GenomeNet

Database: RefSeq
Entry: NC_013084
LinkDB: NC_013084
Original site: NC_013084 
LOCUS       NC_013084            1423902 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome H complete sequence.
ACCESSION   NC_013084
VERSION     NC_013084.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 1423902)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1423902)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1423902)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928180.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1423902
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="H"
     gene            complement(<3987..>5309)
                     /locus_tag="KLTH0H00132g"
                     /db_xref="GeneID:8294196"
     mRNA            complement(<3987..>5309)
                     /locus_tag="KLTH0H00132g"
                     /product="KLTH0H00132p"
                     /transcript_id="XM_002555841.1"
                     /db_xref="GeneID:8294196"
     CDS             complement(3987..5309)
                     /locus_tag="KLTH0H00132g"
                     /note="highly similar to uniprot|P40896 Saccharomyces
                     cerevisiae YJL213W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H00132p"
                     /protein_id="XP_002555887.1"
                     /db_xref="GeneID:8294196"
                     /db_xref="GOA:C5E1W4"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:C5E1W4"
                     /translation="MKTCTIDVNERNNKKLEDLVAPWRLKPLQNYYITNTNLIDVVEG
                     KTHPEAYIFINEGKISKVNFGREPKSETSKDYEIIEGTGKYVMPGLFDNHVHMGAVPG
                     EMGLAQLAMMPESVAVLRLRFTMEASLARGFTTVRDCGGIEGFVKAAVANGSLIGPRL
                     ITCGHAISQTGGHGDLRPGSLPASAFDSCSCHTGTVGVVADGVDGCYTAAREEFRRGA
                     DFIKMMGSGGVASPTDKITNLQFCHDEIKALVDVAKTYHTYVTAHVYTPEAIQNCIKL
                     GVKGVEHGNLLDEETAELMAELGCYLTPTLVTYKIMASDQFGTFLGPVNRKKNAEVLG
                     QGIDAIKIAQEKGVKICFGSDLLGPLGGYQTQEFFIRGKVQSARDVLLSATVTPAEMN
                     GLGNKLGQVKPGFIADLLMMKSNPLEDVSIMDEPETNLVFVMKEGRIY"
     gene            complement(<6702..>8039)
                     /locus_tag="KLTH0H00154g"
                     /db_xref="GeneID:8294197"
     mRNA            complement(<6702..>8039)
                     /locus_tag="KLTH0H00154g"
                     /product="KLTH0H00154p"
                     /transcript_id="XM_002555842.1"
                     /db_xref="GeneID:8294197"
     CDS             complement(6702..8039)
                     /locus_tag="KLTH0H00154g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H00154p"
                     /protein_id="XP_002555888.1"
                     /db_xref="GeneID:8294197"
                     /db_xref="UniProtKB/TrEMBL:C5E1W5"
                     /translation="MVRKAHLPLLASIASACATCPSISDVNVLSADDGSSSFWGTGLG
                     AYIELTLSATEKGECWFSAPSNVFGNFPACPFSWDYGTVNSAGGNNYSIQFNQIPHGG
                     VAKLGFLTSLAEGYKSSITSGKTDTYSFVTSSGEHKSSVSFNDFPSDQVYCGSCGTQQ
                     EGNSLSFDVSVPAAIIESAFTINIEKQQGYKFQTGGIKLYYTQSSNSFDEASNEQLVP
                     SSSITDSSTEDKISIAFNGNLPSGCSGLRLSYDVAVLEEMTYYSSVCNVEFSSFSQQL
                     TAYVYTKNHMGSIETPAVSKGPGCGSQTSSSSGYSSSTVTTLSPSTGFTSSSTSAAVT
                     SATSSSGCDDGCDDGSGSSSSSSSPAAPTSSSGCDSGCDDNTATSSATPSTSTSSSSS
                     SGTSCDSGCDENSGSGSGSGSGHGSGHYAGHGGRHNWGHNSGHKGGQGSGCKS"
     gene            <17248..>17763
                     /locus_tag="KLTH0H00198g"
                     /db_xref="GeneID:8294199"
     mRNA            <17248..>17763
                     /locus_tag="KLTH0H00198g"
                     /product="KLTH0H00198p"
                     /transcript_id="XM_002555843.1"
                     /db_xref="GeneID:8294199"
     CDS             17248..17763
                     /locus_tag="KLTH0H00198g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H00198p"
                     /protein_id="XP_002555889.1"
                     /db_xref="GeneID:8294199"
                     /db_xref="GOA:C5E1W6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5E1W6"
                     /translation="MLFIRKAAIGDLSDITNIIESAKIFLKSQNIDQWQNGYPNQEQA
                     RVDIAGGQCYVLICNNEVAAVGTITTDVDPSYTTIQGSWRKDSRKSYASLHRLAVSER
                     FRGKHLAQELLSGMIMKCKELGFVDVRVDTHKQNKVMQALLVKNYFEYRGVIYKNENR
                     SSRNAYQLLLH"
     gene            complement(<18972..>19883)
                     /locus_tag="KLTH0H00220g"
                     /db_xref="GeneID:8294200"
     mRNA            complement(<18972..>19883)
                     /locus_tag="KLTH0H00220g"
                     /product="KLTH0H00220p"
                     /transcript_id="XM_002555844.1"
                     /db_xref="GeneID:8294200"
     CDS             complement(18972..19883)
                     /locus_tag="KLTH0H00220g"
                     /note="similar to uniprot|P32331 Saccharomyces cerevisiae
                     YPR058W YMC1 Putative mitochondrial inner membrane
                     transporter member of the mitochondrial carrier (MCF)
                     family"
                     /codon_start=1
                     /product="KLTH0H00220p"
                     /protein_id="XP_002555890.1"
                     /db_xref="GeneID:8294200"
                     /db_xref="GOA:C5E1W7"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E1W7"
                     /translation="MSEELTSPQVVDDLVDSHDVNQAFKDIFCGTVGGFAQVLVGQPF
                     DITKVRLQTSPVPSTAVEVIKNLVKNEGILAFYKGTLVPLVGVGACVSCQFGINEAMK
                     RHFRRDHTESDQTLTLSQYYTCGFVSGFANAFLASPIEHVRIRLQLQTKSLDKAEYRG
                     CIDCTKKLLQGGALMRGLSATMLRTSHGFGVYFATYEALIANQAHHGVLRQEIPAWKV
                     CLYGAFSGAFFWAMTYPFDVIKSVMQADSLKSPKYGRTVFSVARSIRRERGIGAFLKG
                     FWPTMLRSLPVNGATFAAFETAMRLIN"
     gene            complement(<23047..>23715)
                     /locus_tag="KLTH0H00264g"
                     /db_xref="GeneID:8294202"
     mRNA            complement(<23047..>23715)
                     /locus_tag="KLTH0H00264g"
                     /product="KLTH0H00264p"
                     /transcript_id="XM_002555845.1"
                     /db_xref="GeneID:8294202"
     CDS             complement(23047..23715)
                     /locus_tag="KLTH0H00264g"
                     /note="similar to uniprot|P40008 Saccharomyces cerevisiae
                     YER004W FMP52 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0H00264p"
                     /protein_id="XP_002555891.1"
                     /db_xref="GeneID:8294202"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E1W8"
                     /translation="MSSRALIIGATGLCGSAFVKYVAKDPSFTEIATISRKALNGNYD
                     GKVRSLILEDSSNWSAAVPENYDILFSGLATTRGEAGKENFYKVDHDMNLQLARSAKE
                     KGYSTYVVVSSTGADENSMFYYMKTKGELERDILALGFERTIILRPGPLLGERTKSKG
                     LLNGLSSKIGSIVYRTKLQSVFGCPVYGDEVAKVGVKLALDTSDTAKIKIVESAEILR
                     LAGV"
     gene            complement(<24401..>26059)
                     /locus_tag="KLTH0H00286g"
                     /db_xref="GeneID:8294203"
     mRNA            complement(<24401..>26059)
                     /locus_tag="KLTH0H00286g"
                     /product="KLTH0H00286p"
                     /transcript_id="XM_002555846.1"
                     /db_xref="GeneID:8294203"
     CDS             complement(24401..26059)
                     /locus_tag="KLTH0H00286g"
                     /note="some similarities with uniprot|P53857 Saccharomyces
                     cerevisiae YNL234W similar to globins and has a functional
                     heme-binding domain involved in glucose signaling or
                     metabolism regulated by Rgt1p"
                     /codon_start=1
                     /product="KLTH0H00286p"
                     /protein_id="XP_002555892.1"
                     /db_xref="GeneID:8294203"
                     /db_xref="GOA:C5E1W9"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="UniProtKB/TrEMBL:C5E1W9"
                     /translation="MFVGTNHRPNAAPQFVESLLTESQSTEDICLQSGDLKHRVSSDR
                     SSERIRLLRQSAVSSDTYPRSFLDAYHDEFSSSSSNGELTSERGESEKGDEAKIPKGI
                     TPEASVTFQKHYKMSLQLQPHEIEMVRCSWSILLDDECSKPKYDAFVDKCVKPRINVP
                     YKPPANEDSKNNVKEQLANSGKYEDDLKVPTFLFGAQFLHNIREIIPTIENSFPGIQH
                     AASGVTGVVGMAISNLEDLSVMDYYLSSLGKHHARILGVYASHFDVAGIAFLKTLRDR
                     FGYHYTKELDELWSRIYIYLANSMLQYGIDPILQDSGSSEITLGFPQLKEDSLSTSNA
                     DLSSKDSCGENEKIVGSLSDLSKNSTYSSKSAKEVSLVSSNKLLSRTSGWQSSKSSAS
                     SGQEGINSKTKKKEPTRNVGSVRGGGAWSGSHPQPTLAEESNVHYGASVRGGGGWQRS
                     SGRSPSEKDFKGNSIGVVNDGKHALSTSRINGKSNFSLPASRPGATYAGKTSDITGKT
                     HLRCSENYEMVTKAYSTVNSTARSSGGVRGGGGFNSGNGDCTLM"
     gene            <28695..>30227
                     /locus_tag="KLTH0H00308g"
                     /db_xref="GeneID:8294204"
     mRNA            <28695..>30227
                     /locus_tag="KLTH0H00308g"
                     /product="KLTH0H00308p"
                     /transcript_id="XM_002555847.1"
                     /db_xref="GeneID:8294204"
     CDS             28695..30227
                     /locus_tag="KLTH0H00308g"
                     /note="weakly similar to uniprot|Q12300 Saccharomyces
                     cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
                     /codon_start=1
                     /product="KLTH0H00308p"
                     /protein_id="XP_002555893.1"
                     /db_xref="GeneID:8294204"
                     /db_xref="GOA:C5E1X0"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E1X0"
                     /translation="MGFLQKVFLAEEDIQGSKFRAIFIGLFVAFGGVLFGYDTGTISG
                     ILAMKYVKEHFTHRGSFTAGETSLITSILSAGTFVGAISAPLVSDTMGRRFGLIASTI
                     VFSIGVILQVAATGQDLLIVGRVIAGLGVGILSAIVPLYQSEAAPKWIRGAVVSCYQG
                     AITVGLLLAACVNQGTHARTDSGSYRIPIAIQFAWALILFVGMIVLPESPRFYVKQGK
                     IEKAGNALSRLRGLPADHPIVEGELEEILANFNYEKSLGSTTVWDCFKRGNHQLKRML
                     IGLAIQALQQLTGINFIFYYGTQFFQNSGIKNPFIIQVIMNVVNVVMTWPGVLLVELA
                     GRRNLLLWGAVGMCVSELIVASVGTALPDSTAANKTLIAFSCTFIASFAATWGPLAWV
                     VVGEIYPLRVRGKSVALCAASNWLFNFAIAYATPYLVDQEHANLQSKVFFIWGGCTFL
                     CFLFVYFFIYETKGLTLEQIDELFETCTSAPDSKNFIPSSGYAHESPDAEKAVVEAVE
                     KV"
     gene            <31537..>36237
                     /locus_tag="KLTH0H00330g"
                     /db_xref="GeneID:8294205"
     mRNA            <31537..>36237
                     /locus_tag="KLTH0H00330g"
                     /product="KLTH0H00330p"
                     /transcript_id="XM_002555848.1"
                     /db_xref="GeneID:8294205"
     CDS             31537..36237
                     /locus_tag="KLTH0H00330g"
                     /note="similar to uniprot|P53855 YNL242W Saccharomyces
                     cerevisiae ATG2 Peripheral membrane protein required for
                     the formation of cytosolic sequestering vesicles involved
