIRKKSILRNKFVNNG
                     RLGYYATISCFNGGSGRLVTSINDMHHWNPLKASTPDARTLQDVFEEQVAEDVVWDII
                     DEVEAEMLCR"
     gene            <636890..>639490
                     /locus_tag="KLTH0G07898g"
                     /db_xref="GeneID:8293651"
     mRNA            <636890..>639490
                     /locus_tag="KLTH0G07898g"
                     /product="KLTH0G07898p"
                     /transcript_id="XM_002555334.1"
                     /db_xref="GeneID:8293651"
     CDS             636890..639490
                     /locus_tag="KLTH0G07898g"
                     /note="similar to uniprot|P07272 Saccharomyces cerevisiae
                     YLR014C PPR1 Zinc finger transcription factor containing a
                     Zn(2)-Cys(6) binuclear cluster domain positively regulates
                     transcription of genes involved in uracil biosynthesis
                     activity may be modulated by interaction with Tup1p"
                     /codon_start=1
                     /product="KLTH0G07898p"
                     /protein_id="XP_002555380.1"
                     /db_xref="GeneID:8293651"
                     /db_xref="GOA:C5DMD2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DMD2"
                     /translation="MSTARKRRGSAANAEESVDRKRRPTSAIMGISRSIAACKRCRVR
                     KVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSYVIFLEDRLEALTKRLREYGVDA
                     AEVQGNIPATSDDCPCDVNVFEEKVRAEHQVPRDNAMAGYIINNGTSIQTGVASRDQS
                     DIKTVSELQESAKSLDSLGAMKLSKKNGKLSLGAASNSYLGDSSGIPFAKLILTAINF
                     APEAVEETSEEPVSATDQREGPLNVSYLPTKEEAESLVSQYFTYCNSQLPILHRESFL
                     KRVFEPIYGPLNEGVSLSSDNTIINGNFKLPQDKADSEQSGEIWYKPSLSQQEVENSE
                     QIPPKYHIPLFFLNMALAIGDSARILETDEARSVAFKDRASEFKEALFRSNDRMEALA
                     GTLLIAKYSIMRPNVPGVWYTMGSALRLAVDLGLHAEKLNKNYDPFTRDLRRRLFWCT
                     YSLDRQICAFFGRPFGIPDDNISTEFPSSLDDALITNTADNIEDYSLVKSSMASYKCI
                     SLAFFRIRKIQAQIVQELYAHRTSLPDGFESLDEWRELMNEELDEWYEKRVPKTHRKM
                     NCHFPTELFQLELCHSKVMLYGLCPKAMTLNERGYEMVYRNTKSVIAIYYRLCHDGNI
                     MHTWVTVHNLFMAGMTFLYVLHNARFDLRESLQKSQKTCSTLIYVLEQLTKECEAARK
                     GARIFKVLSAAVFKLRSEPSEGAAPAEDTPALGGEASPGAEDKGGGDGPENEHPLDSE
                     VYSGRTAEAGEKQEELELELDEEAHTSRLGAAARGLSVPDLDASALNQFFIELDKLSP
                     FSDLSNGHASAGVSAGTAVLGEHSESSESSEPAAPQVRPPASSRDGQRVYDMMNQFST
                     ETIWDQVFSK"
     gene            <640089..>641063
                     /locus_tag="KLTH0G07920g"
                     /db_xref="GeneID:8293652"
     mRNA            <640089..>641063
                     /locus_tag="KLTH0G07920g"
                     /product="KLTH0G07920p"
                     /transcript_id="XM_002555335.1"
                     /db_xref="GeneID:8293652"
     CDS             640089..641063
                     /locus_tag="KLTH0G07920g"
                     /note="similar to uniprot|Q12289 Saccharomyces cerevisiae
                     YOR100C CRC1 Mitochondrial inner membrane carnitine
                     transporter required for carnitine-dependent transport of
                     acetyl-CoA from peroxisomes to mitochondria during fatty
                     acid beta-oxidation"
                     /codon_start=1
                     /product="KLTH0G07920p"
                     /protein_id="XP_002555381.1"
                     /db_xref="GeneID:8293652"
                     /db_xref="GOA:C5DMD3"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DMD3"
                     /translation="MSATLEQDSADLEARLASTPPEAHAVRDNLKSLAAGGVGGVCAV
                     LTGHPFDLIKVRCQSGQASGALDAGKRVLREARAQPGALPLNQMRGFYRGVVPPLLGV
                     TPIFAVSFWGYDVGKRLVAWGNSPAPEIAGAAVARSLTTGQLALAGFLSAIPTTLVTA
                     PTERVKVVLQTSDSGSFVGAAQKLVREGGVRSLFQGTLATLARDGPGSALYFASYEVC
                     KRYLSGTNAATAASEPLSVASVCLAGGAAGMSMWIGVFPIDTIKTRLQSGSGAQTMAQ
                     ATREIYGRGGIRAFFPGLGPALLRSFPANAATFLGVELTHELFKKYNV"
     gene            complement(<641317..>642480)
                     /locus_tag="KLTH0G07942g"
                     /db_xref="GeneID:8293653"
     mRNA            complement(<641317..>642480)
                     /locus_tag="KLTH0G07942g"
                     /product="KLTH0G07942p"
                     /transcript_id="XM_002555336.1"
                     /db_xref="GeneID:8293653"
     CDS             complement(641317..642480)
                     /locus_tag="KLTH0G07942g"
                     /note="similar to uniprot|P27810 Saccharomyces cerevisiae
                     YOR099W KTR1 Alpha-1 2-mannosyltransferase involved in
                     O-and N-linked protein glycosylation member of the
                     KRE2/MNT1 mannosyltransferase family"
                     /codon_start=1
                     /product="KLTH0G07942p"
                     /protein_id="XP_002555382.1"
                     /db_xref="GeneID:8293653"
                     /db_xref="GOA:C5DMD4"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DMD4"
                     /translation="MQLNGKDGARRALGAACIVAITLWVLVRGASIGGSSAQRTSTVV
                     KHTDGFKYRKVAQPKYTGPKEKATFVTLARNQDLYSLLGSIASIEDRFNSKFQYDWIF
                     LNDEEFSEEFKRVTTAMVSGQTKYGLVPEEHWSYPSWIDKGKAAAVREEMREKKIIYG
                     DSESYRHMCRYESGFFYRHELLQDYDWYWRVEPDTRIYCDVDYDVFKFMRDNGKKYGF
                     TISLKEYVGTIETLWNTTLEFTEKNPSLVHPNNMMDFISDDGGLSYNLCHFWSNFEVG
                     WLDLWRGPAYSAYFDHLDHAGGFFYERWGDAPVHSIGAALFLDRSEIHHFGDLGYFHI
                     PFHACPIDLNTRLENRCNCDPNQDFTWKGYSCTSKFYTVSGKDRPAGWQKYAD"
     gene            <643559..>646180
                     /locus_tag="KLTH0G07964g"
                     /db_xref="GeneID:8293654"
     mRNA            <643559..>646180
                     /locus_tag="KLTH0G07964g"
                     /product="KLTH0G07964p"
                     /transcript_id="XM_002555337.1"
                     /db_xref="GeneID:8293654"
     CDS             643559..646180
                     /locus_tag="KLTH0G07964g"
                     /note="weakly similar to uniprot|P20676 Saccharomyces
                     cerevisiae YOR098C NUP1 Nuclear pore complex (NPC) subunit
                     involved in protein import/export and in export of RNAs
                     possible karyopherin release factor that accelerates
                     release of karyopherin-cargo complexes after transport
                     across NPC potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0G07964p"
                     /protein_id="XP_002555383.1"
                     /db_xref="GeneID:8293654"
                     /db_xref="UniProtKB/TrEMBL:C5DMD5"
                     /translation="MSSAVSRRANKRSISSTIVNFFKKENSPEFRESSPIDGPDSTTA
                     GFKEGRTPEPPVPDLILYETDYNTRPPLLPILPVQRLKILRHKQYLRRLNDNRLLETF
                     TAPASNEMSGDFDSSHLVTLRSLKRRANGRPTSKKVPPKSVLGKRWCGDLQYDVAEYD
                     VAKKPKISKPSAGTDPTAALESPRLSSAVLKKSTLEQNSSSSDGLTNTEAKLLNGNAL
                     TDLASSKITKKIKKGFTVDDQDDKPKKLLALPSSGFDFLKSNAESSKNQDSERPAEAG
                     NFGKKLLPSSAEATDSPALAKVPSLFDKGKSLEGASQNAAKAEKPETPKPSFSIGKAD
                     GTSKPSFSFGKTDDTLKEGKPLFSFKRPTTSDQDENPAASSHATKSQKPSFSFSQSVG
                     ASGASQAAPKPAKPAFSFGKPAESQPQSMETQTENATGAADAQVSFNNKPKSNAGFTF
                     GSVTTNAANSGLASSENDPQQSGEKQTEGARNVPSFSFGKAGKPAAEVQAQSSSFKFN
                     TTEPASSGTEKKAAPAFSFSNPATEAKAATPVFSFGTSKTSNEPNTNVGKAKSPSLTP
                     SDSASIGSKRSFTFGVTPDQPSSQTANAPLSTQSNSKTPAAPSKPFTFGATSEKKDST
                     PPAFSFNTAGQPDGQSAASAASSTGSGFKFDTSGLKVNEPRDAKSSFTFGSNSAAPKP
                     AFNLGSSTHSFNAPQPQQPNSAFTFNNPSSAQQPLQQPQPNGIGFPSASTTSNNSPAF
                     GNTTNQQLAFNFGTGNATASSTPPPFGSASAPAFTPNPQSRPFSPSHTVNLNFGGVGS
                     QPPSTIFGGAANQNPAQVFGAQPNGSHPFPGMSQAPSQIFGGSSTSSIPQPQNQQTPM
                     LNLPPGRKLARMRARRT"
     gene            complement(<646652..>648361)
                     /locus_tag="KLTH0G07986g"
                     /db_xref="GeneID:8293655"
     mRNA            complement(<646652..>648361)
                     /locus_tag="KLTH0G07986g"
                     /product="KLTH0G07986p"
                     /transcript_id="XM_002555338.1"
                     /db_xref="GeneID:8293655"
     CDS             complement(646652..648361)
                     /locus_tag="KLTH0G07986g"
                     /note="weakly similar to uniprot|P39106 Saccharomyces
                     cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
                     integral membrane glycoprotein of the Golgi complex
                     required for addition of alpha1 3-mannose linkages to
                     N-linked and O-linked oligosaccharides one of five S.
                     cerevisiae proteins of the MNN1 family"
                     /codon_start=1
                     /product="KLTH0G07986p"
                     /protein_id="XP_002555384.1"
                     /db_xref="GeneID:8293655"
                     /db_xref="GOA:C5DMD6"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DMD6"
                     /translation="MRIFTRKLLKVGAAAVCVICLLYAYQSSLHNHVSKSLTEDIAAH
                     LVKDKEPFSSPSEICSQYFRKLYELEPNWWNSYSEGWQLAATDYETENLRLIMERLRT
                     YEKCLEIGALPSNIQDIDKRMFPFIRLEQSPIFESSDLKKAYQNGQFPSMSNGAISKY
                     RYNPQQSWLANWNRTSQETSGPTRGIVLSFPDAHASLVVRLLKVLEHQGNRLPIQIIH
                     KGDLSDYSRSLISRSLPPNQRLWFVNVKPMLDPHFIDDFSLYRNKWLAMIFNTFSTPI
                     FIDADAVSVQPVEDYLQSEAYVESGTIFFRDRAFAHKFDYEYCVPLLKALQPSRLETL
                     YFGQRRLIDEQLMMSDSTSLEQRIVQSFFVGGQRHQMDSGLLAVDKSKHLMPLMAGVF
                     LNLAPKLSKCTHGDKETFWLAFLLTNHAYRFHPEEASAIGEDDGSGEVCSVQLGHTSS
                     HGTLLWFNSGFRVCKFADAIDTDWEGYPKEYLHETFASIQEAREYYESMTNIKAAVLP
                     DISVNPWTGGFADLCIGYRYCARVSPGSGQLINFNAEEQKKMREIGNAWMSATEAELN
                     FRA"
     gene            <648554..>648991
                     /locus_tag="KLTH0G08008g"
                     /db_xref="GeneID:8293656"
     mRNA            <648554..>648991
                     /locus_tag="KLTH0G08008g"
                     /product="KLTH0G08008p"
                     /transcript_id="XM_002555339.1"
                     /db_xref="GeneID:8293656"
     CDS             648554..648991
                     /locus_tag="KLTH0G08008g"
                     /note="weakly similar to uniprot|Q12274 Saccharomyces
                     cerevisiae YOR097C Hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G08008p"
                     /protein_id="XP_002555385.1"
                     /db_xref="GeneID:8293656"
                     /db_xref="UniProtKB/TrEMBL:C5DMD7"
                     /translation="MDQAKDALSAYYKRLEAAVGESSFKDVHLPSFLLGCFATILLLV
                     LEPVFKALVGGILVSVVTVVKYLVVVGGVVLCGLILTSKGTAQEASQPEPLVDPRDHF
                     IKNASPDDLNVVGYNEMKTGRRRRKPKPVKNTYDTFVRQAGGT"
     gene            complement(<649179..>649909)
                     /locus_tag="KLTH0G08030g"
                     /db_xref="GeneID:8293657"
     mRNA            complement(join(<649179..649607,649769..>649909))
                     /locus_tag="KLTH0G08030g"
                     /product="40S ribosomal protein S7"
                     /transcript_id="XM_002555340.1"
                     /db_xref="GeneID:8293657"
     CDS             complement(join(649179..649607,649769..649909))
                     /locus_tag="KLTH0G08030g"
                     /note="highly similar to uniprot|P26786 Saccharomyces
                     cerevisiae YOR096W"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_002555386.1"
                     /db_xref="GeneID:8293657"
                     /db_xref="GOA:C5DMD8"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:C5DMD8"
                     /translation="MSAQAKILSQAPTELELQVAQAFVDLEASSPDVKADLRLLQFKS
                     IREIDVAGGKKAIAIFVPVPSLAAYHKVQTKLTRELEKKFPDRHVVFLAERRILPKPS
                     RRSRQLQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYMVGGNKVQKVLLDSKDVQQ
                     VDYKLESFQAVYNKLTGKQIVFEIPGESH"
     gene            <650856..>651683
                     /locus_tag="KLTH0G08052g"
                     /db_xref="GeneID:8293658"
     mRNA            <650856..>651683
                     /locus_tag="KLTH0G08052g"
                     /product="KLTH0G08052p"
                     /transcript_id="XM_002555341.1"
                     /db_xref="GeneID:8293658"
     CDS             650856..651683
                     /locus_tag="KLTH0G08052g"
                     /note="highly similar to uniprot|Q12189 Saccharomyces
                     cerevisiae YOR095C RKI1 Ribose-5-phosphate
                     ketol-isomerase"
                     /codon_start=1
                     /product="KLTH0G08052p"
                     /protein_id="XP_002555387.1"
                     /db_xref="GeneID:8293658"
                     /db_xref="GOA:C5DMD9"
                     /db_xref="InterPro:IPR004788"
                     /db_xref="UniProtKB/TrEMBL:C5DMD9"
                     /translation="MFRNLKSLVHTSVRRFAAKMTSIPDVKNLPTLHSTLEEAKRVAA
                     YRAVDENLDYANHRVIGVGSGSTVIYVAERLGQYLLDPQFSIYASQFICIPTGFQSKE
                     LILTNGLRLGSVEQYPVIDIVFDGADEVDVNLQLIKGGGGCLFQEKLVSTSASKFVVV
                     ADYRKRSPKYLGTNWVKGVPIEVVPTSYIRVLNDLKTKLKCKNAVLRQGAPAKAGPVV
                     TDNCNFIIDAHFGEIEHPEKLHQDIKMLVGVVETGLFIDNASKAYFGNPDGSVEMLV"
     gene            complement(<651983..>652537)
                     /locus_tag="KLTH0G08074g"
                     /db_xref="GeneID:8293659"
     mRNA            complement(<651983..>652537)
                     /locus_tag="KLTH0G08074g"
                     /product="KLTH0G08074p"
                     /transcript_id="XM_002555342.1"
                     /db_xref="GeneID:8293659"
     CDS             complement(651983..652537)
                     /locus_tag="KLTH0G08074g"
                     /note="highly similar to uniprot|P40994 Saccharomyces
                     cerevisiae YOR094W ARF3 Glucose-repressible
                     ADP-ribosylation factor GTPase of the Ras superfamily
                     involved in development of polarity"
                     /codon_start=1
                     /product="KLTH0G08074p"
                     /protein_id="XP_002555388.1"
                     /db_xref="GeneID:8293659"
                     /db_xref="GOA:C5DME0"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DME0"
                     /translation="MGNSISRVMVKMFGYREMKILMLGLDNAGKTTILYKLKLNKIKT
                     SAPTVGFNVETVSFRNVKFNMWDVGGQDRLRPLWRHYFPATTALIFVIDSQDMKRLNE
                     AKEELYSIIGDKEMEEVVLLVLANKQDLKGSMNPQEISDYLELKSHLDSQLWCVIGSN
                     ALTGQGLVEGLSWITNNTKTKDKK"
     gene            <653942..>658783
                     /locus_tag="KLTH0G08096g"
                     /db_xref="GeneID:8293660"
     mRNA            <653942..>658783
                     /locus_tag="KLTH0G08096g"
                     /product="KLTH0G08096p"
                     /transcript_id="XM_002555343.1"
                     /db_xref="GeneID:8293660"
     CDS             653942..658783
                     /locus_tag="KLTH0G08096g"
                     /note="similar to uniprot|Q12275 Saccharomyces cerevisiae
                     YOR093C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G08096p"
                     /protein_id="XP_002555389.1"
                     /db_xref="GeneID:8293660"
                     /db_xref="GOA:C5DME1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010506"
                     /db_xref="UniProtKB/TrEMBL:C5DME1"
                     /translation="MDFHIPSCLPEEAGNRLRELIKDYHDGDVTAKGYLKKRQEILDK
                     HNPTAYPLGSPNSAQNRGSTHIRNHSLASTIRSQRSSVAQGNDNYSIDTTSILNSRNN
                     SIYKVTTRNSSVLNSKSSALTSPAKSSGGDTSGPCYNPMIPLLPRTESPPMTDSLPAI
                     LRARSQLYERETAFMSINNKNKETGISWDKLYLRAEKVAHELGKHKLYKMDKVLLWFN
                     KEDLVEFTVSLLGCFIAGMVAVPVSLETYSLSEISQIVGLTNAGFTLIAENCLKQIDS
                     LRFDGNNKVRLTKSGFLSDITFITTDDLGTYSKAKKSSPTFDIPSVSYIEFTRTPLGR
                     LSGVVMKHKILSKQLETMASILNSRRKAHWPKGDIERSYKNKRTGSRYIMLSSLDPTR
                     STGLIFGVLFNIYTGNLLMTVDDRLLQKTGMYENIINKHRVNILLNDQLQLKQVVINY
                     LENPALVTSKKNKIDFSCINWCITSCTNIDTEVTDMIVHKWLKNLGCLDASQCYSPML
                     TLLDFGGIFVSMRDQLGNLGNFPVHDTKLRLQDELFIDKELLKENIIKPSITAMINSS
                     SSTKDYLRLSCFGFPIPDATVCIVNPDDGTLAPDLTVGELWISSPSITDEFYQMEKIN
                     EFVFNAKLNFKKMTELWQLAAFGPDGGSFKSSERLDTIMSVCPPTKSFIRTKLMGFVH
                     NGKIYVLALIEDMFLQNKLVRLPNWSHTSDVTKARNVDQPQNTDASDNQESLLSKRVV
                     QTYYLQHITENVVRMVEKALEVSVFELPQNKNEHFLVMVVETPLASNLSAATVQPTLA
                     SIAQRREQYEKKMTTMVEQIYKILWIFHRIQPMCIILVTPRSLPRRYCSLEIANSTVE
                     KKFLSGGLNSKFVKFQLDNVVLDFIPHSSYVNESIFSEHLSSLRHSAIGQENAMLSGN
                     SGALPWQTSGIDYREKCMDNRNNKDLTTFSSIIDILEWRSAKQSDEFAFSDGIAGSSV
                     ANSSPNNVHSKVSWKTFSSIVGNFVKKIVQSKTPLKSGDHVAILSGNSVEYVATVIAC
                     FYCNLVVIPIAPLNEAYPNEEVNFLMSVVNNHNVKRIFVDAKMYAMLEDGTSISRQIK
                     KFKHLLPKITVFSKIKKKNDISPSNFKDVLKNRRGSLTSESSPCVIWIDRETDIHQEI
                     NVVVTHKVLLNMCKIVKETLQLTSDSPVISMYKHTAGLGFIQTCLIGIYVGTTSCFFN
                     YQDILGDATNFLISLQNFSVKNLILSPEMLYLILDRANSIIERGRAIGSGRKDSKLAK
                     TMLRPDFLKKVRNIMIPFKGRPLTNTIQACLEKYPSIVINTSQLNYVYQHIFNPLVAL
                     NPLNVPSLDIYLDLTSLREGLVRDINPNGLTSSDLSQYLHLQSSGVVAVCTDVPIVNP
                     ETLEPCYENEIGEIWCCSEANVYDYWISKVTSPEKQVRFSGKKANLQKTSFVSAQFKS
                     KLGGQADNGLSYLRTGDLGFIKRIKCTDSRDNTLELAVLYVLGSINETVEILGLTHFV
                     SDLEATVKSAHPCIANCMVAKVGGLLSCLVECRNSRGYEHSNITPLIVAALLKKNGVV
                     LDLCCFVKPKSARITGNAWQTNRMTLLKDWLKGRLQVEAQFGINYGENNSIYLLSDFA
                     ERK"
     gene            <659150..>660802
                     /locus_tag="KLTH0G08118g"
                     /db_xref="GeneID:8293661"
     mRNA            <659150..>660802
                     /locus_tag="KLTH0G08118g"
                     /product="KLTH0G08118p"
                     /transcript_id="XM_002555344.1"
                     /db_xref="GeneID:8293661"
     CDS             659150..660802
                     /locus_tag="KLTH0G08118g"
                     /note="similar to uniprot|Q99252 Saccharomyces cerevisiae
                     YOR092W ECM3 Non-essential protein of unknown function"
                     /codon_start=1
                     /product="KLTH0G08118p"
                     /protein_id="XP_002555390.1"
                     /db_xref="GeneID:8293661"
                     /db_xref="GOA:C5DME2"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C5DME2"
                     /translation="MSLTLGQAIWASVKPIIKIYLIMGCGFLLARLNILTVEATRAIS
                     DIVLTLLLPCLSFNKIVGNIEDQDIKQVGIICLSSVLIFATGWFFAYVIRMFLPVPKQ
                     WRGGILAGGMFPNISDLPIAYLQTMDQGLIFTEEQGNKGVANVIIFLAMFLICVFNLG
                     GFRLIEKDFNYHDKESAYVNEDYEMADSHKAEDSRSSSDIAPGGSRATPTPTYRSNTR
                     DQTSLNSLTPEESTTNSGPSIDTNQPVALTNGIQRNRSDRRGSLAGSVRALELREMPS
                     QDITDLVREYSNVDQFGRRRSSTAHSQTGSGRRASLVRRIQTSDLTRMVTSDAAVTGK
                     DVEESGKSLPHWIYKLVPTPYIVFFLKNCLRPCSMAVILSLIIAFIPWVKALFVTSEN
                     TPHIKQAPDNQPALSFFMDFTAYIGAASVPFGLLLLGATLGRLKLKKLYPGFWKSAVL
                     LVVLKLCVMPIFGVLWCDRLVKAGWASWENDSMLLFVIAIDWALPSMTTAIYFTASYT
                     PPDAVETVQLDCVSFFLMLQYPLMVISLPFLVTYFLKVQMKV"
     gene            <661164..>662909
                     /locus_tag="KLTH0G08140g"
                     /db_xref="GeneID:8293662"
     mRNA            <661164..>662909
                     /locus_tag="KLTH0G08140g"
                     /product="KLTH0G08140p"
                     /transcript_id="XM_002555345.1"
                     /db_xref="GeneID:8293662"
     CDS             661164..662909
                     /locus_tag="KLTH0G08140g"
                     /note="similar to uniprot|P53933 Saccharomyces cerevisiae
                     YNL094W APP1 Protein of unknown function interacts with
                     Rvs161p and Rvs167p computational analysis of
                     protein-protein interactions in large-scale studies
                     suggests a possible role in actin filament organization"
                     /codon_start=1
                     /product="KLTH0G08140p"
                     /protein_id="XP_002555391.1"
                     /db_xref="GeneID:8293662"
                     /db_xref="InterPro:IPR019236"
                     /db_xref="UniProtKB/TrEMBL:C5DME3"
                     /translation="MNNSDEYRGTGSLNRRQRLMNIMKTTRDAYIPAFTTTLSQFRSE
                     ASSTIKGYYDSANHTGATQGVRTWPVDMKTLIYPSYTRMVDQRYFETHIRGLVFSPGT
                     MNRKSRLILSLCRQLVRPSSPSERAALEEQLEAPLNDSQSISDSASTHSSLSLDNSDD
                     DTLRSRISGFLHKHIMGVTLTIDISDGSSLKERTSVVTDNYGNYDVKVATQFQPQNIT
                     INIDTKDGCTVNCPINIVKDQGFALISDVDDTIKHTGVTGDKRSMFSNVFVHEFKTWA
                     IPGMSLWYNTLKDSEGVDFFYVSNSPFQIYPVLEDYVSKHFPMGPLFLKQYSGNLVSS
                     LMSSSAKRKLGTILGILADFPHKRFILVGDSGEGDLEAYTEAVKLFPNQILGVYIRCC
                     KDSMSDVAAYGHKVIDELNALIEKKYYSKTNIPSTSGEVSSTRKDLTKSPSIPDLIQL
                     DDVKTPPLKPTKKPMLTSAQRQEIESSKKAQPPLPPRKHRTFPSSIKEPSTVNRSATD
                     DAIYYTPSSQNDYGSYPTFFDSKADSWRQRVVQTIKELKNCNAQTRLQFFTEPELCLE
                     DSIETIRKEKARNIA"
     gene            complement(<663061..>664086)
                     /locus_tag="KLTH0G08162g"
                     /db_xref="GeneID:8293663"
     mRNA            complement(<663061..>664086)
                     /locus_tag="KLTH0G08162g"
                     /product="KLTH0G08162p"
                     /transcript_id="XM_002555346.1"
                     /db_xref="GeneID:8293663"
     CDS             complement(663061..664086)
                     /locus_tag="KLTH0G08162g"
                     /note="similar to uniprot|Q12000 Saccharomyces cerevisiae
                     YOR091W RBF46 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G08162p"
                     /protein_id="XP_002555392.1"
                     /db_xref="GeneID:8293663"
                     /db_xref="GOA:C5DME4"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C5DME4"
                     /translation="MPPKKKQQQPVKKKDNVDKTFGMKNKNRSTKVQKFIQQVQTQVD
                     PKKEEMKRKKQEEKLLRERQEAERRALFNPAMDQSVKSGVDPKTVLCAMFKIGNCNKG
                     ARCKFSHDPNVGRRVEKKDLYQDARAEKEADTMDQWDEEKLRSVILSKHGNLRTTTDK
                     VCKFFIEAVENGKYGWFWVCPNGGDKCMYRHSLPEGFVLKTKEQKRLEKEALDSQPKI
                     TLEEFIETERDKLDKSKLTPITVANFAKWKQDHITQKINAEKRDEAKRKPTGREVVLK
                     KFTEDKKFAEVDDMDATKGSAWDLSEFTRALKDAEANTGDGIKDYGDGSNPTFDLVNK
                     TTTTASA"
     gene            <664281..>665942
                     /locus_tag="KLTH0G08184g"
                     /db_xref="GeneID:8293664"
     mRNA            <664281..>665942
                     /locus_tag="KLTH0G08184g"
                     /product="KLTH0G08184p"
                     /transcript_id="XM_002555347.1"
                     /db_xref="GeneID:8293664"
     CDS             664281..665942
                     /locus_tag="KLTH0G08184g"
                     /note="similar to uniprot|Q12511 Saccharomyces cerevisiae
                     YOR090C PTC5 Mitochondrially localized type 2C protein
                     phosphatase contains Mg2 /Mn2 -dependent casein
                     phosphatase activity in vitro but in vivo substrates are
                     unknown"
                     /codon_start=1
                     /product="KLTH0G08184p"
                     /protein_id="XP_002555393.1"
                     /db_xref="GeneID:8293664"
                     /db_xref="GOA:C5DME5"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C5DME5"
                     /translation="MSRYTSEGLNVKLRKILKDLGIPRLIFRRGNKLAASMNGIPRLT
                     RGYATRVLRSKSGMKKGALLAGSSLLLTYMCWDTKFVSCESIKGIKQYNSGPSDSDQS
                     NTISLLSDKEVTQRLRQMEKSYYVQRGRGVLRYDLAQLPSNAPIEDNHIEQVITVPVS
                     SGGQEEADLYFFGVFDGHGGPYTSAKLSQSLVPYVAHQLGQIYGDFSLSEGGPGAFSA
                     ATDSAITTAFKNLDRDLVYGALGKLFEEPTKQNLVSALPAISGSCALLTMFDSNENTI
                     KCAVTGDSRALLGSQDSNGQWTVKALSVDQTADNTEEVERIRAEHPGEPGAVRNGRVL
                     GSLQPSRAFGDYRYKIKELAGKVVSDLPGHLRVYFRREPRDFKTPPYVTAEPVITSTK
                     LDSNAKFMVLASDGLFELLTNEEIAGLVVNWMQHSKNAHFGNSAGIQKDSHGAKSIPP
                     VTDLSTHKEQQRRVFSRTGQSSSPVSILDDANVATHLIRNALSAGGNKDYVSTLVSIP
                     SPMSRKYRDDLTVTVVFFGEGQDLGKIDGQLIPNYEATSPPRPKL"
     gene            <666127..>666765
                     /locus_tag="KLTH0G08206g"
                     /db_xref="GeneID:8293665"
     mRNA            <666127..>666765
                     /locus_tag="KLTH0G08206g"
                     /product="KLTH0G08206p"
                     /transcript_id="XM_002555348.1"
                     /db_xref="GeneID:8293665"
     CDS             666127..666765
                     /locus_tag="KLTH0G08206g"
                     /note="highly similar to uniprot|P36017 Saccharomyces
                     cerevisiae YOR089C VPS21 Rab5-like GTPase involved in
                     vacuolar protein sorting and endocytosis post vesicle
                     internalization geranylgeranylated geranylgeranylation
                     required for membrane association"
                     /codon_start=1
                     /product="KLTH0G08206p"
                     /protein_id="XP_002555394.1"
                     /db_xref="GeneID:8293665"
                     /db_xref="GOA:C5DME6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DME6"
                     /translation="MNSALTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAF
                     LTQRVNMGDHTIKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWV
                     KELREQASKDIIIALVGNKLDMVETGAERKVALEEAENLASQEGLLFFETSAKTGSNV
                     NEVFLAIGQKIPLKSAQQQQQGQGSSGLRINDDSRVDLRAAQDGPAPSSCNC"
     gene            complement(<666947..>668986)
                     /locus_tag="KLTH0G08228g"
                     /db_xref="GeneID:8293666"
     mRNA            complement(<666947..>668986)
                     /locus_tag="KLTH0G08228g"
                     /product="KLTH0G08228p"
                     /transcript_id="XM_002555349.1"
                     /db_xref="GeneID:8293666"
     CDS             complement(666947..668986)
                     /locus_tag="KLTH0G08228g"
                     /note="similar to uniprot|Q12324 Saccharomyces cerevisiae
                     YOR087W YVC1"
                     /codon_start=1
                     /product="KLTH0G08228p"
                     /protein_id="XP_002555395.1"
                     /db_xref="GeneID:8293666"
                     /db_xref="UniProtKB/TrEMBL:C5DME7"
                     /translation="MPTYALPTAAGVDWTLDHPPGCEAPHPRQLLRISLNLKYLIDKV
                     VPILYEEQAIMCDHSRILNSRVIALAREACGGSKGNQQSLRKYQSALIFCLLKVCAWY
                     WDLAAAELHNAEIYNLRASAAQQLCKLIIEQEEQRDAQFLFIQMLCRRYVINENDEDS
                     VAQNALELAMDMHCTTVIGSSGYQRCLKWLWRGWIVQHRQDSKAYVLCDVIPSARFSS
                     HFHPDRLKTPMYQNWLQIWFSLIFVILYTAVVNGKDSTAVDGIEFSEGLFYFFTIGST
                     LDELNKIYHVGRSYIGFWNAFNDTMYFTILTSMVLRIVSVSPIKTTMPAEYWDKISYR
                     VLSCAAPLVWARLLLYLESSRFVGALLVVLKHMMQESIVFFFLLFLLIIGFLQGFIGL
                     DSSDGNREITWPIVSNLMLTVLGSGDFKMFKDFAPPYAGILYYVYCFIVSVILLNILI
                     ALYSTAYEKVIDNALDEYMALMAQKTLRYIRAPDEDVYVPPLNLIELMLMPFMLMLPQ
                     KTAKALTHLVMTVAYFPMLVFIAVKEVREAKRVAYNRMRKLEDDANETDTAWDLTDGY
                     VDDADGWIPHSGNSGIAATQVKNKRSLNLQREAETADPDFRVKASWFKSVKRAVQPVD
                     QGFDSGIGWEFYDVYREITEKADNSDKKIEELTKMVQELTMAVKEMSPSNPKSKT"
     gene            <672012..>675770
                     /locus_tag="KLTH0G08250g"
                     /db_xref="GeneID:8293667"
     mRNA            <672012..>675770
                     /locus_tag="KLTH0G08250g"
                     /product="KLTH0G08250p"
                     /transcript_id="XM_002555350.1"
                     /db_xref="GeneID:8293667"
     CDS             672012..675770
                     /locus_tag="KLTH0G08250g"
                     /note="some similarities with uniprot|P53935 Saccharomyces
                     cerevisiae YNL091W NST1 Protein of unknown function
                     mediates sensitivity to salt stress interacts physically
                     with the splicing factor Msl1p and also displays genetic
                     interaction with MSL1"
                     /codon_start=1
                     /product="KLTH0G08250p"
                     /protein_id="XP_002555396.1"
                     /db_xref="GeneID:8293667"
                     /db_xref="GOA:C5DME8"
                     /db_xref="InterPro:IPR025279"
                     /db_xref="UniProtKB/TrEMBL:C5DME8"
                     /translation="MGKKRQGKKISEPLNENPTVVSGSDVHFDFSEENMSASTKKKMK
                     NKKKNTAKVAEAEIYDSEAEYPSSRVIKRAPNGDVIVETLAEEEKPKPNPDLGRSIPT
                     KLDSHWESLSSEEKKRILRIEKNEVFEVIKNYQSNNNCNCSVCGRRNVAMEQELEQIY
                     NRLYDSAKQTNSDTDFVLFHLNMIKELQRANATANAVPSVERVNAPSQEPTSPQYLED
                     MRDEAVKYCLSNKAVESLKEEVLQFKHNKQRQQQLQQQQLQQQQQQQHQPQLRLQDEA
                     NRITEQRFEPLVSQQTPHDLQPTRNDEQLNHYSLHEEDTKLQQELIHDEHKNLSSTEH
                     HDNEFLDLPNAAGTDNKKHVEPMFTGEAVASLPTGPLQSQDMASNDDVKNRYMDFAKA
                     FVSSHPKIAHEYVSRMMMYPDMRALTEDLMYNNGQSFIKAMEDYVVQKDKSPEQSQEN
                     NHIGSLFEEGAPLTPDQYANIQRHIAQGMTDRMNFEKGDFKGALEGEGKGLLEQFLAG
                     EDPISMLLKSFTKQNGVSGDQLIANQNIQEEIDYDDEDEYDEEEYSDYEDEEESEYED
                     DVYEEENNNGQYHHHQYHHHHSHTHHHEEELELEEEEVSTAGNEEEYDSGIDEQERLE
                     EGRRLIQIAITKLLQKKLVDSYHEKQAENNRLRLLQELEAEEQKKREKEEKKQRKREK
                     EKEKKRAQQQAKEQERRKKEEEDARLKKEAEEREMQRREAQRQRVEEAKRKKDEERRK
                     KLEEQRRKEEEQQKQKKLKEEQKRKREEEKRLKDEAKKLKEEGAKRQKEEDAKRQKEE
                     ELKKQKEAKKLDQERKRQQQEESKTQYQAQQKHMAESNFNRRQSTPPEAVPYGVPNAP
                     FNDENHNDLFHMINEAASKSLSSSSSHLQTLLQPQLSQPDLQHPHTGVALSGAPQSNW
                     QTSGNYAPPYEPLASNVKGLDNSWSSRGGIFQTSPSVTQPHLSAQQSSSAQPSLPQFA
                     QFGNTASERKKSFNDELSDLTNFLSSTSLSGNPGSSTGAPGYNIPDTLWSSVDQTTHP
                     ANAPFSGTTSSVPPLSIGSTAHRKSIWENEAPLNPTNASPGLRNLSTNIWGDIQSNPN
                     QVPSESLTDVVVKSYALLSREFSTDYVDVEKLYHTVFSLMKDSSNLAYSNFLGHILTM
                     RATHNCDVVSNQSGAITHVKIPYAYLQSQQPQPGFLPSSELPRNQSSYKGGDFSNVLF
                     DELYNGASGTMPPVQRPLPNSTPVTQGGSNQFSYSQPFSQSGTNNIWG"
     gene            676642..676743
                     /locus_tag="KLTH0G08272r"
                     /db_xref="GeneID:8293668"
     tRNA            join(676642..676677,676708..676743)
                     /locus_tag="KLTH0G08272r"
                     /product="tRNA-Trp"
                     /note="tRNA-Trp (CCA) cove"
                     /db_xref="GeneID:8293668"
     gene            <678358..>678921
                     /locus_tag="KLTH0G08294g"
                     /db_xref="GeneID:8293669"
     mRNA            <678358..>678921
                     /locus_tag="KLTH0G08294g"
                     /product="KLTH0G08294p"
                     /transcript_id="XM_002555351.1"
                     /db_xref="GeneID:8293669"
     CDS             678358..678921
                     /locus_tag="KLTH0G08294g"
                     /note="highly similar to uniprot|P06781 Saccharomyces
                     cerevisiae YNL090W RHO2 Non-essential small GTPase of the
                     Rho/Rac subfamily of Ras-like proteins involved in the
                     establishment of cell polarity and in microtubule
                     assembly"
                     /codon_start=1
                     /product="KLTH0G08294p"
                     /protein_id="XP_002555397.1"
                     /db_xref="GeneID:8293669"
                     /db_xref="GOA:C5DME9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DME9"
                     /translation="MTENVVRRKLVIIGDGACGKTSLLYVFALGKFPKEYHPTVFENY
                     VTDCRVDGIKVSLALWDTAGQEEYERLRPFSYSKANVILIGFAIDDAESLLNARTKWT
                     EEALRYCPEAPIVLVGLKRDLRKSESSHKFVTREEAEQVARAIGAKKYMECSALDGSG
                     VDDVFELATRTSLLVNKEPGQTCCLIA"
     gene            complement(679154..679227)
                     /locus_tag="KLTH0G08316r"
                     /db_xref="GeneID:8293670"
     tRNA            complement(679154..679227)
                     /locus_tag="KLTH0G08316r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:8293670"
     gene            <679454..>683764
                     /locus_tag="KLTH0G08338g"
                     /db_xref="GeneID:8293671"
     mRNA            <679454..>683764
                     /locus_tag="KLTH0G08338g"
                     /product="KLTH0G08338p"
                     /transcript_id="XM_002555352.1"
                     /db_xref="GeneID:8293671"
     CDS             679454..683764
                     /locus_tag="KLTH0G08338g"
                     /note="similar to uniprot|P06786 Saccharomyces cerevisiae
                     YNL088W TOP2 Essential type II topoisomerase catalyzes
                     topology changes in DNA via transient breakage and
                     rejoining of phosphodiester bonds in the DNA backbone
                     localizes to axial cores in meiosis"
                     /codon_start=1
                     /product="KLTH0G08338p"
                     /protein_id="XP_002555398.1"
                     /db_xref="GeneID:8293671"
                     /db_xref="GOA:C5DMF0"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:C5DMF0"
                     /translation="MSAEKSASERYQKISQLEHILKRPDTYVGSVEIQEQTQWIHDEA
                     TDCMVEKNVKIVPGLFKIFDEILVNAADNKVRDPSMKKIEVNINKEENFIEVKNDGKG
                     IPIEIHEKEQIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSSEFILETA
                     DPIKGEKYLQKWEANMSICHKPKITSYKKGPSYTKVSFKPDLQRFGMEHLDDDIVGIM
                     RRRVFDINGSVRDISVYLNGKSLRIRNFKNYVELYLKSLEKKKSEEQGADVGKAPTIL
                     YERLNDRWEIAFAVSDVAFQQISFVNSIATTSGGTHVNYVSDQIVKKITEHLKKKKKG
                     KTIKAFQIKNHIFIFVNCQIENPAFTSQTKEQLTTRVRDFGSKCDIKDEFINKIMKTE
                     LAERVFELADQNEEKALQKSDGSRKNRITKYATLEDANCAGTKQGYKCTLVLTEGLSA
                     QSLAVAGLAVVGRDYYGCYPLRGKMLNVREASAEQINKNAEIQAIKKIVGLQHRKKYE
                     DTKSLRYGHIMIMTDQDHDGSHIKGLIINFLESSFPGLLDIPGFLIEFITPIVKVTIT
                     RPKRDVISFYNMPDYEEWREKESHKYSWKQKYYKGLGTSSLQEAREYFSDLDTHLKKF
                     HALEGEDSQLIDLAFSKKKADDRKEWLRQYEPGNTLDPTLSEIPICDFINKELILFSL
                     ADNVRSIPSVLDGFKPGQRKVLYSCFKRKLKSEIKVAQLIGYVSEHTSYHHGEQSLAQ
                     TIVGMAQDYVGSNNIYLLKPNGAFGTRAAGGKDSAAPRYIFTELNNITPNIFNPLDNP
                     LLTYLQEDDQTIEPQWYLPVIPMILVNGAEGIGTGWSTNIPCFNPLEIVQNIKKLMNG
                     EPMDDMAPFYRGWEGRLQKIDGQRYRMYGRIEQVGPRTLEITELPAKTWISTIKEHLL
                     LGLAGNEKTKPWIKDMQENHGATIKFTVELTDEEMQNTRRIGFYERFKLVSTISLANM
                     VAFDPNGRIKKYEDVRDILSDFYYVRLEYFQKRKDHMSERLQWQVEKLSQQTRFIKLI
                     VEKKLTVTNKPRSALFRELEELGFPKINSEGRPYYGAVKGEEQSVLDAAYSDDNEDPE
                     EESNEVNGPQDKYGTFEYLLGMKIWSLTKEKYEKLLNQKQEKEVELDNLLRLSAKDLW
                     CQDLDAFSNAYKAFLEYDEKKRNSIIPDAASTKQKGKRKRAKADDDDYKPKPKKKAKT
                     ASAAKPKTEDSQFENVLIEQKVIEKPKRVVKVKDEKQPTIESLVGKNKGATIDSSAAN
                     SASATPPPQPPKMIKSEDSSQSSASDKSADAPKGGERDQMSVFSSKFREASALFDSFK
                     PAEATASNHSLSEKPGTENPDAAESEVAKPKKPVTKATARKPSRKNQISDESDFEISD
                     NGEASPVIESTISQPPRKRAARAKPSKSYKETIDLSDMSFQEEVPAEDESDESFQESE
                     "
     gene            <684153..>687683
                     /locus_tag="KLTH0G08360g"
                     /db_xref="GeneID:8293672"
     mRNA            <684153..>687683
                     /locus_tag="KLTH0G08360g"
                     /product="KLTH0G08360p"
                     /transcript_id="XM_002555353.1"
                     /db_xref="GeneID:8293672"
     CDS             684153..687683
                     /locus_tag="KLTH0G08360g"
                     /note="similar to uniprot|Q12466 Saccharomyces cerevisiae
                     YOR086C TCB1 Contains three calcium and lipid binding
                     domains green fluorescent protein (GFP)-fusion protein
                     localizes to the cell periphery C-terminal portion of
                     Tcb1p Tcb2p and Tcb3p interact"
                     /codon_start=1
                     /product="KLTH0G08360p"
                     /protein_id="XP_002555399.1"
                     /db_xref="GeneID:8293672"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:C5DMF1"
                     /translation="MATTGSEVVLPTERDQVAVVDGVDKLAPPQANEEKVSKNVSEDH
                     TKNVNASEFERPTVDASYVGWKQIGGWEEKDELTLEDELMDLNNETFLDNVIPDKFYG
                     DWYQTAGVIFLGGSLSFLIGKLGFSLGPVFFVVLAMSLLYRASIKRYRATIRDQVQKE
                     FTVQKVEGDYESMEWLNSFLDKYWARLEPEVSQMIVQQVNEILATNPAIPAFVKALWI
                     DKFTLGVKPPRIDLVKTYQNTDTDVVVMDWGVSFTPHDLSDLNSKQLKNYVNQKVTIN
                     AKAFGLPLSVSVSDIAFKAMLKVRFKLMTPFPHIETVNLQLTETPDVDFVAKLLGESI
                     FNWEILSIPGLYPLIRELAKKYMAPILMPPFSLQLNIPQLISGSAVSIGILEVTVKDA
                     IDIKRARNILNRSVDPYLSFEFNGVCVGKTRTVRDSLNPVWNETLFLLLNSFTEPLSI
                     VLYDRRENVKDKVLGRIEHNLSTLHDENTQKNLSGCFLRSSKPVGQLNFGLKFHPTLE
                     PKQLPDGTVEDAPDLNVGISKLIIEEAKELSEPGSKVSAYVELYVNAKLVLTTGSVKN
                     TETPSWFQEYEAVIADRRKTRTKIVIKNAKGETIGSTVQTLSDLIDRSEVGKCWIPLQ
                     NGKGQIKVTTYWKPVELGMGANSVAYTPPIGAVRVFISKAEGLRNLEKFGKIDPYARV
                     LVNGIPRGRTDVRGSTLNPVWNQGIYVAVTSPNQRITLECLDVETVGADRTLGKFNID
                     VANMFQKGNDDKYVENVDEEPKVGRLVDKKGAKGSVTYYVSFYPTVPVLSLEEIQEVD
                     ELNERKKRLQIQESEKSDDELSKQAEQKRKEEEFEVKELEDLFSNKLKLDLDELLQYK
                     SGVFAFSVLGGELPQTGCYVQAFFDSNGYPRYVSQKFGGRTIRNGATGDVIIKELDWS
                     ITTFRVTKKGDASKAEECYAEVTIPTIELVKNCYYKPSILNLTGGNSAKLMLQVSWFP
                     VAASKLPQADLITNSGDLTINVLGANNLISADRNGKSDPFVKFYIDNNESSFFKTHHK
                     KRTLDPVWNEKCEVQINNRVNNYLKIKMMDWDAGNKDDLIGEAIYPLASVDPENPSDV
                     DIPLIGPEGKDGGVLHLSFSFSPRYTLSVRKTEKKVGDLASKGISSGLHAGTSVIGGG
                     LGAVGKIKKGIFGGDKKDDKKSDKKDGDAH"
     gene            <687894..>688187
                     /locus_tag="KLTH0G08382g"
                     /db_xref="GeneID:8293673"
     mRNA            <687894..>688187
                     /locus_tag="KLTH0G08382g"
                     /product="KLTH0G08382p"
                     /transcript_id="XM_002555354.1"
                     /db_xref="GeneID:8293673"
     CDS             687894..688187
                     /locus_tag="KLTH0G08382g"
                     /note="similar to uniprot|P48232 Saccharomyces cerevisiae
                     YNL086W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G08382p"
                     /protein_id="XP_002555400.1"
                     /db_xref="GeneID:8293673"
                     /db_xref="GOA:C5DMF2"
                     /db_xref="InterPro:IPR020515"
                     /translation="MEPQEVAAAAGVHPIELCVYSILSNNLDGIYQSVNDLRESQALL
                     VVRLKQIRNLLKEEQEYYNEEEGLGVERERLEELELRVEKLTQKYKKLLADCV"
     gene            complement(<688210..>689253)
                     /locus_tag="KLTH0G08404g"
                     /db_xref="GeneID:8293674"
     mRNA            complement(<688210..>689253)
                     /locus_tag="KLTH0G08404g"
                     /product="KLTH0G08404p"
                     /transcript_id="XM_002555355.1"
                     /db_xref="GeneID:8293674"
     CDS             complement(688210..689253)
                     /locus_tag="KLTH0G08404g"
                     /note="weakly similar to uniprot|P48439 Saccharomyces
                     cerevisiae YOR085W OST3 Gamma subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins Ost3p is important for
                     N-glycosylation of a subset of proteins"
                     /codon_start=1
                     /product="KLTH0G08404p"
                     /protein_id="XP_002555401.1"
                     /db_xref="GeneID:8293674"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:C5DMF3"
                     /translation="MRFTQLAVFFAAFFLPFISAISNEKLSKEASRYKGIIQLTNNNF
                     KRILDSKREAYIVVLLTATNAQVGCTLCMELDPEFSMMADSWYKDHPEGLSESGTGMF
                     FARADFDPKKNSDVFMHFKVNNVPRLLFLTPQGDPSSFSQINLPGEGGMTRVLAIVNT
                     LRDATGISDFKIYQPINWGSVFVTAFATAAVTLLVKKYKPVAAKLITSKYVWGLATVF
                     VIILWNAGYMFNSIRGSQFAGMTQDGSAVIYFMEGQQQNQFGIETQIVGVIYGVLASC
                     VAGLVLFVPYAKQFYATDKSGRPTLSKACFVEFSLTLSFLVTLYLVYGALTGVFKLKS
                     PGYPFKLIKFPFH"
     gene            <690275..>692689
                     /locus_tag="KLTH0G08426g"
                     /db_xref="GeneID:8293675"
     mRNA            <690275..>692689
                     /locus_tag="KLTH0G08426g"
                     /product="KLTH0G08426p"
                     /transcript_id="XM_002555356.1"
                     /db_xref="GeneID:8293675"
     CDS             690275..692689
                     /locus_tag="KLTH0G08426g"
                     /note="similar to uniprot|P40850 Saccharomyces cerevisiae
                     YNL085W MKT1 Protein involved in propagation of M2 dsRNA
                     satellite of L-A virus forms a complex with Pbp1p that is
                     involved in posttranscriptional regulation of HO
                     endonuclease"
                     /codon_start=1
                     /product="KLTH0G08426p"
                     /protein_id="XP_002555402.1"
                     /db_xref="GeneID:8293675"
                     /db_xref="GOA:C5DMF4"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DMF4"
                     /translation="MPVKSLESFLFERGLVGTYPIESLKNATLGIDVDHYVSRLLTSK
                     REQYLDAIGGFPTSLKLYLESDLQVFREFDITPIFVFSGSPVANQLEANGHYAAAAPE
                     AAAAAINASNSGPMSSSATSTTRTAKEAILAQRHKGWTQWNNMHANNQSSYIDQPVPP
                     SEPFKYSIPLDTKRFQSDLIDYFISLDIRFQVAPYSSWFQLTYLLQNEYIDAIYGPTE
                     LLMLKSVEKFILGMEFPNKEYRFVDRARVLSEINCSPEEFVDICMTVGNDLQPYTLSP
                     LRMYPVQQLFEVALEMVLTSGTDFYAYQLMNPIKSESIQSVARYQKGISALKFMPVLK
                     ENGKVELYSPAERGEDRMTYSAGSPYSPASSTGSLESIPNDVHDVVAQRLPHEYYFYQ
                     SIGLVSGKLMDAITTGVYPDEPPLDGGSSESYRKLVKNSVELFKNKEINLLTQPINRY
                     YQIKPIKHVKWFAPDDAVTLANRVTPPIFDRINHLIVKISQPEREFSLAQFLTMVNES
                     GDLTKSFVSDKVLFPNSVPLNEKLATPFDVLATAFIRFLSLLGFFDFDSSQKTLKVTP
                     WGRILLDMTKTGVDSESIEPVFVLLMFLKTGVLSLREETVPATPSALSKATLRSYSKE
                     SSYILVLTRILSIFRLQQKPSNYHGPIDRKTLVFRDHLDYVKENLNDLFEVTLVSSLA
                     AGEFDRLSLDNTGWQKKIVAAMPFKLSTPSTVMAMIWQFYLQKFLHNGNSKSDALNLI
                     ASTFNTSKVVPNLDEELKRSLDFARQFGQVLGALSKANLCEKQDYELVVEAVEFAEKA
                     FADERV"
     gene            693784..693856
                     /locus_tag="KLTH0G08448r"
                     /db_xref="GeneID:8293676"
     tRNA            693784..693856
                     /locus_tag="KLTH0G08448r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=75.56"
                     /db_xref="GeneID:8293676"
     gene            <694234..>695820
                     /locus_tag="KLTH0G08470g"
                     /db_xref="GeneID:8293677"
     mRNA            <694234..>695820
                     /locus_tag="KLTH0G08470g"
                     /product="KLTH0G08470p"
                     /transcript_id="XM_002555357.1"
                     /db_xref="GeneID:8293677"
     CDS             694234..695820
                     /locus_tag="KLTH0G08470g"
                     /note="highly similar to uniprot|P39076 Saccharomyces
                     cerevisiae YIL142W CCT2 Subunit beta of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="KLTH0G08470p"
                     /protein_id="XP_002555403.1"
                     /db_xref="GeneID:8293677"
                     /db_xref="GOA:C5DMF5"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DMF5"
                     /translation="MQSVQIFGDQVTEERAENARMSAFVGAIAVGDLVKTTLGPKGMD
                     KLLQSASSDACMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAE
                     LLREAEKLVEQGRIHPQTIIEGFRIASAAALGALEKTAVDHSKNKESFYQDLVSIAKT
                     TLSSKILSQDKDHFSKLAADSIMRLGGSTNLEHIQVLKIIGGRLSDSFLDEGFILPKR
                     FGNNQPKRVENAKILIANTSLDTDKVKIFGAKFKVDSTSKLAQLEKAEKTKMKNKIDK
                     ISKFGINTFINRQLIYDYPEQLFTDLHINSIEHADFEGVERLALVTGGEVVSTFDSPE
                     KCKLGRCDLIEEVIIGEDTFTKFSGCQAGEACTIVLRGATEQVLDEAERSLHDALSVL
                     SQTTKETRTVLGGGCAEMIMSKAVDTAAQNVSGKKSLAVEAFARALRQLPTILADNAG
                     FDSSELVAKLRSSIYNGMTTSGLNLNDGSIADMRELGIVESYKLKRAVVSSASEAAEV
                     LLRVDNIIRAKPRTANRQHM"
     gene            complement(<695936..>697150)
                     /locus_tag="KLTH0G08492g"
                     /db_xref="GeneID:8293678"
     mRNA            complement(<695936..>697150)
                     /locus_tag="KLTH0G08492g"
                     /product="KLTH0G08492p"
                     /transcript_id="XM_002555358.1"
                     /db_xref="GeneID:8293678"
     CDS             complement(695936..697150)
                     /locus_tag="KLTH0G08492g"
                     /note="similar to uniprot|P39013 Saccharomyces cerevisiae
                     YNL084C END3 EH domain-containing protein involved in
                     endocytosis actin cytoskeletal organization and cell wall
                     morphogenesis forms a complex with Sla1p and Pan1p"
                     /codon_start=1
                     /product="KLTH0G08492p"
                     /protein_id="XP_002555404.1"
                     /db_xref="GeneID:8293678"
                     /db_xref="GOA:C5DMF6"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /db_xref="UniProtKB/TrEMBL:C5DMF6"
                     /translation="MPKLEQFEIKKYWQIFLGLKPQENKVTHDQVLPILYNSKLDSSI
                     LNKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNIDTVPDDLPDWLIPGSKAKLDAQ
                     RRKKESAEAQSAVPEASKPAPAAPAAPAAPAAPETPETPAVQQKAPELDWYISPANKE
                     LYASTYDACDTFTDGTVSYPALAGVVRSVFPNVSSSEVDRMWLLVNPQKSPSINRDPA
                     FYLIHALKQRNDMGCELPSELPHAIKEICNQHRVSYDLNSSQADVKRSSSPTKPADYH
                     ASASVRERSSNFRSGGGAEGEVGQIKKQIADLDAQPSGTPQVVSNPSDVPSDPNTARK
                     QFEELLRYREEQLRYSGNTHNGSINVKGIKEDLKTIAQQVGVLEQFLANKKQELQQLQ
                     SESRNLNYSGRA"
     gene            <697857..>700331
                     /locus_tag="KLTH0G08514g"
                     /db_xref="GeneID:8293679"
     mRNA            <697857..>700331
                     /locus_tag="KLTH0G08514g"
                     /product="KLTH0G08514p"
                     /transcript_id="XM_002555359.1"
                     /db_xref="GeneID:8293679"
     CDS             697857..700331
                     /locus_tag="KLTH0G08514g"
                     /note="similar to uniprot|P38928 Saccharomyces cerevisiae
                     YIL140W AXL2 Integral plasma membrane protein required for
                     axial budding in haploid cells localizes to the incipient
                     bud site and bud neck glycosylated by Pmt4p potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0G08514p"
                     /protein_id="XP_002555405.1"
                     /db_xref="GeneID:8293679"
                     /db_xref="GOA:C5DMF7"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="UniProtKB/TrEMBL:C5DMF7"
                     /translation="MRGAWVLLVGFVASLVRTQPYEAYAASKQLPPVAIAGEAFSFKL
                     SNDTFKSSVDEATQIQYEAYGLPSWLEFDSANRVLSGTPAQDDLGQDSGTSYVSYTLQ
                     GIDPADNGTLNKTYQLALSDGTQPAVAPSFNLLSLLKNSGYTNGKNALKLSPGEIFNV
                     SFDRDTFTNSSSATTFYGRSALYHAPLPSWIFFDESSLKFSGTAPVVNSEIAPESYFS
                     FSLIASDVTGYTSSEVMFDLVVGAHQFTTSIQNTLVVNVSSSGSFNYKLPMNYVYLDD
                     EPVSQSNISSIQLLDAPDWASVSNQSLSGTLLTGESSENLTIAIEDVYGDAVYLNFLV
                     ESTSKLFAVSSLPNVNATKDEWFQYSLLPSQFTDYDNTNVSVSFSNSSDSSSWLSFHS
                     SNLTLMGKVPDDFTSLAVDVSAKQSSDEQKLSFKVLGVSSLKKTSSSTSAQSSKTATS
                     SATSSASSPTATSSQTQAASPTNETQKKKSNNRTTAIACGVAIPVAVILALILFLLLW
                     RRKKNKSGAAQDQENTPRIGNPQLGNPANNPNVIGAVSPFGDENSLDDTSTAKRLAAL
                     NGMKLDAQGGSGSEGSTIDEKAECGSLSSSSSDSYHDAAFTASTDALVPRDESDQYFD
                     SNKHTSSVYLNSEPTNRKSWRFSAAGAAANRNTRESYNSLNTVSTAELFSTQIAGNKS
                     LPKDPRKSSLGMRDSVFMGNLSNPARGTRDGSSSNSGSLSASNVAKSSEGLKESTLPH
                     LKEIPHDENSFHSQITASSSDDFIPVKDGNNYTWIERINNAEVKTPERKRSLKRLVSL
                     PNKSGVGVCDANDIQGQEPEVDASMD"
     gene            complement(<700491..>702065)
                     /locus_tag="KLTH0G08536g"
                     /db_xref="GeneID:8293680"
     mRNA            complement(<700491..>702065)
                     /locus_tag="KLTH0G08536g"
                     /product="KLTH0G08536p"
                     /transcript_id="XM_002555360.1"
                     /db_xref="GeneID:8293680"
     CDS             complement(700491..702065)
                     /locus_tag="KLTH0G08536g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G08536p"
                     /protein_id="XP_002555406.1"
                     /db_xref="GeneID:8293680"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5DMF8"
                     /translation="MLRSLRPRSGTALKTLKPSMPQQRVRMLHHKDDGKSTDASTQPD
                     AAATTLTDKYEHKRLSNVPKTAKGYEATWLNALAERQKQLAQGKIIDSYVYSSVKSTE
                     VGEKTRKDSFAYLALPFREDASVADFYVNAAGRLRMGQIFQDLDALAGRIAYRHTSPA
                     QPVIVTASVDRIYLLKSIDFMADYNIVLSGSVVWTGRSSMEIAIKATAIKGDLPAEIT
                     EDSLAAEDTFLTASFTFVARNPETHKSLAVNKLLPLNEKEWMDFRRAESHNAAKKLRA
                     SNESLDTNPPTGEESKIIHNMWVASKELSKLSHKPPNVMSMKDTNAKSTMFMQPQYRN
                     RHSYMIFGGYLMRQTFELAYCAAASFSHAFPRFVSLDSTHFKAPVPVGSILHMDATVV
                     HTEHLFDRSSKPKVTTVTHKSADGNTVFHFDSSPVNELSTQKGALLSKPGTLIQVKVD
                     TIVQELASEKKNSSGSFIYSFYVHRDADEKTIGKPGYTTVIPETYSEMIEYISARRRA
                     IDTAAYANTLRRNNKL"
     gene            complement(702430..702502)
                     /locus_tag="KLTH0G08558r"
                     /db_xref="GeneID:8293681"
     tRNA            complement(702430..702502)
                     /locus_tag="KLTH0G08558r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:8293681"
     gene            <703446..>704993
                     /locus_tag="KLTH0G08580g"
                     /db_xref="GeneID:8293682"
     mRNA            <703446..>704993
                     /locus_tag="KLTH0G08580g"
                     /product="KLTH0G08580p"
                     /transcript_id="XM_002555361.1"
                     /db_xref="GeneID:8293682"
     CDS             703446..704993
                     /locus_tag="KLTH0G08580g"
                     /note="similar to uniprot|P48233 Saccharomyces cerevisiae
                     YNL083W SAL1 Probable transporter member of the Ca2 -
                     binding subfamily of the mitochondrial carrier family with
                     two EF-hand motifs Pet9p and Sal1p have an overlapping
                     function critical for viability polymorphic in different
                     S. cerevisiae strains"
                     /codon_start=1
                     /product="KLTH0G08580p"
                     /protein_id="XP_002555407.1"
                     /db_xref="GeneID:8293682"
                     /db_xref="GOA:C5DMF9"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DMF9"
                     /translation="MTLPEETEEQRDRRFKTLFSTIDINGTGKVSLEDLAEAFKRTNH
                     PLKSSPEAIDQIFRSLDCNGDSVVDFDDFKKYAATAESQIKQGFLRLDRDNDGRIRTS
                     DLSTYLSSLARGKEPRPEKPSTFKEFVKWAFVPKKKGTENSPYITYDQWRDFLLFMPR
                     KKGSRLHTAYSYFYLFNEDVDLSSEGDVTLINDFIRGFGFFVAGGISGVISRTCTAPF
                     DRIKVFLIARTDLSSTFLKSKDTLLERNPNADLSKIKSPLVKAATTLYRQGGIRAFYV
                     GNGLNVMKVFPESAIKFGSFELAKRVMSKLEGVKDNSDLSRLSTYIAGGLGGVMAQFS
                     VYPVDTLKYRVQCAPLNAHSKGRELLFSTAREMYKEGGLRLFYRGVTVGVMGIFPYAA
                     LDLGTFSALKKWYITRQARICGLPEDQVTMSNMFVLLMGAFSGTVGATVVYPVNLLRT
                     RLQAQGTYAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSISYLCYENL
                     KRGMNLE"
     gene            complement(<705083..>705814)
                     /locus_tag="KLTH0G08602g"
                     /db_xref="GeneID:8293683"
     mRNA            complement(<705083..>705814)
                     /locus_tag="KLTH0G08602g"
                     /product="KLTH0G08602p"
                     /transcript_id="XM_002555362.1"
                     /db_xref="GeneID:8293683"
     CDS             complement(705083..705814)
                     /locus_tag="KLTH0G08602g"
                     /note="similar to uniprot|P38927 Saccharomyces cerevisiae
                     YIL139C REV7 Subunit of DNA polymerase zeta which is
                     involved in DNA repair required for mutagenesis induced by
                     DNA damage"
                     /codon_start=1
                     /product="KLTH0G08602p"
                     /protein_id="XP_002555408.1"
                     /db_xref="GeneID:8293683"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:C5DMG0"
                     /translation="MFKVVEKWLQIYFKCIINVVLYYRNVYPKESFDWTTYQAFNLPR
                     HIPLNRHPQLQEYVETLVTDVISKLGYIKNFNLRIVNQEDGACIERYVLDFSEFRHEE
                     VGNTTELEIFDEMRSSLNSLIAQLEKLPKIRPGSVTFEIVIDSEGLDLGHRMNRVHTL
                     KERLEQEQDTNWVKCSEGSFTAEPRPKRSQAQDPRIKMIALAGCDSGPLVIYQFMERL
                     LAPTGESLSQVYESSQTSESSVLFS"
     gene            <705919..>708639
                     /locus_tag="KLTH0G08624g"
                     /db_xref="GeneID:8293684"
     mRNA            <705919..>708639
                     /locus_tag="KLTH0G08624g"
                     /product="KLTH0G08624p"
                     /transcript_id="XM_002555363.1"
                     /db_xref="GeneID:8293684"
     CDS             705919..708639
                     /locus_tag="KLTH0G08624g"
                     /note="similar to uniprot|P14242 Saccharomyces cerevisiae
                     YNL082W"
                     /codon_start=1
                     /product="KLTH0G08624p"
                     /protein_id="XP_002555409.1"
                     /db_xref="GeneID:8293684"
                     /db_xref="GOA:C5DMG1"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:C5DMG1"
                     /translation="MSSKIAAINDADVHRITSGQVIIDLASAVKELLDNSIDSGADQV
                     VCTFKNYGLESLECSDNGSGVPEDSYESLALKHYTSKISSFEDVSQVTTLGFRGEALS
                     SLAAIASLVVTTTTQPPKAARLEYNFKGELVKKTVTSRNKGTTVHVSQLFNNLPVRKK
                     EFTRNHKRQFSKCIMLLQAYTIIQERMKISVWHITGNGRRSLVLSSTKDRGIPKRIIG
                     VFGSSAMQGLSDIHLTLQISPKRSFSSQLSGAEVSSGSPEYIIVVSGYISRNTFGCGR
                     TAKDRQFIYINQRPVIYPSLAKSCNEVYRTHNNVQYPVFVLNFELSPEFIDVNVTPDK
                     RTVLLHAESSVIDAFREALADYYSEQEMVLPISNTHTVKVDNDNTEPKVAKPGVMSQE
                     LDGEYNNDVGEDSRQTLDGRIDTGPYRENGPKTESPESEEREALFDLSNAKVSNKMIE
                     KSLPQPNLFVDEPDSPSENNATTAKAPAPEAIVKEVIGTDNEERTAKRAADYELNINK
                     KQKTLDPFVNPSQEQDSDLYLRGENSISQEPITLQIGDKKIEEKAILTRDNRLLFSSN
                     PKAPQSCSCSSDNEESDSESLNQSAITNVIGSERAPSDTGAENSYPIIRPNADSYARK
                     APKSSWESAAIQKSSNDCVSLTTAITVRLQSIKKSFSHIYQLMESRKGTQHETHYQKN
                     DKLDDFEEGERYLTLSVSKSDFKKMEIVGQFNLGFILVTRRKSGKFDLFIIDQHASDE
                     KYNFEKLQKNTVFKSQKLLAPQIVEMSIIDELVMMDNLEVFEKNGFKLEIDEEQPQGC
                     RVKVVSLPVSRKTLFDMNDLHELIHLVKESDGLSKDSIRCSKIRAMHAMRACRSSIMV
                     GRPLVKKSMLRVVRNLSELDKPWNCPHGRPTMRHLMELRDWDSFNEDYKL"
     gene            complement(<708704..>709153)
                     /locus_tag="KLTH0G08646g"
                     /db_xref="GeneID:8293685"
     mRNA            complement(<708704..>709153)
                     /locus_tag="KLTH0G08646g"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_002555364.1"
                     /db_xref="GeneID:8293685"
     CDS             complement(708704..709153)
                     /locus_tag="KLTH0G08646g"
                     /note="highly similar to uniprot|P53937 Saccharomyces
                     cerevisiae YNL081C SWS2"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_002555410.1"
                     /db_xref="GeneID:8293685"
                     /db_xref="GOA:C5DMG2"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:C5DMG2"
                     /translation="MVVHILGKGFKGKEVIKIALASKFYGIGLKTSETLCAKLGFYPW
                     MRMHQLSEPQIMSITSELSTMTIEGNARAVVKENIALKRRIGSYQGMRHALNLPVRGQ
                     HTRNNAKTARRLNRVDRRGFHTLREEAIEQPKSSLRKLWTSLRKFTS"
     gene            complement(<709393..>710451)
                     /locus_tag="KLTH0G08668g"
                     /db_xref="GeneID:8293686"
     mRNA            complement(<709393..>710451)
                     /locus_tag="KLTH0G08668g"
                     /product="KLTH0G08668p"
                     /transcript_id="XM_002555365.1"
                     /db_xref="GeneID:8293686"
     CDS             complement(709393..710451)
                     /locus_tag="KLTH0G08668g"
                     /note="similar to uniprot|P53938 Saccharomyces cerevisiae
                     YNL080C"
                     /codon_start=1
                     /product="KLTH0G08668p"
                     /protein_id="XP_002555411.1"
                     /db_xref="GeneID:8293686"
                     /db_xref="GOA:C5DMG3"
                     /db_xref="InterPro:IPR021100"
                     /db_xref="UniProtKB/TrEMBL:C5DMG3"
                     /translation="MEDTLERNAEQLPVPLESRSSQIHIHHHHHYHRRTASEGGSQGK
                     REAGSSKKNTYRSIKSLTLNNLDARQHFLIAVCRDVSLLPPLLSLAHSLKKAWSLWYR
                     KDMLYATDNNSGSLTMSFTKLWQTYRTLRTQASSGGTDLSSQLITARSSEYILCSLWC
                     VVSAYLTYAILDSLMVRWIVKYSTIAAILRMFSMSLLIITVEMLLLSSLSPKGDYYLH
                     TWILISCVLTGAYIWQSFLTSDLSYVEQNPISAGSTSAYGRRSSSSHSLSALSDPTNA
                     SQEDLAQTASRKKKNAHTVFNFAKNKQIHFYNITVFCVVPVGFASFITMIGLLRNLVI
                     QRLDVEQLERIIREVYND"
     gene            complement(<711026..>711937)
                     /locus_tag="KLTH0G08690g"
                     /db_xref="GeneID:8293687"
     mRNA            complement(<711026..>711937)
                     /locus_tag="KLTH0G08690g"
                     /product="KLTH0G08690p"
                     /transcript_id="XM_002555366.1"
                     /db_xref="GeneID:8293687"
     CDS             complement(711026..711937)
                     /locus_tag="KLTH0G08690g"
                     /note="highly similar to uniprot|P49017 Saccharomyces
                     cerevisiae YML110C COQ5 2-hexaprenyl-6-methoxy-1
                     4-benzoquinone methyltransferase involved in ubiquinone
                     (Coenzyme Q) biosynthesis located in mitochondria"
                     /codon_start=1
                     /product="KLTH0G08690p"
                     /protein_id="XP_002555412.1"
                     /db_xref="GeneID:8293687"
                     /db_xref="GOA:C5DMG4"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR023576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMG4"
                     /translation="MYHTRIASGSALRAGIMARSSKCALLSSSRCLHAGMLLRKEGPA
                     ETTHFGSKTVAKEEKEKLVGSVFSNVAAKYDVMNDVMSMGVHRLWKDHFINKLDAGKR
                     PNSKEPLHFIDVAGGSGDIAFGLLDHAEHKFHDTESTMHIVDINADMLKEGEKRALNQ
                     GKYYNDPRVKFLVQNGETLDQIESNSKDVYTVSFGIRNFTDIQAGLNTAYRVLKPGGI
                     FYCLEFSKVDNPLVDLVYQQWSKVLPVMGSLVANDYDSYQYLVESIQRFPQPEEFKAM
                     IEKAGFESAGYEKLTFGVCAIHWGVKV"
     gene            complement(712719..712828)
                     /locus_tag="KLTH0G08712r"
                     /db_xref="GeneID:8293688"
     tRNA            complement(join(712719..712754,712793..712828))
                     /locus_tag="KLTH0G08712r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove"
                     /db_xref="GeneID:8293688"
     gene            complement(<713923..>714511)
                     /locus_tag="KLTH0G08734g"
                     /db_xref="GeneID:8293689"
     mRNA            complement(join(<713923..714390,714494..>714511))
                     /locus_tag="KLTH0G08734g"
                     /product="KLTH0G08734p"
                     /transcript_id="XM_002555367.1"
                     /db_xref="GeneID:8293689"
     CDS             complement(join(713923..714390,714494..714511))
                     /locus_tag="KLTH0G08734g"
                     /note="similar to uniprot|P40414 Saccharomyces cerevisiae
                     YIL138C TPM2 Tropomyosin isoform 2 actin- binding protein
                     that stabilizes actin filaments required with Tpm1 the
                     main tropomyosin for the formation and stability of actin
                     cables in vivo which direct polarized cell growth and the
                     distribution of several organelles"
                     /codon_start=1
                     /product="KLTH0G08734p"
                     /protein_id="XP_002555413.1"
                     /db_xref="GeneID:8293689"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:C5DMG5"
                     /translation="MDKIREKLSNLKLEAESWQEKYEEVKEQMKQLEQENTEKENQIK
                     SLTTKNQQLEDEVEKLEGELSEHKQLSEDSHNLRSHNENFTKKNQQLEEELEESDTKL
                     KETTDKLRETDLKAEGLERKVVSLEQERDDWEKKYEELTAKYDEAKKELDEIAASLEN
                     L"
     gene            complement(<715507..>716895)
                     /locus_tag="KLTH0G08756g"
                     /db_xref="GeneID:8293690"
     mRNA            complement(<715507..>716895)
                     /locus_tag="KLTH0G08756g"
                     /product="KLTH0G08756p"
                     /transcript_id="XM_002555368.1"
                     /db_xref="GeneID:8293690"
     CDS             complement(715507..716895)
                     /locus_tag="KLTH0G08756g"
                     /note="similar to uniprot|P53940 Saccharomyces cerevisiae
                     YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ) family
                     overexpression interferes with propagation of the [Psi ]
                     prion"
                     /codon_start=1
                     /product="KLTH0G08756p"
                     /protein_id="XP_002555414.1"
                     /db_xref="GeneID:8293690"
                     /db_xref="GOA:C5DMG6"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DMG6"
                     /translation="MKSVSNSELYDILGVSASASRQDIKKAYRVNALKHHPDKNGHSE
                     ESKLKFQQICKAYEILKDERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQF
                     FGGGSTTGSFFNDDMSFFGKRQGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKL
                     ALKRTRLCKKCKGEGGLKASQCYTCGGRGIRTETKRHGPMVQTWSSTCSDCAGRGSFM
                     KQKDICRDCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGD
                     VIIILEQLPHKAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGE
                     ILKPGAIKCVEGMGMPKSGGRFGNLYIRFDVAFPESLKPETVEALRAALGQEPGANSG
                     AGEPAVAVEGREVEEHVLSNFAPDLELSRDSYRKRQARGQSASSKRRKYADDDSNDSD
                     VADEQNGGCTVH"
     gene            <717652..>720354
                     /locus_tag="KLTH0G08778g"
                     /db_xref="GeneID:8293691"
     mRNA            <717652..>720354
                     /locus_tag="KLTH0G08778g"
                     /product="KLTH0G08778p"
                     /transcript_id="XM_002555369.1"
                     /db_xref="GeneID:8293691"
     CDS             717652..720354
                     /locus_tag="KLTH0G08778g"
                     /note="similar to uniprot|P40462 Saccharomyces cerevisiae
                     YIL137C RBF108 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G08778p"
                     /protein_id="XP_002555415.1"
                     /db_xref="GeneID:8293691"
                     /db_xref="GOA:C5DMG7"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:C5DMG7"
                     /translation="MFSLTNCVVPKRYNASLVLDHEKANFRGVLKVELEPRQGAKELS
                     EFSLHGENLIVLSAHIGNLKFTVKYDRPGKAITFSTDKPIDVSNGQRVEPLILEYIGK
                     INAIKTYKDATRGIFKTNYMDSETGSSDNYVIATHSQPGFARMILPCIDEVNHKAQFQ
                     LDITAHERFQIVSNTAAVSEERIPESQQKRVFFDTTPLMTPSLLAFVLGDLRSIESKV
                     ALPQGELPVRFLAAQQVELAAFGLDTVCKYLPALQEMFKLSFPIAKLDFALLPFLSDM
                     AMENFGLITIQQDNVLLGPTNLADASVQSRVEQLLVHELVHQWMGNYISFDSWDHLWF
                     NEAFATWCACEVLSNVKGADYFASDDYLFQLESCLKRDSIPESRSISDTCKSDHVAQT
                     ADAVDPQNYAKGISLIRSLQCSVGKENFKLALQEFVSDEKFHNRSIKPSEIWTFFGKK
                     LRSENIPNYMFSWVHTPSFPILHVTQESGKTTLQQHRVKSAPDQQFEDVPYHIPLFTR
                     LPDGSLDKNHALLTDRTLSLDYPVVSFNSNVQGYYRVSYESASCYEQIAQAISSGALS
                     ELDLYGIMRDLNDFIGNEIYQNKEHLDGLIHIISKTVPKIDNETLSKYYIGWSMGLKI
                     LEQLDLSVMRFASSGKDLDLEKLIIAPFFKRIDWPESFHGSKRDAYEIDVMAQVLSLG
                     KKLPEVQALCAKYFKKVLQGPKAAIPFELVGSIFTVVSFQNTTLKQWKKHFELAKSSQ
                     GIAPHVTGCSPADLQTVALETIGFSTSLELVQKALNFVLTNISLGGSEKALFGMSYNA
                     KEKCGNQCVRDVVWEWFIQHYDQWARKSLSGGSQESGKIKSTLMALSVIVFEMWLDTP
                     EKIDTFTAMKQSAFGTTLGVSEIWASVKDSQLSKMKIYQGLLGF"
     gene            complement(<720613..>721986)
                     /locus_tag="KLTH0G08800g"
                     /db_xref="GeneID:8293692"
     mRNA            complement(<720613..>721986)
                     /locus_tag="KLTH0G08800g"
                     /product="KLTH0G08800p"
                     /transcript_id="XM_002555370.1"
                     /db_xref="GeneID:8293692"
     CDS             complement(720613..721986)
                     /locus_tag="KLTH0G08800g"
                     /note="weakly similar to uniprot|P53939 Saccharomyces
                     cerevisiae YNL078W NIS1 Protein localized in the bud neck
                     at G2/M phase physically interacts with septins possibly
                     involved in a mitotic signaling network"
                     /codon_start=1
                     /product="KLTH0G08800p"
                     /protein_id="XP_002555416.1"
                     /db_xref="GeneID:8293692"
                     /db_xref="UniProtKB/TrEMBL:C5DMG8"
                     /translation="MCSEYSLLSQESIVVDLSIQNPRLSNALHCYPTSTSPSSPDSDR
                     LPFYQRTNAARALEDAEDMTDEEQEQSLIQPLIDAHNRSSDEPLRLKTTCATTALPQR
                     VPVPYRTHRPQHSQTVTILDESESEQSKPFVSQQLTMSQFDLQQTRNFEQRAKLRQQA
                     LEAHNSDSNNTLGILDKVCKWSRYSKRAQKRPQRTPSARSASSVRRAPSLSKRKDFSN
                     KSEMASFASSGNFIFHRGFSLRRAPGLPPRYKYRSRAELASAMDYVAPESTPVTDFTT
                     SQHFLTMQLKPPAFWQVLRLHPKFTYKFVSAGSLYRQSLNSQKGLHRNSIRRPSPLPQ
                     RVRTLRRSKSVPGSRKNITLQLQNPQLYDVWRHYVMSVVLQRIQFRMYLVNSSNSDKV
                     STSESDASQPLSRCSSLALQASWINDFGARNTRGDDTYAGSCKDEASSISSSGRHQGI
                     RRLRLVS"
     gene            <723401..>725035
                     /locus_tag="KLTH0G08822g"
                     /db_xref="GeneID:8293693"
     mRNA            <723401..>725035
                     /locus_tag="KLTH0G08822g"
                     /product="KLTH0G08822p"
                     /transcript_id="XM_002555371.1"
                     /db_xref="GeneID:8293693"
     CDS             723401..725035
                     /locus_tag="KLTH0G08822g"
                     /note="weakly similar to uniprot|P16547 Saccharomyces
                     cerevisiae YIL136W OM45 Protein of unknown function major
                     constituent of the mitochondrial outer membrane located on
                     the outer (cytosolic) face of the outer membrane"
                     /codon_start=1
                     /product="KLTH0G08822p"
                     /protein_id="XP_002555417.1"
                     /db_xref="GeneID:8293693"
                     /db_xref="UniProtKB/TrEMBL:C5DMG9"
                     /translation="MSSKKIIGGAAMVAAGYALYEYQVQRQQRHLNTGALTQAPHKDA
                     HLFEKKGGEAGSKLDQVTNQARDQVAGWAHDADRKVSSTMADVERAKANSSKWIGDQL
                     GEAQEAVTDRRDKYLERSGELNAIVEETNERKREGQNRISRLVTDARDTISADIRNIK
                     DGVSEDASSIKEAFVGAKKGTQDTADSLKRQASDVESDIKNKAGNARDTAVEAKESIF
                     NWGFSKAEKAKAVAIQEYDQANKHFNELRDKYNSEKGLFSSGDQELKKQVDEASKKLE
                     EYKKKLEDASSRYAKYTNDNINELSDKLEQEDRKLRKKGFFQWLRGDTSGSDKSKAHD
                     VDEVATKSVVGWGETAEALAREELDELVRNKKIGRSEAQRRLDELKKIKDEGWFTYKG
                     RNDEALAKRAAKALEGWGETASELAQEEYEEARRKTSNFNAPKTISDAVDTAKEKLDA
                     AKKNLDENASGLWSSGKEKSEELRQKAQQEYEQAQKDYSSSLQSLSEWSEKAKGKFWS
                     GADTALDATKSTADTLHAKAKEGLNSAQEYAKDKKE"
     gene            <725516..>727264
                     /locus_tag="KLTH0G08844g"
                     /db_xref="GeneID:8293694"
     mRNA            <725516..>727264
                     /locus_tag="KLTH0G08844g"
                     /product="KLTH0G08844p"
                     /transcript_id="XM_002555372.1"
                     /db_xref="GeneID:8293694"
     CDS             725516..727264
                     /locus_tag="KLTH0G08844g"
                     /note="weakly similar to uniprot|P34072 Saccharomyces
                     cerevisiae YNL076W MKS1 Pleiotropic regulatory factor
                     involved in Ras-CAMP and lysine biosynthetic pathways and
                     nitrogen regulation involved in retrograde (RTG)
                     mitochondria-to-nucleus signaling"
                     /codon_start=1
                     /product="KLTH0G08844p"
                     /protein_id="XP_002555418.1"
                     /db_xref="GeneID:8293694"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C5DMH0"
                     /translation="MMEETRSKSASGKHQPSKSKEPSNDPQSNSEADLSRQKFLKVAP
                     SLFTPEKLPLFDSLDLYTALIRSSKALEQGERLHNLSWRIMNKALLKDHELNKSKKRD
                     GVRNLYQVLNPANSGQFQRQQQPRQIPTPPRTHQRTASEMQPMQVMSAMQGTASEAKT
                     SPEQPRFPHIHHQKLPVRATSDLQIKRGLHRAQDPRPGHQPQQPHLQQLHVQHAQSKH
                     APNKQGARFTLGNDSSVSSPESSQMILASPDATVFAGKREGSAQANSMDASDAQKRKK
                     NHKRVAQPTRSAGSLFTPRPDDGPTASALPTKAISHDHIPKSLFGRKPTAHHKPAAPS
                     SENKVFFSSDDDESDWNSLSDDSELYDDEEDDQYYQKQWDKLMFSRSEQSKGGFHAGR
                     NTTPPPADKHDPKRSLLSGLFLNELANKAPTPPIMTPLTAQHPTLGESSVVAVGDVTP
                     ASLRASTSSFFPEGTQEKAPEPSAPSAIPPRYPRSRGSFSSIISDSTLQRYAHQSNAP
                     PTAQTILPTALSTHMFLPNNVHQQRMARSVLSRSALSERRESIDIPSKNRNNSFLKTR
                     MEISEEEEFARAKTGR"
     gene            <727640..>728491
                     /locus_tag="KLTH0G08866g"
                     /db_xref="GeneID:8293695"
     mRNA            <727640..>728491
                     /locus_tag="KLTH0G08866g"
                     /product="KLTH0G08866p"
                     /transcript_id="XM_002555373.1"
                     /db_xref="GeneID:8293695"
     CDS             727640..728491
                     /locus_tag="KLTH0G08866g"
                     /note="highly similar to uniprot|P53941 Saccharomyces
                     cerevisiae YNL075W IMP4 Component of the SSU processome
                     which is required for pre-18S rRNA processing interacts
                     with Mpp10p member of a superfamily of proteins that
                     contain a sigma(70)-like motif and associate with RNAs"
                     /codon_start=1
                     /product="KLTH0G08866p"
                     /protein_id="XP_002555419.1"
                     /db_xref="GeneID:8293695"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:C5DMH1"
                     /translation="MLRKQARERREYLYRKAQELQDSQLQQKRQLIKHALAQGKPLPK
                     DVAEDEQLQKDFQYDQTIQETIDDEYSATSGLAEPKVIVTTSRDPSTRLSQFAKEIRL
                     LFPSAVRLNRGNYIMPNLVDACKKSGTSDLVVLHEHRGVPTSLTISHFPHGPTAYFTL
                     HNVVLRHDILNAGNQSEVNPHLIFDNFTTPLGQRVVTILKHIFPPGPKKDSPRVITFA
                     NRGDFISVRQHVYVRTREGVELAEVGPRFEMRLFELRLGTLDNKEADVEWQLRRFVRT
                     ASRKDYL"
     gene            complement(<728865..>730604)
                     /locus_tag="KLTH0G08888g"
                     /db_xref="GeneID:8293696"
     mRNA            complement(<728865..>730604)
                     /locus_tag="KLTH0G08888g"
                     /product="KLTH0G08888p"
                     /transcript_id="XM_002555374.1"
                     /db_xref="GeneID:8293696"
     CDS             complement(728865..730604)
                     /locus_tag="KLTH0G08888g"
                     /note="some similarities with uniprot|P40463 Saccharomyces
                     cerevisiae YIL135C VHS2 Gene whose overexpression
                     suppresses the synthetic lethality of the hal3 sit4 double
                     mutation"
                     /codon_start=1
                     /product="KLTH0G08888p"
                     /protein_id="XP_002555420.1"
                     /db_xref="GeneID:8293696"
                     /db_xref="UniProtKB/TrEMBL:C5DMH2"
                     /translation="MSLRTRVCATPPLFRATLAPAIARNDTPRCARPQRATPRSQRAA
                     NALRRGRRSARLRPVLAARAGATGSTSRCTKDCFDRRARNPLAASTCSISTCCSSSSS
                     SSSVIDTHNRAKSLKSSDSFQNPTDPAATRQQRQSLRRDRNPVRQRLSHTQTHSPKTR
                     SSAFPLGVTSMDFDEDTYDTYEDASGELPSPVASERSMIFERNVEEPRAPGAAAAPAA
                     STTSAGSGHDSERAARDSASASGRHALEDLVAPALDASASIVNDQDTDLDNVEMIYSG
                     RPSTLGLDLALGRTRTNSFQNLPALSRAGSTASAISMSSAASAASGASCASCTSNASN
                     ATATDRPRVLRFYSYADMLSDENAHSRRPSLTQSTSSSLLRQSPQPSFSNPFSPSNRR
                     NSNSSGLSPGLAAPTLSSRHLPNHLTTCSRSPTLRASTPVGQPTPTATQLPAAGPQAR
                     KERNKFHLESSGSDCSTSDEESDQDMATSPNSPTLMQSAANSQPLYNTVTGPRLTRAS
                     TQNSFKKARPPYRVRTYSSASSMSPLFHASRASFSNQGAAQNLNDVLYDDSLQTSSVG
                     DVLRKKVSNAGDV"
     gene            730767..730838
                     /locus_tag="KLTH0G08910r"
                     /db_xref="GeneID:8293697"
     tRNA            730767..730838
                     /locus_tag="KLTH0G08910r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (CTG) cove score=70.60"
                     /db_xref="GeneID:8293697"
     gene            731135..731247
                     /gene="SNR68"
                     /locus_tag="KLTH0G08932r"
                     /db_xref="GeneID:8293698"
     ncRNA           731135..731247
                     /ncRNA_class="snoRNA"
                     /gene="SNR68"
                     /locus_tag="KLTH0G08932r"
                     /product="snR68"
                     /note="C/D snoRNA monocistronic SNR68"
                     /transcript_id="XR_002432212.1"
                     /db_xref="GeneID:8293698"
     gene            <731432..>733006
                     /locus_tag="KLTH0G08954g"
                     /db_xref="GeneID:8294193"
     mRNA            <731432..>733006
                     /locus_tag="KLTH0G08954g"
                     /product="KLTH0G08954p"
                     /transcript_id="XM_002555375.1"
                     /db_xref="GeneID:8294193"
     CDS             731432..733006
                     /locus_tag="KLTH0G08954g"
                     /note="similar to uniprot|P32048 Saccharomyces cerevisiae
                     YNL073W MSK1 Mitochondrial lysine-tRNA synthetase required
                     for import of both aminoacylated and deacylated forms of
                     tRNA(Lys) into mitochondria"
                     /codon_start=1
                     /product="KLTH0G08954p"
                     /protein_id="XP_002555421.1"
                     /db_xref="GeneID:8294193"
                     /db_xref="GOA:C5DMH3"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5DMH3"
                     /translation="MLRPASPLARSLARGLSTALDFARRNEAIAARARDFYPSLSRVA
                     PATATVAGFVRKYCDLEHDRPDLREVLRARVDSVRVAGKNMCFVDVSSARCSTQLILN
                     YNVMAAHAAPGAAALSRQQFFQHVQDLRPGDHVQACGFPGRSQRERTLSLKCTQLTTL
                     LAPALRALPPRLSDPAKRNQNRVLDYLVNGHDALRVRHSVLSALREFLDARGFLEAET
                     PVLSPKANGAAAEPFTTRTNATNAALQLRVAPELWLKRLVVAGVDRVYELGRVFRNEG
                     VDASHNPEFTTLEFYQTYASMEDLIALAEQLLLHVLERADTARARELKAVLLANGGRF