                     in vacuolar import through both the Cvt pathway and
                     autophagy"
                     /codon_start=1
                     /product="KLTH0H00330p"
                     /protein_id="XP_002555894.1"
                     /db_xref="GeneID:8294205"
                     /db_xref="GOA:C5E1X1"
                     /db_xref="InterPro:IPR015412"
                     /db_xref="InterPro:IPR026849"
                     /db_xref="InterPro:IPR026885"
                     /db_xref="UniProtKB/TrEMBL:C5E1X1"
                     /translation="MPSWFAQNLQRRLLLYFLQKASLFSNIDVSALDVSLGSSSHFTF
                     HDLDLDVESINIPDIALRSGFIEKLELSLTVSGGVKVEGSGLVFVVKPLLTNTYHPQS
                     SSFSLSKTVYDLASSVMQYSDKENTPEEDLSGEDNSSESDNRSYENFAAPAPSVLQSM
                     RNKALDLALSNLKIQLKDVTIQFLFPQNNVLELSLQEALVLSANKAREVQLSNLQLLH
                     WKQTKSPDEEVESKTDLSMSDSLVYSKAEATSIYMSALQSFQEHENESTFVPQKSEAL
                     SFDTLSMKFRGFASIDDLSISDIAIDFNECIIDLPLLLELNESISLPLLAMFSSKFHN
                     NISDTAKYQPQNLQNYKRFQNEQDIREESLFSNLKGSSAIIKLPGQLKVRLKSLLVKI
                     CESGIMSSTLGDISVLHQGFPIFTHVPTVPPFFSLMCIPGARKIDIALHHDISVVLDV
                     HSLTDIFRCVKSFEKCMAAWQQAVPRKSQPRGVKPKPYSIGIESETCHLELRLGEGTL
                     NANLSAFSVPNIFESVSLNSVEMNMKKNAQETPLVSIENIKLVTPENPMQFNSYDHGY
                     QEIVISSKCCINIESIRAEVPFLELESLSLEVQNLLKKVVASPDIKRSEYSPRKSGNR
                     QLKRSVRILGSSSIISKQSSTAQYVIQICTVDICLKDILGHDFGDLRGHLSDFFIYMG
                     TDQRFTAHSNKLSINRVSLSQGESLVDVLLVKNEQAPVLMVHKKLTGKICCTLRSVCL
                     RYDAHILDLLKNRKTSNDSASQILPKPAAEVKQNTTVLEFKLLECSISLKPYRLKSSV
                     ILILNKASIEFVLPNFRSKGTLKACYILLIDDISNLVDQPGTNYPSLLSFYTERGFAN
                     VGKFDKMTLSLTKSRNTMEIRADVNSVSLSLCADSAQALIQTIIDLGVPLTFPEDQKY
                     RTKPTPTDILDDIENDFFTEAKIQINPISTKEDPISIFDNFLDKSPEVVDTDSNMPAG
                     ESGSPKFGDQRFMVTEEDYFSSKGCYPVQSIPEDPDVELSIVFGVENVSLKLYDGFDW
                     KYTRNSISEIISQMESVLRQQDLNQDPELIKASIFDSIYLFADKGTDVDSLRQHINRD
                     LQSEPSVFVKGSSKKTRLRPSRDFKVRIGISGITAIFTKFVVDEPTEFTSDLSADTLH
                     DVKLQVRDIEVVDNVPSSTWNKLLTYLKDKPRAKGSEMLSLNIQTVRPIDFLAATELI
                     MYVHVLPLQVHIDQDTLEFLTRFAEFKDSRFELIDEFPDFVYIQKLEVEAVQIRMDYK
                     PKKVDYSGLKSGHASEFMNFFILEGSRFQLQHLIVYGVNGFPELNKTLNNAWLPDITG
                     NQLKGILSGVAPMKTLVTLGSGVKALVSTPVKEYKRDQKLGRGLQKGTQVFVKVTTGE
                     FVRLGVKLASGTQALLENAEELMGGEGSRARDHSINGFEFDLVPEETVKQYEKLMGGT
                     NPSHKGRVSEAIVVEPPSNEKEPPRIFSLYADQPNTLQRGLKEAQSSFGRNIQLAYDA
                     LKKAQGEIKESESAQETASSMARVVPVALIRPIIGATEALSKTLQGISNEIDEEQVTY
                     LQDKYKSRRPRETL"
     gene            <36466..>39633
                     /locus_tag="KLTH0H00352g"
                     /db_xref="GeneID:8294206"
     mRNA            <36466..>39633
                     /locus_tag="KLTH0H00352g"
                     /product="KLTH0H00352p"
                     /transcript_id="XM_002555849.1"
                     /db_xref="GeneID:8294206"
     CDS             36466..39633
                     /locus_tag="KLTH0H00352g"
                     /note="similar to uniprot|P35688 Saccharomyces cerevisiae
                     YDL240W LRG1 Putative GTPase-activating protein (GAP)
                     involved in the Pkc1p-mediated signaling pathway that
                     controls cell wall integrity appears to specifically
                     regulate 1 3-beta-glucan synthesis"
                     /codon_start=1
                     /product="KLTH0H00352p"
                     /protein_id="XP_002555895.1"
                     /db_xref="GeneID:8294206"
                     /db_xref="GOA:C5E1X2"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5E1X2"
                     /translation="MSYATEPHKQQVLNRNNDRTINSGHLATVPNERLQEKRPSLPHQ
                     QSSRTAKICARCNKAIARGSLKALGRYYHEECFVCYDCGKVCKPKYFPFEDPKTRKLI
                     PLCQQDYFKRNNLLCFVCGKALRGVYYNAFGKLYDEEHFCCKICKEKCGVNTCFNYQD
                     DLYCKYHFLKFFSNRCKGCQYPISDQYIEFPRGEEVHRWHPECYGVHKYWHVSLPPEA
                     VGLPQIKRADPNDIFLGEEHLSNRTDLEKYVFTFNKLVSKTWSVLYRFEEETAICISD
                     MFQYLTSFDQLKGLNSTALFVLKIECLFRALDSLDSLCGYNLFGKPQGKYGDPADDRL
                     EAADNDVSSETVDTINLKYAKFPRNLSTKVMIYLQLLRKLSSASREKDVNVSSLMSVI
                     TGVAHFLKLLVRHGLQTALDRNRSVHSANALIKFLREIEKNELVSGDPFRLINVSINA
                     TDCCAACGKYIQEDCIQFKARRWHKGCFSCSICQRHIDLYGVADAAFNTKANSVLCAQ
                     CAVGDPDSSSGFKSVTKLAQLIFLLKIALVRSKAVMEIQLKNREALKRSNSVKESISM
                     QQTYIRTLNDIKRLKSRRQSVPLTTNKQEARRSRILETSEMDTGRSSQPEDKCLVIQT
                     DKSPETEPENQNMFNSTKTLTLDDISRIVAAEQARELRPNAFAYFKKLKDNDDDAVNI
                     MNKKSGIYYSELKFEELYLIKLISLSLLNASSIDVMKDEATVNSLVPSPPKSLKNGAN
                     FWSKMRTIMSKDGKRGYSKKVFGTSLEVLTTQWGVDSDLGIGPSKIKIPIIVDELISS
                     LRQLDMSVEGVFRKNGNIRRLRELAVAIDDNPSEVPDLSKENAVQLSALLKKFLRELP
                     DPLLTFPLYKLWIEIAKIESDLERHKYFGLLYALLPGFNRSVAEVLFSFLHWTSSFSH
                     IDSQMGSKMDIHNLSTVITPNILYEQGATSAQPTVHGGAIHNTYNDAFAQNEGENYFL
                     AIEVVDYLINHNEDLSVVPKYMATLLKEVKEKQLFGFEAIKGFVSAQLEGGRLNFSEY
                     DVVESVKMKTSSSVAKLEVKGNNAS"
     gene            complement(<39762..>41297)
                     /locus_tag="KLTH0H00374g"
                     /db_xref="GeneID:8294207"
     mRNA            complement(<39762..>41297)
                     /locus_tag="KLTH0H00374g"
                     /product="KLTH0H00374p"
                     /transcript_id="XM_002555850.1"
                     /db_xref="GeneID:8294207"
     CDS             complement(39762..41297)
                     /locus_tag="KLTH0H00374g"
                     /note="highly similar to uniprot|P11412 YNL241C
                     Saccharomyces cerevisiae ZWF1 Glucose-6-phosphate
                     dehydrogenase"
                     /codon_start=1
                     /product="KLTH0H00374p"
                     /protein_id="XP_002555896.1"
                     /db_xref="GeneID:8294207"
                     /db_xref="GOA:C5E1X3"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="UniProtKB/TrEMBL:C5E1X3"
                     /translation="MSKPTEFKENTSIVVFGASGDLSKKKTFPALFGLFREGYLDPSC
                     KIIGFARSNLSDEDLHEKIKPNLKTNNDEKGSEKIEQFLKMVSYISGPYDKDEGFDKL
                     AKELDSYEKKQGVKSPHRLFYLALPPSAFVTVATQIKKKVYAEHGETRVVVEKPFGHD
                     LDSFRELQSDLSPLFREDELFRIDHYLGKEMVKNLVFMRFGNTFLNAAWNKENIQMIQ
                     ISFKEPFGTEGRGGYFDEIGIIRDVMQNHLLQVLTLLTMERPVTFDSEAVRDEKVKVL
                     KAFAPIDHKDILIGQYGKSEDGSKPGYLDDDTVNPDSKCVTFAALGFKIQNERWDGVP
                     IVMRAGKALNEGKVEIRIQFKAVPSGVFSEVAHNELVIRVQPDEAIYIKCNSKTPGLS
                     TTSQVSELDLTYARRFKDFWIPEAYEALIKDVLSGDHSNFVRDDELDISWKLFTPLLK
                     YLEGPDAPKPEEYAYGSRGPAELVNFLKSHDYVFEDSGSYQWPVITPEVTKKKQNSTD
                     SKM"
     gene            complement(<43400..>44791)
                     /locus_tag="KLTH0H00396g"
                     /db_xref="GeneID:8294208"
     mRNA            complement(<43400..>44791)
                     /locus_tag="KLTH0H00396g"
                     /product="KLTH0H00396p"
                     /transcript_id="XM_002555851.1"
                     /db_xref="GeneID:8294208"
     CDS             complement(43400..44791)
                     /locus_tag="KLTH0H00396g"
                     /note="similar to uniprot|P23503 YNL240C Saccharomyces
                     cerevisiae NAR1 Nuclear architecture related protein
                     component of the cytosolic iron-sulfur (FeS) protein
                     assembly machinery"
                     /codon_start=1
                     /product="KLTH0H00396p"
                     /protein_id="XP_002555897.1"
                     /db_xref="GeneID:8294208"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /db_xref="UniProtKB/TrEMBL:C5E1X4"
                     /translation="MSSLLSEKDLNDFISPGLACVKPAEPIEKGEKQEGDLEVGKESN
                     DMGKVSISLQDCLACSGCITSSEEILLSQQSHTVFLEAWKNLARDTALVVSIPPQCRL
                     SLAHYYDMSLESFDKSFLTLMKEKFGARYIVGTQIGRNITVNQTNKLLTERKSLSSSK
                     KPALCAVCPGFVLYAEKTKPELVPYLLDVKSPQQITGALLKKAIPNIYHLTIMPCFDK
                     KLEASRKDGEGEVDCVITPREFATMLQEQDLKLTDFLTSTDETVLKQSCSPPGWDISV
                     HWASNEGSASGGYAYQYILHQKSLHPGSCISTITGKNSDLKEFRLMDVSNENVIASSS
                     ELYGFRNIQNMVRKLTSSGSASRNIKVLRKRATTSSNNGSSFGSAVDPSKTDFIEVMA
                     CPGGCINGGGLLNGEANSSRRRALAKSLELEYGKVIPKVSCSDHPRDDSTYKYKFSAI
                     EKSQDVLTVGNTW"
     gene            <46022..>48457
                     /locus_tag="KLTH0H00418g"
                     /db_xref="GeneID:8294209"
     mRNA            <46022..>48457
                     /locus_tag="KLTH0H00418g"
                     /product="KLTH0H00418p"
                     /transcript_id="XM_002555852.1"
                     /db_xref="GeneID:8294209"
     CDS             46022..48457
                     /locus_tag="KLTH0H00418g"
                     /note="similar to uniprot|P13134 YNL238W Saccharomyces
                     cerevisiae KEX2 Subtilisin-like protease (proprotein
                     convertase)"
                     /codon_start=1
                     /product="KLTH0H00418p"
                     /protein_id="XP_002555898.1"
                     /db_xref="GeneID:8294209"
                     /db_xref="GOA:C5E1X5"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002884"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:C5E1X5"
                     /translation="MRLAFCKYFLLQVLLLSIVSQAVRVPVKDHSSRSYFAVESVLEV
                     PRLLKLHPNWVFEHEARGLDKHYVFSTKKDEYSKRDEVEASYEGVKSYHPLPPKKLQK
                     RLPVPDRPVDSSLEVVNEVRDRLSIEDPLFGIQWHLVNGNYPGHDVNVSGLWYENVTG
                     HNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGEIAAV
                     KNKACGIGVAYNAKVAGIRILSAEVTAEDEAASLIHALDVNDIYSCSWGPLDDGRVLQ
                     GPDDLVRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYSITVGAIDH
                     KGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHGKCSDTHGGTSAAAPLAAGVYSLVL
                     EANPNLSWRDVQYLSILSSEEINDDDGEWQEGALGKRYSHKYGYGKLDAYRIVTMGRE
                     WENVGPQSWYYSSVQKVGKSTNSTDEDLVSSISVSSEQLKNANFKRVEHITVTVSIET
                     TIRGRTTINLVSPKGIVSKLGVVRRSDTSPEGFQNWTFMSVAHWGEIGEGDWSLHVRT
                     TEDSNNVEFKDWRLKLFGESLDASKAKTFEFGNDKEPTEDLQQQQQEESVSDHPTSLA
                     SSTQPTFTAASSITSTHSTVSATTTTAETSDQDVNSPNKLPRPFEGLRYFLAIFAVGF
                     LVLVLYYYFFVKSRRLVRRSRAEAYEFDIIDTDSDHDSSLNSASNTSVPMMGELNEED
                     FNFDLSDEELLRSATVSPAPRYEQNVPAGASSDDLPTADPSKGKVHSENSSNNNGKRN
                     NMPREGSQGPNNG"
     gene            <48723..>50072
                     /locus_tag="KLTH0H00440g"
                     /db_xref="GeneID:8294210"
     mRNA            <48723..>50072
                     /locus_tag="KLTH0H00440g"
                     /product="KLTH0H00440p"
                     /transcript_id="XM_002555853.1"