                     ARVEFLPTLQRETGIDFSQLDLADPRALAAALEARGIELDTADRSPQQILNALCARYI
                     EDRHCRGSLPTLIFHHPTVMSPLAKGNPDDDMLTTKRFEVFIGGKEYINAYEEENCPQ
                     AQLQKFEAQQQAQEAYGDRESLAIDHAYVDAMKWGMPPIGGFGVGIDRLCMLLTGDTR
                     IERVLSFGTIDDIGKQ"
     gene            <733113..>734141
                     /locus_tag="KLTH0G08976g"
                     /db_xref="GeneID:8293699"
     mRNA            <733113..>734141
                     /locus_tag="KLTH0G08976g"
                     /product="KLTH0G08976p"
                     /transcript_id="XM_002555376.1"
                     /db_xref="GeneID:8293699"
     CDS             733113..734141
                     /locus_tag="KLTH0G08976g"
                     /note="similar to uniprot|P53942 Saccharomyces cerevisiae
                     YNL072W RNH201 Ribonuclease H2 catalytic subunit removes
                     RNA primers during Okazaki fragment synthesis cooperates
                     with Rad27p nuclease"
                     /codon_start=1
                     /product="KLTH0G08976p"
                     /protein_id="XP_002555422.1"
                     /db_xref="GeneID:8293699"
                     /db_xref="GOA:C5DMH4"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:C5DMH4"
                     /translation="MYILTTEKASSSPNFPGLTKAIKRKRSTTMSANCGSYRTPKSPE
                     PLAELPPTVLEAKDSLHSRTFYSEVPQQIRDSGCAVILGVDEAGRGPVLGPMVYGISY
                     CTREYQDEVLKKRYAFDDSKKLTDPVRRDLFQRMYTGEIDQVGYATTCISACDISSGM
                     LRFPPEKNYNLNEQAHDVTIALIRGVLERGVAVEHVYVDTVGPPATYQRKLEGLFPSI
                     KFTVAKKADSLFCVVSVASVVAKVTRDVLIELLRARPDEVLGSGYPSDAKTTAWLRSN
                     RTALFGWPLQTVRFSWQTSQTLLDRNPDAVPIEWEDDYIGKGSQSMAAMFQPAEKAVT
                     LDNWYSVE"
     gene            <734671..>736086
                     /locus_tag="KLTH0G08998g"
                     /db_xref="GeneID:8293700"
     mRNA            <734671..>736086
                     /locus_tag="KLTH0G08998g"
                     /product="KLTH0G08998p"
                     /transcript_id="XM_002555377.1"
                     /db_xref="GeneID:8293700"
     CDS             734671..736086
                     /locus_tag="KLTH0G08998g"
                     /note="similar to uniprot|P12695 Saccharomyces cerevisiae
                     YNL071W LAT1 Dihydrolipoamide acetyltransferase component
                     (E2) of pyruvate dehydrogenase complex which catalyzes the
                     oxidative decarboxylation of pyruvate to acetyl-CoA"
                     /codon_start=1
                     /product="KLTH0G08998p"
                     /protein_id="XP_002555423.1"
                     /db_xref="GeneID:8293700"
                     /db_xref="GOA:C5DMH5"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:C5DMH5"
                     /translation="MSSFIRTVPRIRSAVLRSARLQLRTYASSYPPHTVIGMPALSPT
                     MTQGNIAVWNKQVGDKLEPGEAIAEIETDKAQMDFEFQEDGFLAKILEPAGAKDLPVG
                     KPIAVYVEEEGDVAAFKDFKVEETAPAKSEKPVADAKPAEDNKSAKDDKPAKKPSASK
                     QAASGKPAGDRIFASPLAKNIALQHGVALKSVTGTGPHGRITKSDVEEFLSKSPAASA
                     GGSAAAGTAAAAAAPAGPGAQYEDIPISNMRKIIGDRLLESTSGTPAYIVSSQISVSK
                     LLKLRQSLNASGKDQYKLSVNDMLIKAVTVAAQRVPDANAYWLANEGVIRKFKNVDVS
                     VAVATPNGLLTPIVKNAHAKGLVSISSEIKELGKRAKINKLKPEEFQGGTICISNLGM
                     NNAVSMFTSIINPPQSTILAIGTVQRVPVEDAGAEYGFIFEDKINITGTFDHRTIDGA
                     RAGDFMRELKKVVENPLEMLL"
     gene            <736937..>737866
                     /locus_tag="KLTH0G09020g"
                     /db_xref="GeneID:8293701"
     mRNA            <736937..>737866
                     /locus_tag="KLTH0G09020g"
                     /product="KLTH0G09020p"
                     /transcript_id="XM_002555378.1"
                     /db_xref="GeneID:8293701"
     CDS             736937..737866
                     /locus_tag="KLTH0G09020g"
                     /note="similar to uniprot|P40464 Saccharomyces cerevisiae
                     YIL134W FLX1 Protein required for transport of flavin
                     adenine dinucleotide (FAD) from mitochondria where it is
                     synthesized from riboflavin to the cytosol"
                     /codon_start=1
                     /product="KLTH0G09020p"
                     /protein_id="XP_002555424.1"
                     /db_xref="GeneID:8293701"
                     /db_xref="GOA:C5DMH6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DMH6"
                     /translation="MAHEFTPLQREIIAGLSAGTLTTVATHPLDLVKLRLQLLATSHQ
                     SHGYTEVIKTIVTDSKANGTFIREAYRGLGVNLVGNSIAWGLYFGLYRFSKDAVYRMW
                     TKDPDSDGQTSFQKDSTMGPLFYLASAALSGIATAVLTNPIWVVKTRIMSTNARAAHG
                     YKTMWDGIRKIYTQEGLTGFWRGLLPSLFGVGQGAIYFTAYDSLKHRYFASRGIHKEQ
                     KLDNLENIALTSVSRMVSVSAVYPLQLLKSNLQSFEAVKQQNSYKLWALIRSIYYKDG
                     AKGLYKGLSANLVRALPSTCITFCIYENMRHWL"
     gene            complement(<738010..>738847)
                     /locus_tag="KLTH0G09042g"
                     /db_xref="GeneID:8293702"
     mRNA            complement(join(<738010..738578,738814..>738847))
                     /locus_tag="KLTH0G09042g"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_002555379.1"
                     /db_xref="GeneID:8293702"
     CDS             complement(join(738010..738578,738814..738847))
                     /locus_tag="KLTH0G09042g"
                     /note="highly similar to uniprot|P26784 Saccharomyces
                     cerevisiae YIL133C RPL16A N-terminally acetylated protein
                     component of the large (60S) ribosomal subunit, binds to
                     5. 8 S rRNA; has similarity to Rpl16Bp, E. coli L13 and
                     rat L13a ribosomal proteins; transcriptionally regulated
                     by Rap1p and to YNL069C uniprot|P26785 Saccharomyces
                     cerevisiae YNL069C RPL16B N-terminally acetylated protein
                     component of the large (60S) ribosomal subunit, binds to
                     5. 8 S rRNA; has similarity to Rpl16Ap, E. coli L13 and
                     rat L13a ribosomal proteins; transcriptionally regulated
                     by Rap1p"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_002555425.1"
                     /db_xref="GeneID:8293702"
                     /db_xref="GOA:C5DMH7"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:C5DMH7"
                     /translation="MSSFEPVVVIDGKGHLLGRLASTVAKQLLNGQKIVVVRAESLNI
                     SGEFFRNKLKYHDFLRKATAFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAAMER
                     LKVFEGVPPPYDKKKRVVVPQALRVLRLKPGRKYTTVGKLSTSVGWKYEDVVAKLEEK
                     RKVRSAEYYAKKKAFNKKVTAAKAATSESEAAQKLATLGY"
     gene            complement(<739377..>740039)
                     /locus_tag="KLTH0G09064g"
                     /db_xref="GeneID:8293703"
     mRNA            complement(<739377..>740039)
                     /locus_tag="KLTH0G09064g"
                     /product="KLTH0G09064p"
                     /transcript_id="XM_002555380.1"
                     /db_xref="GeneID:8293703"
     CDS             complement(739377..740039)
                     /locus_tag="KLTH0G09064g"
                     /note="weakly similar to uniprot|P40465 Saccharomyces
                     cerevisiae YIL132C CSM2 Protein required for accurate
                     chromosome segregation during meiosis"
                     /codon_start=1
                     /product="KLTH0G09064p"
                     /protein_id="XP_002555426.1"
                     /db_xref="GeneID:8293703"
                     /db_xref="UniProtKB/TrEMBL:C5DMH8"
                     /translation="MEPAPALLPNDKVVLWFDSDEECISKMMATFLTVDSAEQSAKTL
                     YFIDAMDRFPIKEFCRLVPPKENAAVYENVRIMASLDMEELSSVVSQVVSSAQMSHST
                     RLRDPSAPQPQVCVVIRGLDVIFRNTALKDQARAHLLLKDIMLRVRMMANTDPLLLKA
                     VLLFEVQQKPRGINLPGSNDSSQNAPPPSKRPRSDYRSGAPNNLNSIAVYLMKFYADR
                     VI"
     gene            complement(<741018..>743542)
                     /locus_tag="KLTH0G09086g"
                     /db_xref="GeneID:8293704"
     mRNA            complement(join(<741018..743258,743495..>743542))
                     /locus_tag="KLTH0G09086g"
                     /product="KLTH0G09086p"
                     /transcript_id="XM_002555381.1"
                     /db_xref="GeneID:8293704"
     CDS             complement(join(741018..743258,743495..743542))
                     /locus_tag="KLTH0G09086g"
                     /note="similar to uniprot|P41813 Saccharomyces cerevisiae
                     YNL068C FKH2 Transcription factor of the forkhead family
                     that regulates the cell cycle and pseudohyphal growth also
                     involved in chromatin silencing at HML and HMR potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0G09086p"
                     /protein_id="XP_002555427.1"
                     /db_xref="GeneID:8293704"
                     /db_xref="GOA:C5DMH9"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:C5DMH9"
                     /translation="MSAHKGQPLGNPQQNQDLVNAVISVLGTPEQPTTVASVFSNERN
                     LATEVQAYAKIAGRDWTFYVKHLVITIGRNTDPQDHTVDIDLGPAKVVSRKHATIKYN
                     LAEGFWELQVQGRNGAKVDFQRVSAGPQADPVQLQSGSILDIGGTQMMFILPDRSPYV
                     EQRALDHLAPKLNAAFGNATGNPNPLLQDALRDASQPKNAVKAFRMYNSYENPYAPSA
                     VSSYNAPQMGAGYGSIMDPGLLAANDIASDLSRDENKNVKPPFSYATMITQAILSNPE
                     GVLSLADIYKYISSNYAYYRYIKTGWQNSIRHNLSLNKAFEKVPRKPNEPGKGMKWRI
                     SKDYQKDFLDKWQSGKISKVRRGSSVARQLQLHMTKFNSLPIQDTSSESPAQPPLSDQ
                     QEQEQQQEQQQQHESQQERQHQQHQHQQQQQQQQQHLQQQHLQQQQLQHQQQQQQLQQ
                     QHQQQFQQQQFHQKQFRPQQLPHLQQLHTSSDQLPDQSQRQNLQKLQQSAPASQFYGT
                     LQPNVPLPPTSSLSPLVPQRPSSPQMQPPISIPSRQPTSTYPTLPRPTTRTHNSVTSG
                     SSLPGSAARISPTQDTLLRSPTKPFHITAMEAYTPERGSSHVNRSPTGSNSQQNADSR
                     LSTRQASQTAQSSPGVWNLLQFSSVNNTPAGFRAMEEAAQANNMGDGPRPLQTGPQMG
                     RATQDNPNLPTLHINGSAAETDKMRAQHDMGGNSISGKGNSSAEYVSSPIKNHNRDDA
                     PGSKELMLDREGAKISVVDERT"
     gene            <744062..>746410
                     /locus_tag="KLTH0G09108g"
                     /db_xref="GeneID:8293705"
     mRNA            <744062..>746410
                     /locus_tag="KLTH0G09108g"
                     /product="KLTH0G09108p"
                     /transcript_id="XM_002555382.1"
                     /db_xref="GeneID:8293705"
     CDS             744062..746410
                     /locus_tag="KLTH0G09108g"
                     /note="weakly similar to uniprot|P40467 Saccharomyces
                     cerevisiae YIL130W ASG1 Proposed transcriptional activator
                     member of the Gal4p family of zinc cluster proteins"
                     /codon_start=1
                     /product="KLTH0G09108p"
                     /protein_id="XP_002555428.1"
                     /db_xref="GeneID:8293705"
                     /db_xref="GOA:C5DMI0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DMI0"
                     /translation="MSDLQNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN
                     QPSKRVATASASTAAAALTPPYGVSQPSRVKPHKALRDAKLQLSKYKMLFGRLFPQMP
                     PIEQVDVASFANAFQGFVASNEEFQNATKNSHVTVPVSSASGAGSPATASATPEGSVG
                     VDAIEGIDGSIQSHEGREIKIILPPKPVALHFIQVTWEQCCVLFRFYHRPSFIASLDE
                     LYETDPHDYTHEQMHFLPLCYAVMAVGALFSKSMQSTGTPSDTASPGKFMQDEGYKYF
                     VAARKLIDITNARDLNSIQAIVMLFIFLQCSARLSTCYTYIGVAMRNALREGMHRNLN
                     ADTHSYNPIEIEMRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEFITK
                     DGLHFEKQGNVLSSAGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLELKLR
                     QWLDNLPPELAPGSNDVPPKYERANQLLHLSFLQVQVILYRPFIHYLSATVPTKAADS
                     LSIRRARNCISVARTVVKLAKKMMEKKTLTGSYWFSIYNIFFSVAGLIFYLHEVAPTD
                     EAGELEYSEIQKDAELGKGVLLYLKDTSMAANRTYNLLNMLFEKFNSKTIKWSQVKQG
                     EFKASAPESSQQAPIKTPPVNMDTEPSTYNLDPGNMDLLAFENPQDATLQSTSTISGV
                     NTMNTINTSNMLMNKDFFGVNDSLEMDKFFNLSENGSLDEKAAPLQPPDIQLKEEYEV
                     PSEQNMSESYVPGAFDQLDVQLFGRYLPPYMSQQNESPKFGS"
     gene            complement(<746572..>754329)
                     /locus_tag="KLTH0G09130g"
                     /db_xref="GeneID:8293706"
     mRNA            complement(<746572..>754329)
                     /locus_tag="KLTH0G09130g"
                     /product="KLTH0G09130p"
                     /transcript_id="XM_002555383.1"
                     /db_xref="GeneID:8293706"
     CDS             complement(746572..754329)
                     /locus_tag="KLTH0G09130g"
                     /note="similar to uniprot|P40468 Saccharomyces cerevisiae
                     YIL129C TAO3 Identified in a hunt for mutants that
                     activate OCH1 transcription Transcriptional Activator of
                     OCH1"
                     /codon_start=1
                     /product="KLTH0G09130p"
                     /protein_id="XP_002555429.1"
                     /db_xref="GeneID:8293706"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:C5DMI1"
                     /translation="MNTGFTFPPNEGESKIGGFKFPPSADDAAEEPSAGDESATPDPY
                     VEQQAQSDDKNAVTESNDPAQPTETSPGIIRASTPLIAEQIHEPTGLASSEVNVTQAP
                     INAASTSKSFVNEYAENMRQHLATDWKSPSEYALHILFTKFVRHAGSKLNLCLQYPLD
                     SEPPIVDLLGEGVDQAFDQIIESLGYISKNKPKPVIDAMMFWRKTKSEVAAVAAENVE
                     KLLQEYDHIKQSFAIQESAKSPHSGTPTHRTNAKSGSSSSKFSHKRNNSSKSYASSNS
                     AAELRLRVVEDQIEAAKETAFQADRKSLISIYILCRVLIEIVRQGPDSSDDDLHEKLE
                     EIVFTQLKTTDPISISSSIIKSSNWNSFAELLGCMSETKFVAVSDRFIADLEKMPSLL
                     PRELEPSVHLLILGMRYLRLKNYPLEQFEESADFIKSLAKFFATSQNHSIRLAYAEVI
                     SQLLLPLAGSLTAEVNHPTWVEAMALILDTCKKLQTDNKFWSSSFKLTVTILCVSPQE
                     LFSEHWMPLLENNIIKVKSKSLDERVVFATGLSRLMWVYLFRCTETLNNTERRLKKLF
                     SLFLSTKKKDNWITTDMDLINPLTDMLVTIGSLHPVFIVENIIIPLTRASFNGSTLEN
                     LSFEKLILAIDSYRGLLVSSERPEFPENDCRFYELNLNKVSGKMGNAVASDHEEVCKT
                     FYHLFLLLDSSIGSEVWSPENEHQRQPTTPFSGISSFNFKFSNDNSSNNNRSLNAALF
                     AALIEAMPCCLTVSSSIPFKSTIEILARNAVHRNLLVASSSQSALKALALKKNPYTLI
                     TWFAKYSFDFDEKTQSSYNMAYLSSLEYRKLLVLYIELLQCWLSEFKADAEKKAAAET
                     SLGGHGPSIIDNEGTDTKDTEKYEWKNIATVIEDVEGNGLFFLCSHDHTIRRLAIQIL
                     RIVSKFDEAMLEKTHGLEKNHARSSSRFVAESGTRLIDLLQSYNYSNLLESRKVTISV
                     AEKARLGKLNAKYKNGILIKLAESDYGVDAALWMRAFPKLLTLVFDQSPMTMALCRSI
                     VCIRLVQLHEIVLSIASNTLSTPKEVSPEVIVNQWKLYLIVACSSLTSTTDQKLHIPT
                     TNYQHGRNKSQQIFTVQHQKIKSATSIFKMVLPLLNCENSFVKDAIITGLSSMNVNIF
                     KAYLQSVDRFLGSWRVGSSSNGMRVEMFHILAVLAPFFTHETIIEDEWILRKVSQYLK
                     DAKKFLEEKEVQTSFNYQQLRSYFASLLSSFYLAVKNLPLVEDLFPFEARASCFNFLK
                     EWCGYGQYSSMSNGRYNEMRNKDEFRHNGTLSTAIEFQKSRLELITLETMANLCCDTI
                     TKKINDVPGSPIIISFDISGLICWIDSLFVAQDERVCKLGTVALKGLLENNKENAQLY
                     KDTLMQYSLHNLDTRVATLYYTAVCASLLEMETFILPEDDMVSLGLSGIYNESSEVRS
                     YSIDLLSAIETKIYKSSYTKVFKERLANDSKTVYKSTAKEISTIFAEIPSTEVRLKIF
                     SIMCRSINYLKSELKQDILTLLVPWVHKFTLKSIEDGGTFMILNNLFAMTVEHNNRYP
                     MEIEQLWISLGKGNGFQNIHVALDYILITSTSSRNPTFVKRAKDVVLYLANVPGGMGV
                     IDSFMINLEPKHMIPETAPSKKNPAVEDKYAYVANVWKLLGYRGREVVFSKAQLSIVF
                     LVNLLTIPNESMLTKVPLLLHICFSLLDHYVPIIQESAAKILSDLIFGLVPTHEESEE
                     TVAMIKDRTQIWSYDNLMKDKNGARSPKAMDSLIRNVVSLFSDFETLQRDWQNIALKW
                     ATSCPVRHIACRSFQIFRSLLTFLDKQMLRDMLHRLSNTISDENPEIQGFAMQILMTL
                     NAVTAELSAAKLIDFPQMFWALVACLNSVHEQEFIEVLSSLTKFVSKIDLDSPDTVQC
                     LIATFPSSWEGKFDGLQQTIMCGLRSSNSWDIALGFLDRLNLFKDSRIIANSESRILF
                     ALLANLPRFLNAMDTDEFDDHLKKAADSLIVLATSNNQPSLARLVDSLAKKKFRSKKD
                     FVSQTVSFISRVYFPDYSAQTLVFLLGLLFNKIDWVRTQTLQLLVHIVPLIDLRRPEF
                     VGVGADLISPVLRLLLTEYESQALELLNCIRNVSGSKMDKDVLRISMGNKDAKIAYSR
                     TATLFGIPEESGWSVPMPTVTAATTRHNVHAVFSTCSDNSSDDPIQREPDTLKDLVEF
                     HADGGYAAAAAIEAYDTNSLVEDKDGSLSHMWAELDNLDTFFTTEAGITEPDFDGKFL
                     KHAHTNSEDTMHADQTSALDCAPQLYDKKVSVILNHSLTRTPSNVSFKTNLADSFGNS
                     MHGGPHVMVENLSSHSRANSGPIRSSSAGNYSGGRSHSKVAQTATHHGLETVSPARLR
                     NPENQELLFRFEGILRNPHRTKKKWQKQQHQQQQLLAQSFHDESVNYHFERDSATSLP
                     QGLGTKGSPPLSPTLSDSNKNIPTALREGTKNKGYQPKPKTQKHHYHIPHFSSRLSDG
                     KLTPPLSSSSNAFSLRSSPSPRSSKASNSSAPASSQSQFSRRVKSGQGKSKSGNGVIE
                     TSPLNQGTPVQKLMQDRNLEDDLLIEKQLLSLQDELQNRSTSNEPSS"
     gene            <755459..>758518
                     /locus_tag="KLTH0G09152g"
                     /db_xref="GeneID:8293707"
     mRNA            <755459..>758518
                     /locus_tag="KLTH0G09152g"
                     /product="KLTH0G09152p"
                     /transcript_id="XM_002555384.1"
                     /db_xref="GeneID:8293707"
     CDS             755459..758518
                     /locus_tag="KLTH0G09152g"
                     /note="similar to uniprot|P40469 Saccharomyces cerevisiae
                     YIL128W MET18 DNA repair and TFIIH regulator required for
                     both nucleotide excision repair (NER) and RNA polymerase
                     II (RNAP II) transcription possible role in assembly of a
                     multiprotein complex(es) required for NER and RNAP II
                     transcription"
                     /codon_start=1
                     /product="KLTH0G09152p"
                     /protein_id="XP_002555430.1"
                     /db_xref="GeneID:8293707"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:C5DMI2"
                     /translation="MSHSYSSQNLRADVVSIIANVESDEAKALELSKKVALKVSEGQL
                     KLVELVICLREYITSPEQIERQHALHCLSTILGELPKHTLLKNDVSVILDFYLGKFDD
                     IYCMKETLYGLSHIVNMKCFYSNQVSSVLKPLKDDYQSTQYLAATRYYAFLVLQHLLE
                     KFRESMSTNLPLNNLFIETFLSIAGGEKDPRNLLISFHLNSAISSALENISQYKEDLF
                     DTLFCYFPITFKPPKNDPYRITNIDLKVALRSAISASPYFEEDAFGNLIDKMTASSPS
                     VKNDTLLTMKACIERFGGEACIKNWVPIWNALKFEIMNNVDADESVTESNEPEFNNYE
                     ESLRIITSISAQLLNLKEGAFDKFQSHIFDELEPNFKYEKDLKQSSAILAAVARTNVT
                     SFNKVMDDVLKLFFDNVSDLDVNKLKLLILNLSFFFDAYIEVFSPYSNKAQNKAVPDN
                     KLAQYKDQILMILSKSLKGSSKSEVSLRTLSVVQLTKLVKMPGFLSGEEVSLIVQYLT
                     ETILTDDNKNVYFACLEGLKVTSDVSENSVVEISLNQMLKHLEKEGTHTVVLGEEEAV
                     PVERILKVILDFTTSRHKLVVESIIGISNIICHFSKYVEEKEYCFMLVSCLYSLFDNN
                     QEVLTNDVASHLKKSIETELLASSKNVAIYSDDHNLHLISAVFYFLNVNAPQANHQIE
                     LDRFLVLFTEDTKVLKSPARSVIIFAKLLSAFDKACKIPGGLLLNESIRLLKVQHEKC
                     SEFEKLAYLELLAVLSNKWCTEDNVNANLDISNTALIDLEIEAWCTKGLAMKNSKLAE
                     TYTDKFVKLLGDADIGPASAKLFGVFVMDIPTLDRIKGISWNNNVRLLYKQKLFSDVA
                     PKLVSGYSATSDMSLKANYLLALSLLLKNTPNKITINYIPNLLSLLLQAVQLNNSDVR
                     VSALTTIRGTVNQASQLITEHIHSLIPLLMRLTNPDKHNAYLVRLTALEILRDFTDHV
                     PLNYLLPYKDDIIKGLAVALDDKKRRVRKTCIDTRQAYFELGQVPFE"
     gene            complement(<758602..>759195)
                     /locus_tag="KLTH0G09174g"
                     /db_xref="GeneID:8293708"
     mRNA            complement(<758602..>759195)
                     /locus_tag="KLTH0G09174g"
                     /product="KLTH0G09174p"
                     /transcript_id="XM_002555385.1"
                     /db_xref="GeneID:8293708"
     CDS             complement(758602..759195)
                     /locus_tag="KLTH0G09174g"
                     /note="similar to uniprot|P40470 Saccharomyces cerevisiae
                     YIL127C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G09174p"
                     /protein_id="XP_002555431.1"
                     /db_xref="GeneID:8293708"
                     /db_xref="GOA:C5DMI3"
                     /translation="MSSASAKAQATAAVNNVLSLVLPGSAKIDHNSTKRQNNSKGSKA
                     QLINANLKKAVRVRERDAHSIKKREQRNRRKLQRARQLAEDKVDQQAKLDILRKHREE
                     DSLTAKERKFLNKVINKNVRDLKSWDVDAEELHELQESVLRNTSQRSSLQKRKRKQRR
                     DDFDESKKPVSGDHRYPGLTPGLAPVGLSDEEDSDEE"
     gene            <759594..>763520
                     /locus_tag="KLTH0G09196g"
                     /db_xref="GeneID:8293709"
     mRNA            <759594..>763520
                     /locus_tag="KLTH0G09196g"
                     /product="KLTH0G09196p"
                     /transcript_id="XM_002555386.1"
                     /db_xref="GeneID:8293709"
     CDS             759594..763520
                     /locus_tag="KLTH0G09196g"
                     /note="similar to uniprot|P32597 Saccharomyces cerevisiae
                     YIL126W STH1 helicase related protein snf2 homolog"
                     /codon_start=1
                     /product="KLTH0G09196p"
                     /protein_id="XP_002555432.1"
                     /db_xref="GeneID:8293709"
                     /db_xref="GOA:C5DMI4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:C5DMI4"
                     /translation="MNTAEIDVVMPSAASQGEAEKVTVNIPAPETLAQLDQLLGRYRA
                     VIQEPEKNKVEIDALERVLCSISEQQDEYTVKLQKLRTGMQNQPAYDEQLFKSQLIAL
                     QLLSRDVDVPDGLLTEEQTEDDRTVGSSNHTSTLESTESNLKPVKLSLDFDSNAKSFG
                     LYDKFSNLGMPKGKESLGAISVEGTILSRIAERIKELESLPANLGTYSLEDSLLFTAK
                     DDVPSSIDDLKLKAIVELRALKLLTKQKSLRQKLIMNVTSQAHHTIPSLRDSPFTMAA
                     QRSVQVRNKVIVPQTARLAEELERQQLLEKRRKERNIHMHKVNVIIDYVQDQQVTHTS
                     PRERGAQFGKLCLSLHNQTEKDEQKRVERTAKQRLAALKSNDEEAYLKLLDQTKDTRI
                     THLLRQTNSFLDSLAQAVRVQQNEAKIREGGEIRPMTDEEREKIDYYEVAHSVKEKVE
                     KQPSILVGGTLKEYQVRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLKEAKS
                     EPGPFLVIVPLSTITNWTLEFEKWAPSLATVVYKGTPNQRKSMQHQIRTGNFEVLLTT
                     YEYIIKDRSLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNN
                     LPELWALLNFVLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLR
                     PFLLRRLKKEVEKDLPDKVEKVVKCKLSGLQHQLYQQMLKHNALFFGAGTEGATKGGI
                     KGLNNKIMQLRKICNHPFVFDEVEGIINPTRGNSPLLYRVAGKFELLDRILPKFKATG
                     HRVLMFFQMTQVMDIMEDFLRMRDLKYLRLDGATKTEERTGMLKLFNAPDSEYFCFLL
                     STRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEE
                     VILERALQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLLENENVKDENDEAELDDEEL
                     NEILARGDDERKLFDKMDEERAAMELKQAKSQGLSTPLPRLIQLDELPEVLTEDITNH
                     LQTEPAAVGRIRERKKVYYDDGLTEEQWLQAVDNDEDSLEDAINRKRRSRERRQHSKE
                     LKDSEPGEIDTLDNSLEPTPEIELAKPNGKRSRAARKAAASEVKNENEQDEQLEEEEE
                     DGHTPKKLKLKVKLSLKSDQQKSTPGELDGPTVEQPQTSAPKPKSKSKKVTTCEFTPQ
                     VEHLLEEMRAQIDPTDEHARTSVFEILPSKKLYPDYYKLISNPVALDTITKKCKKGLY
                     GSLEDVRQDLETMFGNAQFYNEEGSWIFNDAEELRKFVSAWFESNK"
     gene            <763754..>764329
                     /locus_tag="KLTH0G09218g"
                     /db_xref="GeneID:8293710"
     mRNA            <763754..>764329
                     /locus_tag="KLTH0G09218g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_002555387.1"
                     /db_xref="GeneID:8293710"
     CDS             763754..764329
                     /locus_tag="KLTH0G09218g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
                     RPL9A Protein component of the large (60S) ribosomal
                     subunit, nearly identical to Rpl9Bp and has similarity to
                     E. coli L6 and rat L9 ribosomal proteins and to YNL067W
                     uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
                     Protein component of the large (60S) ribosomal subunit,
                     nearly identical to Rpl9Ap and has similarity to E. coli
                     L6 and rat L9 ribosomal proteins"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_002555433.1"
                     /db_xref="GeneID:8293710"
                     /db_xref="GOA:C5DMI5"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:C5DMI5"
                     /translation="MKYIQTDQTLDIPEGVTVNIKSRVIKVTGPRGALTKNLKHIDVT
                     FAKVSNKQVKITVHNGDRKHVAALRTVKSLVANMITGVTKGFKYKMRYVYAHFPINVN
                     VVEKDGAKFVEIRNFLGDKQVRMVPVREGVSIDFSTNQKDEIVLSGNSIENVSQNAAD
                     IQQICRVRNKDIRKFLDGIYVSQKGFVEEEA"
     gene            complement(<764752..>766188)
                     /locus_tag="KLTH0G09240g"
                     /db_xref="GeneID:8293711"
     mRNA            complement(<764752..>766188)
                     /locus_tag="KLTH0G09240g"
                     /product="KLTH0G09240p"
                     /transcript_id="XM_002555388.1"
                     /db_xref="GeneID:8293711"
     CDS             complement(764752..766188)
                     /locus_tag="KLTH0G09240g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G09240p"
                     /protein_id="XP_002555434.1"
                     /db_xref="GeneID:8293711"
                     /db_xref="UniProtKB/TrEMBL:C5DMI6"
                     /translation="MPALFAEAQHLTRNDVLQSIFENNSDQEDALPPTPGYLFFLEDH
                     EDRKTPELYLDLAQQDPVLSDVSFHGEPFLKRFESTMPSNFDSLRWSVDDILADCTPE
                     KSSLWSGAWSDDEALSKDLNSSPFSTPSLTQSNIEDVLARVPEPPIMCFAEFQRHPPQ
                     EKPGHIPARASTGKVSKPNNKQASRGKRSSKFNLSAKRALLQKLISRMQMRTRLEQTY
                     EHGILVRRNVAKELAIEGEGATPQLQFCGTRFQDVQTFLQSQATLHQDACHFRTIWSY
                     NREQKGSTIILTLSLTDEQSKCGENEYQFSVISRYLPYDCFGRPHGAVKKKLNRVQEE
                     LEREKETRKGDTYCWRHFLTSFEYFKLVSFMLGKEYDFNLNDNQTGETRGSDGKVISP
                     EKRHDMRTRSHAKIYFEGKAVKSAHELLNDETISSHKSFIVGTFGQIMAYTNKRPFGS
                     DSSLSVMEFKYLEEALEKEINFHVFHGV"
     gene            <767500..>770541
                     /locus_tag="KLTH0G09262g"
                     /db_xref="GeneID:8293712"
     mRNA            <767500..>770541
                     /locus_tag="KLTH0G09262g"
                     /product="KLTH0G09262p"
                     /transcript_id="XM_002555389.1"
                     /db_xref="GeneID:8293712"
     CDS             767500..770541
                     /locus_tag="KLTH0G09262g"
                     /note="highly similar to uniprot|P20967 Saccharomyces
                     cerevisiae YIL125W KGD1 Component of the mitochondrial
                     alpha-ketoglutarate dehydrogenase complex which catalyzes
                     a key step in the tricarboxylic acid (TCA) cycle the
                     oxidative decarboxylation of alpha-ketoglutarate to form
                     succinyl-CoA"
                     /codon_start=1
                     /product="KLTH0G09262p"
                     /protein_id="XP_002555435.1"
                     /db_xref="GeneID:8293712"
                     /db_xref="GOA:C5DMI7"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DMI7"
                     /translation="MLRGISRFSQQSVAKRALYRSGNQCVRGNWGTRCLATNSSDNFL
                     STTNAAYIDEMYEAWQKDPTSVHVSWNAYFKNMGNAGIPASSAFVAPPTLVSHHTGAQ
                     IPQDMVMGASGTMDQGILTHLKVQLLCRAYQVRGHQKAHIDPLQISFGDDKSKPLPKE
                     LTLEHYGFTERDLDREITLGPGILPRFTREGKKAMTLREIIAALEKLYCSSYGIEYIH
                     IPSRAQCDWLRERIEIPQPYHYTIDQKRQILDRLTWATSFETFLSTKFPNDKRFGLEG
                     LEGVVPGIKTLIDKSVELGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFQGSAAPE
                     EYEGSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLESQDPVVLGRTRAIMFAKNDL
                     DKYQKAMGVLLHGDAAFAAQGVVYETMGFSHLPDYSSGGTIHIITNNQIGFTTDPRFA
                     RSTPYPSDIAKAIDAPIFHVNANDVEALTFIFNLAAEWRATFHTDAIIDVVGWRKHGH
                     NETDQPSFTQPLMYQKISKQKSVIDVYTEKLISEGSFTKKDIDEHKQWVWGLFEKAFE
                     KAKDYEPTSREWLTADWANFKSPKELATEILPHEPTVVQQEKLKEIGKIISSWPEDFE
                     VHRNLKRILTNRGKSIEKGEGIDWSTGEALALGSLATEGYHIRVSGEDVERGTFSQRH
                     AVLHDQKSERTYTPLQHLSDKQANFTICNSSLSEYGCMGFEYGYSLTSPDFLVMWEAQ
                     FGDFANTGQVIIDQFLAGGEAKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQMANE
                     DPRYFPSEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLILFFSKQLLRH
                     PLARSKLSDFSDNGFQWIIEDVEHGKSIASKEETKRLVIMSGQVYTALHKKRESLGDK
                     NTAFLKVEQLHPFPFAQLRDSLNSYPNLEDIVFCQEEPLNMGSWAYAAPRLGTVLKET
                     DKYKDFEVRFAGRNPSGAVAAGSKALHAAEEEAFLKEVFGQ"
     gene            <771061..>771927
                     /locus_tag="KLTH0G09284g"
                     /db_xref="GeneID:8293713"
     mRNA            <771061..>771927
                     /locus_tag="KLTH0G09284g"
                     /product="KLTH0G09284p"
                     /transcript_id="XM_002555390.1"
                     /db_xref="GeneID:8293713"
     CDS             771061..771927
                     /locus_tag="KLTH0G09284g"
                     /note="similar to uniprot|P40471 Saccharomyces cerevisiae
                     YIL124W AYR1 NADPH-dependent 1-acyl dihydroxyacetone
                     phosphate reductase found in lipid particles and ER
                     involved in phosphatidic acid biosynthesis and required
                     for spore germination capable of metabolizing mammalian
                     steroid hormones"
                     /codon_start=1
                     /product="KLTH0G09284p"
                     /protein_id="XP_002555436.1"
                     /db_xref="GeneID:8293713"
                     /db_xref="GOA:C5DMI8"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DMI8"
                     /translation="MAEGKIALVTGASSGIGYELTRQLAGKGYKVYAAARREERIAPL
                     QKEFPQLVVPIKLDVSEPEQISALRDRLAKELPSQKLDILYNNAGQSCTFPASDVTND
                     VLEQAFKVNVFGPINTCRELLPFVINAQGTVIFTGSLAGIISFPFGSVYSATKGAIHS
                     YARGLHIEMKPFGVRVLNVITGGVGTDIADKRPLPEDSIYNIPEASEAMAYRREMAKN
                     NKPMDVGKYVSSVVRDIESSRDPVDIYRGTFAGAARWISLLMPYWMLDWILARRFKLT
                     GMINALQKRKRE"
     gene            <773328..>774662
                     /locus_tag="KLTH0G09306g"
                     /db_xref="GeneID:8293714"
     mRNA            <773328..>774662
                     /locus_tag="KLTH0G09306g"
                     /product="KLTH0G09306p"
                     /transcript_id="XM_002555391.1"
                     /db_xref="GeneID:8293714"
     CDS             773328..774662
                     /locus_tag="KLTH0G09306g"
                     /note="some similarities with uniprot|P40472 Saccharomyces
                     cerevisiae YIL123W SIM1 (putative) invovled in control of
                     DNA replication"
                     /codon_start=1
                     /product="KLTH0G09306p"
                     /protein_id="XP_002555437.1"
                     /db_xref="GeneID:8293714"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:C5DMI9"
                     /translation="MKVSAVLALSVAGSSLASALPHAHKRAASQEPCSTAHAHRAGKR
                     AVAVEYVYQTVTVDHQGQTLSYPTTTLTSEPTSSAAASSSSAAASSSASSPATASSSS
                     AAASSSSAASSSSAAASSSSASSSSAASSSAAPSSSASSSSASSSAVSSSSSSSSSPS
                     STSTGGSSSTGIDGDLSAYSGPSEAFQDGTIKCSDFPSGQGVISLDWLGFGGWSGIEN
                     SDGSTGGDCKEGSYCSYACQTGMSKTQWPSEQPSNGVSVGGLYCKNGYLYRSNTDAEY
                     LCEWGKDMAEVVSEIDSDVAICRTDYPGTENMVIPTYVKAGDSVPLTVVDEDTYYQWK
                     GMKTSAQFYVNNAGVSLEDGCVWGTAGSGVGNWAPLNFGGGYTNGVAYLALIPNPNNY
                     DALNYNVKIVAADDDSTVLGDCKYENGKYNDGSSDGCTVSVTKGKAKFVLYN"
     gene            <778062..>779753
                     /locus_tag="KLTH0G09350g"
                     /db_xref="GeneID:8293716"
     mRNA            <778062..>779753
                     /locus_tag="KLTH0G09350g"
                     /product="KLTH0G09350p"
                     /transcript_id="XM_002555392.1"
                     /db_xref="GeneID:8293716"
     CDS             778062..779753
                     /locus_tag="KLTH0G09350g"
                     /note="similar to uniprot|P40474 Saccharomyces cerevisiae
                     YIL121W QDR2 Multidrug transporter required for resistance
                     to quinidine barban cisplatin and bleomycin member of the
                     major facilitator superfamily of transporters conferring
                     multiple drug resistance (MFS- MDR)"
                     /codon_start=1
                     /product="KLTH0G09350p"
                     /protein_id="XP_002555438.1"
                     /db_xref="GeneID:8293716"
                     /db_xref="GOA:C5DMJ0"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ0"
                     /translation="MGENYINQGKQADPVPDLPHMKPNMPDHDQGAVPYSRFGSNEKL
                     VLVAICAASGIFSTIAGPIYYPALTTIENQFHISTELVNVSVVLYFLFQGLAPTLMGG
                     LADSFGRRPIVMWSIALYLAACIGIACSRTYAQILVLRCLQSAGISPVIAVNSGIMGD
                     VTTRAQRGGYVGLTAGFQVLGSAFGALIGGGIVSTWGWRAIFWFLAIGSGCSLVCSSL
                     LLPETKRSVVGNGSITPPAIWSKAPILALPQIRKKLHLDSPDYETLAPKERLNLLAPL
                     DVFRRPEIALLLLVTGLQFSLWVCHLTALSSLLEKDYHLKVAEVGLSYLPSGICTLIS
                     VVGAGRVLNWNYRRRLSKHNLFIEEATQRLLAENDNDEKRVDKILSTDISYTFNIFRA
                     RLEIMFVPLLLSGGGFMGFGWCLDAHTPLVAVLVFSGFASLFSNCVIACATTLVVDLY
                     PQKSSTATGCVNFSRCVLAAILVAALNKMLTSLSVGGTFTLLAGLTILSTVTLIIPIK
                     YGPGMAHKRAVRDRTAADEKAEAAVKEVDQQRQSSESEDLSSLNTISQPRSRAGV"
     gene            <780184..>781839
                     /locus_tag="KLTH0G09372g"
                     /db_xref="GeneID:8293717"
     mRNA            <780184..>781839
                     /locus_tag="KLTH0G09372g"
                     /product="KLTH0G09372p"
                     /transcript_id="XM_002555393.1"
                     /db_xref="GeneID:8293717"
     CDS             780184..781839
                     /locus_tag="KLTH0G09372g"
                     /note="similar to uniprot|P53943 Saccharomyces cerevisiae
                     YNL065W AQR1 Plasma membrane transporter of the major
                     facilitator superfamily that confers resistance to
                     short-chain monocarboxylic acids and quinidine"
                     /codon_start=1
                     /product="KLTH0G09372p"
                     /protein_id="XP_002555439.1"
                     /db_xref="GeneID:8293717"
                     /db_xref="GOA:C5DMJ1"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ1"
                     /translation="MDNNSIHSSLSSESDLQSTMKLEKPVLGLEGDNTKKLLPQDAAS
                     RVTTREMRESSSDSRDRVESSGVNSKLPQGAPFTLLSHGQKWFMVALLTSAGFWSSLG
                     SPIYYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGML
                     IYVCASIGLACSQSYGVIVFLRCLQSAGISPIIAINSGVVGDFTLKHERGTFVGAVSG
                     FTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMIINFLILPETKRTLVGNLSIR
                     PKRLINRAPILLLKSVRRKLHFDNPDYETLDPNKGKVDPISAFKIILHPEIILSLMPA
                     GLQFALWTITLASISSQLSVTPYNFKLTIIGICYLPSGIGGLIGSFVTGKVIDIYYRR
                     ALRRFEEKKEQGIIPIDSKFNTLRARLFTSIPQNFLAVIAFTLFGWSVERGWNIAVPL
                     ITSAIGSFCAMSTLSSSSTLLVDLYPSKSSTATSCYNFIRCSLSAIFMACLSKMNNAL
                     TVGGTFTLISGFVFIGNFVTLIPMFYGMKWRERRALRAEREKP"
     gene            complement(<782211..>783446)
                     /locus_tag="KLTH0G09394g"
                     /db_xref="GeneID:8293718"
     mRNA            complement(<782211..>783446)
                     /locus_tag="KLTH0G09394g"
                     /product="KLTH0G09394p"
                     /transcript_id="XM_002555394.1"
                     /db_xref="GeneID:8293718"
     CDS             complement(782211..783446)
                     /locus_tag="KLTH0G09394g"
                     /note="highly similar to uniprot|P25491 Saccharomyces
                     cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
                     envelope protein) heat shock protein"
                     /codon_start=1
                     /product="KLTH0G09394p"
                     /protein_id="XP_002555440.1"
                     /db_xref="GeneID:8293718"
                     /db_xref="GOA:C5DMJ2"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ2"
                     /translation="MVKETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAA
                     DKFKELTVAYEVLSDSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGG
                     GASRPRGPQKGRDIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKKCA
                     SCNGQGVKFITRQMGPMIQRFQAECDACNGTGDIVDPKDRCKTCNGKKIDNERKILEV
                     HIEPGMKDGQKIVFQGEADQAPGVIPGDVIFVISQRPHKHFERKGDNLYYQAEVDLLS
                     AIAGGEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGGFGDLIVTFKVN
                     FPTNHFADEESLKKLEEILPPRAKPSFPKSADVEECVMNDYDPAKHSGRQSNGRGASS
                     YDSDDEEQGGAEGVQCASQ"
     gene            <784397..>785278
                     /locus_tag="KLTH0G09416g"
                     /db_xref="GeneID:8293719"
     mRNA            <784397..>785278
                     /locus_tag="KLTH0G09416g"
                     /product="KLTH0G09416p"
                     /transcript_id="XM_002555395.1"
                     /db_xref="GeneID:8293719"
     CDS             784397..785278
                     /locus_tag="KLTH0G09416g"
                     /note="similar to uniprot|P53944 Saccharomyces cerevisiae
                     YNL063W MTQ1"
                     /codon_start=1
                     /product="KLTH0G09416p"
                     /protein_id="XP_002555441.1"
                     /db_xref="GeneID:8293719"
                     /db_xref="GOA:C5DMJ3"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ3"
                     /translation="MVRIKPSVLKKACQINPLLPLLLPECRTIEAAQQELRWIQNEVS
                     DKKRVRQCCMLRARHYPLQYLLGSQPFGPLDVTCQPGVLIPRWETEEWTVSLAEKLPR
                     DMAFDIMDLCTGTGCIPLLLKQMCPKCSVFAVDRSPLAYKLATRNSNTLQVPLKIIKK
                     DILERSSEIVPRTVDLITCNPPYIPRTTFARETARSVKLFEPKLALLGNKEFYANLVD
                     CWMSRTDAFVYEVGDLSQCYYVLNRVTGDVDLSRKWRIGFRHDSCGRPRIVYGFRASG
                     SRLNWASILVKFGDMKH"
     gene            complement(<785300..>786763)
                     /locus_tag="KLTH0G09438g"
                     /db_xref="GeneID:8293720"
     mRNA            complement(<785300..>786763)
                     /locus_tag="KLTH0G09438g"
                     /product="KLTH0G09438p"
                     /transcript_id="XM_002555396.1"
                     /db_xref="GeneID:8293720"
     CDS             complement(785300..786763)
                     /locus_tag="KLTH0G09438g"
                     /note="similar to uniprot|P41814 Saccharomyces cerevisiae
                     YNL062C GCD10 Subunit of tRNA (1- methyladenosine)
                     methyltransferase with Gcd14p required for the
                     modification of the adenine at position 58 in tRNAs
                     especially tRNAi-Met first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="KLTH0G09438p"
                     /protein_id="XP_002555442.1"
                     /db_xref="GeneID:8293720"
                     /db_xref="GOA:C5DMJ4"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ4"
                     /translation="MDPLKHITYYNHVLVRLPSNNLKVCELKPNSDVSLGKFGAFKVN
                     DIIGYPFGTTFEIHYDNAIEASAPDAGPSGDAAQEGTSSKGARNKFKIPVGRLSVIES
                     RLTANAAATGLGSEEEGTPQRELQLVGNSDSNKNLINIGSSIQKLSSEEIEQLKQQSV
                     SSNEIISKMIEAHGSFHQKTVYSQEKYLKRKKQKFAKFFTVEYMSSSGLLQYLIDKGD
                     VLRAMDLSEESMGMILNLANIRSNGTYLCVDETGGLLVYALLERMFGGENDSAAQGKI
                     VVVHENEHPNLDLLKFSNYTEEFIQQHVKTVSILDYFEPPVTEEVKEAFTPLTDEQLK
                     SLKSNKKGAYYRRLKWYNTQLEIIEWATKQQYDGLVVASTLHLPTFVPKLGERVHGSR
                     PIVCYSQFKETVLELSHTLYNDLRYLAPTIVETRCRPFQTIRGRLHPVMTMRGGGGYM
                     MWCHKVIPVGAADAALQPRPEEAPQGAEAESKKQKTE"
     gene            <787197..>789110
                     /locus_tag="KLTH0G09460g"
                     /db_xref="GeneID:8293721"
     mRNA            <787197..>789110
                     /locus_tag="KLTH0G09460g"
                     /product="KLTH0G09460p"
                     /transcript_id="XM_002555397.1"
                     /db_xref="GeneID:8293721"
     CDS             787197..789110
                     /locus_tag="KLTH0G09460g"
                     /note="similar to uniprot|P40991 Saccharomyces cerevisiae
                     YNL061W NOP2 Probable RNA m(5)C methyltransferase
                     essential for processing and maturation of 27S pre-rRNA
                     and large ribosomal subunit biogenesis localized to the
                     nucleolus"
                     /codon_start=1
                     /product="KLTH0G09460p"
                     /protein_id="XP_002555443.1"
                     /db_xref="GeneID:8293721"
                     /db_xref="GOA:C5DMJ5"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ5"
                     /translation="MGSRRHKNKQGAPPSLDEFQAKKSNKSEHKGKSRSEDVDGKKHK
                     SKRRAENDTKSGNKRSKTERVEKTKSKEPEQTEEEELPEVDLEELSKARKTLFDDEED
                     EGQEEDGADEFDEDLKDEFDLEQEYEGEDDDDEGGRPVFSDDEGVDMEDLNAANMEAL
                     SMKLDQEQALEEEEAEKELAEAAQLQPRAEILPTEEEEEALRDRPTDLNAVRTRMIEI
                     VKVLEDFKNLGAEGRSRSEYVDRLLKDICEYFGYSQFLAEKLFNLFSPTEALEFFEAN
                     EVSRPVTIRTNSLKTRRRDLAQTLVNRGVNLKPIGPWTKVGLQIFDSQVPIGATPEYL
                     AGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGCVFANDANKA
                     RTKSLIANIHRLGCTNTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKDQSVKVS
                     RTDKDFMQIPHLQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEENEAVVDYALRKRP
                     NVKLVDAGLAIGKEAFVSYRGKKFHPSVKLARRYYPHVYNVDGFFVAKFQKIAPSKHD
                     DNQANAREKENAARQEALEEGIIHDDFADFGNEEDKKYIEKSRKVSLLKKGIDPKATK
                     KNQGSNSTPNKSA"
     gene            complement(<789233..>791470)
                     /locus_tag="KLTH0G09482g"
                     /db_xref="GeneID:8293722"
     mRNA            complement(<789233..>791470)
                     /locus_tag="KLTH0G09482g"
                     /product="KLTH0G09482p"
                     /transcript_id="XM_002555398.1"
                     /db_xref="GeneID:8293722"
     CDS             complement(789233..791470)
                     /locus_tag="KLTH0G09482g"
                     /note="similar to uniprot|P53946 Saccharomyces cerevisiae
                     YNL059C ARP5 Nuclear actin-related protein involved in
                     chromatin remodeling component of chromatin-remodeling
                     enzyme complexes"
                     /codon_start=1
                     /product="KLTH0G09482p"
                     /protein_id="XP_002555444.1"
                     /db_xref="GeneID:8293722"
                     /db_xref="GOA:C5DMJ6"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ6"
                     /translation="MPRDSSLPPLKIHTLSEPDASDTPEPFDDAADYDPNVPIAIDFG
                     SSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQAKSPYDGA
                     IVSNWDYTEEIMEYTFHHLGVNGNDGVSNPILMTEKLATLQSQRENWYQLLFECFGVP
                     QVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSV
                     EYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVDYQDEIRKILTLEELETKNIVVE
                     APFAETVQPEKSEEELRLQAEKRRETGRRLQEQAKQRRQEKLAQKEEEYEYYTQLKEQ
                     MKDQSKKAVLSTLQSAGFDDEQDFKKYLVGLEKTLKRAQVLEAGEEEEVSLADKFDLV
                     DVPDEQLNEEQIKEKRKQRLLKANFDARVKAKEEKLKKEQEEEEARQKDEAWRSEDLQ
                     GWIKDKRQKLTALIKTRKEKLKIKNDMKDRKSHAAQKRMKNIATLAEERSRSSAKRSR
                     QQSTVDNDPNDTFGANDEDWLVYNDITSNPEALDQAIEEEYNVIVGLEQQLLEYDPNF
                     TEEDTLDAQYDWRNSTLHLFLRGPRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAG
                     LDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNMRLPGVRERIVREFTG
                     MLPMGSNLNVRMASDSAVDAWRGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG
                     NVLFL"
     STS             791502..792721
                     /standard_name="D1S3688"
                     /db_xref="UniSTS:474266"
     gene            complement(<792202..>794076)
                     /locus_tag="KLTH0G09504g"
                     /db_xref="GeneID:8293723"
     mRNA            complement(<792202..>794076)
                     /locus_tag="KLTH0G09504g"
                     /product="KLTH0G09504p"
                     /transcript_id="XM_002555399.1"
                     /db_xref="GeneID:8293723"
     CDS             complement(792202..794076)
                     /locus_tag="KLTH0G09504g"
                     /note="similar to uniprot|P39980 Saccharomyces cerevisiae
                     YEL065W SIT1 Ferrioxamine B transporter member of the ARN
                     family of transporters that specifically recognize
                     siderophore-iron chelates transcription is induced during
                     iron deprivation and diauxic shift potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="KLTH0G09504p"
                     /protein_id="XP_002555445.1"
                     /db_xref="GeneID:8293723"
                     /db_xref="GOA:C5DMJ7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ7"
                     /translation="MSLKMLGFNKGPEEKEAGDAMERSRRADEALRRQKDVGVKNIEV
                     YAAQYDHVAYRVALFFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLSTVNCIKTV
                     MAAGGMVAYARASDMFGRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLYQLGKAG
                     LALILQVIAVDFSNLNWRMVALYVPALPTIINTWVSGDVISAIGSDWEWGIGMWAFII
                     PLSCIPLFCCLVHMRYLAHKHAPEQLGKQRQLYSMASWSEYLIEVFFWRLDSVGLILV
                     VGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSV
                     LKDRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGT
                     LLGFVIVYVKRTKKFILFGVCVWFVAFGLLVHFRGDESSHSGIIGALCLLGFGGGFFN
                     YSAQVSMQASTAAHQDLAVVTSLYLACYNIGSAFASAISGAIWTNVLPKELNKRITEK
                     QVATLAYSSPFKFIIKYKWGTPQRVAVVHAYQKVQRILCIVPLCFCVTLLIAAFLLRD
                     KKLSEVVALGELEHGHSESASSTGDAGASHELSSTENELHNESEKSSNTRVQNNPVTA
                     "
     gene            complement(<794931..>800147)
                     /locus_tag="KLTH0G09526g"
                     /db_xref="GeneID:8293724"
     mRNA            complement(<794931..>800147)
                     /locus_tag="KLTH0G09526g"
                     /product="KLTH0G09526p"
                     /transcript_id="XM_002555400.1"
                     /db_xref="GeneID:8293724"
     CDS             complement(794931..800147)
                     /locus_tag="KLTH0G09526g"
                     /note="similar to uniprot|P19097 Saccharomyces cerevisiae
                     YPL231W FAS2 Alpha subunit of fatty acid synthetase which
                     catalyzes the synthesis of long-chain saturated fatty
                     acids contains beta-ketoacyl reductase and beta-ketoacyl
                     synthase activities"
                     /codon_start=1
                     /product="KLTH0G09526p"
                     /protein_id="XP_002555446.1"
                     /db_xref="GeneID:8293724"
                     /db_xref="GOA:C5DMJ8"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ8"
                     /translation="MSPENQDELCHVLLTELLAYQFAWPVRWVETQEVLLNERQTERY
                     IEIGPQPILANMAKRTLKQNENYENATTISTRREVFSVAGDMDKICYRYDPPAQSVEK
                     TDAPEENAQGKINDGTEIPRAQEISTSCNSSGATSGRSFSTQPELTTELVVQSVVANK
                     IAGYSIETLPLSHTLKELCKGKSTLQNEIKGDLYKELPGLQDAQLEDMSLESICKEVE
                     SPKTLGPVTLGEVTKFIPRKFAGKLGTVSAVKEYLSRSWGVNNSAPLLLFIASRDLKT
                     RFSSEEETQQFIDNSCVEFAKFKKIDYSLESAKTNDVGAGCSAETDEKPKTVDIEVYN
                     ECNSDLMQLQKEQHNVMGQHLKVTDAQCEIEILKSKLEAMEGKLSAIGEEFGLDYIEK
                     SLTRSFSPLKIRVYDSAWNWGKQSVLQLLHAALLNPQKAVEILSPNEIHNLVNRADLS
                     IIKIIQHKLETEPFSLSVKRRFEGIIQACLRDISSQPVYSATQFTSYEPLGSEHATMQ
                     HVRSYDPSQYIKEMSVGTTKSSAETSIVSTKLDSDMSSYYKIEKELFQVYSKIIQYSL
                     ASNNSPHNIRAQFETIYEQLLIFLRNSDHVASFFRGIINEAVFSVNKSLITTKDDEQD
                     IIVSDCEISSSDDEDDVPPQPVRQTHQPNVSIPTGVVPFLHLKRRSHVSGEWIYDKAL
                     TQMYLNNLLRIGKAGVSFSDKRALILVSDAKDNLSLEVINALLQAGTVVVVATQRYDH
                     ETTSAFQKSYQKYGASGSKLIVLPLNISSKIDVFRFSEYLFSNIGDIDFLLPMNVKAT
                     PGSILDYSSEAELTHRSSSVNLLRLLGCFVKEKRVHAMETRPTHVLLPLSPNHANIYE
                     ESNFKDTFLALVLQKWYDEDWSTELSICGCVYGWTNDDGGDLVARGLEKMGVRTFANN
                     EMALNMLGLLSYNVVECSQESPLIADLNGGLQTLPNISSVVSKLQKEMATSVEIREEI
                     EEQARITRELRGVKEPEVQFVEPKGNVRSDFPQMLPYHEVRAKFNGEQLSGLLDLSQV
                     VVVTGFAEIGPWGSARTRWEMEKSGEFSLEGCIELACVMGLIEYQSSAERSGWVDCKS
                     GLPVEEVDIKQRYEAQILEHTGIRIIEPELFQGYDPKRKQLLHEVIITHDLSPIQMDA
                     ASAQQYKLQHGELVEVYPIAETGNSECHVKFLKGCSLMIPKALRLDRFVAGQVPTGWD
                     PARYGIGEDITSQVDQVTLYALIATAEALISSGITDPYEMYQYVHVSEVGNCSGSGIG
                     GMNSLRAMRQERLKDTDVQNDIIQETFVNASAAWVNMLLLSSSGPIKTPVGACATALE
                     SLDNAVETIRSGQAKVCIAGGYDDLEGHVSHEFGNMGATVNSDKELQSGRDPREMCRP
                     ATSTRAGFLEAHGAGIQVLMSAEVAIEMGVPIYGIVAMTSTASDKIGRSLPAPGKGIL
                     TCARQQPRARSARSAKLDARYRKRQLQARLREIDDWAQNELAAGAPDVGPAEARLVQQ
                     LAHRQAADAKKHWGNYFWHDNPRVSPLQGALATFGLTVDDLTVASCHGTSTKANELNE
                     SQILDTIMQHLGRTPGNPLLAVFQKHLTGHPKGAAGAWMANGLLQLMQDRVVPGNRNA
                     DNIDQGFRRFEHLLYPSENILVADVKAACLTSFGFGQKGAMAVLVNANYVLAALSESE
                     YTHYAARVRAREARAQRRLADALVHHTTCRFKDQAPFSAAHEEAVYLDPFARADDELR
                     VRPLRDQARGPA"
     gene            <802001..>802696
                     /locus_tag="KLTH0G09548g"
                     /db_xref="GeneID:8293725"
     mRNA            <802001..>802696
                     /locus_tag="KLTH0G09548g"
                     /product="KLTH0G09548p"
                     /transcript_id="XM_002555401.1"
                     /db_xref="GeneID:8293725"
     CDS             802001..802696
                     /locus_tag="KLTH0G09548g"
                     /note="highly similar to uniprot|Q00245 Saccharomyces
                     cerevisiae YIL118W RHO3 Non-essential small GTPase of the
                     Rho/Rac subfamily of Ras-like proteins involved in the
                     establishment of cell polarity GTPase activity positively
                     regulated by the GTPase activating protein (GAP) Rgd1p"
                     /codon_start=1
                     /product="KLTH0G09548p"
                     /protein_id="XP_002555447.1"
                     /db_xref="GeneID:8293725"
                     /db_xref="GOA:C5DMJ9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMJ9"
                     /translation="MPICGGSSASKKPIERKIVILGDGACGKTSLLNVFTRGYFPKVY
                     EPTVFENYIHDIFVDSQHITLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSVDSRDSL
                     DNVQHKWVGEIADHCEGVKLVLVALKCDLRSNEEEFALDTAITPGNIQQQQQQQQQSS
                     VQSGGLISYEEGLAMAKKIGALRYLECSAKMNRGVNEAFTEAARCALTATPKGAKDHA
                     GEESKKGSSCTVM"
     gene            complement(<802806..>803702)
                     /locus_tag="KLTH0G09570g"
                     /db_xref="GeneID:8293726"
     mRNA            complement(<802806..>803702)
                     /locus_tag="KLTH0G09570g"
                     /product="KLTH0G09570p"
                     /transcript_id="XM_002555402.1"
                     /db_xref="GeneID:8293726"
     CDS             complement(802806..803702)
                     /locus_tag="KLTH0G09570g"
                     /note="weakly similar to uniprot|P40476 Saccharomyces
                     cerevisiae YIL117C PRM5 Pheromone-regulated protein
                     predicted to have 1 transmembrane segment induced during
                     cell integrity signaling"
                     /codon_start=1
                     /product="KLTH0G09570p"
                     /protein_id="XP_002555448.1"
                     /db_xref="GeneID:8293726"
                     /db_xref="GOA:C5DMK0"
                     /translation="MVHQTDFISSTAILKTQKASTSLVHATMFERAMPSLTNAGKASS
                     TKTYTTPTITPPSIKGNPHIWSSDKPSGTLFIAVGSVVGFIFLIIALAYIVSAYISRR
                     QTEKLRFETIDQEFQSHVGGKSYSKLGNSDDPEKSGFLSKAVHTPQSRSVARLLDRPD
                     FQQPSPALSNQDSSTSLAQEFYSSIRDQTAAQNRKSLFISPTVEIVNQQRKSAVLQNM
                     NNSVSSLVSDSGAELNKPEKAAPSTRKAMYKARNKSSMGSAVGIAKSRSTSPVKSGLR
                     DKPLDRAKTPSVYLDKMFEDES"
     gene            <803888..>804397
                     /locus_tag="KLTH0G09592g"
                     /db_xref="GeneID:8293727"
     mRNA            <803888..>804397
                     /locus_tag="KLTH0G09592g"
                     /product="KLTH0G09592p"
                     /transcript_id="XM_002555403.1"
                     /db_xref="GeneID:8293727"
     CDS             803888..804397
                     /locus_tag="KLTH0G09592g"
                     /note="similar to uniprot|P53949 Saccharomyces cerevisiae
                     YNL056W Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae which is a model
                     system for studying replication of positive- strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="KLTH0G09592p"
                     /protein_id="XP_002555449.1"
                     /db_xref="GeneID:8293727"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DMK1"
                     /translation="MVYIPPLNFAPVVSTEVSLYRSGYPMPLNYAFIADQLHLRTIIY
                     VGDKELSEDYNEFLTQHNIQYHFVHMNSCRDKNVQEQMDKVLRLIVDRANYPILIHSN
                     KGKHRVGVVVGIIRKLLQGWSTTGIYQEYDIFSGGLKGQVDLEFITMFDTELIVRRDH
                     LPDFVKWER"
     gene            <804939..>806108
                     /locus_tag="KLTH0G09614g"
                     /db_xref="GeneID:8293728"
     mRNA            <804939..>806108
                     /locus_tag="KLTH0G09614g"
                     /product="KLTH0G09614p"
                     /transcript_id="XM_002555404.1"
                     /db_xref="GeneID:8293728"
     CDS             804939..806108
                     /locus_tag="KLTH0G09614g"
                     /note="similar to uniprot|P07172 Saccharomyces cerevisiae
                     YIL116W HIS5 Histidinol-phosphate aminotransferase
                     catalyzes the seventh step in histidine biosynthesis
                     responsive to general control of amino acid biosynthesis
                     mutations cause histidine auxotrophy and sensitivity to Cu
                     Co and Ni salts"
                     /codon_start=1
                     /product="KLTH0G09614p"
                     /protein_id="XP_002555450.1"
                     /db_xref="GeneID:8293728"
                     /db_xref="GOA:C5DMK2"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DMK2"
                     /translation="MTFDLSKIVRPKIFNLEPYRCARDDFTEGVLLDANENPHGPVVK
                     DSNREFVLNRYPDPHQVAFKTKMSELRNSQSVFKDQKITPLSADNLCLGVGSDESIDA
                     LIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNSFQMNTDKVIETLQ
                     GDSNIKIAFVTSPGNPTGALIDIASIEKILSQWQSGIVAIDEAYIDFCSTGGSAAPLV
                     NKYPNLAVLQTLSKSFGLAGVRLGVTFTSKDLSRVLNAMKAPYNISSMASNLVLKALS
                     SESVQTMKDNVQEIVEERERVLKALTSMENVQDTQVGGLDANFIMVRIVDGGKGNNEL
                     SKALYYRLATESGVVVRFRGTEYGCTGCLRITIGTHEENSKLIKEFEKKLKELTA"
     gene            complement(<806164..>810963)
                     /locus_tag="KLTH0G09636g"
                     /db_xref="GeneID:8293729"
     mRNA            complement(<806164..>810963)
                     /locus_tag="KLTH0G09636g"
                     /product="KLTH0G09636p"
                     /transcript_id="XM_002555405.1"
                     /db_xref="GeneID:8293729"
     CDS             complement(806164..810963)
                     /locus_tag="KLTH0G09636g"
                     /note="weakly similar to uniprot|P40477 Saccharomyces
                     cerevisiae YIL115C NUP159 Subunit of the nuclear pore
                     complex that is found exclusively on the cytoplasmic side
                     forms a subcomplex with Nup82p and Nsp1p required for mRNA
                     export"
                     /codon_start=1
                     /product="KLTH0G09636p"
                     /protein_id="XP_002555451.1"
                     /db_xref="GeneID:8293729"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DMK3"
                     /translation="MRRCLPTRVCPVYIQPLFILCLCACTPPRALRLIFFFNSHNKVI
                     ASHHQYKKENLRPDLCTLMSVLGDELPTATSEDFGFKPLGKIDILPSYEEQLPFSKLQ
                     NLAISNISKLYAAATNQKVVVGTLHNLRSQLPDAAGTDADASEEPRQLQFLSEKDLEC
                     VVYVGFNSAGTAALCITKDFGLFRFDVSQKEWSSLNISLPTSQELTVTSVKPLSPDLQ
                     ILLVQASNQLYQVEISGASSVIANDITDFDVGHNQYVLMHGDGTIEIHKDFQEQSPKT
                     LTPPDDVLEQISEECVPLAIEVLSELRYLVVFGNPVTESDEDVMYDHRMFLVTLTGNN
                     EAKFQESFDIAPAFGSVLRTPNYYRISLNQLMPSLPHLYVISSAASSELTLLDDNAVI
                     QPNQDSDRAVLPINQDTDNDTNPVGMAVDLTSELQVAEPCQGVNVSNNLPIVFVLNSE
                     GELLVFALFNSSGIKKNEFTAEGAFNALQSEWKASEEMLSIKLKTSTDKETGSSETSG
                     GSRPPTDSSTGTSIEISGSDDSSITAQPSSPSIKSSSPQPFEGQQKSSPFTGQLASEQ
                     SSFGKPSFGQPSFGQSSSGQSSFGQSSYGQTSFGKSSLGQSSFGQPSFGQSSFGQSAS
                     EKSTFGQPSFGQTAFGKPSLEQPVAGQQAFGKPSFGQPAFGQSVFGKSSVDSSATKPA
                     QSLESKTPALGSDREAVSGAKDTSSQLTQTKPLFGNTTFGQSTPTKPLTDSSMSTAGA
                     GSFGKPAFGKPAFGSGFQFGTSNPQINSDGSKDTASSQPAFKAPAFGAPAFGTPAFGQ
                     TSIGSHESKPQVTGTENSTGSGFGAFSAFAKTDSPFSKLSSGPSPFINKPVADKPESN
                     ESEGKETLKSKPDESSSIGSEHGFGIPSKSLFSKTAISNSSSVNSSASKSDSKDNASS
                     LFSNFNDKIAEHKQSQSPFSQFQNQPVPSATNNEESTNDDESHQAEDSDSNSDKETST
                     GDDASSTESSEDAQSQPEHDEQLKLTKEGDSGNSDQFSKEQHSLEPGSNKTDFSSLTE
                     RIKKVANIDGNSFSDAFSKSMTVKEPEASQTGASAFSKFSKGLQKSPKPAFSFANIGK
                     QQSLNTDSKLTNSSNNLGRSTLGERDTEKDSKVNRKESQDSKKSEHQSAAKEEGSEAT
                     TTFNKSEGSFDQKGANEAVLREGKTLSGKETDELGESDTWKPSAAVSQKETTDEYCSS
                     EVDSKEASKEVSEESPVNLPDTEYPGKRTETSTEGESFDDLDDLKEELEHIKTNTDKI
                     KMPTSSEHATEPAHTNPRFALGNSSTETFDAKTQTFRQVHDAEVGTEKNAVDHADVQA
                     FENDEKYLAQQYAPKKIGTFFIGAKLLQKPSLSKNETMKRIEATFNVVSSELEVLEGN
                     LKNIGEFINDQSKNPFSRTAETLFLNYTWRLEEASVLNSFVKELFEEGGPTFAEVSSL
                     MCDAENLRDKDLVSLKSNQFSTREYFCQLKTLCEQNETFKRGLTFRQTQFQRKLRSKI
                     SSVQNLIHNMGGTLRVLQAQASTGDVKETPLVSRLIESSSRRGDLLEAIQALRSEVAE
                     LKIRDRSLIKFSDADSATRTAPISELKLKLDTKQQIGQVLMNRLQNT"
     gene            complement(<811056..>811901)
                     /locus_tag="KLTH0G09658g"
                     /db_xref="GeneID:8293730"
     mRNA            complement(<811056..>811901)
                     /locus_tag="KLTH0G09658g"
                     /product="KLTH0G09658p"
                     /transcript_id="XM_002555406.1"
                     /db_xref="GeneID:8293730"
     CDS             complement(811056..811901)
                     /locus_tag="KLTH0G09658g"
                     /note="similar to uniprot|P04840 Saccharomyces cerevisiae
                     YNL055C POR1 Mitochondrial porin (voltage- dependent anion
                     channel) outer membrane protein required for the
                     maintenance of mitochondrial osmotic stability and
                     mitochondrial membrane permeability"
                     /codon_start=1
                     /product="KLTH0G09658p"
                     /protein_id="XP_002555452.1"
                     /db_xref="GeneID:8293730"
                     /db_xref="GOA:C5DMK4"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:C5DMK4"
                     /translation="MAPPFFSDISKDINGLLNRDFYHGTPAAVDIKTTAPNGVAFAVK
                     GKSSPKDNAIAANVEAKVTDKATGLTLTQGWSSANALDTKIELAELTPGLKSELATTF
                     VPGASKAAKLNLSFIQPFFTARGAFDLLKGPSFVGDLTLAHEGFVGGAEVGYDIAAAA
                     VSRYAVALGYSAGAYSVALSINNAQLTTASFFQKVSPLLDVGAKAVLNPQAGSNVNIE
                     FASKYTLDATSQVKAKVADSGIVALAYKQALRPGVDLGVGASFDALKLSEPVHKLGWS
                     LSFSA"
     gene            <813511..>815556
                     /locus_tag="KLTH0G09680g"
                     /db_xref="GeneID:8293731"
     mRNA            <813511..>815556
                     /locus_tag="KLTH0G09680g"
                     /product="KLTH0G09680p"
                     /transcript_id="XM_002555407.1"
                     /db_xref="GeneID:8293731"
     CDS             813511..815556
                     /locus_tag="KLTH0G09680g"
                     /note="weakly similar to uniprot|P53950 Saccharomyces
                     cerevisiae YNL054W VAC7 Integral vacuolar membrane protein
                     may function to regulate Fab1p kinase activity"
                     /codon_start=1
                     /product="KLTH0G09680p"
                     /protein_id="XP_002555453.1"
                     /db_xref="GeneID:8293731"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:C5DMK5"
                     /translation="MSTEDDKRMIVETETVQTPAQNLLPVQSEDKAEDEATSIITQGD
                     GPANLIDHNPLSIHNGSGAIRNKKSSLLIDSFLGKEATPSSTGLASTQGTAKPAVQST
                     SHSKPSHKELLEESQPRLGVPEDHKPEALSPRASGPIEHAEDGTARRARDPPNKADFF
                     AARLASAVGENEISDSEETFVYESTANSTNNAAPGESRAYGIPAKMSAPLLNHNTPNA
                     STSKLLNRAKATRHTSIAAIPPAQPSEQSDDLHSLRYVNRANPQEIRSVRSYTTMPRS
                     PGKRLSLISLAQNGGASAPRKTSRLASSNSNANARRKVSQKRQLRTTASKIFDAHGAS
                     LRRYSGVPDDVNLEDYIEQTGGELTPKKFAYHSDSEFEDEPVSYTQNADNEEEDNHSM
                     FYYSHPKNDLEARHVLSDYDEAEEGGHPVQGQHLGYQPELDYYADNYYLQPTEATALK
                     KKPSHYNGYSPHNFYTTKTNWARFRNFVYFAFVVSFLLTLGFISGFLLATNKELHDLQ
                     LSKITSVLVSADELVFDVIATAFNPGFFTVEIQKVELDIFAKTSHLDPDGGALGTPYE
                     TILLGTVENLENSLQFQGGFFRRNYDHSKSSVKLIHPGSVDEEGRDDARPHKENIEDG
                     IAKWRQLIHYEFDLIVRGNMYYKMPFFNSEKSVGVQCVTLVNPYKGGNGNELLGNEA"
     gene            <816434..>817804
                     /locus_tag="KLTH0G09702g"
                     /db_xref="GeneID:8293732"
     mRNA            <816434..>817804
                     /locus_tag="KLTH0G09702g"
                     /product="KLTH0G09702p"
                     /transcript_id="XM_002555408.1"
                     /db_xref="GeneID:8293732"
     CDS             816434..817804
                     /locus_tag="KLTH0G09702g"
                     /note="similar to uniprot|P38590 Saccharomyces cerevisiae
                     YNL053W MSG5 Dual-specificity protein phosphatase required
                     for maintenance of a low level of signaling through the
                     cell integrity pathway regulates and is regulated by Slt2p
                     also required for adaptive response to pheromone"
                     /codon_start=1
                     /product="KLTH0G09702p"
                     /protein_id="XP_002555454.1"
                     /db_xref="GeneID:8293732"
                     /db_xref="GOA:C5DMK6"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DMK6"
                     /translation="MLRTTGSAAEGSKESPDGSTGPRSPRHVRNRNTKNLSLSISKSP
                     TQRISAMEEHFGVTPQDTLQGPVQIPKPTPNQREAQIFTLSGVMNSSATSPVSATGSQ
                     GAKNRLKRGMSLPLSLKTANVRSAAAHSFSHQSPGAERTSSSIEAQSLLLGSQPDPPQ
                     PITSWVYHKSSSLSSSPLDEENGPYTYTEVYKENAYPAGPLLVFGSYIYLYSEPTVED
                     MSKFDVVINVAKEVQDCRAQLQPSESLEYHHAEWTHTTKICTDLPRLTQIIHQAVIAK
                     KRVLVHCQCGVSRSASLIVAYIMRYQNLALNDAYNRLKSVAKDISPNMSLIFQLMEWN
                     EALNAQRQRTAQEDLKVARNKASSLDLDKSNSDPVEIANMISQQNALDLSSPNCSSVS
                     TENTPCTPSEFLNCDQLTSTATSSSKLFGTARPLVPGPPPHLSNFNSFAQSPVEIGDK
                     GRSGWD"
     gene            <818249..>821470
                     /locus_tag="KLTH0G09724g"
                     /db_xref="GeneID:8293733"
     mRNA            <818249..>821470
                     /locus_tag="KLTH0G09724g"
                     /product="KLTH0G09724p"
                     /transcript_id="XM_002555409.1"
                     /db_xref="GeneID:8293733"
     CDS             818249..821470
                     /locus_tag="KLTH0G09724g"
                     /note="similar to uniprot|P40480 Saccharomyces cerevisiae
                     YIL112W HOS4 Subunit of the Set3 complex which is a
                     meiotic-specific repressor of sporulation specific genes
                     that contains deacetylase activity potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0G09724p"
                     /protein_id="XP_002555455.1"
                     /db_xref="GeneID:8293733"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DMK7"
                     /translation="MSDGSRSSSNEPGLPTVKKRSLSNYLSNIQNRREELGRVVKKEE
                     DKAKHGAATSGANSTKEAGVKEDAPKHSDSLGVKKTENEMRDELREKSMLEASRDLGN
                     TDSSAGQEKVSKGAPKPPGDENGGKEENKNGSGSDQSLSTTRAPSESKDNCTVKNKSE
                     DPKSETVGEASEAEKDSRKNANEDSSDVKTAPKGSIIKSELIQLIEEPEKEKPREKNE
                     EIESELSEVDSDAPTEPASPPKPRLGRLIRGDQLKSPTKSNSRYFSTGNSEESELSDI
                     EDLNHLPISSSILHGDSSPHKPSHIGLNSSPVNLVHSKPKPTTAVKSHVAISKTTKTR
                     KSGVHRDAGGRTRLQIACDKGKHDVAKRLIQEGYDVNDQDNAGNSPLHEAALNGHLDI
                     VKLLLSNGADVNIQSHEPVKDTPLIDAAANGHLKVVKLLLKYNADPTISNAKGLTAFE
                     SIDEDSDFDSEERKLVRDLKYELRKAATEFGNNPGRQARSSSKNGFSESERSSSNARM
                     EEEFFWTDISSKAGREKLLRASREGKLSYVGAYLENGGRVDFKSFTEAVRSGHEDITS
                     LFLAFGAQPNLVLRDGQTPLMMSLGRGHIGTAKLLLEAGANPLAKDKKGKSVLSYAKN
                     SELGLVSEDEVQLIENAIRKERRSNEEFWNRESPGSERTEKSQQQEEQDESTKASNQS
                     PQKARLLSTKSTVPQKRPHSYESQSNTNISDVKEPSPEVDAGSRNPFIQDSFEGYAGN
                     RRSPRDGSLSPGTVLPMSDPPRSQTSTPAYPGSVKAVETTEEREQRLKAEESYRQKRL
                     LNKKKKEQEFLQKIAEDERKREEEIARQDAERAKKLEEEKAKQAEREIQKRTEAELER
                     RRKIRAQYPLGLRAIDFDRKDEFQRFLPIYYVTIDGLRHVLDLQVCILLKDESFLAKC
                     ENGRDIPQAQKEQIWNIFKFIFLYGGRKSTDKAFGSQALSGIDRLSFKDLAELDNAER
                     QKFANLPLRWIPWNSVSFPEGTEIIKEAAESQMIEVSLEQHTTSWLGAQTNSTNASHY
                     NSHQVPLSTAIRQIPQEVYGDLPPRLRNRSSILKVLKGPRPSW"
     gene            <821736..>822519
                     /locus_tag="KLTH0G09746g"
                     /db_xref="GeneID:8293734"
     mRNA            join(<821736,822068..>822519)
                     /locus_tag="KLTH0G09746g"
                     /product="KLTH0G09746p"
                     /transcript_id="XM_002555410.1"
                     /db_xref="GeneID:8293734"
     CDS             join(821736,822068..822519)
                     /locus_tag="KLTH0G09746g"
                     /note="highly similar to uniprot|P00424 Saccharomyces
                     cerevisiae or to YIL111W uniprot|P00425 Saccharomyces
                     cerevisiae YIL111W"
                     /codon_start=1
                     /product="KLTH0G09746p"
                     /protein_id="XP_002555456.1"
                     /db_xref="GeneID:8293734"
                     /db_xref="GOA:C5DMK8"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:C5DMK8"
                     /translation="MLRSSFARVARVTPARFAQTQAISKAAIVDLHSRWEDLPAVEQQ
                     ELVSKLTERQKLPWNQMTETEKQAAWYISYGEWGPRRPVHVKGDGAYIAKGVAVGLVG
                     SVVLFAIIRQFGGEEPKTMTKEWQLKSDEYLKSKNANPWGGYSQVQSK"
     gene            <823484..>824611
                     /locus_tag="KLTH0G09768g"
                     /db_xref="GeneID:8293735"
     mRNA            <823484..>824611
                     /locus_tag="KLTH0G09768g"
                     /product="KLTH0G09768p"
                     /transcript_id="XM_002555411.1"
                     /db_xref="GeneID:8293735"
     CDS             823484..824611
                     /locus_tag="KLTH0G09768g"
                     /note="similar to uniprot|P40481 Saccharomyces cerevisiae
                     YIL110W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0G09768p"
                     /protein_id="XP_002555457.1"
                     /db_xref="GeneID:8293735"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMK9"
                     /translation="MSFQFALSSADLSDDELSDSQNSHQISTGDITGAATPAVNPLDA
                     PHLRSNELKQPQWEGLNKILESLKDVRVSFEKIHTPDKGIPLYRRELFDVKHQLMTES
                     DEKDDEQSKVELEILMGETNEDVRKNVYEGGLKSWECSIDLVDALSTDFGNGFSSGTI
                     LELGCGTSLPSEYLFAQLLKSNRRCDAKLILADYNDSVLRLVSIPNLIITWALLTLDE
                     QKLTTLQQGGNETVPIVEYELIFTSELLTAFEEDIVKRGISILLASGTWGRDLCSLLS
                     PELSRSEEVLLLSSETIYHPETLPIISELILELMQLTAHASNSTIKTLVAAKDIYFGV
                     GGSVIEFERYMQQRIKERRLGLKLFTQKVQAGLKRSIVSIE"
     gene            <824749..>825912
                     /locus_tag="KLTH0G09790g"
                     /db_xref="GeneID:8293736"
     mRNA            <824749..>825912
                     /locus_tag="KLTH0G09790g"
                     /product="KLTH0G09790p"
                     /transcript_id="XM_002555412.1"
                     /db_xref="GeneID:8293736"
     CDS             824749..825912
                     /locus_tag="KLTH0G09790g"
                     /note="similar to uniprot|P53951 Saccharomyces cerevisiae
                     YNL051W COG5 Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p) a cytosolic tethering
                     complex that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments"
                     /codon_start=1
                     /product="KLTH0G09790p"
                     /protein_id="XP_002555458.1"
                     /db_xref="GeneID:8293736"
                     /db_xref="GOA:C5DML0"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:C5DML0"
                     /translation="MSDPLAAFEDYLTPDFNASRTCNKLLKASNPDLQCEELDLVTPL
                     KKVKYHIEEIERRNDDVIKANPSHLIESFDSKKIAQVQTRDALSSSLEYLSMSYKRLD
                     AEVLEPYQKCLLLRSALSKIHQTSSILRDVSIFLHLLRQVTGFGTLDQTDPSAHQKAL
                     ILASIHSQIQTELSSNPNLGALELVKKYDVETILPSRRNTVRYLSDRLFSDCANNLEV
                     QSKNLDVTQLAKALYELSQKDFITVIDRVLLSKITNSTQTLSKTITSIKTLPAALETV
                     MKNGRDVRALGRALNEAASTKSTLLKDYLSHKKHSCISEMFWSRVSKNFKREFEISFN
                     RGGPVGKSLAANSSVILESIINAMKDSTEKENGESNLEKMLDSVAILNLHTTR"
     gene            complement(<825945..>826723)
                     /locus_tag="KLTH0G09812g"
                     /db_xref="GeneID:8293737"
     mRNA            complement(join(<825945..826638,826707..>826723))
                     /locus_tag="KLTH0G09812g"
                     /product="KLTH0G09812p"
                     /transcript_id="XM_002555413.1"
                     /db_xref="GeneID:8293737"
     CDS             complement(join(825945..826638,826707..826723))
                     /locus_tag="KLTH0G09812g"
                     /note="similar to uniprot|P53952 Saccharomyces cerevisiae
                     YNL050C"
                     /codon_start=1
                     /product="KLTH0G09812p"
                     /protein_id="XP_002555459.1"
                     /db_xref="GeneID:8293737"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:C5DML1"
                     /translation="MNEYRRVTREELFDNDPDEPLQEEQPLIEPDLEFITVNDVQVSD
                     SKQDNDPEGAQEFEFPLFSFGAMENSASHDSEKDDAEESRGRTSTRLMKVSLREPSPD
                     FFKQERPRSFYFAEYSVEQTNNFKTAAIEANDILRESAAAPNLRWSQFRGRLWDLKSH
                     NAKIEREQLRELKIKRRRPGKKQRLAKKAGSERVQERLEKAKELKKLAKKKFHKRGGK
                     KNKKTESDGPSKPRFRTE"
     gene            complement(<827019..>829712)
                     /locus_tag="KLTH0G09834g"
                     /db_xref="GeneID:8293738"
     mRNA            complement(<827019..>829712)
                     /locus_tag="KLTH0G09834g"
                     /product="KLTH0G09834p"
                     /transcript_id="XM_002555414.1"
                     /db_xref="GeneID:8293738"
     CDS             complement(827019..829712)
                     /locus_tag="KLTH0G09834g"
                     /note="similar to uniprot|P40482 Saccharomyces cerevisiae
                     YIL109C SEC24 The Sec23p-Sec24p complex is one of three
                     cytoplamic COPII factors involved in ER to Golgi transport
                     vesicle coat component"
                     /codon_start=1
                     /product="KLTH0G09834p"
                     /protein_id="XP_002555460.1"
                     /db_xref="GeneID:8293738"
                     /db_xref="GOA:C5DML2"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DML2"
                     /translation="MSHHKKRVYPQAQLQYGQAVGQAGSPVLQPSYPSQINTPVAEQQ
                     PQFMTPAQQQLHQQIDQVSQSMGGMQLHNVPVMDPNAYQQAPAVPQPGVPAPYQQQAP
                     AASPGFSQPVSVGRPMNQLYPIDLLTELPPPISDLSLPPPPLMVQPEKFVVPVETANA
                     SSDFVRCTLNAMPKSNSLLKKSKLPLALVIRPYQHLQDTDDTVPLNTDGLVVRCRRCR
                     SYMNPFVTFIEGGRRWRCNFCNLANDVPMAFDVSQQGVPVNRYERNEIQHAVMEYLAP
                     KEYAVRQPPPSSYAFVLDVSQNAIKNGLLATAARTLLETLDSLPNHDERTRVTILAVD
                     NSIHYFSIPLDEEGDHIKMLDVVDLDEPFLPMPSSMYVPLKGCRSNIEKLLNQLPEIF
                     QYNIMSKLALGPALKSAFNLIKGVGGKIIVVASTLPNSGIGKLQRRNETNVANTAKEA
                     AQLLGCQDAFYKNFTIDCNKNQITIDLFLASEDYIDVASLSNLSRFTGGQTHFYPGWS
                     AAKLTDVTKFTKEFSKHLSMDLSMEAVMRARGSSGLRMTRFYGHFFNRSSDLCAFPTF
                     PRDQSYVFEVSIDEQLVRDYAYLQIAVLLSLNTGQRRIRVITMAIPTTDSLAETYASA
                     DQLAITNYFTQKAVEKAYTNLEEAREYLNRSVQEILATYKKEIVVSNTAGGAPLRLCA
                     NLRMLPLLTHSLTKHMAFRAGLVPSDHRASALNFLESSPLPYLIKNIYAKVYSLHDMP
                     DEAGLPDENGEIVLPERINATSSLLERYGLYLIDNSTELFLWMGGDAVNELTMDVFGT
                     PDILEIPIGKQELPVLDNSEFNSRVRNIISKIREHDDVITYQPLYIVRGASLSEPVNH
                     ASAREVATLRLWASSTLVEDKILNSQSYREFLQNMKTRITK"
     gene            <830050..>832122
                     /locus_tag="KLTH0G09856g"
                     /db_xref="GeneID:8293739"
     mRNA            <830050..>832122
                     /locus_tag="KLTH0G09856g"
                     /product="KLTH0G09856p"
                     /transcript_id="XM_002555415.1"
                     /db_xref="GeneID:8293739"
     CDS             830050..832122
                     /locus_tag="KLTH0G09856g"
                     /note="similar to uniprot|P40483 Saccharomyces cerevisiae
                     YIL108W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G09856p"
                     /protein_id="XP_002555461.1"
                     /db_xref="GeneID:8293739"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:C5DML3"
                     /translation="MGEIVLYNLQDGVEVYSACLVIHGKCSSSNTSVIEVRHSQFPCL
                     RYEVHKSGFKCLVQLSPGENKLTFATDQKESKTVTCHYTPLVQNEPVHLCLLVARDSP
                     MVFDSPSSQQKKEGGNNLDLAVRKLRLGARLMQAYTNEQMLRNGFGPRTFQFVEEYGL
                     DTTFKQPEMRNRVKVHIVRTEKSVKELRDPDRAQQNPHAKDAGGLFGIAMEALRKYGG
                     PFASSSERPVQAAVMILDAHWDAKLNLITAHAALGGGDDSLKLAIFGSHGLYAWPYFI
                     EDVPRYFTDETRSSTKEVANDCNECGSHWECFTLTLGAFMHEIGHLLGCPHQENGVML
                     RDYVRLNRSFLSKEAFSTRTNSNGAQPPIYPREECTWHRLDLLKFLYHPSFTLPQDFY
                     DPSMMRPGCIGGFKAPSPSVYVLPNNCCVLRSETGIYCIQIICGDLARAHIEYLPISL
                     GGTGPQKEIFLSLDDLRSRIPPEHLEKYRDSFKIKACAVNSPESNWEQFPRFLQASQI
                     PMANYGFPKHVVGMKSSLYGGADRGKDVGIIAFDGRRVTAVRVFHGAALDGIMLFLDE
                     GNSNPEKDPPLPPRTYMGKLTNAMKSVSIQSTDRQSVLFGKQTNSYSDFEMNFGEHLL
                     GFNLRSGCWVDGVQVLTTQGRASKFFGNNGGGSQHQIIAPGGQHILGFYGRVGQWVDA
                     IGIVYGAI"
     gene            complement(<832255..>834468)
                     /locus_tag="KLTH0G09878g"
                     /db_xref="GeneID:8293740"
     mRNA            complement(<832255..>834468)
                     /locus_tag="KLTH0G09878g"
                     /product="KLTH0G09878p"
                     /transcript_id="XM_002555416.1"
                     /db_xref="GeneID:8293740"
     CDS             complement(832255..834468)
                     /locus_tag="KLTH0G09878g"
                     /note="similar to uniprot|P40433 Saccharomyces cerevisiae
                     YIL107C PFK26 6-phosphofructo-2-kinase inhibited by
                     phosphoenolpyruvate and sn-glycerol 3- phosphate has