                     /db_xref="GeneID:8294210"
     CDS             48723..50072
                     /locus_tag="KLTH0H00440g"
                     /note="similar to uniprot|P53584 Saccharomyces cerevisiae
                     YNL237W YTP1"
                     /codon_start=1
                     /product="KLTH0H00440p"
                     /protein_id="XP_002555899.1"
                     /db_xref="GeneID:8294210"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:C5E1X6"
                     /translation="MGSHYGCPRKLVAYLAIALLLVEQETCAGMQMDDTEGLTRPDIV
                     QAGPKTFHWLCTLALLLLLPSVSTALSFAGKLYFSMFLQIVSLAYAVAEAFILRFPDG
                     DGIENRTSRGTAWFMLALLGVTVFFGSLATGTGALVQNKRLQSLASHTGEKTLRYIHR
                     ALSFAVVLTGWIKCCLAPVAMFGFCRDKHTGQCIAHGIMGTAFVLYGFVYSMVLVVPW
                     IRNSQAEYSQDRIDSWVMCAWGIVNTFTEHRWGREDWNHGDYQHTAMGIIWWAGGLLG
                     IFLSRNGRRTFVPSLLIIFTGWAMSEHSQKLIISTKVHALFGLVLMAGGALRIVEISF
                     LLRDRRAASEILSFQYLAPFCLVCSGVLFMGANEEQLQLVLRLGADHSAYSLVAISAA
                     FVVYLWILLCLELYLKLVKLAEKGPLDSYTNNRGLESLTEFELDDVDGENHETVSRN"
     gene            <51279..>54104
                     /locus_tag="KLTH0H00462g"
                     /db_xref="GeneID:8294211"
     mRNA            <51279..>54104
                     /locus_tag="KLTH0H00462g"
                     /product="KLTH0H00462p"
                     /transcript_id="XM_002555854.1"
                     /db_xref="GeneID:8294211"
     CDS             51279..54104
                     /locus_tag="KLTH0H00462g"
                     /note="similar to uniprot|P32259 YNL236W Saccharomyces
                     cerevisiae SIN4 involved in positive and negative
                     regulation of transcription"
                     /codon_start=1
                     /product="KLTH0H00462p"
                     /protein_id="XP_002555900.1"
                     /db_xref="GeneID:8294211"
                     /db_xref="InterPro:IPR021665"
                     /db_xref="UniProtKB/TrEMBL:C5E1X7"
                     /translation="MSLFGTEDGEFVAWSKSGLIAYLDSRSSHANLCITFMETINGTN
                     WRLHPCKRYVVHPHLLETQSPAGASSIVGGGGGGSSRSFHNLNSVHWNNLSSHTGEQL
                     AACDELGNLTIIAAGQSMEGQGTLDKMIVLCQDNIYKTYNLTAPLQEVNPAAKIYRKQ
                     AKKEVHTTIIEFMWIGTQKPVLTMLGARKDSTTSTFHSQIQQCQPYGLFHPASIKSAF
                     IALRRGGQLDFWYQFSNSRDHKKISLQLNGSHEARSKQFEWFQMGGFAQMEDDQALLI
                     GAFSKLSNSLSFYRLHVNWNLSSQNSMNDPSLKLQHLLEIKPDYVGPQGELLNFTNFE
                     LLSPTHDRQSPLELLMCYEVAGLSRSIVKRYSLIKAVPSAILTIEFGVLNTEIPSSGS
                     DYSFSENEVITFDSGVTAAKSYNSETLVIFKLKNGRIEVYNRKTWRKENHEFNKINAS
                     ASHAATLSSPFCTGLNFPEIPPPAVTGWSEIAPALGGVLTKSRFDGELQFHPVTAPVT
                     DDSQNDSNIAAAFAYAFVCANHLQASGEDLSIAIKTYMLRIRQQSVARSDVFLREVIC
                     IIYHLFGLTPDASKEVKDKLIMSRPIQRAMLLQLELGSSFDNSNVYNMSRTAMSLRNI
                     LFAFNGVSRNIQVLIHHSATMNFQQSNGKLFQFAFSKQDLIYSLIPCAKWFVKLVTFL
                     TQQMIVLVNSPQDKDNTLVLGILSSKMTRQLLLSVLSEIRKIIHLVTKFPETAFPILN
                     ESSIYLRKVLGDSPVNFEKFETFLADVNNKFTSLSEQQAQGNAMKDSYLIIEGDIPEE
                     ISHLKEFMLSYSNTAVLSHIKPSEVYFSDTRGLRIFASELFSDSIFKLLQPLEKGLVV
                     NSKVLSESISSSSFCVAESDDISKDTLKNLNEGQKVKRCCRCGAITRAGYTVSKDNTI
                     VPTSISTKRWTSLYLKTCICSGFLYEL"
     gene            complement(<56283..>57424)
                     /locus_tag="KLTH0H00506g"
                     /db_xref="GeneID:8294213"
     mRNA            complement(join(<56283..57332,57377..>57424))
                     /locus_tag="KLTH0H00506g"
                     /product="KLTH0H00506p"
                     /transcript_id="XM_002555855.1"
                     /db_xref="GeneID:8294213"
     CDS             complement(join(56283..57332,57377..57424))
                     /locus_tag="KLTH0H00506g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H00506p"
                     /protein_id="XP_002555901.1"
                     /db_xref="GeneID:8294213"
                     /db_xref="InterPro:IPR027806"
                     /db_xref="UniProtKB/TrEMBL:C5E1X8"
                     /translation="MMKTSDVERLAYLHQERHLKNDGFCEFIENVATNQYLLRYTYGN
                     LVIRQATNKLTQRTPQLVLETLEDNGVFHNEERILIEKFTEQLIANQIQFETRKRSRG
                     RGKNFCYNKNYHSGGKFKLKYTNTDFRKLTGFCRSDFDRVVEALKMPSYIGAYSLDAF
                     ECFFIFVVRLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASSCLSVTNASWLA
                     GRLANIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLENAAYSGHKKTHTLKY
                     QAVTTPDGICIDLAGPFAGSQHDSFLFANSGLYRRLKPALKVGGIQYRISGDPAYRSS
                     DLLTVGYKGQNLTNGQKEYNKILSGSRVSIE"
     gene            <57753..>58538
                     /locus_tag="KLTH0H00528g"
                     /db_xref="GeneID:8294214"
     mRNA            <57753..>58538
                     /locus_tag="KLTH0H00528g"
                     /product="KLTH0H00528p"
                     /transcript_id="XM_002555856.1"
                     /db_xref="GeneID:8294214"
     CDS             57753..58538
                     /locus_tag="KLTH0H00528g"
                     /note="highly similar to uniprot|P32379 Saccharomyces
                     cerevisiae YGR253C PUP2 Alpha subunit of the 20S
                     proteasome involved in ubiquitin-dependent catabolism
                     human homolog is subunit zeta"
                     /codon_start=1
                     /product="KLTH0H00528p"
                     /protein_id="XP_002555902.1"
                     /db_xref="GeneID:8294214"
                     /db_xref="GOA:C5E1X9"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5E1X9"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSE
                     GVVLGVEKRVTSPLLEGDSIEKIVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLY
                     YDEDISIESLTQSICDLALRFGEGASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAELLVLKILKQVMEEKLDEGNAQ
                     LSCVTKEDGFKVYSDEKTAAIIKELKDKEAQENSETQDVEMST"
     gene            complement(<58659..>59945)
                     /locus_tag="KLTH0H00550g"
                     /db_xref="GeneID:8294215"
     mRNA            complement(<58659..>59945)
                     /locus_tag="KLTH0H00550g"
                     /product="KLTH0H00550p"
                     /transcript_id="XM_002555857.1"
                     /db_xref="GeneID:8294215"
     CDS             complement(58659..59945)
                     /locus_tag="KLTH0H00550g"
                     /note="highly similar to uniprot|Q03330 Saccharomyces
                     cerevisiae YGR252W GCN5 Histone acetyltransferase
                     acetylates lysine 14 on histone H3 catalytic subunit of
                     the ADA and SAGA histone acetyltransferase complexes
                     founding member of the Gcn5p-related N-acetyltransferase
                     superfamily"
                     /codon_start=1
                     /product="KLTH0H00550p"
                     /protein_id="XP_002555903.1"
                     /db_xref="GeneID:8294215"
                     /db_xref="GOA:C5E1Y0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y0"
                     /translation="MTSKRKDGAEEGSEAKRQKVERNVKDEPESQPEVVDLLEEQPAT
                     ESRANSGDKEEKESDEAGVTHFTFDGQEYKFKERASVIEEKEGKIEFRVVNNDNTKEN
                     MMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFDNREF
                     AEIVFCAISSTEQVRGYGAHLMNHLKDYVRATSKIKYFLTYADNYAIGYFKKQGFTKE
                     ISLDKSVWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAAVQRKVRLMSKSYVV
                     HPGLKIFKDLENIKPIDPMEIPGLKESGWTPEMDELAQRPKRGPHFAAMQNVLTELQN
                     HAAAWPFLQPVNKDEVPDYYEFIKEPMDLSTMEIKLENNRYEKMENFFYDARLIFNNC
                     RAYNGENTSYFKYANRLEKFFNTKMKEIPEYSHLVD"
     gene            complement(<60065..>61960)
                     /locus_tag="KLTH0H00572g"
                     /db_xref="GeneID:8294216"
     mRNA            complement(<60065..>61960)
                     /locus_tag="KLTH0H00572g"
                     /product="KLTH0H00572p"
                     /transcript_id="XM_002555858.1"
                     /db_xref="GeneID:8294216"
     CDS             complement(60065..61960)
                     /locus_tag="KLTH0H00572g"
                     /note="similar to uniprot|P38862 Saccharomyces cerevisiae
                     YHR171W ATG7 Autophagy-related protein that is a member of
                     the E1 family of ubiquitin-activating enzymes mediates the
                     conjugation of Atg12p with Atg5p a required step in the
                     formation of autophagosomes"
                     /codon_start=1
                     /product="KLTH0H00572p"
                     /protein_id="XP_002555904.1"
                     /db_xref="GeneID:8294216"
                     /db_xref="GOA:C5E1Y1"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR006285"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y1"
                     /translation="MSDPHLKFVAPCQSFLDTSFFQELARLKLDVLKLDSAIKELTSS
                     IGISHIPRGSPCAHLFLDSHSFGSRERKEGEMLIKGSLYNFNTIEEFKKVDKTRFLRD
                     RADELWKEGIEDPNDCVKFSIISFADLKAFKFFYWVCVPCFQLDSLTASVRGSGPFKS
                     TSKFDEWFAAHPGCWSCLVGESGELMEFNKVNSVRSSTLCMRDTSTVDMVPSALAKSF
                     ISLLKHFRSDLKEVRLIFIRSETASSFWVDTDMSSILAPDNTKLKVTGWERNLQNKLT
                     PRAVDLSSLIDPLHVADQSLDLNLKLMKWRIAPEINLDIIKNTSVLLLGSGTLGCYVA
                     RVLLAWGVRKITFVDNGTVSFSNPVRQPLFTFNSCGKPKAAAAADSLREIFPLVEAEG
                     VELAVPMIGHPITSESKQNEDYKRLLELIKAHDVVFLLMDSRETRWLPTVMGYAEDKI
                     VINAALGFDSYLVMRHGNYETDQKADRLGCYFCQDVVAPSDSLTDRTLDQMCTVTRPG
                     VALMAASQSVELLVSLLQHPMRNGGRPDEKVILGDLPHQIRGFLSEFKTLQLRVTAYE
                     HCSACSSIIVEEFKSRGWDFVRDALNDYKTVEDLCGLSEVQLKAEEVMNDVLDEWDDD
                     GEDGELL"
     gene            complement(<62142..>63680)
                     /locus_tag="KLTH0H00594g"
                     /db_xref="GeneID:8294217"
     mRNA            complement(<62142..>63680)
                     /locus_tag="KLTH0H00594g"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_002555859.1"
                     /db_xref="GeneID:8294217"
     CDS             complement(62142..63680)
                     /locus_tag="KLTH0H00594g"
                     /note="highly similar to uniprot|P38861 Saccharomyces
                     cerevisiae YHR170W NMD3 Protein involved in nuclear export
                     of the large ribosomal subunit acts as a Crm1p-dependent
                     adapter protein for export of nascent ribosomal subunits
                     through the nuclear pore complex"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_002555905.1"
                     /db_xref="GeneID:8294217"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y2"
                     /translation="MNYTPLDQSAFNNHQAATVLCCNCGTPMDGSSGLVMCYDCIKLT
                     VDITEGIPRESNVSFCRNCERFLQPPGQWVRAELESRELLALCLRRLKGLNKVRLVDA