                     negligible fructose-2 6-bisphosphatase activity
                     transcriptional regulation involves protein kinase A"
                     /codon_start=1
                     /product="KLTH0G09878p"
                     /protein_id="XP_002555462.1"
                     /db_xref="GeneID:8293740"
                     /db_xref="GOA:C5DML4"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DML4"
                     /translation="MFKPVQFSDSTTAPSSDSEVEPLESHQSEHQKHVRLDVGSENSP
                     PISPNAPENGLPEFQKRPLSDTPVGSYWNSPSDSQETSSDSTPIPSPHGSSSNLRQFE
                     TALGEDGESKTSNNSHFIHPKVRPTTIDVPGLTKSRTSPDGTISNKDPGSKLVIVMVG
                     LPATGKSFITNKLSRFLNYSMYYCKVFNVGNTRRQFAKEHNLQDQDSNFFDPNNPESK
                     KLREKWAMDTLDQLLDYLLDGPGSVGIFDATNSTKNRRKKVLEKIYSRNNQIKVLYLE
                     SVCSDKTTVEKNIQLKLFGPDYKGKDPEASLQDFKERLSNYVRAYEPVEDDEDLQYIK
                     MIDVGKKVISYNIQGFLASQTVYYLLNFNLAERQIWITRNGESEYNVQGKIGGDSDLT
                     LRGKRYAQALSRFIDKQRISFTEHEMKAHMESNPDGKNFSATEFFVWTSMLNRAVQTG
                     NYFNEDDYPIKQMRMLDELSAGDCEGLTYAEIQAKHPDEFEERLNDKLRYRYPGIGGE
                     SYMDVINRLRPVITEIERIKENLLIVTHRVVARVLLGYFLNLSRDIIANLDVPLHCVY
                     CLEPKPYGVTWSLYEYDESTDDFFKVPHTELNTMKVKEVGLVHSERRYSIVPTAPPSV
                     ANTKGEFLANNASSTSLAKTALPRLPVVGGGTSIARPGRRPQLISATSSRFARNNSNN
                     KDGASERSISTPPLTGGRKEIELNKLNEKLAQLNASESKENTGSKPVMSRSQSEL"
     gene            <835892..>836809
                     /locus_tag="KLTH0G09900g"
                     /db_xref="GeneID:8293741"
     mRNA            join(<835892..835911,836014..>836809)
                     /locus_tag="KLTH0G09900g"
                     /product="KLTH0G09900p"
                     /transcript_id="XM_002555417.1"
                     /db_xref="GeneID:8293741"
     CDS             join(835892..835911,836014..836809)
                     /locus_tag="KLTH0G09900g"
                     /note="similar to uniprot|P40484 Saccharomyces cerevisiae
                     YIL106W MOB1 Mps One Binder (putative) transcriptional
                     regulator involved in mitosis"
                     /codon_start=1
                     /product="KLTH0G09900p"
                     /protein_id="XP_002555463.1"
                     /db_xref="GeneID:8293741"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:C5DML5"
                     /translation="MSFLQNFPGQTIRSTRGFKWNTTRAPFHQDGQSSPTLGENGPPM
                     FQTPQKANNQAITDYNYTPSHQKPYLDASQGTTVSSHKDLKEIVETTLGSQGVLNQAV
                     KLPKGEDVSEWIAVHCVDFYNQINMFYGAITEFCSPESCPRMIATNEYEYLWYVKPGS
                     PPLSVSAPKYVEYLMKWCQDQFDDETVFPSKPNVPFASNFVESNARPILKRLFRIYAH
                     IYCHHFNEILELNLQTVLNTSFRHFCLFTQEFQLLRKQDYGPLLELVQELKDR"
     gene            <837086..>838807
                     /locus_tag="KLTH0G09922g"
                     /db_xref="GeneID:8293742"
     mRNA            <837086..>838807
                     /locus_tag="KLTH0G09922g"
                     /product="KLTH0G09922p"
                     /transcript_id="XM_002555418.1"
                     /db_xref="GeneID:8293742"
     CDS             837086..838807
                     /locus_tag="KLTH0G09922g"
                     /note="similar to uniprot|P53954 Saccharomyces cerevisiae
                     YNL048W ALG11 Alpha-1 2-mannosyltransferase catalyzes
                     addition of the terminal alpha 1 2-Man to the
                     Man5GlcNAc2-PP-dolichol intermediate during asparagine-
                     linked glycosylation in the ER"
                     /codon_start=1
                     /product="KLTH0G09922p"
                     /protein_id="XP_002555464.1"
                     /db_xref="GeneID:8293742"
                     /db_xref="GOA:C5DML6"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:C5DML6"
                     /translation="MSINEVLAIIATALAASVFIAKVLAGFLPHFFRAPPAQWRLRVN
                     KAMMRAENSPNKVPALDFGWKNGSVRRQMIRASYQPSAYTNKMSTQKLVVGTEDRANR
                     ESFVNRLAHNLRTFDRKIYGYFHPYCNAGGGGEKVLWKAVETTLQKDPNGVVAIYTGD
                     NDVSGEEILSNVIKRFEYNLDASRIVFIFLTKRDFVDPKKWPRLTLLGQAFGSAVLAA
                     EALFKLTPDVWCDTMGYPFTYPIVHFLVNVPVVTYTHYPVISSDMLQKLVLTPGFKNN
                     LKLRLKYYYWKIFMLLYTFTGKFVTIATTNSTWTQNHISRIWPQKSKRIIYPPCSTEN
                     LAFGEDGSKWTRKNQAVIIAQFRPEKRHNLIIRSFGSALKKASAQELRAMPKLIFIGS
                     TRGQNDRNYVETLKTLSYETLGISNDLIEFKTDCEYEEMKKHLRTSSYGINAMWNEHF
                     GIAVVEYIASGLIPLVHASAGPLLDIVVPWDSTQQKQANNATEDNRTGFFFRDPSDPD
                     FSSQHNSEYPTLESLFIKIMSLTNDEKLSITRRGKNCVLNKFSDQKFAEQWRSVLEDI
                     PPADSAI"
     gene            complement(<838994..>840952)
                     /locus_tag="KLTH0G09944g"
                     /db_xref="GeneID:8293743"
     mRNA            complement(<838994..>840952)
                     /locus_tag="KLTH0G09944g"
                     /product="KLTH0G09944p"
                     /transcript_id="XM_002555419.1"
                     /db_xref="GeneID:8293743"
     CDS             complement(838994..840952)
                     /locus_tag="KLTH0G09944g"
                     /note="similar to uniprot|P40485 Saccharomyces cerevisiae
                     YIL105C SLM1 Phosphoinositide PI4 5P(2) binding protein
                     forms a complex with Slm2p acts downstream of Mss4p in a
                     pathway regulating actin cytoskeleton organization in
                     response to stress phosphorylated by the Tor2p-containing
                     complex TORC2"
                     /codon_start=1
                     /product="KLTH0G09944p"
                     /protein_id="XP_002555465.1"
                     /db_xref="GeneID:8293743"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DML7"
                     /translation="MSNRNTMNSGISDLTTQQQQELQRIPSNFAPQGVEGGAKSMTSH
                     DHRTYMQRTDNGQLTASHTPYPVENGSSVDGARDSAQYGPASPEIPTGMFQHQKSHAA
                     SLASGSTSETGRPRVSQQWVHSATKQLDPRSPVVILLPTSANPTEVLAQRFAAWRSVI
                     RSILVYLTETVSIQDEIVRQQLRLSHAVNFPFFSTENQHQPSTVEEKAIQKYFLPLGN
                     GSIQDLPSILSQYHSQMANGALKMSKELANDVIPRLEDLRGDLLIKIKEIKSLQSDFK
                     NACAKELQQTRHGLKHFNEAVEAARYGAPKHDPHLVKMSLEKQIRRQLNEENLLHEAF
                     DNLQGSGRELEKVVVMEIQNALSIYARLLGQNAQVVFDALISKLDVGFLNKEPVFEWD
                     NFISKDPNFIEPNLPSRHARDIVYKYQDDPLTFEVKSGFLERRSKFLKSYSKGFYLLT
                     PSFLHEFKTPDRKRDLIPVMSLSLNDCTVAEHSKKGSSEHKFILHAKQNGIIHRGHNW
                     VFRAESYESMMMWFEDLKKLTSTSNPMEKAKFVTTRLSLDANRKHHQRNPSIKASGGK
                     TSQRMSTPVQGGRPTSYGTPNLDNQTNTNTSISIPDTEINGHPMNINQPRVSQDSGEG
                     AYNGNIYIETIRDNDHYRENKLNSPRSQ"
     gene            <841108..>841497
                     /locus_tag="KLTH0G09966g"
                     /db_xref="GeneID:8293744"
     mRNA            <841108..>841497
                     /locus_tag="KLTH0G09966g"
                     /product="KLTH0G09966p"
                     /transcript_id="XM_002555420.1"
                     /db_xref="GeneID:8293744"
     CDS             841108..841497
                     /locus_tag="KLTH0G09966g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G09966p"
                     /protein_id="XP_002555466.1"
                     /db_xref="GeneID:8293744"
                     /db_xref="UniProtKB/TrEMBL:C5DML8"
                     /translation="MGRESVQKSGFIRHRAFHGLLKRGSSKGSMKTNNAFKGYRKWWK
                     CSPKELKPDPKHRSGHRVIYGAEISVAAALVLCFAMLMLLLMVKEVGLTTRHCARWEF
                     WTLLASGGRSSVIRLARDAGSRILQWI"
     gene            <845176..>845832
                     /locus_tag="KLTH0G09988g"
                     /db_xref="GeneID:8293745"
     mRNA            join(<845176..845199,845326..>845832)
                     /locus_tag="KLTH0G09988g"
                     /product="KLTH0G09988p"
                     /transcript_id="XM_002555421.1"
                     /db_xref="GeneID:8293745"
     CDS             join(845176..845199,845326..845832)
                     /locus_tag="KLTH0G09988g"
                     /note="similar to uniprot|P53633 Saccharomyces cerevisiae
                     YNL044W YIP3 Interacts with YPT proteins"
                     /codon_start=1
                     /product="KLTH0G09988p"
                     /protein_id="XP_002555467.1"
                     /db_xref="GeneID:8293745"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:C5DML9"
                     /translation="MNQLSQLSGLTRYADNFSIENVKLELQSLQSKLATLRPVQEFLN
                     FKKVSKPQNFGDLQSRVSYNLRYFSTNYALIVGALSIYTLLTNLLLLFVIVFVFFGLY
                     GINKLNGQDLVLPFGVLKVSQLYTALTCIAVPLGFVASPFSTLMWLIGASAVSVLGHA
                     SFVEKPIETVFEEETV"
     gene            <846079..>847041
                     /locus_tag="KLTH0G10010g"
                     /db_xref="GeneID:8293746"
     mRNA            <846079..>847041
                     /locus_tag="KLTH0G10010g"
                     /product="KLTH0G10010p"
                     /transcript_id="XM_002555422.1"
                     /db_xref="GeneID:8293746"
     CDS             846079..847041
                     /locus_tag="KLTH0G10010g"
                     /note="weakly similar to uniprot|P53958 Saccharomyces
                     cerevisiae YNL042W BOP3 Protein of unknown function
                     potential Cdc28p substrate overproduction suppresses a
                     pam1 slv3 double null mutation"
                     /codon_start=1
                     /product="KLTH0G10010p"
                     /protein_id="XP_002555468.1"
                     /db_xref="GeneID:8293746"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:C5DMM0"
                     /translation="MSNPRGRERATNNVMSSLFGNECSEWPFSDASLTQALEFKTQQE
                     KTKQQFYKLECVNRSIELLKTAMAANVPGHMVTQLFQGVSQGTDTGRGPSERAEEKLP
                     KVTISPRSGESAPLNYKFPPSSSSVSMHRRTNSPARIGAAAVASLAENNQLKEEDTNE
                     LPKPLPQQRSPLQFRTHRRNLSLPVARPASLLQPDMSASYGTRKPQEPMTSVISFGSW
                     QSYDPTSHSVMRRNGSVRKHRKTKSASTTPNFGVIDLNMANQVRLPSISKEPPLLSHN
                     GNSLNEEENEFDDQKTCSEQSSRETTPLPQVTKGPNFANNLLNS"
     gene            complement(<847078..>848544)
                     /locus_tag="KLTH0G10032g"
                     /db_xref="GeneID:8293747"
     mRNA            complement(<847078..>848544)
                     /locus_tag="KLTH0G10032g"
                     /product="KLTH0G10032p"
                     /transcript_id="XM_002555423.1"
                     /db_xref="GeneID:8293747"
     CDS             complement(847078..848544)
                     /locus_tag="KLTH0G10032g"
                     /note="similar to uniprot|P40486 Saccharomyces cerevisiae
                     YIL104C SHQ1 Essential nuclear protein required for
                     accumulation of box H/ACA snoRNAs and for rRNA processing
                     interacts with Naf1p"
                     /codon_start=1
                     /product="KLTH0G10032p"
                     /protein_id="XP_002555469.1"
                     /db_xref="GeneID:8293747"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="UniProtKB/TrEMBL:C5DMM1"
                     /translation="MLTPQFSITQDEEFLFICINIAAIRFSAASLEMVVDENLFIFHL
                     SPYYLRLRFAQNLVDDERSNAEFRSQDETIRIKIPKATKGEFFDDLDLPTKLLARKGD
                     ILGADAVKGPPKNSAGPLIQEIDAPGENTNSEQQGEDFSWEISQTPASPSDATKLLTS
                     KYGFDNNYSSVIGVSIANGNDINELDDPEKSSGEDRVQERLRKENLKFDPEYYVSEYM
                     TAKYGNEDDIQINGIKSLIKFTPPLVKKFLKWYKQADDKEAVMSVEFTEAEQQQMQKN
                     LPKKNYLVDDVKKLYITMLSLLFAYAFEQVENEGVHNTESAWTIGKLAPQLSFLDQQV
                     IPESDTSDFSIIKAVILTGVRRSLSYPLHRNFDLSIKVWNYVYYTLRGGKRLVIQALL
                     DLHEVFRFHDVYYVYNTVLISDLCAWFITAGNENVIRSLAIELKKELDQVTKRDIDFD
                     CVCGIDESSGEVSWENMNIEEMEILSEQEYLQQSGRPT"
     gene            <848726..>849997
                     /locus_tag="KLTH0G10054g"
                     /db_xref="GeneID:8293748"
     mRNA            <848726..>849997
                     /locus_tag="KLTH0G10054g"
                     /product="KLTH0G10054p"
                     /transcript_id="XM_002555424.1"
                     /db_xref="GeneID:8293748"
     CDS             848726..849997
                     /locus_tag="KLTH0G10054g"
                     /note="highly similar to uniprot|P40487 Saccharomyces
                     cerevisiae YIL103W DPH1 Protein required along with Dph2p
                     Kti11p Jjj3p and Dph5p for synthesis of diphthamide which
                     is a modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p) may act in a complex with Dph2p
                     and Kti11p"
                     /codon_start=1
                     /product="KLTH0G10054p"
                     /protein_id="XP_002555470.1"
                     /db_xref="GeneID:8293748"
                     /db_xref="GOA:C5DMM2"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:C5DMM2"
                     /translation="MHTSTATTKGPRRRFVGAQAGSRATVVKSEKGNEVVQKPRARTN
                     VRRAINQIPDEILNDEALNEAIKLLPSNYNFEIHKTIWNIRKHEAKRVALQMPEGLLI
                     YSLVISDILEQFCGCETIVMGDVSYGACCIDDFTARSLDCDFIVHYAHSCLVPIDLTQ
                     IKVLYVFVTINMDESHLIRTLQKNFPSGARIAAFGTIQFNPTIHSIKDKLLDSEKVIY
                     IIPPQIKPLSKGEVLGCTSQRLDKEQIDAMVYIGDGRFHLESAMIHNPEIPAFRYDPY
                     SRKFTIEKYNQKQLVQVRTEALNVAKKGKTFGLILGALGRQGSMGTVNNLEKKLKDAG
                     KTVCKIILSEIFPQKLAMFDDIDVFVQVACPRLSIDWGYAFNKPLLTPYEANVLLEQD
                     RMFSEAYYPMDYYEVNGYGRGKEPSHENVKI"
     gene            complement(<850022..>852463)
                     /locus_tag="KLTH0G10076g"
                     /db_xref="GeneID:8293749"
     mRNA            complement(<850022..>852463)
                     /locus_tag="KLTH0G10076g"
                     /product="KLTH0G10076p"
                     /transcript_id="XM_002555425.1"
                     /db_xref="GeneID:8293749"
     CDS             complement(850022..852463)
                     /locus_tag="KLTH0G10076g"
                     /note="similar to uniprot|P53959 Saccharomyces cerevisiae
                     YNL041C COG6 Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p) a cytosolic tethering
                     complex that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments"
                     /codon_start=1
                     /product="KLTH0G10076p"
                     /protein_id="XP_002555471.1"
                     /db_xref="GeneID:8293749"
                     /db_xref="GOA:C5DMM3"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:C5DMM3"
                     /translation="MDFLDYQTFALDEANAKDYDLPEPASRLPIKSQQSSKDLDKDFS
                     MPRLANAELDAEGTENLQDKMQKYASLSLSALSLKRLPPQSSMENPVVSQGTSLGEKT
                     LEQLVQNGEKTIDNTDALLSKRLSRILDAHHRNTLQCDTQLRRSFKVLEDNQDRLHFN
                     SKTLVRPDFVGSLARNSLRSNLESELLKSHLMILDDIQPIVRRIKRLSEPVQNIHQMG
                     DALLKQGEMAHDETKTYMDTVYILQNALLKHRLKKRILVMLRDKLTLNQVEEDALINS
                     NVGPEFFEVMKKLMRLKETATYLLALPNPKAGTVLMEQTNAKIEKANKRIFNYLVDFL
                     YDLQSASKTFGERAFSSNDKPLITFQQGMLYLSNDLPIFNEFIKRVVKARSQIVLDDF
                     LSQFDVSSAKASRPIIISAHDPVRYLGDVLAHVHSLIVDEADFMDSMFKFQNWNIQDT
                     PTSILQENREFLNGLSISLLNETFGPVENSIRIRLEQIIRFEDDPIINFEIYELLALY
                     QMMFIKYGLRPDSNLILQLINLRNTSSSKILTGLTKILDDANITQNLEKELLPAEWLV
                     KYLAKLCELLTKFEKSGSVKDSETLIDSNFLKEALACLITEKLPEYHKSKFPQARKEK
                     EVKKHLLLSEINCIDLIKTRMLPYRETIFSKGDRHLVYENIDSHLQASTKSLIGLETK
                     SLLEKLGLDLYSNLFNMIFPVESVQDELDYDMYLPVLENPIMQRDTIRSNVHIKLNDF
                     LPILLSDIQDNLLFHIVSPKIADHISTECLSCLSKFYKVFRQVLLKLYPENHEDIDTI
                     LNFSEEEFDTLIGLN"
     gene            complement(<853505..>855454)
                     /locus_tag="KLTH0G10098g"
                     /db_xref="GeneID:8293750"
     mRNA            complement(<853505..>855454)
                     /locus_tag="KLTH0G10098g"
                     /product="KLTH0G10098p"
                     /transcript_id="XM_002555426.1"
                     /db_xref="GeneID:8293750"
     CDS             complement(853505..855454)
                     /locus_tag="KLTH0G10098g"
                     /note="weakly similar to uniprot|P40489 Saccharomyces
                     cerevisiae YIL101C XBP1 Transcriptional repressor that
                     binds to promoter sequences of the cyclin genes CYS3 and
                     SMF2 expression is induced by stress or starvation during
                     mitosis and late in meiosis member of the Swi4p/Mbp1p
                     family potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0G10098p"
                     /protein_id="XP_002555472.1"
                     /db_xref="GeneID:8293750"
                     /db_xref="GOA:C5DMM4"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:C5DMM4"
                     /translation="MYPVHALDSHTVELSTNPVDDYQRTWLAVRGDRDRDLGADFHVT
                     RAKYRTCAVQRFHDVLQREAPGPPAGAAAAETPAGGLPPKRSSLDCSEYLFPDVLVLA
                     QAQAQSDGARAAASAPQSPSSGEGASNVLAPPAQALASSEDLNSLTKNQQFRLRKIQY
                     SDQRVFRAINPNNCVLWDHQTGYVFFTGIWRLYQDVMHALVSLGRPDPRPEVGQAPQP
                     IDRKAHCQLELDYAVSKSLYERAVDADSPEHFSRRNVPPKRAYRHSVSAPSTSAGGAS
                     NATSAGNTTASALHYSDIHWYALDNELRESLCSIYRSAHHVQDDFEFHDLLKRIRGGY
                     IKIQGTWLPFEVARALCMRFCYPIRYMLVPIFGPSFPNECADWYARHVALYPPKVRNS
                     AATQPQPRPMASAVSPRSSSMAIPSLSKKPRRGSTTTSSLATFKRAKVDVELLDASQN
                     LLELSRKLNSRGQRVGFSPFPQVQVPPFRTRASSWAPDTSNQNLAFRGQMLPPISSLL
                     ETLEPPVYRHFPPGHAVLSSDPLLSPRSADTHYSSPPLSPGFNQGFQKNQVMGAVPNQ
                     DPHFVAVPSNSYLAEPRLSFSPSTNTPAPPIPLNGVAHFYNSNGHKYSYPDGMQVMFH
                     PQNPPPATPQQPTRRAHMSNYQVGV"
     gene            complement(<857050..>857694)
                     /locus_tag="KLTH0G10120g"
                     /db_xref="GeneID:8293751"
     mRNA            complement(<857050..>857694)
                     /locus_tag="KLTH0G10120g"
                     /product="KLTH0G10120p"
                     /transcript_id="XM_002555427.1"
                     /db_xref="GeneID:8293751"
     CDS             complement(857050..857694)
                     /locus_tag="KLTH0G10120g"
                     /note="similar to uniprot|P53615 Saccharomyces cerevisiae
                     YNL036W NCE103 Carbonic anhydrase poorly transcribed under
                     aerobic conditions and at an undetectable level under
                     anaerobic conditions involved in non-classical protein
                     export pathway"
                     /codon_start=1
                     /product="KLTH0G10120p"
                     /protein_id="XP_002555473.1"
                     /db_xref="GeneID:8293751"
                     /db_xref="GOA:C5DMM5"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:C5DMM5"
                     /translation="MSPAATNIFTLTHNSELPDLLEANNTWSEKMTEAHPTLFRDFNA
                     HGQAPHTLFIGCSDSRYNEQCLGVIPGEIFTWKTIANVVSDKDLTCRATLEFAINVLK
                     VNKVVLCGHTDCGGINTCLALKREALNDGECSHLYQYLQDVDDLYHEHKEEVKAATSD
                     VAQQSRMLSRLNVAKQYQRLLEIDTVQKALARGDIAVYGLLYDVATGRVEKVSS"
     gene            <858744..>860582
                     /locus_tag="KLTH0G10142g"
                     /db_xref="GeneID:8293752"
     mRNA            <858744..>860582
                     /locus_tag="KLTH0G10142g"
                     /product="KLTH0G10142p"
                     /transcript_id="XM_002555428.1"
                     /db_xref="GeneID:8293752"
     CDS             858744..860582
                     /locus_tag="KLTH0G10142g"
                     /note="similar to uniprot|P08019 Saccharomyces cerevisiae
                     YIL099W SGA1 Intracellular sporulation-specific
                     glucoamylase involved in glycogen degradation induced
                     during starvation of a/a diploids late in sporulation but
                     dispensable for sporulation"
                     /codon_start=1
                     /product="KLTH0G10142p"
                     /protein_id="XP_002555474.1"
                     /db_xref="GeneID:8293752"
                     /db_xref="GOA:C5DMM6"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:C5DMM6"
                     /translation="MGKNQCEQGFRDGARRKWPRISLLTLGAGYLLWVFLYNSDAPST
                     SGGAGPRGRANFATGQPATTHNVTISNFNPQGSVSPTSAPDYSYYQQRIQLRPLISST
                     VARDEFEAWLQKQTTVSFERLLANIGDVELNNLSSTDGVAEGGVIASPSKQAPNYFYQ
                     WVRDSAITINTVVSHISNSSQSSGLNLTLVGTVLKYINNSCILQRTANPSGSLQPELE
                     GLGEPKWEVDDSAFTGSWGRPQSDGPPLRAITTLNFLSTLNQSGHSLENVIDLYQKEF
                     KTDLRLSFQSERELIEQALALDLNFVVKNWRKSGFDLWEEVNGQHFFTALCQLKAVSL
                     GRNYYTNIRPEFDNEQKSISGGLHNSFEDILNFLLVDGGFLNPAKNYIVETPQILGQR
                     SGLDIAILIGSLLTHDSEENSPNSEKFPFDVNDSGILNSLYGLVKQMEILYPVNHQRA
                     NLNLGVALGRYPEDIYNGVDTSEGNPWFLATSAAAEVLYKVIWHYQSLNQDLVIPLDG
                     WQSEFWSLIFERIDFSLQGQDTWQLVIPYHSPAYNQTMVSLFTLGDSFLDKVREHVSD
                     EGEMSEQFNRYTGFLQGARHLTWSYGAFWSSRRWRDQALKALNAPN"
     gene            complement(<860681..>861178)
                     /locus_tag="KLTH0G10164g"
                     /db_xref="GeneID:8293753"
     mRNA            complement(<860681..>861178)
                     /locus_tag="KLTH0G10164g"
                     /product="KLTH0G10164p"
                     /transcript_id="XM_002555429.1"
                     /db_xref="GeneID:8293753"
     CDS             complement(860681..861178)
                     /locus_tag="KLTH0G10164g"
                     /note="similar to uniprot|P40491 Saccharomyces cerevisiae
                     YIL098C FMC1 Mitochondrial matrix protein required for
                     assembly or stability at high temperature of the F1 sector
                     of mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="KLTH0G10164p"
                     /protein_id="XP_002555475.1"
                     /db_xref="GeneID:8293753"
                     /db_xref="UniProtKB/TrEMBL:C5DMM7"
                     /translation="MASKVELLSSYKQLVRALVKSNRRSKIVQQLEDNKKQIALLTYR
                     KISLIRQCQDPDPQEKLKAMMNLNGLNKKIDNLKQDDPSKSRKLYFYDKSNELKKLIM
                     EDRSAETSTIIKKLEHLRDIAGFLQNQMEFEQLVERYNPGLKMDQEEKVKRTAAKVGL
                     QVPDI"
     gene            <863151..>864233
                     /locus_tag="KLTH0G10186g"
                     /db_xref="GeneID:8293754"
     mRNA            <863151..>864233
                     /locus_tag="KLTH0G10186g"
                     /product="KLTH0G10186p"
                     /transcript_id="XM_002555430.1"
                     /db_xref="GeneID:8293754"
     CDS             863151..864233
                     /locus_tag="KLTH0G10186g"
                     /note="highly similar to uniprot|P28834 Saccharomyces
                     cerevisiae YNL037C IDH1 Subunit of mitochondrial
                     NAD()-dependent isocitrate dehydrogenase which catalyzes
                     the oxidation of isocitrate to alpha-ketoglutarate in the
                     TCA cycle"
                     /codon_start=1
                     /product="KLTH0G10186p"
                     /protein_id="XP_002555476.1"
                     /db_xref="GeneID:8293754"
                     /db_xref="GOA:C5DMM8"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C5DMM8"
                     /translation="MLRNGFGISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVT
                     DSVVSIFESENVPIDWETVEISGLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHG
                     SLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVE
                     SLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYP
                     EIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGRE
                     FAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEAK
                     NTTKDIGGSASTTDFTQAIIEKLRAL"
     gene            <864735..>866234
                     /locus_tag="KLTH0G10208g"
                     /db_xref="GeneID:8293755"
     mRNA            <864735..>866234
                     /locus_tag="KLTH0G10208g"
                     /product="KLTH0G10208p"
                     /transcript_id="XM_002555431.1"
                     /db_xref="GeneID:8293755"
     CDS             864735..866234
                     /locus_tag="KLTH0G10208g"
                     /note="similar to uniprot|P40492 Saccharomyces cerevisiae
                     YIL097W FYV10 Protein of unknown function required for
                     survival upon exposure to K1 killer toxin involved in
                     proteasome-dependent catabolite inactivation of fructose-1
                     6-bisphosphatase contains CTLH domain"
                     /codon_start=1
                     /product="KLTH0G10208p"
                     /protein_id="XP_002555477.1"
                     /db_xref="GeneID:8293755"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:C5DMM9"
                     /translation="MSLINEPSVDFHLKLNEQSFHIPNELLKRNAKLVNKLIEKETKR
                     VSSLFEDVNTLMAGHDDHSAMTKLGEIIKAVELLERKLEKRITVESELLQRIEYRINY
                     FKELDSLKGNEDKDGLVEWYRRYTNILVGDYLTRNSEIYENELTELDRSAHTRQKRKL
                     SSSGGSTPPLNAGIQFLRSQGLEHHLDYDILVTANRISKNLTSNHDLSLLVNWIKENQ
                     AYLVSKSSPLEFETRLQEYIELVKDQNYPSAISCFQTHLVKFIKTNFEELKLASGLLV
                     FIKSYQQQMHTPVDVEEKDVSNLSSRSGFFRYFFNRPSLKPPRELKQPTTSEVRIKSA
                     SHANFERYTQVLSDERWDVLKDLFLQEYYSMYGISQHEPLLIYLSLGISTLKTRACMH
                     EMETHGGSNDSLTNYLRGEITKTNCPVCSKEFSAISGNLPYAHHIQSSLFDDPVMLPN
                     GNIYDSKKLKQLAVELRSKMLCELQSDQILDPIDQKVFSEKDFITMYPT"
     gene            complement(<866253..>867242)
                     /locus_tag="KLTH0G10230g"
                     /db_xref="GeneID:8293756"
     mRNA            complement(<866253..>867242)
                     /locus_tag="KLTH0G10230g"
                     /product="KLTH0G10230p"
                     /transcript_id="XM_002555432.1"
                     /db_xref="GeneID:8293756"
     CDS             complement(866253..867242)
                     /locus_tag="KLTH0G10230g"
                     /note="similar to uniprot|P40493 Saccharomyces cerevisiae
                     YIL096C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G10230p"
                     /protein_id="XP_002555478.1"
                     /db_xref="GeneID:8293756"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:C5DMN0"
                     /translation="MARKLKGKTTSKGLKGALLRHQAQEQLNKKITSKQEHAVKKNRP
                     TKAVLNNQKIQRETAAKFIPFEKESTLLLIGEGDFSFARSIIENEYISPANLVVTSYD
                     NSPKELNLKYPKSFQQNYDFLMEHGTKVFFKIDATNLIKSFKLSKKTTWQKIVSSELA
                     SKGLQNIMFNFPHTGKGIKDQDRNIRDHQELILAFFRSSKEFFKQINQNLSSAILDKF
                     AQGYTLKSQENGTPASDSQGKVLISVFNGEPYDSWQIKILAKTSGWKVERSNKFQWEN
                     YPEYSHKRTNSEQETTKPAAEREARTFIFELYDKKKHAKNGKKSQNAGSDDEN"
     gene            complement(<867465..>867953)
                     /locus_tag="KLTH0G10252g"
                     /db_xref="GeneID:8293757"
     mRNA            complement(<867465..>867953)
                     /locus_tag="KLTH0G10252g"
                     /product="KLTH0G10252p"
                     /transcript_id="XM_002555433.1"
                     /db_xref="GeneID:8293757"
     CDS             complement(867465..867953)
                     /locus_tag="KLTH0G10252g"
                     /note="similar to uniprot|P53961 Saccharomyces cerevisiae
                     YNL038W GPI15 Protein involved in the synthesis of
                     N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI) the
                     first intermediate in the synthesis of
                     glycosylphosphatidylinositol (GPI) anchors homologous to
                     the human PIG-H protein"
                     /codon_start=1
                     /product="KLTH0G10252p"
                     /protein_id="XP_002555479.1"
                     /db_xref="GeneID:8293757"
                     /db_xref="GOA:C5DMN1"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:C5DMN1"
                     /translation="MSSKRYSLKVEGNASGSHMRFTVVPRNYKRTCGLNLLFYIVANA
                     GIFGFIEQTTSWSLQNIRTAETLVALSMLALIRNPPIESLSVFRSVGIQISEVRGCVL
                     LPTFINEKLLEQRKFIPKDKIGDIIINEGFQKGFKVIFYLAIILKDASRLQLVFPVCY
                     RF"
     gene            complement(<868108..>869787)
                     /locus_tag="KLTH0G10274g"
                     /db_xref="GeneID:8293758"
     mRNA            complement(<868108..>869787)
                     /locus_tag="KLTH0G10274g"
                     /product="KLTH0G10274p"
                     /transcript_id="XM_002555434.1"
                     /db_xref="GeneID:8293758"
     CDS             complement(868108..869787)
                     /locus_tag="KLTH0G10274g"
                     /note="similar to uniprot|P46678 Saccharomyces cerevisiae
                     YNL039W BDP1 Essential subunit of RNA polymerase III
                     transcription factor (TFIIIB) which is involved in
                     transcription of genes encoding tRNAs 5S rRNA U6 snRNA and
                     other small RNAs"
                     /codon_start=1
                     /product="KLTH0G10274p"
                     /protein_id="XP_002555480.1"
                     /db_xref="GeneID:8293758"
                     /db_xref="GOA:C5DMN2"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:C5DMN2"
                     /translation="MSSVVNKSGTRFAPKIRQRRPVVSAPERAKTLGTSNDKANEAAS
                     AESEGNIEKPESEKPQRRDELDPLSQSTTKGLDEEIGSTQASPPASLPPGQRRRSSRL
                     DSLSGANNMFKSGFMEPSQTAAPSGAETAKNRRLSTITGNQGKKKRMSSISESDTSFQ
                     AIKKRRMSSRSSISRKTGSAQRISILSHMNNMDEHLASADADDENLKNETNGDLFQRT
                     DNLYEKYTISNAKEIPKNIADGDSSRYMVDEDSFTIADLCKPHLPIGETSDNFQRAQE
                     AIKAKQETRKKRRILRARARENFKPLSELNKEEAERLLESRKKAAEEIMNADIPEADQ
                     KHAAIQLRMKSDGTFAVDEESTVVDRHKNATLEHAHKLRLDENPFENLFNSATYGRQQ
                     YTDPWTVDELLRFYKALSMWGTDFNLISQMFPYRTRRQIKAKFVNEEKKHPVMIELAL
                     RSKLPPNFDHYCTEIRKELITLEDFNTKLQGLQKEHEEHLKQIEVSKQSAKEEDLQSQ
                     KAKELDNVNKKASGGLRQDQLNAYRKTEVVLGTIDQMKRHRAQEPQEVTGP"
     gene            complement(<869990..>871270)
                     /locus_tag="KLTH0G10296g"
                     /db_xref="GeneID:8293759"
     mRNA            complement(<869990..>871270)
                     /locus_tag="KLTH0G10296g"
                     /product="KLTH0G10296p"
                     /transcript_id="XM_002555435.1"
                     /db_xref="GeneID:8293759"
     CDS             complement(869990..871270)
                     /locus_tag="KLTH0G10296g"
                     /note="similar to uniprot|P53962 Saccharomyces cerevisiae
                     YNL035C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G10296p"
                     /protein_id="XP_002555481.1"
                     /db_xref="GeneID:8293759"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DMN3"
                     /translation="MIINLLISQSSRTSRTTYSMSYSKLESIEFGPNNWCLKLQPIYN
                     SGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDMVIINNDRMNGSLIATAAEDAVK
                     IYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTELSGVDAELHVYDIRSWQQPLRS
                     LVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEEDDALHQVINFASIHSCG
                     WLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRKPWDCNYVIDVYPGFIAT
                     GKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVPFQHEDLLYSCGEDGS
                     LKVWKSSAGPLNVPQEFWQYSEKIDVFSGTVAEVEMMDSEVPDIELRQEPSDVDAVSK
                     DQDEKRKRKHERRSKDKSKSKTKSSSKDHRYQPY"
     gene            <872129..>874501
                     /locus_tag="KLTH0G10318g"
                     /db_xref="GeneID:8293760"
     mRNA            <872129..>874501
                     /locus_tag="KLTH0G10318g"
                     /product="KLTH0G10318p"
                     /transcript_id="XM_002555436.1"
                     /db_xref="GeneID:8293760"
     CDS             872129..874501
                     /locus_tag="KLTH0G10318g"
                     /note="similar to uniprot|P40494 Saccharomyces cerevisiae
                     YIL095W PRK1 Protein serine/threonine kinase regulates the
                     organization and function of the actin cytoskeleton
                     through the phosphorylation of the Pan1p- Sla1p-End3p
                     protein complex"
                     /codon_start=1
                     /product="KLTH0G10318p"
                     /protein_id="XP_002555482.1"
                     /db_xref="GeneID:8293760"
                     /db_xref="GOA:C5DMN4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DMN4"
                     /translation="MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPA
                     DLSSPAKIACLKRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGS
                     YEVFLLMEYCSGGGLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDI
                     KIENVLISDDRTFKVCDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLY
                     RGYPINEKSDIWALGVFLYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLIS
                     FMLSENPTQRPNICQVLEEVSRIQGTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQ
                     PKLDSANNIINVPFKMSHNQPLRSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTN
                     GPFKFIEGNKALQSKQTPHFQPPISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGD
                     ISKIISANPTNVEPSPIYLSSGTQTDDGFASSHALKLERTKSIASLSSSESVESQHTG
                     GSATRRFGQKLKVFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKR
                     NSLDISSTSSHSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQDDTG
                     AKNYYKSHSPVKVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYGMLSPGDEAAEL
                     ASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAGQQVSKDAEEVPSSRKPAPPK
                     PKRPKKPSHLKADKIIKEAETSAYEHSVDISDIEIDELEKDFKRRFPSAV"
     gene            complement(<874566..>876692)
                     /locus_tag="KLTH0G10340g"
                     /db_xref="GeneID:8293761"
     mRNA            complement(<874566..>876692)
                     /locus_tag="KLTH0G10340g"
                     /product="KLTH0G10340p"
                     /transcript_id="XM_002555437.1"
                     /db_xref="GeneID:8293761"
     CDS             complement(874566..876692)
                     /locus_tag="KLTH0G10340g"
                     /note="highly similar to uniprot|P53973 Saccharomyces
                     cerevisiae YNL021W HDA1 Putative catalytic subunit of a
                     class II histone deacetylase complex that also contains
                     Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
                     subcomplex to form an active tetramer deletion increases
                     histone H2B H3 and H4 acetylation"
                     /codon_start=1
                     /product="KLTH0G10340p"
                     /protein_id="XP_002555483.1"
                     /db_xref="GeneID:8293761"
                     /db_xref="GOA:C5DMN5"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:C5DMN5"
                     /translation="MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTI
                     VPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENG
                     LIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETE
                     KGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCL
                     FSNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKY
                     YPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVII
                     SSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVA
                     KVLIGEPPDELPVVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTA
                     INKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHD
                     TPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAV
                     ITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQ
                     RPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGI
                     NNILEERFEEATDFILDTFEEWSDSE"
     gene            <876756..>878345
                     /locus_tag="KLTH0G10362g"
                     /db_xref="GeneID:8293762"
     mRNA            <876756..>878345
                     /locus_tag="KLTH0G10362g"
                     /product="KLTH0G10362p"
                     /transcript_id="XM_002555438.1"
                     /db_xref="GeneID:8293762"
     CDS             876756..878345
                     /locus_tag="KLTH0G10362g"
                     /note="highly similar to uniprot|P53972 Saccharomyces
                     cerevisiae YNL022C"
                     /codon_start=1
                     /product="KLTH0G10362p"
                     /protein_id="XP_002555484.1"
                     /db_xref="GeneID:8293762"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMN6"
                     /translation="MDAQVFLVTTQFIKNFIDNMKSKLIAKKHLLLKKPNTADKRLDV
                     PIMNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWR
                     YNEFLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFV
                     LKYKARLSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQEL
                     SKKFPTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFP
                     AHILNASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMI
                     NTAGCTKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADG
                     ASPVEEEEKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAE
                     ENERIVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEAC
                     IRVAPKEDGGIGFFAVCFERD"
     gene            complement(<878375..>879478)
                     /locus_tag="KLTH0G10384g"
                     /db_xref="GeneID:8293763"
     mRNA            complement(<878375..>879478)
                     /locus_tag="KLTH0G10384g"
                     /product="KLTH0G10384p"
                     /transcript_id="XM_002555439.1"
                     /db_xref="GeneID:8293763"
     CDS             complement(878375..879478)
                     /locus_tag="KLTH0G10384g"
                     /note="highly similar to uniprot|P40495 Saccharomyces
                     cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase an
                     NAD-linked mitochondrial enzyme required for the fourth
                     step in the biosynthesis of lysine in which
                     homo-isocitrate is oxidatively decarboxylated to
                     alpha-ketoadipate"
                     /codon_start=1
                     /product="KLTH0G10384p"
                     /protein_id="XP_002555485.1"
                     /db_xref="GeneID:8293763"
                     /db_xref="GOA:C5DMN7"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C5DMN7"
                     /translation="MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLE
                     NLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEG
                     YSSPIVALRKKLGLYANVRPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGT
                     RVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCR
                     QVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSL
                     GVVPSANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHK
                     AVDANLRDNSIKTPDLGGKSTTQQVVEDVLSRM"
     gene            <880042..>882933
                     /locus_tag="KLTH0G10406g"
                     /db_xref="GeneID:8293764"
     mRNA            <880042..>882933
                     /locus_tag="KLTH0G10406g"
                     /product="KLTH0G10406p"
                     /transcript_id="XM_002555440.1"
                     /db_xref="GeneID:8293764"
     CDS             880042..882933
                     /locus_tag="KLTH0G10406g"
                     /note="similar to uniprot|P53971 Saccharomyces cerevisiae
                     YNL023C"
                     /codon_start=1
                     /product="KLTH0G10406p"
                     /protein_id="XP_002555486.1"
                     /db_xref="GeneID:8293764"
                     /db_xref="GOA:C5DMN8"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:C5DMN8"
                     /translation="MTSGQDQIAEAEFDEGYVVVRADSETSEAFENVGEDLDEQDEQD
                     EQDEQDELDEQGDTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVF
                     DYECIREWAVKSTQKSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNS
                     CGQTCDAPICVHGCSSTCHLGPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCG
                     NPCGLTLPCGVHKCQRECHNGVCGECPETIAKEINCYCGLESLPSIKCQDVKIQSKSQ
                     DGSGKKWIGAFACSRIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGE
                     TPLENMETPRTKCTDPIPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSC
                     NSRPFIVPCKFQGPPRCNTKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLD
                     ESLVEAQHICLKKCNLKLSCGRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPV
                     RCGTVLPPCRNPCIKTLQGPLDCGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKV
                     RTLCFQNNVSCGRVCGKQLVSCHHSCTKTCHREGECQSICKQVCGISRSNCSHICRFK
                     CHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAAHEGQDPADQRPLECTEDCAAARRRL
                     ELMEAFGMNTETVQPTEGIVDLAALAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIE
                     EHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLYCESQDKEPKRSVYVKKTVDS
                     RKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILNYTSTGESSPPVAQINGLLI
                     QKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSGDVMVFAENYATASINVERDINR
                     VVGHLDLIAKDSFLAEGVTVCRVEQVMAEETNRSDESSVAEAPEDPLFV"
     gene            <883191..>883946
                     /locus_tag="KLTH0G10428g"
                     /db_xref="GeneID:8293765"
     mRNA            <883191..>883946
                     /locus_tag="KLTH0G10428g"
                     /product="KLTH0G10428p"
                     /transcript_id="XM_002555441.1"
                     /db_xref="GeneID:8293765"
     CDS             883191..883946
                     /locus_tag="KLTH0G10428g"
                     /note="similar to uniprot|P53970 Saccharomyces cerevisiae
                     YNL024C Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0G10428p"
                     /protein_id="XP_002555487.1"
                     /db_xref="GeneID:8293765"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMN9"
                     /translation="MAELLDFTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDG
                     GESGCGGKLWIAGELLCEYLLENSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGL
                     CAGSLARANGGNAKVHITDIDQLVRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPD
                     AISNKTDLVLAADCVYLETAFPLLEKTLLDLTKGETPPVVLMSYRKRRKADRIFFKAI
                     RKNFKVVPITSFDRCDDFLKQRTHLFQLIRVQK"
     gene            complement(<884037..>884822)
                     /locus_tag="KLTH0G10450g"
                     /db_xref="GeneID:8293766"
     mRNA            complement(<884037..>884822)
                     /locus_tag="KLTH0G10450g"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="XM_002555442.1"
                     /db_xref="GeneID:8293766"
     CDS             complement(884037..884822)
                     /locus_tag="KLTH0G10450g"
                     /note="similar to uniprot|P40496 Saccharomyces cerevisiae
                     YIL093C RSM25 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="XP_002555488.1"
                     /db_xref="GeneID:8293766"
                     /db_xref="GOA:C5DMP0"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="InterPro:IPR019520"
                     /db_xref="UniProtKB/TrEMBL:C5DMP0"
                     /translation="MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVR
                     EPRLVNPSTNKETAKLSEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDK
                     LREVFYEQHPWELSRPKMLVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAH
                     QELLAAYDQARFEFYRLRIQEEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVW
                     KQKAIDQTEVMSARNINPSESWSAQESQPQSDAKAEDTKELQL"
     gene            <885262..>885480
                     /locus_tag="KLTH0G10472g"
                     /db_xref="GeneID:8293767"
     mRNA            <885262..>885480
                     /locus_tag="KLTH0G10472g"
                     /product="KLTH0G10472p"
                     /transcript_id="XM_002555443.1"
                     /db_xref="GeneID:8293767"
     CDS             885262..885480
                     /locus_tag="KLTH0G10472g"
                     /note="highly similar to uniprot|Q8TGJ3 Saccharomyces
                     cerevisiae YNL024C-A Identified by gene-trapping
                     microarray-based expression analysis and genome-wide
                     homology searching"
                     /codon_start=1
                     /product="KLTH0G10472p"
                     /protein_id="XP_002555489.1"
                     /db_xref="GeneID:8293767"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:C5DMP1"
                     /translation="MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAF
                     WKCARIGERASPYVSIACIIMAVNQFQT"
     gene            complement(<885735..>887978)
                     /locus_tag="KLTH0G10494g"
                     /db_xref="GeneID:8293768"
     mRNA            complement(<885735..>887978)
                     /locus_tag="KLTH0G10494g"
                     /product="KLTH0G10494p"
                     /transcript_id="XM_002555444.1"
                     /db_xref="GeneID:8293768"
     CDS             complement(885735..887978)
                     /locus_tag="KLTH0G10494g"
                     /note="similar to uniprot|P40498 Saccharomyces cerevisiae
                     YIL091C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0G10494p"
                     /protein_id="XP_002555490.1"
                     /db_xref="GeneID:8293768"
                     /db_xref="GOA:C5DMP2"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSSLKRSSSAIKGSNEYRSSKSGRKQLRTIRKASGPRRGLAEES
                     ANEENNGSETEAEDKLAAPELNEPAQDQRAGGEAYAALLTLLKAEHGGPARRKTKTDD
                     KKTSADPTSNVKDEEESESRDNEDEEEDEDEEAAIENALMDEHTSGDEDDEGDDGSHQ
                     DDINGVTREGGDATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSC
                     KLHVDKNQEFIYSRPTLVNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQDKLTP
                     LQKQIVDPMFQYQDLLYEYEDYDKETEYRDLYALHVLNHIYKTRDRILKNNQRLQENP
                     DQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPS
                     YKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKK
                     KRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYIND
                     QAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIF
                     QRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLRE
                     KTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRYEIKGVKTVIFYKP
                     PTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVGTERAAVLTHGP
                     NETYEFK"
     gene            <889468..>890892
                     /locus_tag="KLTH0G10516g"
                     /db_xref="GeneID:8293769"
     mRNA            <889468..>890892
                     /locus_tag="KLTH0G10516g"
                     /product="KLTH0G10516p"
                     /transcript_id="XM_002555445.1"
                     /db_xref="GeneID:8293769"
     CDS             889468..890892
                     /locus_tag="KLTH0G10516g"
                     /note="similar to uniprot|P40499 Saccharomyces cerevisiae
                     YIL090W ICE2 Integral ER membrane protein with type-III
                     transmembrane domains mutations cause defects in cortical
                     ER morphology in both the mother and daughter cells"
                     /codon_start=1
                     /product="KLTH0G10516p"
                     /protein_id="XP_002555491.1"
                     /db_xref="GeneID:8293769"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:C5DMP3"
                     /translation="MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVT
                     LFNLYLITTTLKIAARARGLAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTN
                     TRPDESLIDLLRSTTQSQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQ
                     AVGETNRWLSRGNGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGF
                     TFSIVSGLGIYGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWH
                     NQHRSLRSSDTLLTYYRDIILKNGEMVWDAILARTNVNVGASGTPVWASWNRVQPLWK
                     FVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK
                     RRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPWSVPDTPKVVVDSW
                     GFWNWCNIFCTMAIYASELLGSKS"
     gene            complement(891104..891198)
                     /gene="SNR66"
                     /locus_tag="KLTH0G10538r"
                     /db_xref="GeneID:8293770"
     ncRNA           complement(891104..891198)
                     /ncRNA_class="snoRNA"
                     /gene="SNR66"
                     /locus_tag="KLTH0G10538r"
                     /product="snR66"
                     /note="C/D snoRNA monocistronic SNR66"
                     /transcript_id="XR_002432213.1"
                     /db_xref="GeneID:8293770"
     gene            <892671..>893570
                     /locus_tag="KLTH0G10560g"
                     /db_xref="GeneID:8294191"
     mRNA            <892671..>893570
                     /locus_tag="KLTH0G10560g"
                     /product="KLTH0G10560p"
                     /transcript_id="XM_002555446.1"
                     /db_xref="GeneID:8294191"
     CDS             892671..893570
                     /locus_tag="KLTH0G10560g"
                     /note="highly similar to uniprot|P47821 Saccharomyces
                     cerevisiae YNL025C SSN8 Component of RNA polymerase II
                     holoenzyme involved in RNA pol II carboxy-terminal domain
                     phosphorylation"
                     /codon_start=1
                     /product="KLTH0G10560p"
                     /protein_id="XP_002555492.1"
                     /db_xref="GeneID:8294191"
                     /db_xref="GOA:C5DMP4"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /db_xref="InterPro:IPR028367"
                     /db_xref="UniProtKB/TrEMBL:C5DMP4"
                     /translation="MSASYWESTQRQKWQYTRESLFRERHQLWLMECQLFPQGLTVTM
                     ENNKADGEAVTRNIPITHVDLHYGKDYNLRIYCYFLIMKLGRRLNIRQYALATAHVYL
                     ARFLLCASVREVNLYLLVTTCIYLACKVEECPQHIRALVNEARSLWPEFVPPDPTKVT
                     EFEFYLLEELQSYLIVHHPYRSMEQIVSALRSEPYGLVLSATDLQNCWSLINDSYITD
                     LHLLVPPHVIAMASMLIIVSLQRSQRPSLQETFNSFMAQSQVDLAEVMDTIQDLITMY
                     DYWDKYNEPWVKFLLHSLYLRST"
     gene            <893699..>895000
                     /locus_tag="KLTH0G10582g"
                     /db_xref="GeneID:8293771"
     mRNA            <893699..>895000
                     /locus_tag="KLTH0G10582g"
                     /product="KLTH0G10582p"
                     /transcript_id="XM_002555447.1"
                     /db_xref="GeneID:8293771"
     CDS             893699..895000
                     /locus_tag="KLTH0G10582g"
                     /note="weakly similar to uniprot|P28496 Saccharomyces
                     cerevisiae LAC1 and to YHL003C uniprot|P38703
                     Saccharomyces cerevisiae LAG1; Ceramide synthase
                     components, involved in synthesis of ceramide from
                     C26(acyl)-coenzyme A and dihydrosphingosine or
                     phytosphingosine"
                     /codon_start=1
                     /product="KLTH0G10582p"
                     /protein_id="XP_002555493.1"
                     /db_xref="GeneID:8293771"
                     /db_xref="GOA:C5DMP5"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:C5DMP5"
                     /translation="MPVIHGPAPSFMYQCLPVVMRVWSYSARRSSNLLSVSTYVKKKF
                     MVGSRSHSCVRYKVLDKQEDGTRWPSKELGKPEMSSELKQRKVHAGQVATGSQEPVEK
                     QKHRRQKKVASRVDRYSCMLSTAFFALLYLGSKVKPEFTSKFTTLQYKYADVADAYDI
                     GIDDAYMVVTCIVALVMVRSFLLEFVLKPIALRRFHIQSRKSQQRYAEQGWSLVYYTF
                     SWVLGFYLYCQSPYFLNCDHIYLGWPHDRLSSTFKMYYLLQISSWLQQIVVLNVEERR
                     KDYWQMFAHHIITCLLTLGSYYYYFTRIGHVILIMMDIVDVFLSSAKMLKYCGFTTAC
                     DYMFAVFLVFWVLLRHIAYNYIFYHAGTKAPGLMSHGQCMASAVQKRCWTPLVIDIFL
                     WLLGGLQVITIIWMALIIKVLIKILKGGSAEDVRSDEDDSD"
     gene            complement(<895162..>896568)
                     /locus_tag="KLTH0G10604g"
                     /db_xref="GeneID:8293772"
     mRNA            complement(<895162..>896568)
                     /locus_tag="KLTH0G10604g"
                     /product="KLTH0G10604p"
                     /transcript_id="XM_002555448.1"
                     /db_xref="GeneID:8293772"
     CDS             complement(895162..896568)
                     /locus_tag="KLTH0G10604g"
                     /note="similar to uniprot|P40501 Saccharomyces cerevisiae
                     YIL088C AVT7"
                     /codon_start=1
                     /product="KLTH0G10604p"
                     /protein_id="XP_002555494.1"
                     /db_xref="GeneID:8293772"
                     /db_xref="GOA:C5DMP6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DMP6"
                     /translation="MDAGATAFFSTVNMVKTIVGAGMLAVPYAFKSDGILVGTALTIV
                     GAVTSGFGLFVLAKCSKTLINPRASSFFTLCSITYPSLSLIFDFAMFVQCYGVGLSYL
                     VLVGDLFPGVVGGTRRGWIIGSTLATVPLSLIKRLDGLKYSSILGLFAVAYLVCLILG
                     SFLKDVVLSENYREFRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNS
                     MQNINKVITSSISTSAALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGT
                     MVILSFPLLLHPCRIAANNMMHWILLTYGKCEVHHEARNKHKHPTSPITMVIEDEEDR
                     LLLGSEGNYEATVNGPSYQEVEENREDSLTEVVPFPNQRFYIITAVLVISLYVLALNV
                     SSFALVLALVGATGSTAISFTLPGLFGYKLIGSQAARNGQLMSRSDKFLKSCSLALAI
                     YGLAVMFLSLYVTIKYGA"
     gene            <896733..>897644
                     /locus_tag="KLTH0G10626g"
                     /db_xref="GeneID:8293773"
     mRNA            <896733..>897644
                     /locus_tag="KLTH0G10626g"
                     /product="KLTH0G10626p"
                     /transcript_id="XM_002555449.1"
                     /db_xref="GeneID:8293773"
     CDS             896733..897644
                     /locus_tag="KLTH0G10626g"
                     /note="similar to uniprot|P53965 Saccharomyces cerevisiae
                     YNL032W SIW14 Tyrosine phosphatase that plays a role in
                     actin filament organization and endocytosis localized to
                     the cytoplasm"
                     /codon_start=1
                     /product="KLTH0G10626p"
                     /protein_id="XP_002555495.1"
                     /db_xref="GeneID:8293773"
                     /db_xref="GOA:C5DMP7"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DMP7"
                     /translation="MEATGERHKVKWFNGGMVQRMEDRLRDILERDSNNLLRLLKSED
                     EELELKFGLDTGAYDLHRMIDEDAGMKMRVEEIIKRFYIDAVPGISNREAQREKEVTG
                     QKNTEKLEEDVDDVYDAEEHRGKSDAIRQETCEEEVIPPENFSHVVGEIYRSSFPRPE
                     NFSFLQQRIKLKSIMVLIPEEYPQENLEFMARAGIKLFQFGMSGNKEPFVNIPSDLLT
                     SALEVAINPENHPVLIHCNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARAL
                     DQQFIEMYDEDKIKRIAQEKQWLPIQW"
     gene            complement(<897703..>898131)
                     /locus_tag="KLTH0G10648g"
                     /db_xref="GeneID:8293774"
     mRNA            complement(<897703..>898131)
                     /locus_tag="KLTH0G10648g"
                     /product="KLTH0G10648p"
                     /transcript_id="XM_002555450.1"
                     /db_xref="GeneID:8293774"
     CDS             complement(897703..898131)
                     /locus_tag="KLTH0G10648g"
                     /note="similar to uniprot|P40502 Saccharomyces cerevisiae
                     YIL087C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G10648p"
                     /protein_id="XP_002555496.1"
                     /db_xref="GeneID:8293774"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:C5DMP8"
                     /translation="MSASDVRELSSTPYPALANSLMLLATPVVSPAANAPARQAAQGA
                     GWSRFGSFWSRPKLVGPSTKTALLFGAAQAVGSWIIYDGDLESGSGFLGAWSALYLIV
                     GGRGSISALRYGRVWPLALSAAALSNTLLYARRFISGGFT"
     gene            complement(<898316..>898726)
                     /locus_tag="KLTH0G10670g"
                     /db_xref="GeneID:8293775"
     mRNA            complement(<898316..>898726)
                     /locus_tag="KLTH0G10670g"
                     /product="KLTH0G10670p"
                     /transcript_id="XM_002555451.1"
                     /db_xref="GeneID:8293775"
     CDS             complement(898316..898726)
                     /locus_tag="KLTH0G10670g"
                     /note="highly similar to uniprot|P02303 Saccharomyces
                     cerevisiae YNL031C HHT2 and highly similar to
                     uniprot|P02303 Saccharomyces cerevisiae YBR010W HHT1"
                     /codon_start=1
                     /product="KLTH0G10670p"
                     /protein_id="XP_002555497.1"
                     /db_xref="GeneID:8293775"
                     /db_xref="GOA:C5DMP9"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DMP9"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <899311..>899622
                     /locus_tag="KLTH0G10692g"
                     /db_xref="GeneID:8293776"
     mRNA            <899311..>899622
                     /locus_tag="KLTH0G10692g"
                     /product="KLTH0G10692p"
                     /transcript_id="XM_002555452.1"
                     /db_xref="GeneID:8293776"
     CDS             899311..899622
                     /locus_tag="KLTH0G10692g"
                     /note="highly similar to uniprot|P02309 YBR009C and to
                     uniprot|P02309 YNL030W Saccharomyces cerevisiae, HHF1 and
                     HHF2, two identical histone H4 proteins; core histone
                     required for chromatin assembly and chromosome function;
                     contributes to telomeric silencing; N-terminal domain
                     involved in maintaining genomic integrity"
                     /codon_start=1
                     /product="KLTH0G10692p"
                     /protein_id="XP_002555498.1"
                     /db_xref="GeneID:8293776"
                     /db_xref="GOA:C5DMQ0"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ0"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<899864..>901414)
                     /locus_tag="KLTH0G10714g"
                     /db_xref="GeneID:8293777"
     mRNA            complement(<899864..>901414)
                     /locus_tag="KLTH0G10714g"
                     /product="KLTH0G10714p"
                     /transcript_id="XM_002555453.1"
                     /db_xref="GeneID:8293777"
     CDS             complement(899864..901414)
                     /locus_tag="KLTH0G10714g"
                     /note="similar to uniprot|P40504 Saccharomyces cerevisiae
                     YIL085C KTR7 Putative mannosyltransferase involved in
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family"
                     /codon_start=1
                     /product="KLTH0G10714p"
                     /protein_id="XP_002555499.1"
                     /db_xref="GeneID:8293777"
                     /db_xref="GOA:C5DMQ1"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ1"
                     /translation="MRAWTSKAARPKRARKRGLFVCLALAIWGLFHVSKLRSSRDEPF
                     SKMGINSRRDHTFSAGCLDPYAYQEQPGYQRQNATFVMLTRNQELSGVLSSMYSVERH
                     FNQWFQYPYVFLNDEEFSEEFIAQVRAATHADVEFGVLSELEWEFPTEVREQLVFKHS
                     IEDQGDRGIMYGNMESYHKMCRFYSGAFFKHPLVSRHEWYWRIEPDVEFFCDVTYDPF
                     WEMQRRGKKYGFTVLIKELYWTVPNLFRYTRSFIRQNKVKVGDLWDLFVDNYNVAAGD
                     ELLNKLANHEWEVERELMDRVEIEHLLETSQYTSAEDVDEELVRTLVSRAKRKPPVIE
                     DKFDNEEYNLCHFWSNFEIARVDLFSTGLYASYFEFLEQSGGFWAERWGDAPVHSLGL
                     GMMLDARDVHYFRDIGYQHSTLAHCPANKRGGQLPYVENPDYATIFGKKRSAYARLGR
                     LGRARSSEQTYGTGCRCVCPRKRDIEDTSATCFGGWYELTRDDRVARTPVDAPALLHE
                     LRGDFYST"
     gene            complement(<902899..>904605)
                     /locus_tag="KLTH0G10736g"
                     /db_xref="GeneID:8293778"
     mRNA            complement(<902899..>904605)
                     /locus_tag="KLTH0G10736g"
                     /product="KLTH0G10736p"
                     /transcript_id="XM_002555454.1"
                     /db_xref="GeneID:8293778"
     CDS             complement(902899..904605)
                     /locus_tag="KLTH0G10736g"
                     /note="similar to uniprot|P32837 Saccharomyces cerevisiae
                     YDL210W UGA4 Permease that serves as a gamma-
                     aminobutyrate (GABA) transport protein involved in the
                     utilization of GABA as a nitrogen source catalyzes the
                     transport of putrescine and delta-aminolevulinic acid
                     (ALA) localized to the vacuolar membrane"
                     /codon_start=1
                     /product="KLTH0G10736p"
                     /protein_id="XP_002555500.1"
                     /db_xref="GeneID:8293778"
                     /db_xref="GOA:C5DMQ2"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ2"
                     /translation="MEKVQAAANTTDVSSSIEPAADGLHQFGSLRTITSKRAGEVNFI
                     DAKGANGDSELLAEIGYKQELNRHFSTIQVFGVAFSIMGLLPSIASVLAIGMPGGMVS
                     LMWGWLIAGIFILAVGCGMAELASAIPTSGGLYYYTYYYSPEKYKAFLSFVIGNTNSL
                     ALVAGLCSITYGLAQEILSIVVVAKDGDFNITSGKTYGVFVAGIAATTAVTSLATVAV
                     SKLQTVSILANVGLIVLFFIVLPIGVANTKGLNFNDGSFIFGKWQNETSWPDGWQFMM
                     AGLQPAIWTIGAFDSCIHMSEEAKNATKAVPVGIISSIGVCWILGFIVCIVIAACMGP
                     NIDAILESSYGSPLPQILFNALGKKWTIAFMTLIAACQFLMGCSILTAISRQIWAFAR
                     DDGLMFSRYIKVVNKKLSSPLRATWFGALCALVIGLLCLIGSTASNALFSLAIGGNYV
                     AWMTPNLLRMTVGKDLFRPGAFFMGKLWSPIVNWIAIIFQTFILIMIMFPADSKDITP
                     DTMNYTVVICGGVWIGSIVYFLVYKKKAFHGPKSNLSDEEYADAVGQDVIDQILSHQK
                     SG"
     gene            complement(<905696..>906700)
                     /locus_tag="KLTH0G10758g"
                     /db_xref="GeneID:8293779"
     mRNA            complement(<905696..>906700)
                     /locus_tag="KLTH0G10758g"
                     /product="KLTH0G10758p"
                     /transcript_id="XM_002555455.1"
                     /db_xref="GeneID:8293779"
     CDS             complement(905696..906700)
                     /locus_tag="KLTH0G10758g"
                     /note="similar to uniprot|P40505 Saccharomyces cerevisiae
                     YIL084C"
                     /codon_start=1
                     /product="KLTH0G10758p"
                     /protein_id="XP_002555501.1"
                     /db_xref="GeneID:8293779"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ3"
                     /translation="MKVCSNRNRSRDAANEAGSGGSAVRGRSSPSLSEEQVTNSNTLP
                     AISRKDKRRHNFESKVRKVSQNFSLDRDTHYRNRLTSLQTTLTTLHQGNSVQFLRKLR
                     DLEEERDYELVRLRLFEEYRVNRSGIEFQEDIEKTKAEHEKVIKLCKEKLYESLESKM
                     KKLQEERLLMDVANAHSYSMDYSRTKFQKTTRSATASAWDSSPNEFGKEISANESATD
                     TGTERRSLRRRLATTAASRAMSDEQDAPSAKDSPAPLSYNSTSSESRFLQGISDSTDL
                     QALLFGDKDREVKKTRATNRLSTKAAPPLQSLKPEEVTEDIALIRSLTGQPPAPFKNL
                     "
     gene            <906878..>908110
                     /locus_tag="KLTH0G10780g"
                     /db_xref="GeneID:8293780"
     mRNA            <906878..>908110
                     /locus_tag="KLTH0G10780g"
                     /product="KLTH0G10780p"
                     /transcript_id="XM_002555456.1"
                     /db_xref="GeneID:8293780"
     CDS             906878..908110
                     /locus_tag="KLTH0G10780g"
                     /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
                     YML005W TRM12 Putative tRNA methyltransferase has a role
                     in tRNA modification S-adenosylmethionine- dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0G10780p"
                     /protein_id="XP_002555502.1"
                     /db_xref="GeneID:8293780"
                     /db_xref="GOA:C5DMQ4"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ4"
                     /translation="MGKVELLVAETSYLKLIKSSLEANGAFVKPIHFEDGCKIVRTAY
                     DMDDARVQEILETYKGVKAREYTVQEAAIFDRVSRFTDEYLTKNGISAADRVELAAHI
                     PLRYTLYHPVVLFNNSAERSFLHASWQNVLQKPENSQFFKLMLQELFPQYTHAATNMP
                     IVEHDVMRRPFHLVPLEGCLFEGEACEQTWDEPTPRDFTRSVWCHVVQNGIHQFWSPV
                     FTMFSRGNIKEKKRILDTYPDIGGRDIVDLYAGIGYFTLSYLKAGARRVFCFELNPWS
                     TEGLRRGVAFNNFRGECHVFQESNVNCIARLAQFQNLEIRHINLGLLPSSAQGYPLAL
                     SLVRDRSALSLTTLHIHENVHLDSLTSGQFTEQTVNHLQEIEPLFQYRARHLEKIKTF
                     APDVWHVCLDVDVHVPGR"
     gene            <908386..>909966
                     /locus_tag="KLTH0G10802g"
                     /db_xref="GeneID:8293781"
     mRNA            <908386..>909966
                     /locus_tag="KLTH0G10802g"
                     /product="KLTH0G10802p"
                     /transcript_id="XM_002555457.1"
                     /db_xref="GeneID:8293781"
     CDS             908386..909966
                     /locus_tag="KLTH0G10802g"
                     /note="some similarities with uniprot|P53968 Saccharomyces
                     cerevisiae YNL027W CRZ1 Transcription factor that
                     activates transcription of genes involved in stress
                     response nuclear localization is positively regulated by
                     calcineurin-mediated dephosphorylation"
                     /codon_start=1
                     /product="KLTH0G10802p"
                     /protein_id="XP_002555503.1"
                     /db_xref="GeneID:8293781"
                     /db_xref="GOA:C5DMQ5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ5"
                     /translation="MDFNQFMSYQEKSGEKSNTNSPKDTPQGGSGLFPGSGGREEPAQ
                     LTLNTGFNGWAGTSRHVSEAESIFLSPLSEDSPRGFPVGQRLATPTINIEQTQEPFDE
                     NDAMRAFVGNIQEPFDSLGLGFQNELQGAPSSFSPAHSMLSPHFNDDFVSTRSASVHS
                     ATSDSGRTAGAHRVDIALSPVASRLTTGDDELDEILSVRSGPDPFGDIDYPQESQSIP
                     AQDVSSFLSPVDNMFGFGDSSAYSDPAPLPANFSRPQISVQEFQVITPAEMSKSPQVS
                     ASPSPSNSFQGGPSQQNTNLLSVERDDVAVTSDDEEVHDLMRQGRKVRRKSAQGFVRS
                     PSRGRSLSVDEKARSLSENRERLLELAALKPSKSHNDRSEEQSDGYDFTEEDSLPMNV
                     SGVTRRKSIQKNPAVYACELCDKKFTRPYNLKSHLRTHTDERPFACAICGKAFARQHD
                     RKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTEGGKRCIAPLYEEV
                     TREREAGRKPEIDLPIDI"
     gene            <910133..>911620
                     /locus_tag="KLTH0G10824g"
                     /db_xref="GeneID:8293782"
     mRNA            <910133..>911620
                     /locus_tag="KLTH0G10824g"
                     /product="KLTH0G10824p"
                     /transcript_id="XM_002555458.1"
                     /db_xref="GeneID:8293782"
     CDS             910133..911620
                     /locus_tag="KLTH0G10824g"
                     /note="similar to uniprot|P53969 Saccharomyces cerevisiae
                     YNL026W SAM50 Essential component of the Sorting and
                     Assembly Machinery (SAM complex) of the mitochondrial
                     outer membrane the authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0G10824p"
                     /protein_id="XP_002555504.1"
                     /db_xref="GeneID:8293782"
                     /db_xref="GOA:C5DMQ6"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ6"
                     /translation="MNGPASDNEELETRILEASQRSSKLEEIDLEHQKVLQNQQLLYA
                     KDLFSNKAHTPVHVSSVVVNNAECVRPSVLQNYLDQTITRATTFEHLCELSDILNMKL
                     ISNGLVENCTQTLDSRGVLHYELQDSDPKPSYATPHSTGHTVSVVDIVPIVNLQPLKK
                     ISAKTGTNIGNGEGDGYLQLQWRNALGGGEKFTFDATKGTKTHSSYLFDYSQPLSPWW
                     LWDCSVYKNSRSLGNMELLMRGTRASVRSAFEKHKHLNYELGVESLWRSTQATSTHSS
                     DSLLLLAGDEVKNSLSHSVFWDTRDRPIFPLAGSFYKLTNELSPSKYWKCFFEASKVK
                     SWRKNDFFTASFTLKGGYINNFSASKPLHISDKFHNGGSNDVRSFQLMGLGPKDLHDS
                     LGGDAFVSYGVSLFSRLPFKRWSDSNFRLHAFFNGARLINTNGDQLKNCISSLAREHS
                     TSTGIGLVLGHPVARFELNFGIPLTAHTSDSARKGFQYGIGLSFL"
     gene            complement(<911687..>912736)
                     /locus_tag="KLTH0G10846g"
                     /db_xref="GeneID:8293783"
     mRNA            complement(<911687..>912736)
                     /locus_tag="KLTH0G10846g"
                     /product="KLTH0G10846p"
                     /transcript_id="XM_002555459.1"
                     /db_xref="GeneID:8293783"
     CDS             complement(911687..912736)
                     /locus_tag="KLTH0G10846g"
                     /note="highly similar to uniprot|P40506 Saccharomyces
                     cerevisiae YIL083C Homolog to human PPCS"
                     /codon_start=1
                     /product="KLTH0G10846p"
                     /protein_id="XP_002555505.1"
                     /db_xref="GeneID:8293783"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ7"
                     /translation="MPIHTSTTEVARAIDRSLNAELFPPAETADEEKFFLTNPRPEYL
                     DDLTQQARDFIELQYSLGRSRIVLVTSGGTTVPLENNTVRFIDNFSAGTRGASSAEQF
                     LRQGYAVIFLHREFSLTPFNRNFTHNSDVCFLDYFDNSGAVKPQFRQDLLSAKSLFER
                     YMHEERRLLLLPFTTVNQYLWSLKSVAKLLDRKGSLFYLAAAVSDFFVPHSRLPEHKI
                     QSQEVSQPSTLPNSTAHTSVDGKLIVDLDPVPKFLRRLVVSWAAQAMIVSFKLETDES
                     ILIKKATQALDRYNHQLVIGNLLQTRNKEVVFVSEQNRKGDWIRVPDDKQAIEELIIP
                     QVISHHDKWIRDQTQ"
     gene            <913243..>915762
                     /locus_tag="KLTH0G10868g"
                     /db_xref="GeneID:8293784"
     mRNA            <913243..>915762
                     /locus_tag="KLTH0G10868g"
                     /product="KLTH0G10868p"
                     /transcript_id="XM_002555460.1"
                     /db_xref="GeneID:8293784"
     CDS             913243..915762
                     /locus_tag="KLTH0G10868g"
                     /note="similar to uniprot|P40309 Saccharomyces cerevisiae
                     YJL094C KHA1 Putative K /H antiporter"
                     /codon_start=1
                     /product="KLTH0G10868p"
                     /protein_id="XP_002555506.1"
                     /db_xref="GeneID:8293784"
                     /db_xref="GOA:C5DMQ8"
                     /db_xref="InterPro:IPR004771"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ8"
                     /translation="MASSVGGVLSGVNPFHYNASAPYTLFLIQACIILVLSNGIHAVM
                     SRMRQPKVISEVLAGVILGPTAFGQIPHYTETIFPKSSISGLTLVANLGIILFMFFLG
                     LEVDNGFIRQNGRTALSIGLATLAVPFGFGCLFALPLYNNYMKSDDTPEVKFTVFMVF
                     IAVSFAVTAFPVLCRILAELRLVKERVGVIVLTAGTMNDVVGWTLLALCIILSNSQSD
                     PVNVVYILLCTAGWILLYVFPLRYALRWCLVKTNELKREKPSSLSTLCILVLAFLSAY
                     FTDIIGVHPIFGAFIAGLIVPREEGYVIKLAERMEDIPNLVMIPIYFTIAGLNVNLTL
                     LNKGRDWGFAIASIAIAVATKALSGALLSKFHGLFWRESFAVGVLMSCKGIVEIVVLS
                     TGLNAGIISEKVYAMFIFMALISTFITTPLTVWILPESYRDKVEDILSEQRAKEHKEC
                     EVKGESTGAFSFPEKWPIQRIVVVLNDAESLAATLSVLQCIIGAHHNHFYTPSKECVT
                     RIITKDEEAHTLCASPTIKHIENEADLVVKTLYLRQLTDRTTDVISTSSVENSKQLLA
                     SDSTLRTFKIFADLFSIRYDNETMFSNAREKVLNIASIPFSTSDILLFPLKGNLDVKE
                     PWLSDGLGQKTSDIMQRLGSQNELPEDFVNKLATSVKTNVVLYFANQDQELTTEQTKE
                     SEQIILILPSSSLVSSDYLALFLTLIVYQGHRRNGKLAELFILCNQKNKDSRRILDQW
                     FAAFEVSDARLQGIEVAGDLDCDDTEGESSLSKTSTASPKLMSLLSNDARTVVFVGDS
                     EFYRKGKLNSCSLDLVSAASHFKADLVICNHPPSLTCCEQS"
     gene            917117..917190
                     /locus_tag="KLTH0G10890r"
                     /db_xref="GeneID:8293785"
     tRNA            917117..917190
                     /locus_tag="KLTH0G10890r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.40"
                     /db_xref="GeneID:8293785"
     gene            <917604..>918914
                     /locus_tag="KLTH0G10912g"
                     /db_xref="GeneID:8293786"
     mRNA            <917604..>918914
                     /locus_tag="KLTH0G10912g"
                     /product="KLTH0G10912p"
                     /transcript_id="XM_002555461.1"
                     /db_xref="GeneID:8293786"
     CDS             917604..918914
                     /locus_tag="KLTH0G10912g"
                     /note="some similarities with uniprot|P32588 Saccharomyces
                     cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
                     abundant mRNP-component protein hypothesized to bind a
                     pool of non-translatable mRNAs not reported to associate
                     with polyribosomes"
                     /codon_start=1
                     /product="KLTH0G10912p"
                     /protein_id="XP_002555507.1"
                     /db_xref="GeneID:8293786"
                     /db_xref="GOA:C5DMQ9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DMQ9"
                     /translation="MSETVAETRPEQPPVTADESASSTPAPAPAPEVAQTPVQTPESS
                     TKPEEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMDK
                     NNKQANYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVSSEDTFNLFVGD
                     LNVDVDDETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGA
                     VVNGRAIRINWASKREHNSHNNNPMNNRGGARRGGFRNHGNNQLRHQMPPMGMPGRGA
                     MLPNMGMPSQPPMPQGAQPQGPIMPPQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATE
                     QDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGK
                     EKPSYIPQPKPGQGASKMEQLPTQPIEQDPQSNTPAEQPQEEEQ"
     gene            <919304..>921580
                     /locus_tag="KLTH0G10934g"
                     /db_xref="GeneID:8293787"
     mRNA            <919304..>921580
                     /locus_tag="KLTH0G10934g"
                     /product="KLTH0G10934p"
                     /transcript_id="XM_002555462.1"
                     /db_xref="GeneID:8293787"
     CDS             919304..921580
                     /locus_tag="KLTH0G10934g"
                     /note="similar to uniprot|P25037 Saccharomyces cerevisiae
                     YDL122W UBP1 Ubiquitin-specific protease that removes
                     ubiquitin from ubiquitinated proteins cleaves at the C
                     terminus of ubiquitin fusions irrespective of their size
                     capable of cleaving polyubiquitin chains"
                     /codon_start=1
                     /product="KLTH0G10934p"
                     /protein_id="XP_002555508.1"
                     /db_xref="GeneID:8293787"
                     /db_xref="GOA:C5DMR0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DMR0"
                     /translation="MNFVLEKLSALFSTLSIFVRNLSHIDNKSSTLIVLIASTGILLY
                     KNKRIFRNIMENIGTVGGDLTRSFRNNYKGSMFNKWGSKDPEQEAAMLKRGGYVGGLV
                     NDGNTCFMNSVLQSLASSKTLLQFLDNEVIQAYKEAEESEDEHVAEKEFESEKKLSES
                     KTKPKKKVYGKRKKRLTRNAEKDALDDDQDANIEFSTTLKELLNKLNAKHYRDRPYFK
                     TNKLLKTMSKAPNKSIILGYDQEDAQEFFQTILSELEKNVKSLYGKSSKDEEAPVQFD
                     QLPEDSMVGQERLGEMGTVYIPTEQIDPNCVLAHENKSLYSPFKLITPLDGLTAERIG
                     CLQCGENGGIRYSVFSGLSLNLPSENLGSTLKLSELLREWIKPEIIEGVECNRCALNA