                     SFIWTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYVVVAMQCADCARSYTTNTWRAT
                     VQIRQKVSHKRTFLYLEQLILKHNAHVDTINIQEAKDGLDFFYAQKNHAVKMLDFLNA
                     VVPIKSKKSEELVSQDTHTGASTYKFSYSVEIVPLCRDDLVVLPKKLAKSLGNISQFV
                     LCSKISNTIQFLDPMTLQTSDLSPSVYWRSPFDSLADVSQLVEFIVLDVDPTGQTKGK
                     WVLADITVARASDLGSNDQVYYVRSHLGAICHPGDSVMGYFIANSNYNSDLFDALNME
                     HVPDVVLVKKQYIRKTRKNRSWKLKRMAREHKDIEASQDYSSRQQKQEMERAEKDYEL
                     FLQELEEDAEMRQAVNLYKSAQQAPQDGEMDEDEEEDAPQIDIDELLDELDEMTLDEG
                     APPA"
     gene            complement(<63837..>64415)
                     /locus_tag="KLTH0H00616g"
                     /db_xref="GeneID:8294218"
     mRNA            complement(<63837..>64415)
                     /locus_tag="KLTH0H00616g"
                     /product="KLTH0H00616p"
                     /transcript_id="XM_002555860.1"
                     /db_xref="GeneID:8294218"
     CDS             complement(63837..64415)
                     /locus_tag="KLTH0H00616g"
                     /note="similar to uniprot|P53317 Saccharomyces cerevisiae
                     YGR251W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0H00616p"
                     /protein_id="XP_002555906.1"
                     /db_xref="GeneID:8294218"
                     /db_xref="InterPro:IPR022592"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y3"
                     /translation="MSRAKEIQEKLSLQAKLQASFNASALKASEWLPKDSLEDQKSDL
                     TSSKDSFYSLPVIGVGAGLSFEEKEESNAQGEVSTIGEFINSNKKLSSLAKKKKGKHA
                     TNSQSQSGGIFKVSSSDTRAMVALKRKMKSGRRQELRNKISRPSALDMSHPGLGTKED
                     LRHSDSDEEPQVTKTSKKSYGLLFESKKPKRK"
     gene            complement(<64621..>65922)
                     /locus_tag="KLTH0H00638g"
                     /db_xref="GeneID:8294219"
     mRNA            complement(<64621..>65922)
                     /locus_tag="KLTH0H00638g"
                     /product="KLTH0H00638p"
                     /transcript_id="XM_002555861.1"
                     /db_xref="GeneID:8294219"
     CDS             complement(64621..65922)
                     /locus_tag="KLTH0H00638g"
                     /note="highly similar to uniprot|P38719 Saccharomyces
                     cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
                     helicase of the DEAD-box family involved in biogenesis of
                     the 40S ribosomal subunit"
                     /codon_start=1
                     /product="KLTH0H00638p"
                     /protein_id="XP_002555907.1"
                     /db_xref="GeneID:8294219"
                     /db_xref="GOA:C5E1Y4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y4"
                     /translation="MSSEFATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCI
                     GGAKTGSGKTIAFGAPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRV
                     ALVVGGESIVDQAINLQRKPHFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADI
                     LLTDTFSEHLATCISILPPKEKRQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVES
                     MDKVAIPSTLKTTYLLVPEQVKEAYLYQILTNATYNESSAIIFVNRTVTAEILRRTLK
                     QLDVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVQLVINYDISS
                     NPDTFIHRAGRTARAGRSGESICFVAPRDVSRIEAIEERINKKMEEFKDVHDTAVIRK
                     ALNKVTVAKRESLMSMEKENFGERRKLHLKKSGLSKSYRNN"
     gene            complement(<67991..>69601)
                     /locus_tag="KLTH0H00660g"
                     /db_xref="GeneID:8294220"
     mRNA            complement(<67991..>69601)
                     /locus_tag="KLTH0H00660g"
                     /product="KLTH0H00660p"
                     /transcript_id="XM_002555862.1"
                     /db_xref="GeneID:8294220"
     CDS             complement(67991..69601)
                     /locus_tag="KLTH0H00660g"
                     /note="similar to uniprot|P38860 Saccharomyces cerevisiae
                     YHR168W MTG2 Putative GTPase member of the Obg family
                     peripheral protein of the mitochondrial inner membrane
                     that associates with the large ribosomal subunit required
                     for mitochondrial translation possibly via a role in
                     ribosome assembly"
                     /codon_start=1
                     /product="KLTH0H00660p"
                     /protein_id="XP_002555908.1"
                     /db_xref="GeneID:8294220"
                     /db_xref="GOA:C5E1Y5"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y5"
                     /translation="MVLRRPIQRASLRVRFNSTAPDNAPKASDNEIWLRKLSNNRKLA
                     HAPEVSQKIQPASSSQDHRNRFEIISTPPDTSFIGVKAPLSEFTSLSHIQSNNQRHAQ
                     AKKFVDVRILKCRSGQGGDGAVSFFRDAGRAIGPPDGGDGGDGGSVFVQAIEGLNSLA
                     KLKTSYIAEDGANGAAKQLDGARGKDVLISVPVGTVVKWCLNPSAVRSFIEKFKNRGT
                     VNLRQLLEQNKVSLQCTGRFEMDQKPSFIQLFRESYEAGEGWHFKGKDEEYHLEKNWF
                     KQLKEKVSIYDLELASSELSADKFPLLGIDLDKPSDRPICLVKGGKGGLGNMHFLTNL
                     IRNPRFSKMGRSGLEQFFMFELKSLADIGLVGLPNAGKSTILNKISKARPKIGHWEFT
                     TTHPSIGTFNVGAEGFGFTVADIPGIIKDASKDKGMGLEFLRHIQRSKGWTIVVSLER
                     EDPLADLQLLISELGGMEEVARKNVLVVCNKADIEPHNPQSLDKFLDVQGFCETQNWD
                     IIPISALKGENIDLLIEKMARCAETSAT"
     gene            complement(<69803..>70579)
                     /locus_tag="KLTH0H00682g"
                     /db_xref="GeneID:8294221"
     mRNA            complement(<69803..>70579)
                     /locus_tag="KLTH0H00682g"
                     /product="KLTH0H00682p"
                     /transcript_id="XM_002555863.1"
                     /db_xref="GeneID:8294221"
     CDS             complement(69803..70579)
                     /locus_tag="KLTH0H00682g"
                     /note="some similarities with uniprot|O13539 Saccharomyces
                     cerevisiae YHR167W THP2 affects transcription elongation"
                     /codon_start=1
                     /product="KLTH0H00682p"
                     /protein_id="XP_002555909.1"
                     /db_xref="GeneID:8294221"
                     /db_xref="InterPro:IPR018557"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y6"
                     /translation="MSSKTVERLLDDLHKSLDVNYAHSSELIESLSVLSSDSTDDKMI
                     EAIRALQKTFHSFTTSLADLRDENINAMESHNTKRKVEPFANVAKSRLSATFDENGNA
                     STLLSYVDEVITGNNLNLEHINLIGRLSSVLTEMLPSELDDSTQNLELAQILEAYNTD
                     SKGSEDTDCLKEKLLDWIDSIKMEKARYSLENQHILRDSLKALTMEVTRWRENYESIE
                     GMMFGENANSISQMLHKVQRLRPQLNSGSGEGQEEDVKME"
     gene            <70712..>72577
                     /locus_tag="KLTH0H00704g"
                     /db_xref="GeneID:8294222"
     mRNA            <70712..>72577
                     /locus_tag="KLTH0H00704g"
                     /product="KLTH0H00704p"
                     /transcript_id="XM_002555864.1"
                     /db_xref="GeneID:8294222"
     CDS             70712..72577
                     /locus_tag="KLTH0H00704g"
                     /note="similar to uniprot|P16522 Saccharomyces cerevisiae
                     YHR166C CDC23 Subunit of the anaphase-promoting
                     complex/cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="KLTH0H00704p"
                     /protein_id="XP_002555910.1"
                     /db_xref="GeneID:8294222"
                     /db_xref="GOA:C5E1Y7"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR007192"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y7"
                     /translation="MLESSLMNFLSELKLELRESAVQLSRLKLYNSSKWSAEALCGMC
                     EIPSVPVMKTFMKNDDSPLRNRSNIQFEQQESPQKHLSGMESSEYDLYLLASTLFECK
                     EYDRCAYYLADSKHPELKFLKLYSKYLSWDKKTQENMESSLAPRSSKQNTGFRENAEI
                     ANREIMNRLHSHESGNSNALKKSQKSVDLDNGESTSIPMILKELNNYLLLEGEKPTFG
                     ISLLHYLRGVLYKIQDIPSNAISSFLSSLTLFPFNWVCWTELLSCISRTDESVLLLKI
                     LSEKFTDEKTQVMLKFFKLSIFQEFSGNIDDFIQELDYLLSIFPNFAFLKTQHALINY
                     HYMDYVSAGLIFEQIIKLDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAE
                     TCCIIANYYSAKQEHEKSILYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIECYRR
                     AVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVDN
                     LEESIKCYTRALQLSLDSDIDTTILFRLAVLYEKQKDIISCKEYMLRCVEAQHSTDGF
                     INDETTKASLWLARYEARYKNFSEAYKHALRVTHGSSQEIEEARAIVRECRKRMD"
     gene            <72819..>80063
                     /locus_tag="KLTH0H00726g"
                     /db_xref="GeneID:8294223"
     mRNA            <72819..>80063
                     /locus_tag="KLTH0H00726g"
                     /product="KLTH0H00726p"
                     /transcript_id="XM_002555865.1"
                     /db_xref="GeneID:8294223"
     CDS             72819..80063
                     /locus_tag="KLTH0H00726g"
                     /note="highly similar to uniprot|P33334 Saccharomyces
                     cerevisiae YHR165C PRP8 Component of the U4/U6-U5 snRNP
                     complex involved in the second catalytic step of splicing"
                     /codon_start=1
                     /product="KLTH0H00726p"
                     /protein_id="XP_002555911.1"
                     /db_xref="GeneID:8294223"
                     /db_xref="GOA:C5E1Y8"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="InterPro:IPR019580"
                     /db_xref="InterPro:IPR019581"
                     /db_xref="InterPro:IPR019582"
                     /db_xref="InterPro:IPR021983"
                     /db_xref="InterPro:IPR027652"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y8"
                     /translation="MSGLPPPPPPPGFNASVPPPPPPGFRKRTSVSRSEDDFNVKDLK
                     EQLLPPPPPPPMPSSISALPPPPPHHHHHKGPDTSKPALKKQKLLSHCLESPRLSVEE
                     LKERKREWISSQKKRFRQSSSKCARGKTQKRGVIHSHKVDMPPEHLRKIINDHKDMSS
                     KRFIHDKRAFLGALKYMPHAILKLLENMPQPWEQVKEVRVLYHNTGALTFVNEIPRVI
                     EPVFTAQWSAAWIAMRREKRDRRHFKRMRFPPFDDEEPPLSYHEHIQGIEPLDGITLQ
                     LDEVDDALIKDWIFDSKPLLDEKSCVNGSSYKTWSIDHRTMANLHRLSSPLLDSGLDS
                     NKNYLFEKKSFFTAKALNNAIPGGPKFEPLFSAEEENDINEFNSLDRVIFRVPIRTGY
                     RIAFPHLYNSRPRAVQLSWYHTPIACLAEETQDENAETFRFDPSFNLISASYGTSRPL
                     SLESEDFLLDANFRPLLSSEKVCLPDTKAAISLYHAPYPFNLRSGRTVRAQDVALVKK
                     WYLQKPETDVPVKVRVSYQKLLKNYVLNELKSSKLGKQSKKKLLRSLRNTKFFQQTSI
                     DWVEAGLQLCTQGFNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGHAFH
                     LMREILKAIKLLVDAHVQYRLGNVDAFQLADGVYYILNHLGQLTGIYRYKYKVMHQIR
                     ACKDLKHVVYNRFNRVIGKGPGCGFWQPAWRVWIFFMRGIIPLLERWLGNLLARQFEG
                     RSSEVIKTATKQRLDAYYDLELRAAVMNDILDMMPEGIRQNKSKTILQHLSEAWRCWK
                     ANIAWNVPGMPEPIKNIIERYIKAKADGWVSAAHYNRDRIKRGAHVEKTVVRKNLGRL
                     TRLWIKHEQERQQLIEKNGPEITPLVATTIFKTMVDWLEQNNFSPVPFPPLTYKNDTK
                     ILVLALENLKNAFASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVD
                     LSMKDQLQTISPVYSVDPLEKITDAYLDQYLWYEADKRQLFPNWIKPSDTEIPPLLVY
                     KWAQGINNLSEVWDVNNGQSTVLLQTKLEGLAEKIDLTLLNRLLRLVMDPNLADYITA
                     KNNVVLNFKDMSHVNKYGLIRGLQFSSFVYQFYGLMLDLLILGPQRASELAGPSQAPN
                     NFLQFKSLDVEKRNPIRLYCRYFDVVHILFHFEEQDSEALVLDFLSENPDPNFENAVG
                     YNNKKCWPKDARMRLMRPDVNLGRAVFWEISNRVPISLVNITWENSFASVYSKSNPNL
                     LFTMCGFEARILPNFRTEEMISFDEGVWDLVDERTKQRTAKTFLRVSDEHVEKFNDTI
                     RGILMASGSTTFTKITARWNTALISLFTYFREAVVSTESLLDVLVKCETKIQNRVKLG
                     LNSKMPTRFPPAVFYTPKELGGLGMLSASHILIPASDLSWSKQTDTGITHFRAGMTHE
                     DEKLIPTIFRYITTWENEFLDSQRVWADYVAKRQEALKQNRRLAFEELEGSWDRGIPR
                     ISTLFQKDRHTLAYDKGHRARSQFKDFSLERNNPFWWTDTHHDGKLWNLNAYRTDVIQ
                     ALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRF
                     TLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFD
                     VCQVLDGEMDMLQIESVEKEAIHPRKSYKMNSSAADVTLSSNHTWNVSSPSLLHNTND
                     NFNVSNSSKVWIDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLA
                     YNMYDAYGNWFDGLKTLLQNGMKTIMKANPSLYVLRERIRKGLQIYQSQTQEPFLNSS
                     NYAELFSDETKLFIDDTNVYRVAVHTTYEGNIATKPINGCIFTLNPKTGELFLKIIHT
                     SVWAGQKRLSQLAKWKTAEETSALIRSLPKEEQPKQVIVTRKAMLDPLEVHMLDFPNI
                     SIRPTELKLPFSASMAIEKLSDVVTKATEPQMVLFNIYDDWLERVSSYTAFSRLILLL
                     RALRTNEERAKMILKADPTIPIKEHHLWPSFSDDQWIEIESQMRDLILVEYGKKYNVN
                     IASLTQTEIKDLILGQNIKAPSVKRQQMAELEMSKTTQNSNGLDSSSGSAMKIKSTNA
                     QGEEIMVVTSTNFETQTFSTKNEWRKRAIANSLLYMRLKTIYLASDDFVEEKDVFILP
                     KNLLKRFVEISDTKAQVAGYIFGKKAAGHEKVKEIRTIVIVPQLGNTHTVQLSMLPEY
                     SPYLQDLELLGWTHTQSQELKYMSAPEVTTHSNIFKGEKDLVSLSVCLNPGSISLAAY
                     TVSEEGYSWGSSNKNLFDAEPQGFDPEFSEHAQLMLSDRVTGNFLVPSNDVWNYAFMS
                     AVFSPSAKYELKLDIPIEFYNELHRSIHFLQFSDMVENEELEPEKEDVFA"
     gene            complement(<81177..>81479)
                     /locus_tag="KLTH0H00748g"
                     /db_xref="GeneID:8294224"
     mRNA            complement(<81177..>81479)
                     /locus_tag="KLTH0H00748g"
                     /product="KLTH0H00748p"
                     /transcript_id="XM_002555866.1"
                     /db_xref="GeneID:8294224"
     CDS             complement(81177..81479)
                     /locus_tag="KLTH0H00748g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0H00748p"
                     /protein_id="XP_002555912.1"
                     /db_xref="GeneID:8294224"
                     /db_xref="UniProtKB/TrEMBL:C5E1Y9"
                     /translation="MPYSFNIFVGYGFPFNLRTLVAVSSQRSYRTFIPDDILQGMTRC
                     KALGGLSATPDPKSLEKKWVDRLEASRLNCAQVVPRRGVALELDIALQKVLQYLSA"
     gene            <81755..>86374
                     /locus_tag="KLTH0H00770g"
                     /db_xref="GeneID:8294225"
     mRNA            <81755..>86374
                     /locus_tag="KLTH0H00770g"
                     /product="KLTH0H00770p"
                     /transcript_id="XM_002555867.1"
                     /db_xref="GeneID:8294225"
     CDS             81755..86374
                     /locus_tag="KLTH0H00770g"
                     /note="similar to uniprot|P38859 Saccharomyces cerevisiae
                     YHR164C DNA2 Essential tripartite DNA replication factor
                     with single-stranded DNA-dependent ATPase ATP-dependent
                     nuclease and helicase activities required for Okazaki
                     fragment processing involved in DNA repair pathways
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0H00770p"
                     /protein_id="XP_002555913.1"
                     /db_xref="GeneID:8294225"
                     /db_xref="GOA:C5E1Z0"
                     /db_xref="InterPro:IPR014808"
                     /db_xref="InterPro:IPR026851"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z0"
                     /translation="MRSNETKKHGLSPLASPDRSKQEEHEHHPSRSSAVTRASRKKAV
                     QSKKKYKFAPVDTLTRGASSEPPVLQSLSLSQVRKSKVANAPRVDHDPNLVPKPPTTL
                     KAVSKPSKASTSAVGVPKVLEDAPPEEVIWQYSPFKNPRADFSDRDRGYKSTSEDSAI
                     EHVVKESSTPIVPNKFKRVLNFPHMHDGQEMLPDAAVMASKKSSLRTNSVPKSFSLQP
                     PSRASTRDIDEIINDIEDGFEIKPPFQGKDIPSSPTKMVSQRLRERQGGIQEDSLLTN
                     DSLFAHGGTKRVEVDDKLRCSSEDHCSKENKERTDNAESTGDENEEDDEDDESLIELL
                     TQKFVSNPSNERGPTNHENEGANSQQSNLLSSDGTQDDSLLEYFQSSETGQHKADPSC
                     APEKVNFESTIESVEARFSQNVVVQENLNESEKWQSYVEKALCATSREGMERWVVIES
                     KEFLVSNKGLQKVLKCLDHKGSVSNLVVRSPWSRLTFKEGDVVHTISGSNTTNRRLFS
                     DDRDPETGKINDNLLILNPDILISATTVGRAVECERRALLSNQISGPGEPSLPALVGN
                     IVHELVQMCLKYKLDHVHILQERMSSFLDGILDNYVADIIMCQSTKDALLQQITAEHI
                     PNIKQFLDAFVKRDKSRTFPSARSFANKQEMSISNIIDIEENIWSPMYGLKGFIDATV
                     ETTLPNDSTFVAPLELKTGKFKSISHEAQGTIYNLLLSDRYELPVNFFLLFYTKTNDF
                     TKHDTLLHSLKHLIVLRNHISEYLRHELSEVTENKWQGTTLPSILGSAACDNCYSKTE
                     CMVINNLCEDGSPKESGLKKGEYEALTGHLTSNRLNYKEFYMRYEDLIVKEESSLKGI
                     NNEIFLIDSKTRESLSGKCVSNLVIVASEDDSESKLIRYTFCRKEGAAESLPSLINSQ
                     LSKNDMVIISDEAGHFALCTGRVVSISTMEITISTSRRLQSNNVRAPGFEKGRKQVLE
                     TVLMPSKSAKLGQKSITYRIDRNEVQQGLALARFNLLNLFLPSVPEGAVTTDPSTGQE
                     IAFKRSWGGDQKTREIVVDGRTPRFVAPSEPPRVPYDEGLKSRFNEDQWKAFEKVMRL
                     DDYALILGMPGTGKTTLIVEIVKSLVARGKTILLTSYTHSAIDNILIKLKNCDIDICR
                     LGHKHRVHQEAWEFVPDFTEASTFEKFKEQVEKPSVVATTCLNIHDTLLSLRSKDFDY
                     VILDEASQLSLPICVGPLKFAERFVLVGDHYQLPPLVKNDAARVGGLDLSLFKMLCEK
                     HPDSVVELTHQYRMCEDIMTLSNYLIYDGKLKCVSEEVRDQKLEIPHMAELDTMHVPG
                     KHGQWLDIVLNSEKRVVFLDHDKCPAFQEIAEKDNIKNPGEAELVWQCVAAMVRCGVS
                     RRDIGVMTLYRAQLRILRKMFEAEEHNELEILTADQFQGRDKRCVIISMVRSNDGLNG
                     GSLLRELRRVNVAMTRAKCKLIIIGSKATISSVESLRGFMSLLESRGWLHSLPPDCLE
                     SYNIPRPAPSQHSRRKKQGSVVANITAESKFTQDKSVLRDTLNGM"
     gene            <88079..>90586
                     /locus_tag="KLTH0H00792g"
                     /db_xref="GeneID:8294226"
     mRNA            <88079..>90586
                     /locus_tag="KLTH0H00792g"
                     /product="KLTH0H00792p"
                     /transcript_id="XM_002555868.1"
                     /db_xref="GeneID:8294226"
     CDS             88079..90586
                     /locus_tag="KLTH0H00792g"
                     /note="some similarities with uniprot|P53316 Saccharomyces
                     cerevisiae YGR250C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H00792p"
                     /protein_id="XP_002555914.1"
                     /db_xref="GeneID:8294226"
                     /db_xref="GOA:C5E1Z1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z1"
                     /translation="MTVAEQTEQVASALADVAITDQGPQEAVGSPTAVGTEQEPAGEQ
                     EARGREQTRTHAQEQTPGTGQGSAAESSGTSEEDGARSLERDQSQEEFPSKSNSPNSS
                     ALQLDQLANTNLLTVRIKWVDNQLLDYKTTQLVNKLSELSHARKGFVVNPSVIENYEY
                     LSDSSRLAVLGENQDVYMHESGTKEFADFHSDESSAGGSWLYDYVLQAQFKHWADLEV
                     VRDSVVAALGESTIVSKWSVSDNAHALTHPGNLYVRGIPKDLTIDDLVPVFAKFGPVL
                     SMKIICDSNTGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSPLFINYHVERKERERI
                     HWDHIKEDNDDERFKGVFIGNLPIEDVQGKLITPEDVIAEFQKRLGDGGETSQIVSYY
                     LPKRNSQSDIEYKDDDDKTDDIETCVSKHEESPLKGYGFIKFASHTQALGAIEKFNDM
                     EWLGNKLIVNKAVQSKPQSHYHHHHHHHHHQNHNEYRGRRHSERSPSSRQKSMTNISF
                     YAPFSGSQAGFGFYGNPPNARYPAPSDLGPHDIAADSSPNSSPSPHQGYIPPPQLSHR
                     YGAPPSLSSTPESSTAPSSRNDSFFQMHSQGGMMPPSPFMLPIPTKDQQESNLYVKHL
                     PLSWRDEDFFQFYENFGEIISAKIITVGGSKNDGSSDNTFAKQSEPALGSSKGYGFVC
                     FKNPLDASRAMLITDRYQVDENHTLYVSFAQKRAKSISNGDTVMVSTNNSRPSSRKNY
                     YYNNARQDFLGKYNPKFLNAMFNQQNGGRSYPRPRGSWPAPMPMPVAPPHMVPMMPPV
                     VLPSPISPEAIVPGGDIEQDSIAEAPVQIKQGSTTKS"
     gene            complement(<90962..>92134)
                     /locus_tag="KLTH0H00814g"
                     /db_xref="GeneID:8294227"
     mRNA            complement(<90962..>92134)
                     /locus_tag="KLTH0H00814g"
                     /product="KLTH0H00814p"
                     /transcript_id="XM_002555869.1"
                     /db_xref="GeneID:8294227"
     CDS             complement(90962..92134)
                     /locus_tag="KLTH0H00814g"
                     /note="some similarities with uniprot|P53050 Saccharomyces
                     cerevisiae YGR249W MGA1 Protein similar to heat shock
                     transcription factor; multicopy suppressor of pseudohyphal
                     growth defects of ammonium permease mutants"
                     /codon_start=1
                     /product="KLTH0H00814p"
                     /protein_id="XP_002555915.1"
                     /db_xref="GeneID:8294227"
                     /db_xref="GOA:C5E1Z2"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z2"
                     /translation="MQNKTFIHQLHAILQQPELERWIRWEPDEQLRGVFSLRPHDAAF
                     STNVLKRYFKHGNVSSFVRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGG
                     GTSSADGSAGAAATTAGTKSGKSAVVWQFSHPSGAFCRDSTMSELGRIQRKSGGVGKN
                     GKRKNVLSAVCVNYVDTTAAASIVSRPSSAMSGSDEAPQMTPLPSLRPLTTPAPPESA
                     RSPSSPDLLSQKGSSGSSNSVPQLSALYPGSTPVPAGPQNLTLQHLQHNINLIQRGMV
                     TILDVLQQFPPQSSTEAETISATLQALRNDIISADTKWTHLRYPIVSAHSSFSSVGSS
                     FSNAPPGSGSRFPSLSTQKSSVFSNTRFSNASIPRSSSSGQSTTDNWGLAPPHKKK"
     gene            complement(<92994..>94133)
                     /locus_tag="KLTH0H00836g"
                     /db_xref="GeneID:8294228"
     mRNA            complement(<92994..>94133)
                     /locus_tag="KLTH0H00836g"
                     /product="KLTH0H00836p"
                     /transcript_id="XM_002555870.1"
                     /db_xref="GeneID:8294228"
     CDS             complement(92994..94133)
                     /locus_tag="KLTH0H00836g"
                     /note="similar to uniprot|P38858 Saccharomyces cerevisiae
                     YHR163W SOL3 Glucose-6-phosphate dehydrogenase weak
                     multicopy suppressor of los1-1 mutation homologous to
                     Sol2p and Sol1p"
                     /codon_start=1
                     /product="KLTH0H00836p"
                     /protein_id="XP_002555916.1"
                     /db_xref="GeneID:8294228"
                     /db_xref="GOA:C5E1Z3"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z3"
                     /translation="MCACAWERKKRRGAGAGAGRASLRTGRDITLDGMPCTHVTCAMP
                     NGCAPARDVYHTVRGVSLHTDSQDPQRHLARALPSPPTNATRAIYRRPALPYIKTRRP
                     RAAGLHAPTALHAHFLPPPVPMVPVYTYDDSAALSRDLALYILAQQDAALQRGDRFNL