                     VLEHLEKTLIQYEGSEHSSEKLVAAVKARVEQLKDILAKPAIDDDDYKKLHTENMVRK
                     CSKSKQIIISRPPPLLCIHINRSVFDPRTYMIRKNNSRVLFKSKLNLAPWCCAPDEIN
                     LDARLPMSKKEQKSLESSEDENVGGEYFAKLHRHFEEEFEDSEEEEGNFEASNRDVSD
                     YDPLRGEIESSSDENESSSDGEYEVDALGNRVFKQNGAQTEQELVDGTSADPEVASLE
                     GSDAAERLDGIEPETLDNEDEEDSESDHEVKQPPSLSSLHHAPSSSTVPVGPLTYALR
                     SVIVHYGTHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLSTPGIFMLFYEHDYNES
                     LHAMNDDLEWEEENEDRE"
     gene            complement(<921704..>922135)
                     /locus_tag="KLTH0G10956g"
                     /db_xref="GeneID:8293788"
     mRNA            complement(<921704..>922135)
                     /locus_tag="KLTH0G10956g"
                     /product="KLTH0G10956p"
                     /transcript_id="XM_002555463.1"
                     /db_xref="GeneID:8293788"
     CDS             complement(921704..922135)
                     /locus_tag="KLTH0G10956g"
                     /note="some similarities with uniprot|Q07541 Saccharomyces
                     cerevisiae YDL121C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G10956p"
                     /protein_id="XP_002555509.1"
                     /db_xref="GeneID:8293788"
                     /db_xref="UniProtKB/TrEMBL:C5DMR1"
                     /translation="MDFYAFLVLFVIIVAFVLLLPLLSGTFAYKFRKPAARAGKTDHE
                     HLSRTQKLKEKLEFSKDENPIKFQLRDNASTSSRNKPFEVDSKTGLKKRTIGKYSADP
                     NEFDYDLTELIEEDVLEEKKENELRYQQFAGREQEESEALV"
     gene            <922281..>922793
                     /locus_tag="KLTH0G10978g"
                     /db_xref="GeneID:8293789"
     mRNA            <922281..>922793
                     /locus_tag="KLTH0G10978g"
                     /product="KLTH0G10978p"
                     /transcript_id="XM_002555464.1"
                     /db_xref="GeneID:8293789"
     CDS             922281..922793
                     /locus_tag="KLTH0G10978g"
                     /note="similar to uniprot|Q07540 Saccharomyces cerevisiae
                     YDL120W YFH1 Yeast Frataxin Homologue mitochondrial
                     protein that regulates mitochondrial iron accumulation"
                     /codon_start=1
                     /product="KLTH0G10978p"
                     /protein_id="XP_002555510.1"
                     /db_xref="GeneID:8293789"
                     /db_xref="GOA:C5DMR2"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:C5DMR2"
                     /translation="MLKRSIITFGTAVARRPVLRPYAACVRAFSRLQVIPTARGFASG
                     PGSTDGHEIPKEVLELSADAYHISSDAFLDSLQEQLEELSDAYPDLLPDVELTQGVMT
                     LEVPAVGTYVINKQPPNKQIWLSSPVSGPNRFDFYKNRWISLRDGQDLLSLLNIELSD
                     VLPKPVTIEA"
     gene            <923620..>926868
                     /locus_tag="KLTH0G11000g"
                     /db_xref="GeneID:8293790"
     mRNA            <923620..>926868
                     /locus_tag="KLTH0G11000g"
                     /product="KLTH0G11000p"
                     /transcript_id="XM_002555465.1"
                     /db_xref="GeneID:8293790"
     CDS             923620..926868
                     /locus_tag="KLTH0G11000g"
                     /note="similar to uniprot|P22855 Saccharomyces cerevisiae
                     YGL156W AMS1 vacuolar alpha mannosidase"
                     /codon_start=1
                     /product="KLTH0G11000p"
                     /protein_id="XP_002555511.1"
                     /db_xref="GeneID:8293790"
                     /db_xref="GOA:C5DMR3"
                     /db_xref="InterPro:IPR000602"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="InterPro:IPR011682"
                     /db_xref="InterPro:IPR015341"
                     /db_xref="InterPro:IPR027291"
                     /db_xref="InterPro:IPR028995"
                     /db_xref="UniProtKB/TrEMBL:C5DMR3"
                     /translation="MSYAQLNSDPQFKPVQGIYEGRLRQFTDGGGEYKELNLPKFYDK
                     KRISLDQDSVKVQWYQVRFEKGSSPVSPDKRPPWSEIVEKDKNKELEFRDAQKGQPFG
                     PSWSTTWFRVQVTVPDEWLAAEEQLIFEWDCSNEGIVIDPETLIPKTAFSGGGERNEY
                     MLPKGQKHHVFYIESGNNGMFGCGAGSSINPPDNNRYFHLNKADLVWPNWEARALFID
                     FWMLSDAARELPGDSWQKHKARHVGNSVMDLFDPEDASTVTKCRKLIREEYFDQLADD
                     PKVFQAGDSSVRADVHGVGNCHIDTAWLWPFAETRRKVVRSWTSQCTLMDQYPEYRFV
                     ASQAQQFKWLLKEHSNFFHEVLIPKIQQSQFFPIGGSWVENDTNIPSGESLCRQFFLG
                     QRFYLKHFGKKSDVFWLPDTFGYSSQVPQIAKISGIDKFLTQKLSWNNINSFPHTTFN
                     WAGIDGSQLLTHMPPGNTYTASSHFGDVLRTAKGNKNSDVYGSGLMLYGKGDGGGGPT
                     AEMLEKMRRIRSISNRNGNVIPKLQVGTTIEEFYQDILEKTHNGLDLPTWVGELYFEF
                     HRGTYTTQAEVKRLMRLSEIKMHDLEWIATKASLVYPDEYEYPINKINRIWEDILLCQ
                     FHDVLPGSCIELVYKYEARPMLKDAITEIESLINDALKFLKKKGKGNSSIGTLELVES
                     DATNSAKNEREFVKLKDEAKHIKMTNDVLEVTIDKEKGVISSIKDREREVEYLDLDGG
                     RNKRGANQFVLFDDKPLGWQAWDTELYSVNQYKYITSLESVEIAENSSEKCAVELTFK
                     VSNDCEILTSISLGSRTQHESGGLIEIKTSVKNWNLRNKFLKVEFPVNIRNDFASYET
                     QFGITKRPTHYNTSWDVAKFEVCHHKFADYSEFSKGVSVINDSKYGFATHGNLMRLSL
                     LRSPKAPDAHADMGSHEIRYALYPHRGALSSSTVHEALKFNYRHHYSIPESVSEAFDG
                     VIGIEGDPNVILTNIKRGEDDEGLDSEYSTTKGEKRSFVVRLYESLGGESFAVLKTSL
                     PVKNALKVDNLELSEINSIPLTTKSSASSDKSTLEFKVKLRPFEIATYKLVL"
     gene            <926990..>928120
                     /locus_tag="KLTH0G11022g"
                     /db_xref="GeneID:8293791"
     mRNA            <926990..>928120
                     /locus_tag="KLTH0G11022g"
                     /product="KLTH0G11022p"
                     /transcript_id="XM_002555466.1"
                     /db_xref="GeneID:8293791"
     CDS             926990..928120
                     /locus_tag="KLTH0G11022g"
                     /note="similar to uniprot|P18898 Saccharomyces cerevisiae
                     YGL155W CDC43 Beta subunit of geranylgeranyltransferase
                     type I catalyzes geranylgeranylation to the cysteine
                     residue in proteins containing a C-terminal CaaX sequence
                     ending in Leu or Phe has substrates important for
                     morphogenesis"
                     /codon_start=1
                     /product="KLTH0G11022p"
                     /protein_id="XP_002555512.1"
                     /db_xref="GeneID:8293791"
                     /db_xref="GOA:C5DMR4"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="UniProtKB/TrEMBL:C5DMR4"
                     /translation="MSAAPIPDGRLTIQKHRRFLQRHLAILPSKYQEYEANKLAIVTY
                     ALIGLSCIGDPVSEEYAASKEWLRRHYRVIGRGETSLAGFFPSLYMEVENALTLSLTS
                     TLFGLISLLCLNDHKFFISDVDREGICRFVSKCHKPETGGFAASLDVVAEDSLEPSKT
                     DPDDLRHTYMAIAILYLMGCRNASEFGRYVCLEPLFSHFEQKACVSGGFGQYGEPHAG
                     YTSCALSILELISDRWDIFPNSFYDKTIEWLLQRQVSDKCPEMSGNEYFDPEDDGGFQ
                     GRENKFADSCYGFWCANSLSILKAPHKVGDAYQNGLSEYLLNKTQNLLLGGFAKNDNE
                     DPDLYHTCLTLAALSMMSGEFDGTLFLPRKVADTARSQFIAP"
     gene            complement(<928161..>929057)
                     /locus_tag="KLTH0G11044g"
                     /db_xref="GeneID:8293792"
     mRNA            complement(<928161..>929057)
                     /locus_tag="KLTH0G11044g"
                     /product="KLTH0G11044p"
                     /transcript_id="XM_002555467.1"
                     /db_xref="GeneID:8293792"
     CDS             complement(928161..929057)
                     /locus_tag="KLTH0G11044g"
                     /note="similar to uniprot|Q07534 Saccharomyces cerevisiae
                     YDL119C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G11044p"
                     /protein_id="XP_002555513.1"
                     /db_xref="GeneID:8293792"
                     /db_xref="GOA:C5DMR5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DMR5"
                     /translation="MSERPRGTSHLVGGFVGGLTSAVVLQPFDLLKTRLQQSKNSNLM
                     DVVHSIKSPKQLWKGTLPSALRTSVGSALFLSTLNIVRSAIADRRVRGLASKNGSSSF
                     LPQLSMYENLLSGAITRAAVGVATMPITVLKVRFESTMYDYSSLGEAARHIYKSEGIR
                     GLFSGCGATILRDAPYAGIYVLFYEQSKMQIPKILPSALIVRDDNGSFSTKTSTIVNC
                     LAAFSSASLATSITAPFDTIKTRMQLNPSKFPSFGKTLTTILKKERPKNLFDGLSLRL
                     TRKALSAGIAWGIYEELVKKFM"
     gene            complement(<929174..>930136)
                     /locus_tag="KLTH0G11066g"
                     /db_xref="GeneID:8293793"
     mRNA            complement(<929174..>930136)
                     /locus_tag="KLTH0G11066g"
                     /product="KLTH0G11066p"
                     /transcript_id="XM_002555468.1"
                     /db_xref="GeneID:8293793"
     CDS             complement(929174..930136)
                     /locus_tag="KLTH0G11066g"
                     /note="similar to uniprot|P50113 Saccharomyces cerevisiae
                     YGL154C LYS5 Phosphopantetheinyl transferase involved in
                     lysine biosynthesis converts inactive apo-form of Lys2p
                     (alpha-aminoadipate reductase) into catalytically active
                     holo-form by posttranslational addition of
                     phosphopantetheine"
                     /codon_start=1
                     /product="KLTH0G11066p"
                     /protein_id="XP_002555514.1"
                     /db_xref="GeneID:8293793"
                     /db_xref="GOA:C5DMR6"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:C5DMR6"
                     /translation="MQSLTRKVLYGLQLSVGPFCEIPSKVLCLINKLSLGYILSIVFD
                     QSRRTPVGFNQMSKEWLLSAGTGLPAFVLVCDDHRGILHDDFEFEMGMRYLPLEKQQR
                     ILSRKQRDARNTALCNQILQIAGASAACGIHWRDLKFKMSKLGKPYVESANPCIFNLS
                     NSCGKVAMFVKRSHGSIGIDLASTKDCENWGPGYLRLFQDIFSSDELQCLEQTQQGLQ
                     RDRLFIYYWSLKEAYTKLTGTGLNCCLSAINLGALEPLEADKTAKIVRTINGSPITFK
                     SKWIDNLTVLSVCEDSGNSTAEHDELPLYELEVADILSYLDSMK"
     gene            <930082..>931080
                     /locus_tag="KLTH0G11088g"
                     /db_xref="GeneID:8293794"
     mRNA            <930082..>931080
                     /locus_tag="KLTH0G11088g"
                     /product="KLTH0G11088p"
                     /transcript_id="XM_002555469.1"
                     /db_xref="GeneID:8293794"
     CDS             930082..931080
                     /locus_tag="KLTH0G11088g"
                     /note="similar to uniprot|P53112 Saccharomyces cerevisiae
                     YGL153W PEX14 Peroxisomal membrane protein that is a
                     central component of the peroxisomal protein import
                     machinery interacts with PTS1 (Pex5p) and PTS2 (Pex7p)
                     peroxisomal matrix protein signal recognition factors and
                     membrane receptor Pex13p"
                     /codon_start=1
                     /product="KLTH0G11088p"
                     /protein_id="XP_002555515.1"
                     /db_xref="GeneID:8293794"
                     /db_xref="GOA:C5DMR7"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:C5DMR7"
                     /translation="MAQPTAEDRKGLYESAIAFLNDPNVSDAPLTKKIEFLQSKGLTR
                     EEIDQAIKEAKSGPSPNSAEPKDAAVDQGRHADYVYEAIPPPLPKRDWKDYFVMATAS
                     AGLCYGVYQLAKLYVIPNILPDSKSKLEQDKEQIMQQFDKMEQLLSTVEQDHSSQMKK
                     EEQKFKELDEVVVELQTALEGNARTREKLEDDVRILRLEIEGLQKNLNSFILENTDSP
                     AIRKLNDEILSLKNLMKNSTLLKSATPSENDKSPVPGAEAIPSASEILAKMNIPKKND
                     SEAPAWKKSRDAMAAHKDTALPEWQKTAAEKAHTPIPEWQKAMFNAESPSPEESVS"
     gene            <931287..>934514
                     /locus_tag="KLTH0G11110g"
                     /db_xref="GeneID:8293795"
     mRNA            <931287..>934514
                     /locus_tag="KLTH0G11110g"
                     /product="KLTH0G11110p"
                     /transcript_id="XM_002555470.1"
                     /db_xref="GeneID:8293795"
     CDS             931287..934514
                     /locus_tag="KLTH0G11110g"
                     /note="similar to uniprot|P53114 Saccharomyces cerevisiae
                     YGL151W NUT1 Component of the RNA polymerase II mediator
                     complex which is required for transcriptional activation
                     and also has a role in basal transcription"
                     /codon_start=1
                     /product="KLTH0G11110p"
                     /protein_id="XP_002555516.1"
                     /db_xref="GeneID:8293795"
                     /db_xref="GOA:C5DMR8"
                     /db_xref="InterPro:IPR014801"
                     /db_xref="UniProtKB/TrEMBL:C5DMR8"
                     /translation="MDENQDPIYSLALNCSRRRLPSNLFVNFYNELVNEKYGSMINSG
                     EETDADIKQTNVCEKISSSLLRLLDAEKHFLIVDYVVEVLFINYNKELVKELLPQLYS
                     IKDSSQLVLFLSKASAFFLRLTDKLVIDQICGDLGNVIVPSILSSSFNTQGEELIVAI
                     AKFLRNVLSLSSNPIAISDPKVGDRVRELLNCLSKINRLLYKKVAGDFDSLLRLGGSA
                     PPTAREERHGVSSPSIISPRYLESPINVTKQPQSLIPSSVNHQTVKLARYCKNLWLNS
                     RIMGWRTNDVAFVTKYSKIEAEIMKKTSPSQLNVEAAMKDLIETAFTSFAQFVSNKQY
                     HQANSAFNLLERQWNIFITKQLPLHIMENASDMPHIVINALENIDHKVVKALKSYASD
                     KDDAKNRGEDLFDDLPNKNTDIRHDFLKSLIMIGLQPAAVLNDFLREDQVVDTKSLPT
                     NDTVVIKNAQGVKETVDNFSQFIKDTIEDLDAESMFEATDGSLGNADNGIMQILRKFE
                     TLAATKQKDLANVFYDLFRESVSSFDCKTFSKTCCLMCFNMSHSLTTMFAFVNPQKFL
                     AVAIEFVDQIWESSVRKASAGLNDESDFEPNTEFVCFTYALIFIVQVVGTYNVSLIEA
                     LSTSSSDPQSSFIVNYITKLGDIAPALKLNSTLDSSEVLKSWVRDLFINGSISDSLMK
                     SANVKDLAVLIPFIFKESLSAVESGSIRDISALVGGFEYFLQPFLIVGLIGIVFWTEQ
                     YLTTLRSKDLAKDLLESIFDMLNSVLNPSTLNDESRPLHTLILRLNTVQLLKATRAFQ
                     TQTQSSYGTYSSDSEGSTKVDSLISHLEQVARSSILYNVDSSVINSEIGYQRKDINYT
                     PFAITADNSINSILTNQVNSFWNLHSSTYYNIDYLFALIDIITPQRFLEDMLVVLQHK
                     TTDAALPNSRTKGSDGENLFYLDYFFYFLVSHDVMKAENKTDILQYMSSTAESDLIFR
                     KPAHEFQPSAKVEQPSDEDFDMLFGEDTSIPGNESEANINEIKADEISPINPEFLRCS
                     FAAVLHCSLLANKAALESGHTSEVAVDQLTQLHDKYIEILKSSTV"
     gene            complement(<934626..>938645)
                     /locus_tag="KLTH0G11132g"
                     /db_xref="GeneID:8293796"
     mRNA            complement(<934626..>938645)
                     /locus_tag="KLTH0G11132g"
                     /product="KLTH0G11132p"
                     /transcript_id="XM_002555471.1"
                     /db_xref="GeneID:8293796"
     CDS             complement(934626..938645)
                     /locus_tag="KLTH0G11132g"
                     /note="similar to uniprot|P53115 Saccharomyces cerevisiae
                     YGL150C"
                     /codon_start=1
                     /product="KLTH0G11132p"
                     /protein_id="XP_002555517.1"
                     /db_xref="GeneID:8293796"
                     /db_xref="GOA:C5DMR9"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DMR9"
                     /translation="MSLAALLNEDDANPSQRQSFVKDLNQEFRALGARDIKEQRYQDW
                     KMLSYQEFELVTEWNNQSRELGSNGCEKLISNMDSTRREWEQFQEYAARKEEVIRQQR
                     ELRLKQQQEQEQERLQQEKERQETLEQERHQKKAQAAQAAQAAQSQNQHGDRSRVAIK
                     SEPKDNKTLNGNSNPQSRSTDFDGHGDGAEDENEDDEEIDEDEDEEAEIEEEPEHDEE
                     VLFPDDDDNDKDFYLEDEKGEFPSKSKKVDLSSERAKIRREIARMVNKNKNVKAKKRR
                     FTNSTIIEYVSDEKLEVKLTLKQYHVRQLKRLLAENKRAQEEDANESTAKKRKVGGKG
                     DEAQIPSSIEGLPTYGLKMTIKEARGIQRHYDTTYFTIWKDMARKDSAKVARLVQQTQ
                     SSRNVNFKKTSSLVAREARKWQLRNFRQLKDFQTKARRGVREMSSFWKKNEREERDLK
                     KKAEKEALDQAKKEEEERENKRQARKLNFLITQTELYSHFIGRKIKTDEIEGSMADSN
                     LKQANGGGHNIDLSKTQAAKTDFHSIDFDNEDDENLRLKAAQNASSALLATQAKAREF
                     DSNPDEEDELNFQNPTSLGEITIDQPRLLTCTLKEYQLKGLNWLANLYDQGINGILAD
                     EMGLGKTVQSISVLAHLAENHNIWGPFIVVTPASTLHNWVNEISKFLPDFKILPYWGN
                     GNDRKILRRFWDRKQFRYGKDAPFHVMVTSYQMVVSDAAYLQKMKWQYMILDEAQAIK
                     SSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLHFIMPSLFDSHDEFSDWFSKD
                     IESHAQSNTKLNQQQLRRLHMILKPFMLRRIKKNVQSELGEKIEIDVMCDLTRRQNKL
                     YQVLRSQMSAAYDAIENAAGNDEASSDQNIVNTVMQFRKVCNHPDLFEREDVRSPLAF
                     TNFGKSGSLLREGDLIDVDYSARNSITYQIPRLVFDELIAPNFQNDSDVRNKILNHTF
                     NIFHPSNSRSLCMTLSCLTGYSQGEIKDLSHQPIVQRALKLNEDKLSEGSKLLSVYDD
                     KTQLRELNKNSFIVEDERRNLVTLSKSSTKGVLDSLLNIKQGVYEDEYMNSWQPAYHP
                     AVSAPPINLEVSNSNYFSHEKHLELFDPFLCQALNRIPAQTQYELRTKFQLPVSQFPI
                     SECYPEALNKNFSSAISMPSMDRFITESTKLKKLDELLVDLKKGDHRVLIYFQMTKMM
                     DLMEEYLTYRQYKHIRLDGSSKLEDRRDLVHDWQTKPDIFIFLLSTRAGGLGINLTAA
                     DTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLIRGTIEERMRDRAKQKEHVQQ
                     VVMEGKTQDKDIQTVDASG"
     gene            complement(<940157..>941875)
                     /locus_tag="KLTH0G11154g"
                     /db_xref="GeneID:8293797"
     mRNA            complement(<940157..>941875)
                     /locus_tag="KLTH0G11154g"
                     /product="KLTH0G11154p"
                     /transcript_id="XM_002555472.1"
                     /db_xref="GeneID:8293797"
     CDS             complement(940157..941875)
                     /locus_tag="KLTH0G11154g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G11154p"
                     /protein_id="XP_002555518.1"
                     /db_xref="GeneID:8293797"
                     /db_xref="GOA:C5DMS0"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DMS0"
                     /translation="MSSSSRSIELNSVNNFSRDELKPVTKHDEDVFVDSSAAKIDIEQ
                     DAEKAHSVLNRQFNLDAEVAQLNELGDSFKQERSLWRRICSLDLGFEFEDKRYMVYML
                     GAFASAAGILSGIDQSIISGASIGMNKALHLSAHEASMVSSLMPLGAMAGSVIMSPLN
                     EWFGRKSSIMISCIWYTVGAILCAASTSHHLMYAGRFILGVGVGIEGGCVGIYVSESV
                     PSTVRGNLVSMYQFNIALGELFGYIVGVIFFDVHGGWRFMVGSSLVFSTILLVGMFFL
                     PESPRWLVHKGRIGEGWNVWKRLRDVKHDNNNLEFLEMRHAAAQDKELRANESRFQAW
                     FDLIRIPRNRRALVYAVMMVSLGQLTGINAIMYYMSTLMGQIGFSEKRSVAMSMVGGA
                     ALLLGTIPAILYMDRFGRRTWANTIVLFTLGLVLVGVGYQINRETNLPAAEGVYLTGQ
                     ILYNMAFGSYSALTWVLPSESFSLATRSVGMTVCSTMLYLWSWTVTYNFDRMQKAMTY
                     TGLTLGFYGGIAIVIGIPYQLLFMPETKNKTLEEIDDIFSRPTIDIVRENAANVKRNF
                     ARVFRR"
     gene            <942213..>942788
                     /locus_tag="KLTH0G11176g"
                     /db_xref="GeneID:8293798"
     mRNA            <942213..>942788
                     /locus_tag="KLTH0G11176g"
                     /product="KLTH0G11176p"
                     /transcript_id="XM_002555473.1"
                     /db_xref="GeneID:8293798"
     CDS             942213..942788
                     /locus_tag="KLTH0G11176g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G11176p"
                     /protein_id="XP_002555519.1"
                     /db_xref="GeneID:8293798"
                     /db_xref="UniProtKB/TrEMBL:C5DMS1"
                     /translation="MQAAATITKSGVKHFRKAPRNISWVIRAAYFGFGKPRLRKNVFP
                     YRQVTPRGGVRRAPVTPETSGGPEQSRCCRRNTAFILRLGTLGGLEHRVRAYDRILIQ
                     PLLPTISPWTMACSALGTAARGHATARWPRKASPVLLPRISTHFQGACASPRSRIYVC
                     CRARSQPQRDFTPYGSLARKYGLEPRLRALF"
     gene            <944286..>946334
                     /locus_tag="KLTH0G11198g"
                     /db_xref="GeneID:8293799"
     mRNA            <944286..>946334
                     /locus_tag="KLTH0G11198g"
                     /product="acetate--CoA ligase"
                     /transcript_id="XM_002555474.1"
                     /db_xref="GeneID:8293799"
     CDS             944286..946334
                     /locus_tag="KLTH0G11198g"
                     /note="highly similar to uniprot|P52910 Saccharomyces
                     cerevisiae YLR153C ACS2 Acetyl-coA synthetase isoform
                     required for growth on glucose expressed under anaerobic
                     conditions"
                     /codon_start=1
                     /product="acetate--CoA ligase"
                     /protein_id="XP_002555520.1"
                     /db_xref="GeneID:8293799"
                     /db_xref="GOA:C5DMS2"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:C5DMS2"
                     /translation="MTKQHKVVHEAHNVELREAPEHFYKSQPAPGHVTSMDQYREMYE
                     QSIQDPEGFFGPMAREHLHWDRPFTKVCAGSLENGDASWFLNGELNASYNCVDRHAFA
                     NPSKPALIYEADDEKDNRVVTFGELLRQVSEVAGVLKSWGVKKGDTVAVYLPMIAEAV
                     VAMLAVARLGAIHSVVFAGFSAGSLKERVVDAGSRVVITCDEGRRGGKTVHTKKIVDE
                     GLAGVDSVSHILVFQRTGSAGIPMKPGRDFWWHEETAKHRGYLPPTPVNAEDPLFLLY
                     TSGSTGSPKGVVHSTAGYLLGAALTTKYVFDIHPQDVLFTAGDVGWITGHTYALYGPL
                     ALGTATIIFESTPAYPDYGRYWRIIERHKATHFYVAPTALRLIKRVGEAEISKYDTSS
                     LRVLGSVGEPISPDLWEWYHDKVGNKNCVICDTMWQTESGSHLIAPLAGAVGTKPGSA
                     TVPFFGVDACLIDPVSGEELKGNDVEGVLAVKSPWPSMARSVWNNHSRYIETYLKPYP
                     GFYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTAEIEAALGEHDGVSESAVVGIT
                     DELTGQAVIAFVSLKDGYLQENASEGDMAHITPDNLRRELVLQVRGEIGPFAAPKSVV
                     VVNDLPKTRSGKIMRRVLRKVASNEADQLGDMSTLANPDCVPSIISAVENQFLIQKKK
                     "
     gene            <947396..>949255
                     /locus_tag="KLTH0G11220g"
                     /db_xref="GeneID:8293800"
     mRNA            <947396..>949255
                     /locus_tag="KLTH0G11220g"
                     /product="KLTH0G11220p"
                     /transcript_id="XM_002555475.1"
                     /db_xref="GeneID:8293800"
     CDS             947396..949255
                     /locus_tag="KLTH0G11220g"
                     /note="some similarities with uniprot|P54072 Saccharomyces
                     cerevisiae YLR152C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G11220p"
                     /protein_id="XP_002555521.1"
                     /db_xref="GeneID:8293800"
                     /db_xref="GOA:C5DMS3"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C5DMS3"
                     /translation="MSIGVGVAIYAAIKPVLKIYVIILVGYLLARYNLATVETSRGVS
                     NMVVNAILPCLTFNKIVGNISDKDIKEVGVLVLTAFLIFAVGGVGALITKWLTNSPKQ
                     WYWGLLFAGIFPNISDLPIAYVQSMSNGSVFTSGQVDRGVAYCCIFLCTQSFLMMNFG
                     MFRLVGLDFREPSKDEEQLSENSDNSSHLNSKLREGEFTKTPENDVIADKQGPASFHG
                     DRQPQMLASDKGSVDMPRSLYGQDENSSQSEADLGDEPQHFLNTVSTGSSLSSSSGAT
                     ASDVFRSGSRHSGSENSHSRAGVPISISDTIHRMTTARSTASALSIGSQRKSRGRQRR
                     LSQTAKDVINEYSAVQKIKTGEMDLSRPLSLTQEFGSGNAFPSDKSDDEDEEYDGSLP
                     AEGDRRASYTSSSQLSRRRSKKWKRSLASFVERYKLGWLVYIMVNFCRPASLGALLGI
                     IFCMIPWVKALFVHTDVHMHQAPDGQPVLNFLMDFTAYIGNACVPLGLLLLGGTLARL
                     EIGSLPKGFWKTTVAMTAFRLVILPIVGIAWANKLYDINWIENDVAKFVVILTWAMPS
                     ATAQVYFTAFYTPLEGEHLQMDCLSVFFLSQYAVLFITLSIVVSYALKVDLKV"
     gene            <949387..>950352
                     /locus_tag="KLTH0G11242g"
                     /db_xref="GeneID:8293801"
     mRNA            <949387..>950352
                     /locus_tag="KLTH0G11242g"
                     /product="KLTH0G11242p"
                     /transcript_id="XM_002555476.1"
                     /db_xref="GeneID:8293801"
     CDS             949387..950352
                     /locus_tag="KLTH0G11242g"
                     /note="similar to uniprot|Q12524 Saccharomyces cerevisiae
                     YLR151C PCD1 Peroxisomal nudix pyrophosphatase with
                     specificity for coenzyme A and CoA derivatives may
                     function to remove potentially toxic oxidized CoA
                     disulfide from peroxisomes to maintain the capacity for
                     beta-oxidation of fatty acids"
                     /codon_start=1
                     /product="KLTH0G11242p"
                     /protein_id="XP_002555522.1"
                     /db_xref="GeneID:8293801"
                     /db_xref="GOA:C5DMS4"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:C5DMS4"
                     /translation="MLEPTALIKNLGNFKVQNVLPLTSVWPPNRRAATLVLLFIGNRG
                     ELRVLLTKRCRNLRSFSGHVSLPGGKSDSPSETAETIARRESEEEISLPSDDLVLLEK
                     YKMTIENVSSNMPHYLARTFLSVKPIICFLYNSATPKNERYQRPLEGTKFFGKLNPGE
                     TSSMFSVPLNDFIAHQRLWAQYKVEYVNRKEYMKRWGGLTWRIEHYFYPNSNPGDAEW
                     LNNILDTSSGDEDLEGIPCKDVWGLTAKILHDICCIAHGEVAGQESLGHDGLIYGLHE
                     FGGQMKERSRSDWENKMLTNQRSVMFGDVIPSFQLKPIVKQAREF"
     gene            complement(<950524..>951666)
                     /locus_tag="KLTH0G11264g"
                     /db_xref="GeneID:8293802"
     mRNA            complement(join(<950524..951297,951661..>951666))
                     /locus_tag="KLTH0G11264g"
                     /product="KLTH0G11264p"
                     /transcript_id="XM_002555477.1"
                     /db_xref="GeneID:8293802"
     CDS             complement(join(950524..951297,951661..951666))
                     /locus_tag="KLTH0G11264g"
                     /note="similar to uniprot|P39015 Saccharomyces cerevisiae
                     YLR150W STM1 Protein that binds quadruplex nucleic acids"
                     /codon_start=1
                     /product="KLTH0G11264p"
                     /protein_id="XP_002555523.1"
                     /db_xref="GeneID:8293802"
                     /db_xref="InterPro:IPR019084"
                     /db_xref="UniProtKB/TrEMBL:C5DMS5"
                     /translation="MSNPFDLLGNDVEDANVVAPLPPKELVKKNTSSKKADVPPPSAD
                     PSKAKNRPKPTGNEGALRNRDNGRKNNRTRDAPAETTGAKRSTHAARRATDRQSRSGK
                     VDTEKKVRQGWGDDKKELSDEAAAELDAQAEIEADKASEEAPAANKKSLQDYLNEVNN
                     NSLNKTPAPKKSVDQLEDAELLVKKEEVYAEPTKVKNVKSKQLKSKQYLDFDVNFADS
                     TAKPRKFDNNGPRRGGKAKPAAKNAGEKKPAVNAKNFPSLA"
     gene            <952541..>953929
                     /locus_tag="KLTH0G11286g"
                     /db_xref="GeneID:8293803"
     mRNA            <952541..>953929
                     /locus_tag="KLTH0G11286g"
                     /product="KLTH0G11286p"
                     /transcript_id="XM_002555478.1"
                     /db_xref="GeneID:8293803"
     CDS             952541..953929
                     /locus_tag="KLTH0G11286g"
                     /note="some similarities with uniprot|Q12427 Saccharomyces
                     cerevisiae YDR169C STB3"
                     /codon_start=1
                     /product="KLTH0G11286p"
                     /protein_id="XP_002555524.1"
                     /db_xref="GeneID:8293803"
                     /db_xref="InterPro:IPR018818"
                     /db_xref="UniProtKB/TrEMBL:C5DMS6"
                     /translation="MGEHQTAAAGQVETALQGSTKPRPKPSISPPRENNGHVAKPTAL
                     SPQAVPPEKMSQLLLAEGPLAIRFITKALCKEVDGFKHLSASKQRRLIMGALEAGDRD
                     NSVIFAKIGWGQWSARKVGERDFEKEREATNIANSKIKDLVSQERRRSSNGGAGVKKP
                     SAPVKREFEVHERPVFLDENAVASEDEDDDNGPSTRDEFYDENDLNENPTIPYDHFKR
                     RKSSVVYGDSPPEEPGHESISQAIRPILKNYGRRRSSSKLLSPSLSKRGSYRGSNGSS
                     DLISETSRRRLSSTTDEFPGRNMIDLQVRAPKDPEFLGEHSRGREPRSSFSKESSIRS
                     TLAAHSAYRTSPAGRLAATGSDIIPRKDSAYQLSSPSPRESDHPDRSDTDEEDWEHIG
                     AESLRNSRAPSLIRSPNMNPAPNLPADHQPSHMSLSPPAMKESDKREKAQQQEPVAET
                     EDAAILLMSLKS"
     gene            <954331..>956385
                     /locus_tag="KLTH0G11308g"
                     /db_xref="GeneID:8293804"
     mRNA            <954331..>956385
                     /locus_tag="KLTH0G11308g"
                     /product="KLTH0G11308p"
                     /transcript_id="XM_002555479.1"
                     /db_xref="GeneID:8293804"
     CDS             954331..956385
                     /locus_tag="KLTH0G11308g"
                     /note="similar to uniprot|Q99296 Saccharomyces cerevisiae
                     YLR149C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G11308p"
                     /protein_id="XP_002555525.1"
                     /db_xref="GeneID:8293804"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR019417"
                     /db_xref="UniProtKB/TrEMBL:C5DMS7"
                     /translation="MTISEDSGSLDFEDDGSRGSDKVFQNYLMPTLKLYDTRVSINHW
                     QLRDCVKHSSTEPGKIYYIYEHSIRVLDTRPHRQEPGSRVRTKPFGERKRRNSSPKWP
                     VNSQLHSPSQEVVHLDFKSRCFQENSGILVSGGLIGPDDAGNWGHYARHPPSRSGSES
                     NTLNTSNRVSPMRMTSSTVLSDHSSYSNPDSWKGVVSIYNEENDACVTYRLGQYINNC
                     VSINRRNSQQYDLFACNNDAHLYQCDISNRGVELTRRYSDLKFPLNNATLSHDGKSLI
                     TSGDSCKFAIYRQSQVTGFYSLKYDFQPEWGSSFIRSERIPRYAMPDRSGFVDHIYEV
                     PGGDHGFYTSFSENDMMFATVFQNGTCCVYDTRKLETPLAELSSTRKHTQNGAFRVCK
                     FSKGLDDLLFISEHHGRVHVIDTRNFMNHQVIMIPDRNDSSTEQKITAPAGRRSSLPV
                     ELNDPHVTFATSIPVNELQPKLLPYPKLVNCMDNSIENDQTENKPTEETPALRRERRR
                     SEFRVRRYSTSNNHPTSSLESIDPSILDTRYSEQNYRAVDNYNYVGASSRGGEYSYER
                     LLQSREDTESGILFDNEIDFAEAYSDGSDSTTQAVVQRSQQRIPNQFGPRVTQYTGGT
                     DRTRIGSNPAVSSVEENSISGIDWMDDEEGSSLIIGTDYGIMKWNINSWARRSFPSYD
                     FC"
     gene            complement(<956495..>958000)
                     /locus_tag="KLTH0G11330g"
                     /db_xref="GeneID:8293805"
     mRNA            complement(<956495..>958000)
                     /locus_tag="KLTH0G11330g"
                     /product="KLTH0G11330p"
                     /transcript_id="XM_002555480.1"
                     /db_xref="GeneID:8293805"
     CDS             complement(956495..958000)
                     /locus_tag="KLTH0G11330g"
                     /note="similar to uniprot|P06101 Saccharomyces cerevisiae
                     YDR168W CDC37 Essential Hsp90p co-chaperone necessary for
                     passage through the START phase of the cell cycle"
                     /codon_start=1
                     /product="KLTH0G11330p"
                     /protein_id="XP_002555526.1"
                     /db_xref="GeneID:8293805"
                     /db_xref="GOA:C5DMS8"
                     /db_xref="InterPro:IPR004918"
                     /db_xref="InterPro:IPR013855"
                     /db_xref="InterPro:IPR013873"
                     /db_xref="InterPro:IPR013874"
                     /db_xref="UniProtKB/TrEMBL:C5DMS8"
                     /translation="MPIDYSKWDKIELSDDSDIEVHPNVDKRSFIRWKQQSIHEERAK
                     RNNDIKNLEFQVNMNGRLNQRVDKMLANLKDADLVDREAVRKFLNANFDKTEKGEEDN
                     VDPNMPPYNEMVEDLFEQLEINAKKVGANPKDGAVIRKLILEHRQKIDAVTKQAKEKL
                     SQLYKEKASLISSDDIRTGFDKGFVNKKAEAENAAAKALTSTQSSAPSEPSLPAPPLN
                     FVSFEDDVMELAPQTKAFGQISPDNIQGSESFLLKNLQIMSEQQKDALMMSAFEFEME
                     GYSKQAYQVIHQSELISYIREIYDMKKIPYLHVGELTEVVKMFFLKVFYNRSNNQGKK
                     SFLDSVQAKFEHVKKRVKVMQQEEPQEGVETIQLKSLDDSTELQVNLPNFDSKDPEEI
                     KKQNAFKKLPLKMQNAIKTQSLDAINEVFAEMPVEEGEEILEIFNEGSIIGINALLED
                     EGEFQQLQEKYQSDAGVNKLEAEGQAESHDTEPTRSVNDPQTEISTADVVD"
     gene            complement(<958147..>958743)
                     /locus_tag="KLTH0G11352g"
                     /db_xref="GeneID:8293806"
     mRNA            complement(<958147..>958743)
                     /locus_tag="KLTH0G11352g"
                     /product="KLTH0G11352p"
                     /transcript_id="XM_002555481.1"
                     /db_xref="GeneID:8293806"
     CDS             complement(958147..958743)
                     /locus_tag="KLTH0G11352g"
                     /note="similar to uniprot|Q12030 Saccharomyces cerevisiae
                     YDR167W TAF10 Subunit (145 kDa) of TFIID and SAGA
                     complexes involved in RNA polymerase II transcription
                     initiation and in chromatin modification"
                     /codon_start=1
                     /product="KLTH0G11352p"
                     /protein_id="XP_002555527.1"
                     /db_xref="GeneID:8293806"
                     /db_xref="GOA:C5DMS9"
                     /db_xref="InterPro:IPR003923"
                     /db_xref="UniProtKB/TrEMBL:C5DMS9"
                     /translation="MSEHEQVDHEDLNVDEEMNEFDDNEEAPIDNAQLFGNTEDNNEE
                     GPKLDNGSGKLFEIPEFTRKDKTLNEILDMMENNPPIIPDAVIDYYLTKNGFDCADVR
                     VKRLLALATQKFVSDIATDAYEYSRIRSAITVHNSNNGQARARQLILGQQQPGQLTQQ
                     QQQQNEKTKANKVVLTVNDLSSAVSEYGLNVSRPDFYR"
     gene            complement(<958910..>961720)
                     /locus_tag="KLTH0G11374g"
                     /db_xref="GeneID:8293807"
     mRNA            complement(<958910..>961720)
                     /locus_tag="KLTH0G11374g"
                     /product="KLTH0G11374p"
                     /transcript_id="XM_002555482.1"
                     /db_xref="GeneID:8293807"
     CDS             complement(958910..961720)
                     /locus_tag="KLTH0G11374g"
                     /note="similar to uniprot|P27801 Saccharomyces cerevisiae
                     YLR148W PEP3 Vacuolar peripheral membrane protein that
                     promotes vesicular docking/fusion reactions in conjunction
                     with SNARE proteins required for vacuolar biogenesis forms
                     complex with Pep5p that mediates protein transport to the
                     vacuole"
                     /codon_start=1
                     /product="KLTH0G11374p"
                     /protein_id="XP_002555528.1"
                     /db_xref="GeneID:8293807"
                     /db_xref="GOA:C5DMT0"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DMT0"
                     /translation="MCIEILQFLKYLEKHLTKNTLKGWAAMKVAIEHVQLQFIKEIEN
                     NVCSLQVESNFMCFALKTGHMFLIDLESPSNVIKYHFALLSSPQEKLLRVWMDPSATT
                     LLLKTNFAKYYVLTVDSLGKGNESVTPLKKLSKKNRDVISVMWQGKNNFVCGTTEGKV
                     YVVNTQSENSATKAYSSPHSIDGLIFASSPGAEKCAFLATGHTLRYWSNPKDPLTTLK
                     ELPPTETEQFEEIEQTSSRKFVFFQDTFAWTIDSGTIFGTVKGSGDVLKSATVLLNVE
                     LPPSNHRVKGVALSKYHLLLLRGNEILIINKLNNEVVAQETIWNQGSEKFLELVVDYS
                     QSPPTFWCYSTSNIYEIVLEGENNGIWRLLSKLGKYDEALKLPGLAPAEKDFILEQKG
                     DYLFSEEEFTEAARCYGVSDSVTTAEVALKLMKKSDLVALQAFLTAKLNTARQRKNSI
                     VQITLLSDWVVWNFMQMLNDVDELISSEQDDQNLESWRLKKESLGKELMAFFKKNLEI
                     LDRDTVYQIMARQNRKLEVLSFARLINDYKYVLSYWIRSKNWYEALKVLALTQDLECV
                     YKYATILLINSPDSTVNTWMQIKGVNPSELISSLLTYFSNFQKMHSSADSSRSIPNYA
                     LKYLKWCIQEPEDAENLAPIVFNSAIFMMIAGFDAKGRENEIIDFIEAHSGCFDSDFV
                     LRLSIKFKRYKTCIYVYSWLRLYEEAVTLAIKMDLLEDAKLVASTPELDGNSKLRRKL
                     WLMIAQCMIQQQNDTKQTIREILQDSNGILGIKDLLPLFGEFTTIANVKDELIKSLEK
                     HNSTMARVSHEIENSIKIKREIVEDIETLKARFQTLEPGASCDCCDRVLQTRKFYVFP
                     CGHSFHTDCLVREILKSTDHALRSKIETIQRSATKGMTLDNLKELDRLLSTKCCLCSD
                     IKINSIDEPLESDEKERHAWEI"
     gene            <961756..>962064
                     /locus_tag="KLTH0G11396g"
                     /db_xref="GeneID:8293808"
     mRNA            <961756..>962064
                     /locus_tag="KLTH0G11396g"
                     /product="KLTH0G11396p"
                     /transcript_id="XM_002555483.1"
                     /db_xref="GeneID:8293808"
     CDS             961756..962064
                     /locus_tag="KLTH0G11396g"
                     /note="similar to uniprot|P43321 Saccharomyces cerevisiae
                     YLR147C SMD3 involved in snRNP biogenesis and pre-mRNA
                     splicing encodes a core snRNP protein"
                     /codon_start=1
                     /product="KLTH0G11396p"
                     /protein_id="XP_002555529.1"
                     /db_xref="GeneID:8293808"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:C5DMT1"
                     /translation="MSSNGIPIKLLTESQGHVVSLELTTGEAYRGKLVDSEDNMNVQL
                     RDVTATARDGSVTRMDHVFVRGSHIRFFVVPDILKNAPMFKQGPTSKPPPPIRGPKRR
                     "
     gene            <962267..>964960
                     /locus_tag="KLTH0G11418g"
                     /db_xref="GeneID:8293809"
     mRNA            <962267..>964960
                     /locus_tag="KLTH0G11418g"
                     /product="KLTH0G11418p"
                     /transcript_id="XM_002555484.1"
                     /db_xref="GeneID:8293809"
     CDS             962267..964960
                     /locus_tag="KLTH0G11418g"
                     /note="similar to uniprot|P89102 Saccharomyces cerevisiae
                     YDR166C SEC5 Essential 107kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which has the essential function of mediating
                     polarized targeting of secretory vesicles to active sites
                     of exocytosis"
                     /codon_start=1
                     /product="KLTH0G11418p"
                     /protein_id="XP_002555530.1"
                     /db_xref="GeneID:8293809"
                     /db_xref="GOA:C5DMT2"
                     /db_xref="InterPro:IPR029175"
                     /db_xref="UniProtKB/TrEMBL:C5DMT2"
                     /translation="MGDSAFTFGARELCDFYQLKDLDPKVSWAEDSSVVYSLSQPQNA
                     DSIDSSYVVLNELLRQEHEHSTERNDTIETAGLSDPLNSSTRLEDLLDHYRIPQDERY
                     KYYINSKKFNSKLYLKQLHAQDSFKDLSLSLDHLDQSLQAQSEDLKQLVQRNFVKYVR
                     SKNNLDRIYEQFNKFSLGESRDFGTDDLGETVDESIREITIKVKPILDISTKRRNAQT
                     TIAFLQDHKQFFDAPKKLKHCLIEKDFANLVVEYNNAHSTFKDLQRRGFTFPILTKIW
                     DDIENTICHYREVIWDSLVNLVAGETQEQILPLISKLLDLNYAGNPIIEWINTKLDIF
                     ERKIGEVCSQMFTKIIQSQKKIVESALNEKVDLTFYLSIKNLADKLNDGQVSRFGIVG
                     SSFLKNPGLCDTVVVVEMWLLISKFINLLSKESSDFVEFWGHVEKFLDGTYQTSLMND
                     KRKDDILGSNTQTRDDYGQFLEMKNEQIRCIRRRGEDFLKRLCENLSNFFNASQDTLS
                     TGSIPEKETGIPLDYGFLPPNSNCLSCLRYLPRIVEPILKFTTELAQLNVSSSSIEFL
                     RETNALVLERSISAISATKLRDISSFHTLEDWSMYRTSGSEEYGITQFPEVVQTFQNL