                     AVSGGSLLKALRAGLVEDAELRARANWARWHVFFCDERIVPLEHADSNYGAFKAQVLD
                     PLLQHDGVLGPTCYAINESLVGLGENDRLAAEYESLLPAQFDLILLGCGPDGHTCSLF
                     PGDTHSYLLDANTDRRVAWCHSSPKPPADRITFTLPTLASAHALCFVAEGAAKQPVLQ
                     RILQSSPDTSLPAALVTDRFAQRVSWFVDSAAVQDLSVPAVTYNH"
     gene            <94956..>95480
                     /locus_tag="KLTH0H00858g"
                     /db_xref="GeneID:8294229"
     mRNA            join(<94956..95027,95139..>95480)
                     /locus_tag="KLTH0H00858g"
                     /product="KLTH0H00858p"
                     /transcript_id="XM_002555871.1"
                     /db_xref="GeneID:8294229"
     CDS             join(94956..95027,95139..95480)
                     /locus_tag="KLTH0H00858g"
                     /note="similar to uniprot|P53311 Saccharomyces cerevisiae
                     YGR243W FMP43"
                     /codon_start=1
                     /product="KLTH0H00858p"
                     /protein_id="XP_002555917.1"
                     /db_xref="GeneID:8294229"
                     /db_xref="GOA:C5E1Z4"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z4"
                     /translation="MSAAGAAFRRFLNSETGPKTVHFWAPTLKWALVFAGISDVSRPV
                     DKLSGVQNLSLLATGVIWTRWSFVIKPKNMLLASVNFFLACTAGYQLTRICNYRRAQG
                     DTPGQVANYVINGPPPTHLPSERQHALTRQPSPAT"
     gene            complement(<95812..>97068)
                     /locus_tag="KLTH0H00880g"
                     /db_xref="GeneID:8294230"
     mRNA            complement(<95812..>97068)
                     /locus_tag="KLTH0H00880g"
                     /product="KLTH0H00880p"
                     /transcript_id="XM_002555872.1"
                     /db_xref="GeneID:8294230"
     CDS             complement(95812..97068)
                     /locus_tag="KLTH0H00880g"
                     /note="highly similar to uniprot|P53312 Saccharomyces
                     cerevisiae YGR244C LSC2 Beta subunit of succinyl-CoA
                     ligase which is a mitochondrial enzyme of the TCA cycle
                     that catalyzes the nucleotide-dependent conversion of
                     succinyl-CoA to succinate"
                     /codon_start=1
                     /product="KLTH0H00880p"
                     /protein_id="XP_002555918.1"
                     /db_xref="GeneID:8294230"
                     /db_xref="GOA:C5E1Z5"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z5"
                     /translation="MLSRTIAANQLKNSLRASKQIRNLSIHEYRSAELLRQYGVGTPA
                     GEAAFEPQQAYDIAKKLGHDALVVKAQALTGGRGKGHFDTGLKSGVHMIESAEQARDL
                     AKQMLKHRLITKQSGAKGKPVSAVYVVERVNAKHEAYLSILMDRQSKKAMIICSSEGG
                     MNIEEVAAKNPDAIKKFTVTESEGLTAETAKQISKSLGFSAEAEADAADAVTKLYKIF
                     KEKDASQIEINPLSEVEGQDTKVMCMDAKFGFDDNASFRQEEVYSWRDLSQEDADEVV
                     AKKSDLNFVKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIETAF
                     KLILSNEKVDGIFVNIFGGIVRCDFVAQGLVSATKNLAVSVPIVARLQGTNLEEGRRI
                     IEESGLKIYSFDELDPAAQKVVELTR"
     gene            complement(<97752..>99944)
                     /locus_tag="KLTH0H00902g"
                     /db_xref="GeneID:8294231"
     mRNA            complement(<97752..>99944)
                     /locus_tag="KLTH0H00902g"
                     /product="KLTH0H00902p"
                     /transcript_id="XM_002555873.1"
                     /db_xref="GeneID:8294231"
     CDS             complement(97752..99944)
                     /locus_tag="KLTH0H00902g"
                     /note="similar to uniprot|P53313 Saccharomyces cerevisiae
                     YGR245C SDA1 Severe Depolymerization of Actin"
                     /codon_start=1
                     /product="KLTH0H00902p"
                     /protein_id="XP_002555919.1"
                     /db_xref="GeneID:8294231"
                     /db_xref="GOA:C5E1Z6"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z6"
                     /translation="MVRKSRAAILPTNVILLQNLVKRDPQSYREEFLQQYSHYESLRD
                     IFMLNAMENQVADDSNTSQFVELVGFVSQVCSCFPEETANFPNELRQLVLEYHKSLPF
                     EVREKIITSLTMLRNKGVISAETLIQTMFPLLIAYSSHSNALGPNSHAKEVRKLVYST
                     LISLLKNCNTGSKNQKLNKSTQAICFNLLEQPDSQGVWASRLTRELWRRGIWDDSRAV
                     EIMTQAALHDDVKIAYSGVLFFLGADREREENFEDNSDDEDIDVDALKHKMQINKKSG
                     KRGKKLEAAVKSVKKKKAGAKTPQGFLNFSAIHLLRDPQGFADKLFTKQLSSKNNNRF
                     DIDQKIALMQLLSRLIGTHKLMVLGIYSFFLKYLTPKQRDVTKIMASAAQACHDLVPP
                     ETISVMVRKIADEFVSDGVASEVAAAGLNTIREICSRAPLAIDETLLQDLTEYKGSKA
                     KGVSIAAKSLVSLYREVAPEMLRRKDRGKVASMEMQDASRKGKESRRPKFGEESHVQG
                     IAGIELLAQWKKDNEKVDDEEGDDKNWEVAEDSDSDADDDDGEWVTMESDKEYDVDMG
                     DSDDEDAKAAKKAEAAEEDEPAAPAEKIDAETAFRDLASTRVLTPADFAKLQELRTEQ
                     GVARLMGVRNEETVDSDRLVGPVKHKNTKEERLQSVLEGREGREKFGSRKKSRGTEHS
                     TTNREKQRKKNFVMMIHKRSVKGKQKMSLRDRQKVLRQHITKQKKRGF"
     gene            complement(<100199..>101914)
                     /locus_tag="KLTH0H00924g"
                     /db_xref="GeneID:8294232"
     mRNA            complement(<100199..>101914)
                     /locus_tag="KLTH0H00924g"
                     /product="KLTH0H00924p"
                     /transcript_id="XM_002555874.1"
                     /db_xref="GeneID:8294232"
     CDS             complement(100199..101914)
                     /locus_tag="KLTH0H00924g"
                     /note="similar to uniprot|P29056 Saccharomyces cerevisiae
                     YGR246C BRF1 TFIIIB B-related factor one of three subunits
                     of RNA polymerase III transcription initiation factor
                     TFIIIB binds TFIIIC and TBP and recruits RNA pol III to
                     promoters amino-terminal half is homologous to TFIIB"
                     /codon_start=1
                     /product="KLTH0H00924p"
                     /protein_id="XP_002555920.1"
                     /db_xref="GeneID:8294232"
                     /db_xref="GOA:C5E1Z7"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z7"
                     /translation="MAKCKVCGGVDFERDISNANNDLVCKDCGTVSEDNPIVSEVTFG
                     ESSSGAAVVHGSYVGAGQSHAAFGPRGGSSALESRQATINNARRKLRAVSHALGIPEY
                     VTDAATQWYTLALSNNFVQGRRSQNVIAACLYIACRKEKTHHMLIDFSSRLQVSVYSI
                     GATFLKMVKALHITKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQRMARDWMY
                     EGRRPAGIAGACLLLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKSTKSGKLSIN
                     EFRDDAAVESEAQPPSFQRNRAKEKRLRQKIVENEFETSDEALTRNPILSQVLGAQEL
                     SSREVLYYLKQFSQRREKNTQRENISSSTNGLRTHGEATGHSEDAAVSSDSEAGTEHR
                     PDADVDPNSRSHFQDAIDGYSVETDPHRPRNLHLLPTTSALLSKVADDPEDLQDVDDE
                     ELDSQLLDEEASKLKERIWIGINGDFLLEQESKRLKQEADMASGNASVKKRGGPRRKR
                     KAASDADGVLADIKDDSGLHAALKLAEDTGDFTTADNVKNMIQKSSFSKKINYNAIDG
                     LFGSS"
     gene            <102427..>103074
                     /locus_tag="KLTH0H00946g"
                     /db_xref="GeneID:8294233"
     mRNA            <102427..>103074
                     /locus_tag="KLTH0H00946g"
                     /product="KLTH0H00946p"
                     /transcript_id="XM_002555875.1"
                     /db_xref="GeneID:8294233"
     CDS             102427..103074
                     /locus_tag="KLTH0H00946g"
                     /note="similar to uniprot|P53314 Saccharomyces cerevisiae
                     YGR247W CPD1 Cyclic nucleotide phosphodiesterase
                     hydrolyzes ADP-ribose 1'' 2''-cyclic phosphate to ADP-
                     ribose 1''-phosphate no detectable phenotype is conferred
                     by null mutation or by overexpression"
                     /codon_start=1
                     /product="KLTH0H00946p"
                     /protein_id="XP_002555921.1"
                     /db_xref="GeneID:8294233"
                     /db_xref="GOA:C5E1Z8"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR012386"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z8"
                     /translation="MGIALWFVPHSNSPVYDTIQSLILSLQTLFPDAPVFEPHLTVTS
                     QLKCENLTGVNQILTSCVAAVGAIRESVRGKDGAIVSFSGVSVGKGYFTKVRLTCIEN
                     RYLMGIAQVIRELFVAEKPEEAAEWLTEEFRPHVSLVYSDMYHVNQALERVIAQRIED
                     ALDLQLHKVRVAGDHNQCTWHFDSPMTGWGVPGVFKVVRCEGPVDEWEVLGSVEV"
     gene            <103482..>105353
                     /locus_tag="KLTH0H00968g"
                     /db_xref="GeneID:8294234"
     mRNA            <103482..>105353
                     /locus_tag="KLTH0H00968g"
                     /product="KLTH0H00968p"
                     /transcript_id="XM_002555876.1"
                     /db_xref="GeneID:8294234"
     CDS             103482..105353
                     /locus_tag="KLTH0H00968g"
                     /note="similar to uniprot|P26370 Saccharomyces cerevisiae
                     YDL170W UGA3 Transcriptional activator necessary for
                     gamma-aminobutyrate (GABA)-dependent induction of GABA
                     genes (such as UGA1 UGA2 UGA4) zinc- finger transcription
                     factor of the Zn(2)-Cys(6) binuclear cluster domain type
                     localized to the nucleus"
                     /codon_start=1
                     /product="KLTH0H00968p"
                     /protein_id="XP_002555922.1"
                     /db_xref="GeneID:8294234"
                     /db_xref="GOA:C5E1Z9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5E1Z9"
                     /translation="MAEAPQPRNNAISVTACAKRTHRKTGCVPCKIRKKRCSEHKPVC
                     TDCQRLGFYCVYLPEKCPKEKVQYYREKVEKQLLEKKTTLDRRKASGVVQAEAQSSSI
                     NEVVPEESGGTSVSNDEKEGQHVVSNDGLDESQRLLDVTNVAELLGADGGSDSLIPGL
                     LSLSGSPLSPRTLASTPAPSLSDPVLAELDDTALHLYQYYRDRLALIVSIAPSQQNHY
                     RKIFLPMAHQNEGVMYGLLAWAARHLSLTVDENDTALDGSAAPSSLVAGPLTDPRYTE
                     LANKYTLFSLQRLSYRNSGFLMSLAQILVLCGAEICQGDVTRWQTLLQCATSMIKEHA
                     PDGDIGALLAKSELASSLADTQTTRWLLSNFVYHDIMGSDQTHFPMSQYARVLQNPMN
                     PLESPVDPLHGVNRPVFQILGQVKNLARQVKQELRQELQRSGDLDEKDETRDPRDSAS
                     PTAAPAPSRETMAIAQELQGALYRISPSESDLAWYDNFAEIGSDIRPLAETLFSVFRT
                     AALILLKTAVLRQTTDSYEIRFLVSQLSDELDCVLGSQLEGGLCFPLFICGINAHDRA
                     QRISVEIKFADFIKRYKFRNVERALVVMRQLWESADNGVTQDWFDIVDSVGWDLNFA"
     gene            complement(<105471..>105998)
                     /locus_tag="KLTH0H00990g"
                     /db_xref="GeneID:8294235"
     mRNA            complement(<105471..>105998)
                     /locus_tag="KLTH0H00990g"
                     /product="KLTH0H00990p"
                     /transcript_id="XM_002555877.1"
                     /db_xref="GeneID:8294235"
     CDS             complement(105471..105998)
                     /locus_tag="KLTH0H00990g"
                     /note="similar to uniprot|Q05776 Saccharomyces cerevisiae
                     YLR193C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H00990p"
                     /protein_id="XP_002555923.1"
                     /db_xref="GeneID:8294235"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:C5E200"
                     /translation="MVLWYQNSHTFNNDFRTVSLAFFNRYPNPYASHVLSIDTLSREL
                     SPAGDLCTTRLIKKTGKLPQWVKPFLGRISESWIIEMSEVDVRNQVLRTYTRNLDHTR
                     IIQVEEFTTYNFDKKSGKTQASSTVKFSSGFNVGIRSRIEQWSHSKFDENVKRSRMGM
                     AFVMERLEQHRQAWS"
     gene            complement(<106313..>106945)
                     /locus_tag="KLTH0H01012g"
                     /db_xref="GeneID:8294236"
     mRNA            complement(<106313..>106945)
                     /locus_tag="KLTH0H01012g"
                     /product="KLTH0H01012p"
                     /transcript_id="XM_002555878.1"
                     /db_xref="GeneID:8294236"
     CDS             complement(106313..106945)
                     /locus_tag="KLTH0H01012g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0H01012p"
                     /protein_id="XP_002555924.1"
                     /db_xref="GeneID:8294236"
                     /db_xref="UniProtKB/TrEMBL:C5E201"
                     /translation="MQLLKFLAIIASAGAAFGSSGALGGMGSNQDSESKESSKSLVQT
                     ANVVSTPQEQTSKTAAASQTLQSTTAGSVESQFASEITSPSATASISNNGGPVTVLTS
                     GSVTSTVWWTPSVTKWWTPASELTASSDSSSPSSDASSDTVSTSRIVETITSGSHVTT
                     ITTDVLTSVKKSSTKSSSTASISNSTNAAAPLSIDVLLSIGALALGAIAA"
     gene            complement(<107338..>108687)
                     /locus_tag="KLTH0H01034g"
                     /db_xref="GeneID:8294237"
     mRNA            complement(<107338..>108687)
                     /locus_tag="KLTH0H01034g"
                     /product="KLTH0H01034p"
                     /transcript_id="XM_002555879.1"
                     /db_xref="GeneID:8294237"
     CDS             complement(107338..108687)
                     /locus_tag="KLTH0H01034g"
                     /note="similar to uniprot|P14743 Saccharomyces cerevisiae
                     YLR195C NMT1 N-myristoyl transferase catalyzes the
                     cotranslational covalent attachment of myristic acid to
                     the N-terminal glycine residue of several proteins
                     involved in cellular growth and signal transduction"
                     /codon_start=1
                     /product="KLTH0H01034p"
                     /protein_id="XP_002555925.1"
                     /db_xref="GeneID:8294237"
                     /db_xref="GOA:C5E202"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="UniProtKB/TrEMBL:C5E202"
                     /translation="MAQDPDQAKKLQELLKMLSLSQNDASKLTQPQRKQFEEYKFWKT
                     QPVPRFDDEVEDEGPINSSQRPENIPNEPLPLLSEFEWCTVDITDPHQLEDVFVLLNE
                     NYVEDQDATFRFNYSREFFNWSLKPPGWRKDWHVGVRTRQSKRLVAFISAVPATLRVR
                     TKLVKSVEINFLCIHKKLRSKRLTPILIKEVTRRVNKQDIWQALYTAGVVLPSPAATC
                     RYAHRPLNWSKLYEVGFTGLPANASKTQMIAKYTLPKEIDTPGLRPLEEKDLDEVYDL
                     LEKYQSRFDLVQVFTKEEFRHLLLSSTSVVYSYVVESNNKITDFVSFYSLPFTVLNNP
                     HYKELGIGYLFYYASDADFDYSDRYDSEGSLKLKKRLNRLISDVCIKARDLKMDVFNA
                     MSCQDNSLFLDDLKFGPGDGFLNFYLFNYRVRPILGGLRKDNSFDAEKRSNVGVVML"
     repeat_region   complement(108814..110229)
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
     repeat_region   complement(110755..111173)
                     /rpt_type=long_terminal_repeat
     gene            <113798..>115537
                     /locus_tag="KLTH0H01122g"
                     /db_xref="GeneID:8294239"
     mRNA            <113798..>115537
                     /locus_tag="KLTH0H01122g"
                     /product="KLTH0H01122p"
                     /transcript_id="XM_002555880.1"
                     /db_xref="GeneID:8294239"
     CDS             113798..115537
                     /locus_tag="KLTH0H01122g"
                     /note="similar to uniprot|P21304 Saccharomyces cerevisiae
                     YLR196W PWP1"
                     /codon_start=1
                     /product="KLTH0H01122p"
                     /protein_id="XP_002555926.1"
                     /db_xref="GeneID:8294239"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5E203"
                     /translation="MISSTTWVPRGFPSEFPEKYELDDEEMERINQLAQLNLDDAKDG
                     IESEHDDSELGGEEKNSNEASVRGSAKLASQADNDDNLEEYDMEHYGVKEDEMLGEGA
                     EASMFPGLSDEVKFHEGEDGEDAILSLPTQQDSQEEKQELQVYPTDNMVLATRTEDDV
                     SYLDVYVYDDGAGFHDAEVNQEPGDDKDPDVARGLVRDSSLYVHHDLMLPAFPLCVEW
                     VNYKPGSSSDDAANFAAVGSFDPQIEIWNLDCVEKAFPDMILGDPHATSNVGGSKSKK
                     NKKNKKNKNKHVLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEGIAARSVAS
                     IHSNKNVSSSQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQ
                     FADENTFMCGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNPFIPNLLATGAM
                     GEKTVKFWKISESGPSMVLSRDFGVGNVLTTSFAPDIEVAGNIVIGGVDKGLKLWDVF
                     TNRSIRKNLSKELSSLQRQARAEASKIGRASRIARKYTKNDNPDTVVTVDDQGEDEEE
                     GDGQRESGWEDTE"
     gene            complement(<115683..>116168)
                     /locus_tag="KLTH0H01144g"
                     /db_xref="GeneID:8294240"
     mRNA            complement(<115683..>116168)
                     /locus_tag="KLTH0H01144g"
                     /product="KLTH0H01144p"
                     /transcript_id="XM_002555881.1"
                     /db_xref="GeneID:8294240"
     CDS             complement(115683..116168)
                     /locus_tag="KLTH0H01144g"
                     /note="weakly similar to uniprot|P32772 Saccharomyces
                     cerevisiae YDL169C UGX2 Protein of unknown function"
                     /codon_start=1
                     /product="KLTH0H01144p"
                     /protein_id="XP_002555927.1"
                     /db_xref="GeneID:8294240"
                     /db_xref="UniProtKB/TrEMBL:C5E204"
                     /translation="MLLSSVMVNSEIPIVYATPFVVSSPNTVQFVIATSQSQGFAWNQ
                     DIFASQYQQMCKVAFDGHEDHADTVLKRVRSLVQGDGAASFNDSVFDEEDQDMDGKDQ
                     YLSRRVSQELTRPRRRSERTISFTSDSKNGSYQRTESVIIDVGADTEENRYYRSLLSN
                     S"
     gene            <116579..>118102
                     /locus_tag="KLTH0H01166g"
                     /db_xref="GeneID:8294241"
     mRNA            <116579..>118102
                     /locus_tag="KLTH0H01166g"
                     /product="KLTH0H01166p"
                     /transcript_id="XM_002555882.1"
                     /db_xref="GeneID:8294241"
     CDS             116579..118102
                     /locus_tag="KLTH0H01166g"
                     /note="highly similar to uniprot|Q12460 Saccharomyces
                     cerevisiae YLR197W SIK1 Component of the small (ribosomal)
                     subunit (SSU) processosome that contains U3 snoRNA"
                     /codon_start=1
                     /product="KLTH0H01166p"
                     /protein_id="XP_002555928.1"
                     /db_xref="GeneID:8294241"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:C5E205"
                     /translation="MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSF
                     TKLVELVSFAPFKGAAQALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDK
                     NLGPSIKEVFPYIDCMSNELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRA
                     KVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKL
                     VLFIKDKASLTEDSLHDLTAILDDDAGIAERVIDNARISMGQDLSETDMENVCVFAER
                     VTSLADYRRQLYDYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYHSGFIGKASAKNKGRISRYLANKCSIASRIDNYS
                     DEPSNVFGTVLKKQVEQRLEFYSTGAPTLKNELAIQEAIELYNKDKPEEPVKESKKRK
                     LEANEDEDSEEDQKPAKKDKKDKKDKKDKKEKKEKKDKKDKKEKKEKKEKKEKKKKD"
     gene            complement(<118222..>119093)
                     /locus_tag="KLTH0H01188g"
                     /db_xref="GeneID:8294242"
     mRNA            complement(join(<118222..119019,119088..>119093))
                     /locus_tag="KLTH0H01188g"
                     /product="KLTH0H01188p"
                     /transcript_id="XM_002555883.1"
                     /db_xref="GeneID:8294242"
     CDS             complement(join(118222..119019,119088..119093))
                     /locus_tag="KLTH0H01188g"
                     /note="similar to uniprot|Q05778 Saccharomyces cerevisiae
                     YLR199C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H01188p"
                     /protein_id="XP_002555929.1"
                     /db_xref="GeneID:8294242"
                     /db_xref="InterPro:IPR018855"
                     /db_xref="UniProtKB/TrEMBL:C5E206"
                     /translation="MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPID
                     TAGFKRAFIVTNIFRSLFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRST
                     DETKRLEFPVHKLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDR
                     VERVKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYE
                     KLSMETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL"
     gene            <119243..>119584
                     /locus_tag="KLTH0H01210g"
                     /db_xref="GeneID:8294243"
     mRNA            <119243..>119584
                     /locus_tag="KLTH0H01210g"
                     /product="KLTH0H01210p"
                     /transcript_id="XM_002555884.1"
                     /db_xref="GeneID:8294243"
     CDS             119243..119584
                     /locus_tag="KLTH0H01210g"
                     /note="similar to uniprot|P52553 Saccharomyces cerevisiae
                     YLR200W YKE2 Yeast nuclear gene"
                     /codon_start=1
                     /product="KLTH0H01210p"
                     /protein_id="XP_002555930.1"
                     /db_xref="GeneID:8294243"
                     /db_xref="GOA:C5E207"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:C5E207"
                     /translation="MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFD
                     GLREETQVYKLTGNVLLPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRA
                     ELLQTQQARQQ"
     gene            complement(<119673..>120446)
                     /locus_tag="KLTH0H01232g"
                     /db_xref="GeneID:8294244"
     mRNA            complement(<119673..>120446)
                     /locus_tag="KLTH0H01232g"
                     /product="KLTH0H01232p"
                     /transcript_id="XM_002555885.1"
                     /db_xref="GeneID:8294244"
     CDS             complement(119673..120446)
                     /locus_tag="KLTH0H01232g"
                     /note="similar to uniprot|Q05779 Saccharomyces cerevisiae
                     YLR201C FMP53"
                     /codon_start=1
                     /product="KLTH0H01232p"
                     /protein_id="XP_002555931.1"