                     SITTVRNMLYSYEKLPVLNGIYVVTHPSRKMLAGIEVQQIVSMEAVLESILKEAAKEK
                     ENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQLSRKNLEIFTLLAKMETSILG
                     NYLSDLKVTLRDILEERFYEINWAAYNSNSFRVGDYIIEALMVLVRVHSECFKIAPQL
                     IGRILRESQVFISKYLFEAFKPYAGNLSSDGLLQVVVDLQFFLRVLSNMLETTTEATI
                     NATLQNCFENDLDRMQRCIKETEPIVSANLEKTSVQFASFK"
     gene            complement(<964978..>965271)
                     /locus_tag="KLTH0G11440g"
                     /db_xref="GeneID:8293810"
     mRNA            complement(<964978..>965271)
                     /locus_tag="KLTH0G11440g"
                     /product="KLTH0G11440p"
                     /transcript_id="XM_002555485.1"
                     /db_xref="GeneID:8293810"
     CDS             complement(964978..965271)
                     /locus_tag="KLTH0G11440g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G11440p"
                     /protein_id="XP_002555531.1"
                     /db_xref="GeneID:8293810"
                     /db_xref="UniProtKB/TrEMBL:C5DMT3"
                     /translation="MSSSNSSLSSPKVRRLSEGESLAGEMTSSDHSLSIADSQISDIL
                     KELTGLQSEVVALHSSLKESNEQIRRDIQDFCSIGENDLSPSNATSSFHEFQT"
     gene            complement(<965544..>966875)
                     /locus_tag="KLTH0G11462g"
                     /db_xref="GeneID:8293811"
     mRNA            complement(<965544..>966875)
                     /locus_tag="KLTH0G11462g"
                     /product="KLTH0G11462p"
                     /transcript_id="XM_002555486.1"
                     /db_xref="GeneID:8293811"
     CDS             complement(965544..966875)
                     /locus_tag="KLTH0G11462g"
                     /note="similar to uniprot|Q03774 Saccharomyces cerevisiae
                     YDR165W TRM82 Subunit of a tRNA methyltransferase complex
                     composed of Trm8p and Trm82p that catalyzes
                     7-methylguanosine modification of tRNA"
                     /codon_start=1
                     /product="KLTH0G11462p"
                     /protein_id="XP_002555532.1"
                     /db_xref="GeneID:8293811"
                     /db_xref="GOA:C5DMT4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028884"
                     /db_xref="UniProtKB/TrEMBL:C5DMT4"
                     /translation="MIHPIQSSLATKDGTVLFFVVKNTIHTLRWEEGRGEFVAIGMWV
                     DDADNSDTIKAKVREEQQRQLAENEAKRQKTNDGNSNKPSIKEAKVPVPGQGAPPVFK
                     HIRNMALSRDETLLMACTDSDKALVVFELDYTNAENCLKLRKRQPLPKRPNALTTTTD
                     DKTVLVADKFGDVYALSTKEGVVQEAALEPILGHVSLLTDIVVAKEADGKQLIITADR
                     DEHIRITHYPQTFVINKWLYGSKQFVSTLCLPSWGPNLLFSGGGDSLVHSWNWESGKL
                     LDSLDISEIVEPYLGDAQLAPEKFQNETNSLIEYAVAKVVTFANIPYIAFFVEQTKVV
                     LICRVDPDIGAITLAQKIEMPFNIISLSSALSANLLTLTLDNRDSDDSRFAAFISYDG
                     TEFLVDAEKNNAFEKCVLHKFENDPIVNVEPRDVYPLYHIASLRKRGEHFS"
     gene            <967263..>968144
                     /locus_tag="KLTH0G11484g"
                     /db_xref="GeneID:8293812"
     mRNA            <967263..>968144
                     /locus_tag="KLTH0G11484g"
                     /product="KLTH0G11484p"
                     /transcript_id="XM_002555487.1"
                     /db_xref="GeneID:8293812"
     CDS             967263..968144
                     /locus_tag="KLTH0G11484g"
                     /note="similar to uniprot|Q12455 Saccharomyces cerevisiae
                     YLR146C SPE4 Spermine Synthase"
                     /codon_start=1
                     /product="KLTH0G11484p"
                     /protein_id="XP_002555533.1"
                     /db_xref="GeneID:8293812"
                     /db_xref="GOA:C5DMT5"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DMT5"
                     /translation="MVNSGLIKDGWFCEVNDNSFPGQGLALKVEEVLYHSKSEFQDIL
                     VFKSSSYGNVLVLDGIIQATERDEFAYQEMISCIPLYAHKAPRKVLVIGGGDGGVVRE
                     VVKHSSVESVTLVEIDEFVIDLAKEYLPGMACTFGHHKVQVKLQDGFQFLRDVATRER
                     YDVIITDSSDPEGPAEAFFQQEYFELLHSALNDDGIVIAQASENVWLNLGYIQNLVKT
                     AKAVFPQARYCYTTVPTYTSGQLGLIVCAKDKSVNLEHPMRSPSLEEQSQLRYYNAGI
                     HTASFVLPTWAHHQIYR"
     gene            complement(<968173..>968775)
                     /locus_tag="KLTH0G11506g"
                     /db_xref="GeneID:8293813"
     mRNA            complement(<968173..>968775)
                     /locus_tag="KLTH0G11506g"
                     /product="KLTH0G11506p"
                     /transcript_id="XM_002555488.1"
                     /db_xref="GeneID:8293813"
     CDS             complement(968173..968775)
                     /locus_tag="KLTH0G11506g"
                     /note="similar to uniprot|Q12530 Saccharomyces cerevisiae
                     YLR145W RMP1 Protein required for cell viability component
                     of RNase MRP which is involved in RNA processing in
                     mitochondria"
                     /codon_start=1
                     /product="KLTH0G11506p"
                     /protein_id="XP_002555534.1"
                     /db_xref="GeneID:8293813"
                     /db_xref="UniProtKB/TrEMBL:C5DMT6"
                     /translation="MKPDGVAVVDKLHQEVRYVLLINHRNKNQHRMAVWWKHFNELKR
                     SSAQVLELLQHQKLNAVQLRKLYSLLNKFQKKQLSRMYYSFNGVVGLGQFVTLGVVLI
                     GLLARVNALYRQIYADYEREFKNLALIRFEQIFAAESPVEKQLQSLVNEELGEVVDES
                     MVPLPKTEINSNAALISTQKMKAKKKVKKKKKSAIDDIFG"
     gene            <969152..>971461
                     /locus_tag="KLTH0G11528g"
                     /db_xref="GeneID:8293814"
     mRNA            <969152..>971461
                     /locus_tag="KLTH0G11528g"
                     /product="KLTH0G11528p"
                     /transcript_id="XM_002555489.1"
                     /db_xref="GeneID:8293814"
     CDS             969152..971461
                     /locus_tag="KLTH0G11528g"
                     /note="similar to uniprot|Q07268 Saccharomyces cerevisiae
                     YLR144C ACF2 Intracellular beta-1 3- endoglucanase
                     expression is induced during sporulation may have a role
                     in cortical actin cytoskeleton assembly"
                     /codon_start=1
                     /product="KLTH0G11528p"
                     /protein_id="XP_002555535.1"
                     /db_xref="GeneID:8293814"
                     /db_xref="GOA:C5DMT7"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:C5DMT7"
                     /translation="MSYQRPMMPIPSQGDGTYARPAIPPPYIPTAARDGPPPLPPRPG
                     QQRFDFQETPATNKAPANSQNLEMPFSTEAADIFSSAISTDQPLSAFSRTSHPVSLPV
                     NTSTGGKATETNKFYGNMLLGDQTNPVWTHPYSFFLSKDSNLGMAVSYVSASQRVFAS
                     GSPPEYFFGPAGIKSFVFGAVDFTSANQVSLGLTNLTHLQAHVQVRKNANQFILVPLV
                     QGMGFATAVYYNMIPKLSSGVGFKSVNGVTSPRSGIQKYQVVLQNNVTWTLYVTVPSG
                     QSLSLALSNNQIIGNKSVNGCIFQLVPDTNSAIDAAAGCYPNSGTLSGSVSGTTGQYT
                     IAYGLSGSSNGGKTLMYACPHHVSSFTTTMASRKINSSLDSVSMGKMTGYITNTFEMQ
                     VNVPSNVGFDPYSTISGKSTPKYSSDVLNAIKSAASTEAVADVVNESNVDSMYFGGKV
                     LAKYAWILYCCQYVIKDKALVSTLTNNLKTAMARFISNKQTLPLRYDTTWGGIISSGS
                     ESQDFGNSYYNDHHFHYGYHVIAAAILAKVDKENGGNWLSQNKTWVDNLVRDYSNPNS
                     ADSYFPVFRSFDWFAGHSWAKGLFASGDGKDEESSSEDVNAAYAIKLWGNVTGNTNLE
                     SIGNLELGIMRGSLNSYFLYLDNNTVEPASFIGNKVSGILFENKIDHTTYFGTKLEYI
                     QMIHAIPITSISSFIRSPTFVQQEWDQKLSSIVSGVQDGWRGILMLNRALSTPTEAYA
                     FFSGSSFKTQYLDGGQSKTWSLTYSGAFI"
     gene            <971803..>973976
                     /locus_tag="KLTH0G11550g"
                     /db_xref="GeneID:8293815"
     mRNA            join(<971803..971833,971902..>973976)
                     /locus_tag="KLTH0G11550g"
                     /product="KLTH0G11550p"
                     /transcript_id="XM_002555490.1"
                     /db_xref="GeneID:8293815"
     CDS             join(971803..971833,971902..973976)
                     /locus_tag="KLTH0G11550g"
                     /note="similar to uniprot|P38932 Saccharomyces cerevisiae
                     YGL095C VPS45 Protein of the Sec1p family essential for
                     vacuolar protein sorting required for the function of both
                     Pep12p and the early endosome/late Golgi SNARE Tlg2p"
                     /codon_start=1
                     /product="KLTH0G11550p"
                     /protein_id="XP_002555536.1"
                     /db_xref="GeneID:8293815"
                     /db_xref="GOA:C5DMT8"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C5DMT8"
                     /translation="MSDLIELQRNYILSFINDIKTEHNLKFLIIDDCVNALLDSLFAD
                     KNELLRAVTAIDLIDSSKRKGQPSVEAIYLLKPTKFNINCMDADFSNRPPKYKRAHIR
                     FLPGFRDYLIKHFHGKQYLPQYICTLAEVQCAFTPRESLVFQTLGVDQPLQIFYNKKC
                     IDLIERNIDRTVQCMLNLCIVTGEYPIVRYSQPSPEAYKICPATMLAKKLAFQFQEAL
                     DDYARKDETFPPPSSRPRAVCIITERSLDPFSLILHEFSYQSMAYDLAPGVDTRTDIY
                     HYSAETETGQREDKVSKLSELVDPDWAELRHQHIMDASEYLTAKINELIAKNPLLVDR
                     ANVKTSTDLLSVVAHLKDFDEERRRITLHRSLIDECLKINEQRQLAELADFEQALAGF
                     GLDADGNKFKGVTEKLLEVLMNKGANITDKIRYILAYALYRGGIIKEDFVKLLSFIGV
                     NAGHPFFQHFMTLFSNFGYLGYTLIKEKAGDKPYKKEWHHETILNDPNTYNTSRFVPA
                     AANNLSKVITNPLFLNEEAFPYVKDKPIEVLEDETPDNIGYNYSSTSLRNPRHKASWT
                     KNTQNRAPRQRFFYYSLGGLTYGEIRTAYMQSQLKNKDIFIGTDCILTPLDVMQSVEK
                     LSEPRNALGLQDDAKEKEKVPDFLFDRAVVAPVVSQHVHKVSHQRPSNDAKPVMPTPP
                     PQEKEKKRSKFSKFLRSKS"
     gene            complement(<974033..>974980)
                     /locus_tag="KLTH0G11572g"
                     /db_xref="GeneID:8293816"
     mRNA            complement(<974033..>974980)
                     /locus_tag="KLTH0G11572g"
                     /product="KLTH0G11572p"
                     /transcript_id="XM_002555491.1"
                     /db_xref="GeneID:8293816"
     CDS             complement(974033..974980)
                     /locus_tag="KLTH0G11572g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G11572p"
                     /protein_id="XP_002555537.1"
                     /db_xref="GeneID:8293816"
                     /db_xref="UniProtKB/TrEMBL:C5DMT9"
                     /translation="MNESYDWSEEAQKLIKFRDQKVLEPAQNDLLCKRLVIERRIKEA
                     AEEHLKNENAFQLGRLDKVSPEYLRIMCMDYEDLKTAGVAYNPAKIRKEGASSVLRSS
                     DQDELESPESGAATMETLVSKELENDKDSGNILHVSRGQEMVLNARKNTALVKSMLDT
                     QSASSNGIHISKKREVEILSDGSESDSDDSRSKSKRRQVGTHPDAFAHEAQVQFSPDN
                     QAQLFQYERSLSGNAVPTYGYMQQQQVLNMTQQITSRSPPQIHAHSHQQYQIPPRTVK
                     KTRTGTLPPRQLPEAEQSSKNKTPKALRKMENVARKHGL"
     gene            complement(<975378..>977432)
                     /locus_tag="KLTH0G11594g"
                     /db_xref="GeneID:8293817"
     mRNA            complement(<975378..>977432)
                     /locus_tag="KLTH0G11594g"
                     /product="KLTH0G11594p"
                     /transcript_id="XM_002555492.1"
                     /db_xref="GeneID:8293817"
     CDS             complement(975378..977432)
                     /locus_tag="KLTH0G11594g"
                     /note="similar to uniprot|Q07261 Saccharomyces cerevisiae
                     YLR143W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G11594p"
                     /protein_id="XP_002555538.1"
                     /db_xref="GeneID:8293817"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DMU0"
                     /translation="MKFIALVSGGKDSCYSILHSIRQGHELVALGNLYPADESQQELD
                     SFMFQTVGHNIVNMYEKCTGLPLFRHAIRPKTSRNVALHYYPTDEDEIEDLLELLKEA
                     KRKMPEIEAVNAGAILSSYQRTRVEDVCSRLGLVALSYLWQRDQQQLMTEMCGMSKLP
                     GEERSPKMDARIIKTAAVGLDDRHLGKSLPEVFPALQKLNQLYDVHICGEGGEFETMV
                     FDAPFFFNGYLAPKVIQIEGRESSDGVFSSLMGATYVERPNKLTMSKMLENLPVPPPL
                     EESWMEMLKEMSTIGFETNDNAIDSSTQPSSLYFPETSKNRVGNLLYVSNITPRKGST
                     VKEKAQNILDELGTLLADQKVSPSQIMASSLLLSDMSDFHQVNEIYSAFFQVKHVGPL
                     PPARACVGSSLIGEKNSLQLSVVIDLASQLDTVHTMTLNKSKGGLHVQGRSYWAPCNI
                     GPYSQAIWNANDANKISFISGQIALIPSSMQLAESLKTGASQYVSQSVLSLRHFDTLK
                     QTIGSQKQISMVCYVSQKYMASIVARTWSLYCKELASKSEHWFHRELADPRNLIIAKV
                     SSLPKDALCEWGGVTCSRFVTEEDDEDTIPFSSIKEDSGNEFKATVRGNGDTRCYKTL
                     YVDSKDELNKFFKNQGHSQVTLFCQPSNQVLHAKNVEFVPVEKVYDYKGKERLAGLFV
                     MY"
     gene            complement(<977655..>979091)
                     /locus_tag="KLTH0G11616g"
                     /db_xref="GeneID:8293818"
     mRNA            complement(<977655..>979091)
                     /locus_tag="KLTH0G11616g"
                     /product="KLTH0G11616p"
                     /transcript_id="XM_002555493.1"
                     /db_xref="GeneID:8293818"
     CDS             complement(977655..979091)
                     /locus_tag="KLTH0G11616g"
                     /note="similar to uniprot|P09368 Saccharomyces cerevisiae
                     YLR142W PUT1 proline oxidase"
                     /codon_start=1
                     /product="KLTH0G11616p"
                     /protein_id="XP_002555539.1"
                     /db_xref="GeneID:8293818"
                     /db_xref="GOA:C5DMU1"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:C5DMU1"
                     /translation="MLCRQTVAARNLRALASGFRPMAMTQRMMSQSTANKATLKMEAA
                     RPQTATAKPAAVRAPASEAHLQTLSTKELISLGVIGFATINKPMLDLVLKMFPLVPVW
                     LMKLLVSSLYCGGDNFQEVRETGKRLQERGINNMMLSLTIEDAEGTKNINIGSIVSET
                     IASIHQILKPNLQEQLDTVEDVNSIPPGYIALKPSALVSNPYETLLHFNDPEWKAQRE
                     ALVNNCVAITEEIFKLNQEFAKKYPERKIPFFVSVIDAEKYSLQKAGVYELQRILFQK
                     FNPRDSSQVSCVGTWQLYLTDSASDLAKEYERAEREGYKLGLKIVRGAYIHSEPNRST
                     VIHPDQASTDANFNTVMKNVITDLLEKGDQSTYGHLVVASHNYESNALATKLLEGHDG
                     NIGKANVVLGQLLGMADNVTHDLINNQKAKNVIKYVPWGPPVETKDYLFRRMQENGDA
                     VRADNGFPLVKSVTKVLLRSLFGKPQTT"
     gene            complement(<979562..>981067)
                     /locus_tag="KLTH0G11638g"
                     /db_xref="GeneID:8293819"
     mRNA            complement(<979562..>981067)
                     /locus_tag="KLTH0G11638g"
                     /product="KLTH0G11638p"
                     /transcript_id="XM_002555494.1"
                     /db_xref="GeneID:8293819"
     CDS             complement(979562..981067)
                     /locus_tag="KLTH0G11638g"
                     /note="weakly similar to uniprot|Q02983 Saccharomyces
                     cerevisiae YLR141W RRN5 Transcription factor member of UAF
                     (upstream activation factor) family along with Rrn9p and
                     Rrn10p involved in transcription of rDNA by RNA polymerase
                     I"
                     /codon_start=1
                     /product="KLTH0G11638p"
                     /protein_id="XP_002555540.1"
                     /db_xref="GeneID:8293819"
                     /db_xref="UniProtKB/TrEMBL:C5DMU2"
                     /translation="MLIKEHWTSAAKTMDVEGHNVLADYFAVYNNELKEFMDPLSRSS
                     ELAGSFVHTKSRVKWVDAENNKDDENRHLLIEENERSSEEDEDEIQNEELGVFWSAEE
                     KELFFHHLSRSSIHRLEEWHMHLPEKSKFEIIAYYQVLKNNLIKLKQLDSKRHGRILP
                     KVDLPIAYEMDEFFVDLEEEMSCKAEQKLQLLQELPGDTLEMQEADENALINLKNWDK
                     RWGPMYSRHGIEECQPACRQALPMSEQSLRHLEECARSYLRRLLWFTVLSQLETQHVP
                     SSFFKEDAGLSGGEQEVNDYDGVTVNSGGKTHFPQIISRDKVLKGLSVMRQEGLVAPT
                     LAEAVLSTLQKFNIQHEEGRLFRTTQVASGVIPRILEHAEAAHDLELYGRVASDEHAV
                     SSTVGEDLFLHIHKKLFNLNGRRADSDPFVECDKLDIINNPLEQELCDEETRNLDARD
                     MYRSRKYQHAMLSFLQGGHAPLKRVAIQVPDVEPPRKSRIPHWLHREFQFE"
     gene            <981214..>983310
                     /locus_tag="KLTH0G11660g"
                     /db_xref="GeneID:8293820"
     mRNA            <981214..>983310
                     /locus_tag="KLTH0G11660g"
                     /product="KLTH0G11660p"
                     /transcript_id="XM_002555495.1"
                     /db_xref="GeneID:8293820"
     CDS             981214..983310
                     /locus_tag="KLTH0G11660g"
                     /note="similar to uniprot|P42900 Saccharomyces cerevisiae
                     YLR139C SLS1 Mitochondrial membrane protein required for
                     assembly of respiratory-chain enzyme complexes III and IV
                     coordinates expression of mitochondrially-encoded genes
                     may facilitate delivery of mRNA to membrane-bound
                     translation machinery"
                     /codon_start=1
                     /product="KLTH0G11660p"
                     /protein_id="XP_002555541.1"
                     /db_xref="GeneID:8293820"
                     /db_xref="UniProtKB/TrEMBL:C5DMU3"
                     /translation="MFSRCTQAVIRCQRKGFDGCSRFPKLPLGLNRSNSTTTKVLVSD
                     KALHSTRGKKLKPIKAQIVVLNPREAGLFKRKRTPAYFNGNERPRERLSVLEGVEFDS
                     GGTSNNRKQQSSGDILQEIESQRRKLLVFKSSVPNEQVIKSIHDLRPSDDTRVMSTKR
                     YTQLKALLEMAYTLPQLKAYTRQYYDQRVPKSVTKKSIIPSILHKLWNCEVDASMSDE
                     QDLVVERILDSQSRDIYLLLLTNNGKILHNFARLGATVAVALGENKIIVRATSSLVKY
                     VEVSLRKILDNVQREVLPIQSIIDSHSASNSPPISPEDLVNLVQKETATFFEKLLEDD
                     TNSYVVSGFGGKRLAKAEILLLWALDYNPQKTELVRFLGERGDCDYKLFPFTDNQCLD
                     WIDRSKEWYRLQKPVSKNQEPGEIKPLVLDEKAIDELYHDMLTSQSATTSKVNEGLET
                     KVISITLGQILKTLDGKSSTFQPKVPGITKKLLQLPLYDGIAAEDELYTVDQHEYHVQ
                     LKFIPNLSSVGHIKDIPPLELWFELDDYDKAISSSVRCLLHTEDRSLLLQTPQMSHDY
                     KVSVDRTLEATKPYEDDPQNWLKDQPGLKEFLLRARLTFQGSEKLYVPKNLEMNLRLG
                     DSDVLQPVIFDYVNVKYRRVLRLKYMDHYLVQFSDLNGGTSGGKYTQVDFICPESNMI
                     SREAFGSFIKDVLKYV"
     gene            <984811..>985374
                     /locus_tag="KLTH0G11682g"
                     /db_xref="GeneID:8293821"
     mRNA            <984811..>985374
                     /locus_tag="KLTH0G11682g"
                     /product="KLTH0G11682p"
                     /transcript_id="XM_002555496.1"
                     /db_xref="GeneID:8293821"
     CDS             984811..985374
                     /locus_tag="KLTH0G11682g"
                     /note="weakly similar to uniprot|Q12163 Saccharomyces
                     cerevisiae YDR162C NBP2 Protein involved in the HOG (high
                     osmolarity glycerol) pathway negatively regulates Hog1p by
                     recruitment of phosphatase Ptc1p the Pbs2p-Hog1p complex
                     found in the nucleus and cytoplasm contains an SH3 domain
                     that binds Pbs2p"
                     /codon_start=1
                     /product="KLTH0G11682p"
                     /protein_id="XP_002555542.1"
                     /db_xref="GeneID:8293821"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DMU4"
                     /translation="MDHHQECSSADEVAEAGYISIKDFAYDKSNPLHFGYFGESSDDE
                     EGSEECESDSRRQSIVLPSEYIVNRRAVALYDFVPENDNELELREGDVLFIGYRHGQG
                     WLVAENAERTRTGLVPEEYVSLTEPGDGDDDDSESGEERPRPFYLTHMIAQSMNNSRG
                     GQNDEEWEDIDDLESHLNEHLRISNSS"
     gene            complement(<985593..>986729)
                     /locus_tag="KLTH0G11704g"
                     /db_xref="GeneID:8293822"
     mRNA            complement(<985593..>986729)
                     /locus_tag="KLTH0G11704g"
                     /product="KLTH0G11704p"
                     /transcript_id="XM_002555497.1"
                     /db_xref="GeneID:8293822"
     CDS             complement(985593..986729)
                     /locus_tag="KLTH0G11704g"
                     /note="similar to uniprot|Q03771 Saccharomyces cerevisiae
                     YDR161W interacts with PP2C"
                     /codon_start=1
                     /product="KLTH0G11704p"
                     /protein_id="XP_002555543.1"
                     /db_xref="GeneID:8293822"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DMU5"
                     /translation="MSQLGSIVAQAKSFLEENNSKEALKALKPLKKSLKSSNSSNVEL
                     HQIFADAYLDDGQLEKAYPLLVRACELDPNGTIGGSDKYFTLGQVAGGEDGIRLLMQG
                     IESVSQQAGDVLRQDQADKIVNGLLSMIEIWMTDLCMEPNAESQCEELIAKAMEVSDS
                     KSPEAWVTLGSIRISQQRFDDAVEAFTQSWRFFQEKKTKIEEAIESGNATHSEFVDLL
                     QPLLNLTKMCIEMGLYEISLEILAAIKDVDEDNLEGLYLEGFTHYLICKLELFKHKNP
                     SIELNSENVYEFNQHFPELPLELSTESIGEHVREARLALTYMIKLAENSDIRDEVMME
                     LTEGANSLLTELGGPVDITELIRSRKGEEVGDDEDIEFEEIEEA"
     gene            complement(<986837..>989311)
                     /locus_tag="KLTH0G11726g"
                     /db_xref="GeneID:8293823"
     mRNA            complement(<986837..>989311)
                     /locus_tag="KLTH0G11726g"
                     /product="KLTH0G11726p"
                     /transcript_id="XM_002555498.1"
                     /db_xref="GeneID:8293823"
     CDS             complement(986837..989311)
                     /locus_tag="KLTH0G11726g"
                     /note="similar to uniprot|Q03770 Saccharomyces cerevisiae
                     YDR160W SSY1 Component of the SPS plasma membrane amino
                     acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
                     external amino acid concentration and transmits
                     intracellular signals that result in regulation of
                     expression of amino acid permease genes"
                     /codon_start=1
                     /product="KLTH0G11726p"
                     /protein_id="XP_002555544.1"
                     /db_xref="GeneID:8293823"
                     /db_xref="GOA:C5DMU6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DMU6"
                     /translation="MAGANPIPNLFPDNLHISSDENASCSADESHTLGSKNTNDDRKS
                     SDTNYLKELLSSFKGHELDDYKAQLGGQKFYLSEEIDRRMMALQYRAYLEPEVEEESV
                     DFQAYNRKVEREYLLRKKMESLIQNKGREPLEVFGSDVLYSNFVAGDDASQSNIKPSR
                     ARQRLQKIVGSPQKSLPSLFKNSLSRTGTSDTQIIDLEKNHDGIIDERIPAQSYEYQP
                     GLAVKRPERTHSILRRLSIFPHGIGEEQYSVQRKLGIRHIQMIATGATMGVGLFLNSG
                     KALSIAGPFGFVLGFSICGSVALATMLSFTEIAALIPISSGFSGLASRFVEDAFGFAL
                     GWSYWLTYAITFANQIVASNFMLSYYENMRDQRGATVGFVTFFLIIAVLGNLLDVRIL
                     AELTYGFTFFKILVAAMMIFAMIVLNAGAGRHHHPAVGFRFWDASKSPENLTYGLFRP
                     TFDLRDIGSGSKKGISGAKGRFLSVLVVIVVSSFSFSGIELGFVACGEAANPRKSLPS
                     ATKRTFTTIITLYLLSIFVVSLNVYSGDSRLLRYYTAATQSPTTVLLHAFNTNWQIDE
                     TCNKNVIFSSTDFSNGSQSPWVLALESFGLCTFSSVFNAILVVFGVTSEFSSLYASSR
                     TLYSMATQEKAPAVFKLCSRNGVPYVAVLFSGLFGALAYLTINSRSLEIFQALANISG
                     ATISIIWLGLNVSFLRFYYALRKRTDIISRDDPSFPYRSPFQPYVACYGLIGSFLIVV
                     LMGFSNFLHGFWNTKMFFSSYGGLMFFTICYLGYKVFGTSKLQRLDQLDLDSGRREMD
                     RMIWTEHREYTNSLREKVTRFVTWLF"
     gene            complement(<989841..>992941)
                     /locus_tag="KLTH0G11748g"
                     /db_xref="GeneID:8293824"
     mRNA            complement(join(<989841..992789,992918..>992941))
                     /locus_tag="KLTH0G11748g"
                     /product="KLTH0G11748p"
                     /transcript_id="XM_002555499.1"
                     /db_xref="GeneID:8293824"
     CDS             complement(join(989841..992789,992918..992941))
                     /locus_tag="KLTH0G11748g"
                     /note="similar to uniprot|Q99271 Saccharomyces cerevisiae
                     YLR138W"
                     /codon_start=1
                     /product="KLTH0G11748p"
                     /protein_id="XP_002555545.1"
                     /db_xref="GeneID:8293824"
                     /db_xref="GOA:C5DMU7"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="UniProtKB/TrEMBL:C5DMU7"
                     /translation="MAVWSHLEVTKSHVAYACVGVFSAIFSLVSLFAKEKLYIGESTV
                     AVVFGLIVGPHCLDWFNPIEWGNTDSITLEITRIVLCLQIFAVAVELPKKYMLKHWLS
                     VTMLLLPVMTAGWLILALFVWIVIPHVSFPEALLVASCVTATDPILAQSVVSGKFAQR
                     VPGHLRNLLTAESGCNDGMAFPFIYLSLNLLFHSGHGGEIVKDWICVTILYECLFGCI
                     LGAFIGYTGRRAIKFAEEKKLIDRESFLAFYVVLAFICAGFGSMLSVDDLLVSFAAGT
                     AFAWDGWFSKKTKESEISTIIDLLLNLAYFVYFGAIIPWQQFNDPEIGTNAWRLVILA
                     IVVIVLRRIPAVLAFKAFIPDIKSWREALFVGHFGPIGVGAVFAAILARSELEGHATG
                     EETPLKQLPEKGSEYWRLIALIWPMTCFFIVVSIIVHGSSVAVITLGRHLNTITLTKS
                     FTTHTTNGKGNSWMQRLPSLDKSGRSFSLQRIDTKASPETLARQETVETSGVPAKPAG
                     GMKRKRRKLRNRIKKDLFRSRTNNGGNGEDSENLDSERLQREKEAQAAAFALSAELHH
                     DDDASDATDIDAEATGTDAETEEGTIEEPLELVDVMDPSEASHTINRLDAISHGEKVD
                     TESLGHQSQKSKPEPSPSNSLEGQSPNQGTTTTSSSNFDEEKLDRESQAASAASMDSY
                     ARDLEKLRKDMEAKRDEEEGAVAYTEGNKIIVENKDGEIIDQAELNRKPRDEEEGPDS
                     TTPQDRKSRSRSYSINSLKRALTPPRMRRQTLVDEQANKRYFAYKIDDQLIIENDDGD
                     VLRRYKINPHAEAGAKPAPKRKPTGVVAKALSAVGLSKGSSRAPSENTSGSSAQGDVA
                     QPQSSVAKIRDRRLTPVPTSGAMDVGSSEDEEEESEEDGSSDEESERAIDDEPESASD
                     YDGSEDGSYTDEGFSDEEPETAIERARRLTALGHVSAPRREDDEEFVPGNRETQNAES
                     SGPSNKVKSALSRPFRKQ"
     gene            complement(<993342..>997166)
                     /locus_tag="KLTH0G11770g"
                     /db_xref="GeneID:8293825"
     mRNA            complement(<993342..>997166)
                     /locus_tag="KLTH0G11770g"
                     /product="KLTH0G11770p"
                     /transcript_id="XM_002555500.1"
                     /db_xref="GeneID:8293825"
     CDS             complement(993342..997166)
                     /locus_tag="KLTH0G11770g"
                     /note="similar to uniprot|P46674 Saccharomyces cerevisiae
                     YDR159W SAC3 Nuclear pore-associated protein forms a
                     complex with Thp1p that is involved in transcription and
                     in mRNA export from the nucleus"
                     /codon_start=1
                     /product="KLTH0G11770p"
                     /protein_id="XP_002555546.1"
                     /db_xref="GeneID:8293825"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR017173"
                     /db_xref="InterPro:IPR024293"
                     /db_xref="UniProtKB/TrEMBL:C5DMU8"
                     /translation="MSSAVRASAPSSGFSFFNNARNNGSHNGFTKKSHPQKRDKGRKQ
                     NRPGKQLSRENLSRSKPNKNASTSAGVGGSATSVKETPWTSPSKVNAAGPYSQVPPEQ
                     LGFQRIAHKPRSAPRYLIQQRPRLKPGAFTPDPWDVANQQKMLAIENEISDPTQLWET
                     LKKMREVERGVMEDKRLVDRADSAKDLNDAIVFEGSCQDMCPVFERARRSVENNVVRY
                     EKEDQNSKRISRFKALKVFARPAAAAAPSLPSDVRPPAVLVKTLDYIVSNIVPHLPQC
                     EGFLWDRMRSIRQDFTYQNYSGPEAVDCNERIVRIHLLILHVMAKSDVEYSMQQELEQ
                     LHKALITLSEIYDEIRSSGGQSPNEAEFRAYSLLSRPRDPEYDKMAQSLPQDIFNDDI
                     VQLALCFRRIISNSGYSERGHMKTENGLNLYNRFFQLIKSDRVPFLMCSFLEVYVNEI
                     RFYALKSLSHSINRKHKPMPIEYLKEELMFNNESELFAFCEHYSIELGPDGVKVSTLS
                     HHSHNIPETRPLKQSYLLCVEEKLQKTPTSDLINAGKPNFDTLPQAQSLNNSSKGDTA
                     LPSISSLSENNPEKQATTYTIQSPAPFSNAEMNTGFGTSLKFGALGNGSSIARNVEAK
                     EQTENEKRDEIQRQKQLKIQQKIEEQRRLKEEREREKQYEIQQEQNRQQEEARRLARD
                     QKELQDKASKLVASSLIQDVVGKLLQKFAKECLAQSKANQKRNELLAEELYQAFLHEK
                     LYFISLETKADLKLQTRTLKAAWNSWGNKLAARRQKREQQKRTLDELTQVGKRLGIPE
                     FKRPRTETPLSSFSFTLPSSSRNRLVHTPINNQESQFRTPVHKNTAIWSPIDLKTVYC
                     DPIAERFKEKLKELKKAPEERSKISIFVFSRSWDSVSSRWLSSKFGFPVSPHQTYTSD
                     DGRVELEVNSARPNFSTRQLENLQLLVFNSGVTEDNIFDLELKLKQDGEKLIELAHGI
                     ALNTNYRFSILIIYWESAENPLLNDEISKYLKLNKISRVFAAALDSVEVVKLTGDAPH
                     KVLESSLDKVARHTNLELTERGAYNRSLRLKSPSASTSAYRSSRDIDEKLCSALEQER
                     RKHEQERNRNNTYAYLQSHIAASPRTRMRKLPVLLSESHGNRFKTPLAVRPFVKRTSS
                     YSVPSVPSHLAAKARLAREPGPAPADAALPLPADATPSYSRNQDDTTAATAAAVLPAT
                     PSLGSSARCYPGAANTSGISNVTFESPYSTPSARVLPSAGSPAAPVRDASSSVVELRD
                     LIASVKKKLNRR"
     gene            complement(<997347..>998351)
                     /locus_tag="KLTH0G11792g"
                     /db_xref="GeneID:8293826"
     mRNA            complement(<997347..>998351)
                     /locus_tag="KLTH0G11792g"
                     /product="KLTH0G11792p"
                     /transcript_id="XM_002555501.1"
                     /db_xref="GeneID:8293826"
     CDS             complement(997347..998351)
                     /locus_tag="KLTH0G11792g"
                     /note="similar to uniprot|Q12367 Saccharomyces cerevisiae
                     YLR137W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0G11792p"
                     /protein_id="XP_002555547.1"
                     /db_xref="GeneID:8293826"
                     /db_xref="GOA:C5DMU9"
                     /db_xref="InterPro:IPR029063"
                     /translation="MTAKLKLLDEDGIYEHLFERYSLLQKHANELKQDLGIVSRSSGD
                     LEVSFEPQPGSHVKEHFNFEIAQSLSSLNSSRDNNNSTTGYVVWSTTPFFLQWLLYSP
                     SGAIFGKGGTIEVEGDASHSAYELPAIFGSRTVDTDESSDVPAAPQHIIVELGAGIAG
                     MLCVALANYVDKYVCTDQKGLLNGLKRNIKHNIDELRLRNMESSTLDFEISRRTALKT
                     ELDVLDLDWESFGLKSSNFHTLITPAGPSTVCILSMDVVYNEFLIAPYLRTLKKLLQT
                     YEKSGNTSFAILGIQLRDQDVVEMFLSTAVVQFELKVCAIVDSEIDKTRFGLYYITTQ
                     "
     gene            complement(<998449..>999546)
                     /locus_tag="KLTH0G11814g"
                     /db_xref="GeneID:8293827"
     mRNA            complement(<998449..>999546)
                     /locus_tag="KLTH0G11814g"
                     /product="KLTH0G11814p"
                     /transcript_id="XM_002555502.1"
                     /db_xref="GeneID:8293827"
     CDS             complement(998449..999546)
                     /locus_tag="KLTH0G11814g"
                     /note="highly similar to uniprot|P13663 Saccharomyces
                     cerevisiae YDR158W HOM2 Aspartic beta semi-aldehyde
                     dehydrogenase catalyzes the second step in the common
                     pathway for methionine and threonine biosynthesis
                     expression regulated by Gcn4p and the general control of
                     amino acid synthesis"
                     /codon_start=1
                     /product="KLTH0G11814p"
                     /protein_id="XP_002555548.1"
                     /db_xref="GeneID:8293827"
                     /db_xref="GOA:C5DMV0"
                     /db_xref="InterPro:IPR000319"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR005676"
                     /db_xref="InterPro:IPR012080"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DMV0"
                     /translation="MCAKKAVGVLGATGSVGQRFILLLADHPDFELKFLGASPRSAGK
                     KYIDAVNWKQTELLPEFAKDIVVSECKASAFKDCAVVFSGLDAEYAGPIEKEFRDAGL
                     AVVSNAKNYRRESDVPLVVPIVNPEHLEIVGQKLETAKKAGAAKPGFIVCISNCSTAG
                     LVAPLKPLVDSFGPIDLLTTTTLQAISGAGFSPGVSGIDVLDNIVPYIGGEEDKMEWE
                     TKKILAPLSADKSTVNLLSDDEMKVSAQCNRVAVSDGHTECISLRFKNQPPPSLEQVK
                     QSMRDYVCEASKLGCHSAPKQTIHVLEQNDRPQPRLDRNRDNGYGVSVGRVREDPVLD
                     YKMVVLSHNTVIGAAGAGILIAEILLAKNYI"
     gene            complement(<999939..>1000163)
                     /locus_tag="KLTH0G11836g"
                     /db_xref="GeneID:8293828"
     mRNA            complement(<999939..>1000163)
                     /locus_tag="KLTH0G11836g"
                     /product="KLTH0G11836p"
                     /transcript_id="XM_002555503.1"
                     /db_xref="GeneID:8293828"
     CDS             complement(999939..1000163)
                     /locus_tag="KLTH0G11836g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0G11836p"
                     /protein_id="XP_002555549.1"
                     /db_xref="GeneID:8293828"
                     /db_xref="InterPro:IPR013239"
                     /db_xref="UniProtKB/TrEMBL:C5DMV1"
                     /translation="MRSRRSPHNPLAHPVVMHAGPREHVSQEQAMQFLGRFIREREEE
                     ADADASGALAQLRRVERNFKGLPPAVLDTE"
     gene            complement(1000484..1000554)
                     /locus_tag="KLTH0G11858r"
                     /db_xref="GeneID:8293829"
     tRNA            complement(1000484..1000554)
                     /locus_tag="KLTH0G11858r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=62.63"
                     /db_xref="GeneID:8293829"
     gene            <1001789..>1002277
                     /locus_tag="KLTH0G11880g"
                     /db_xref="GeneID:8293830"
     mRNA            <1001789..>1002277
                     /locus_tag="KLTH0G11880g"
                     /product="KLTH0G11880p"
                     /transcript_id="XM_002555504.1"
                     /db_xref="GeneID:8293830"
     CDS             1001789..1002277
                     /locus_tag="KLTH0G11880g"
                     /note="highly similar to uniprot|P14832 Saccharomyces
                     cerevisiae YDR155C CPR1 Cytoplasmic peptidyl-prolyl
                     cis-trans isomerase (cyclophilin) catalyzes the cis-trans
                     isomerization of peptide bonds N-terminal to proline
                     residues binds the drug cyclosporin A"
                     /codon_start=1
                     /product="KLTH0G11880p"
                     /protein_id="XP_002555550.1"
                     /db_xref="GeneID:8293830"
                     /db_xref="GOA:C5DMV2"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DMV2"
                     /translation="MSQVYFDVEVDGQPLGRIVFSLYNDVVPKTAENFRALCTGEKGF
                     GYAGCPFHRVIPDFMLQGGDFTHGTGVGGKSIYGGKFPDENFSKKHTKPGLLSMANAG
                     PNTNGSQFFITTVPCPWLDGKHVVFGEVADGFDVVKKIESLGSPHGTTRGRILISKSG
                     EL"
     gene            <1002588..>1003787
                     /locus_tag="KLTH0G11902g"
                     /db_xref="GeneID:8293831"
     mRNA            <1002588..>1003787
                     /locus_tag="KLTH0G11902g"
                     /product="KLTH0G11902p"
                     /transcript_id="XM_002555505.1"
                     /db_xref="GeneID:8293831"
     CDS             1002588..1003787
                     /locus_tag="KLTH0G11902g"
                     /note="similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
                     YDR153C ENT5 Protein containing an N-terminal epsin-like
                     domain involved in clathrin recruitment and traffic
                     between the Golgi and endosomes associates with the
                     clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
                     clathrin"
                     /codon_start=1
                     /product="KLTH0G11902p"
                     /protein_id="XP_002555551.1"
                     /db_xref="GeneID:8293831"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:C5DMV3"
                     /translation="MDSLSKKIQNLGIHDIRNAARFAQNVIVQYEPYQVDIRRATNTD
                     SWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHIASRPKNFYEKARKQYVNYGSEW
                     RVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHILTRDVMQFRVDFSADGKMEVHE
                     RGIKKKCEQMIQYIEDPAYLKRERAKHNKNVAKIHQSSATFSTVSTPSTSGRDAVYGS
                     YDDEDDDDDDGDYEDFRSAAPAQSAARRRTSAADEQRRQKREMLREKIKASELQRKAS
                     LKKAQEPPADLLDLDDPEPQPQRQSQPAAKPQASTSLGFDDDDDDDEFGDFQSDSHPQ
                     TTAPTSNNTTGTVSGLDLLDWDGPSTSAVPAASGAAAASTTRNGSSSNTQTDAFADLF
                     SYSKSHA"
     gene            complement(<1003887..>1004639)
                     /locus_tag="KLTH0G11924g"
                     /db_xref="GeneID:8293832"
     mRNA            complement(<1003887..>1004639)
                     /locus_tag="KLTH0G11924g"
                     /product="KLTH0G11924p"
                     /transcript_id="XM_002555506.1"
                     /db_xref="GeneID:8293832"
     CDS             complement(1003887..1004639)
                     /locus_tag="KLTH0G11924g"
                     /note="similar to uniprot|Q03768 Saccharomyces cerevisiae
                     YDR152W GIR2 RWD domain containing protein of unknown
                     function"
                     /codon_start=1
                     /product="KLTH0G11924p"
                     /protein_id="XP_002555552.1"
                     /db_xref="GeneID:8293832"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C5DMV4"
                     /translation="MDYKDEQSQELEVLESIYPDEFAVQSDEYPKVQFSVSLPLDLVP
                     LESSSFTQDSINMEHHLVLNFKLPETYPETVPEITIECEQERKANVHDDSEDSEEDEE
                     VEYDEHGNPVESKLANLPDQVQFDEYVKVLESQVESQASEDMLIGMQMCFALVSWIKE
                     SCEHHFQERLAELEREHERKLLDREAEEQKKFRGTKVTSESYLEWRAKFREETGLNER
                     DAARKVEAHSGRLTGRQIFEQGLDGSEDVEEE"
     repeat_region   complement(1005396..1005811)
                     /rpt_type=long_terminal_repeat
     gene            complement(<1005828..>1007309)
                     /locus_tag="KLTH0G11968g"
                     /db_xref="GeneID:8293834"
     mRNA            complement(<1005828..>1007309)
                     /locus_tag="KLTH0G11968g"
                     /product="KLTH0G11968p"
                     /transcript_id="XM_002555507.1"
                     /db_xref="GeneID:8293834"
     CDS             complement(1005828..1007309)
                     /locus_tag="KLTH0G11968g"
                     /note="some similarities with uniprot|P40890 Saccharomyces
                     cerevisiae YJL222W"
                     /codon_start=1
                     /product="KLTH0G11968p"
                     /protein_id="XP_002555553.1"
                     /db_xref="GeneID:8293834"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="UniProtKB/TrEMBL:C5DMV5"
                     /translation="MQVHPSLVTGEGEESNSDGQRFFSIKSNLSLKQDLLLIVTNFRN
                     VPSSGIVSETERKVFSSSDGENFRVARFYSFDANFHCNYFGSGNQNKIICQSPAFQRM
                     EANTLMDVEGRILYSSDGGQTLQKIHHFDNLHIVSSHV