                     /db_xref="GeneID:8294244"
                     /db_xref="GOA:C5E208"
                     /db_xref="InterPro:IPR012762"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="UniProtKB/TrEMBL:C5E208"
                     /translation="MLALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHA
                     LNKHVPSYGFNERALVASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTK
                     RYALTKELDPARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTA
                     LPELHRLSDDMVYFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFA
                     AEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLAKSQLTRS"
     gene            <121076..>122221
                     /locus_tag="KLTH0H01254g"
                     /db_xref="GeneID:8294245"
     mRNA            <121076..>122221
                     /locus_tag="KLTH0H01254g"
                     /product="KLTH0H01254p"
                     /transcript_id="XM_002555886.1"
                     /db_xref="GeneID:8294245"
     CDS             121076..122221
                     /locus_tag="KLTH0H01254g"
                     /note="highly similar to uniprot|P32771 Saccharomyces
                     cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
                     (glutathione-dependent formaldehyde dehydrogenase)"
                     /codon_start=1
                     /product="KLTH0H01254p"
                     /protein_id="XP_002555932.1"
                     /db_xref="GeneID:8294245"
                     /db_xref="GOA:C5E209"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014183"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E209"
                     /translation="MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTA
                     VCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECK
                     FCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVV
                     AIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGA
                     SKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGN
                     TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMG
                     GLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLSK"
     gene            complement(<122337..>124010)
                     /locus_tag="KLTH0H01276g"
                     /db_xref="GeneID:8294246"
     mRNA            complement(<122337..>124010)
                     /locus_tag="KLTH0H01276g"
                     /product="KLTH0H01276p"
                     /transcript_id="XM_002555887.1"
                     /db_xref="GeneID:8294246"
     CDS             complement(122337..124010)
                     /locus_tag="KLTH0H01276g"
                     /note="some similarities with uniprot|P32770 Saccharomyces
                     cerevisiae YDL167C NRP1"
                     /codon_start=1
                     /product="KLTH0H01276p"
                     /protein_id="XP_002555933.1"
                     /db_xref="GeneID:8294246"
                     /db_xref="GOA:C5E210"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E210"
                     /translation="MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK
                     HVELGNGCTLQDAVAQLEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPH
                     LQHPKVFDLWKEYDRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDA
                     NQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHK
                     KCVTADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARP
                     VGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSIL
                     SNIANTKQPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNF
                     QRRTSCFRCSFPAASGAGMNNNGYMKNPLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQ
                     SGPHMGQPQQQQQQQQRMRYNQGQRFGQGQQHQGGSNVPFRAGDWKCATCTYHNFAKN
                     VVCLRCGGPKSTEHQQKELGTVNSYTDIQDIGNGMGISLNTRSFSEPAW"
     gene            complement(<124206..>124850)
                     /locus_tag="KLTH0H01298g"
                     /db_xref="GeneID:8294247"
     mRNA            complement(<124206..>124850)
                     /locus_tag="KLTH0H01298g"
                     /product="KLTH0H01298p"
                     /transcript_id="XM_002555888.1"
                     /db_xref="GeneID:8294247"
     CDS             complement(124206..124850)
                     /locus_tag="KLTH0H01298g"
                     /note="similar to uniprot|Q12055 Saccharomyces cerevisiae
                     YDL166C FAP7 Essential nuclear protein involved in the
                     oxidative stress response"
                     /codon_start=1
                     /product="KLTH0H01298p"
                     /protein_id="XP_002555934.1"
                     /db_xref="GeneID:8294247"
                     /db_xref="GOA:C5E211"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E211"
                     /translation="MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQ
                     QHECYDGYDEARKSHIVDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRT
                     DNTVLYDRLKSRGYHEAKIQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDEN
                     VDRIASWSAAWLEQNPKGVTNELVERGSDEEDGTDEEGGSYGNSASSGEDGEDA"
     gene            <125017..>125589
                     /locus_tag="KLTH0H01320g"
                     /db_xref="GeneID:8294248"
     mRNA            <125017..>125589
                     /locus_tag="KLTH0H01320g"
                     /product="KLTH0H01320p"
                     /transcript_id="XM_002555889.1"
                     /db_xref="GeneID:8294248"
     CDS             125017..125589
                     /locus_tag="KLTH0H01320g"
                     /note="highly similar to uniprot|P06100 Saccharomyces
                     cerevisiae YDL165W CDC36 Component of the CCR4-NOT complex
                     which has multiple roles in regulating mRNA levels
                     including regulation of transcription and destabilizing
                     mRNAs by deadenylation basal transcription factor"
                     /codon_start=1
                     /product="KLTH0H01320p"
                     /protein_id="XP_002555935.1"
                     /db_xref="GeneID:8294248"
                     /db_xref="GOA:C5E212"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:C5E212"
                     /translation="MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNN
                     QPSRNRVLDTFQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAK
                     ISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGG
                     ASERGSYVFFDPQRWEKCQRDFVLFYNAIM"
     gene            complement(<125673..>126941)
                     /locus_tag="KLTH0H01342g"
                     /db_xref="GeneID:8294249"
     mRNA            complement(<125673..>126941)
                     /locus_tag="KLTH0H01342g"
                     /product="KLTH0H01342p"
                     /transcript_id="XM_002555890.1"
                     /db_xref="GeneID:8294249"
     CDS             complement(125673..126941)
                     /locus_tag="KLTH0H01342g"
                     /note="similar to uniprot|P32335 Saccharomyces cerevisiae
                     YLR203C MSS51 Protein required for the maturation and
                     translation of COX1 mRNA involved in maturation of COX1
                     and COB mRNA"
                     /codon_start=1
                     /product="KLTH0H01342p"
                     /protein_id="XP_002555936.1"
                     /db_xref="GeneID:8294249"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:C5E213"
                     /translation="MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTP
                     ENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLE
                     YQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSM
                     DTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNR
                     RVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKRE
                     YVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRE
                     NWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKW
                     ELNDMNPQEVYQFNMFIAGFRGKRYHAIEV"
     gene            <127939..>128232
                     /locus_tag="KLTH0H01364g"
                     /db_xref="GeneID:8294250"
     mRNA            <127939..>128232
                     /locus_tag="KLTH0H01364g"
                     /product="KLTH0H01364p"
                     /transcript_id="XM_002555891.1"
                     /db_xref="GeneID:8294250"
     CDS             127939..128232
                     /locus_tag="KLTH0H01364g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H01364p"
                     /protein_id="XP_002555937.1"
                     /db_xref="GeneID:8294250"
                     /db_xref="InterPro:IPR013177"
                     /db_xref="UniProtKB/TrEMBL:C5E214"
                     /translation="MLGAFTRAFSSLVKTRAPAARLSSTLHAFRGFELPLRCMEPLML
                     LRPLAPVERAPTAMEEMLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK"
     gene            complement(<128402..>129325)
                     /locus_tag="KLTH0H01386g"
                     /db_xref="GeneID:8294251"
     mRNA            complement(<128402..>129325)
                     /locus_tag="KLTH0H01386g"
                     /product="KLTH0H01386p"
                     /transcript_id="XM_002555892.1"
                     /db_xref="GeneID:8294251"
     CDS             complement(128402..129325)
                     /locus_tag="KLTH0H01386g"
                     /note="similar to uniprot|P32339 Saccharomyces cerevisiae
                     YLR205C HMX1 ER localized, heme-binding peroxidase
                     involved in the degradation of heme"
                     /codon_start=1
                     /product="KLTH0H01386p"
                     /protein_id="XP_002555938.1"
                     /db_xref="GeneID:8294251"
                     /db_xref="GOA:C5E215"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="UniProtKB/TrEMBL:C5E215"
                     /translation="MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGF
                     IYRQGVLAFFYVFQAIEQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLE
                     LLYAKEFPTSASLRTFLEETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAG
                     GRVMRSTIYRSTGLFPKFPNLTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELA
                     TRQGLTEEQKLNILDVSNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYS
                     DKLTRKQKSLVLATGVVLQILMMYWVLRKFF"
     gene            complement(<129752..>131923)
                     /locus_tag="KLTH0H01408g"
                     /db_xref="GeneID:8294252"
     mRNA            complement(<129752..>131923)
                     /locus_tag="KLTH0H01408g"
                     /product="KLTH0H01408p"
                     /transcript_id="XM_002555893.1"
                     /db_xref="GeneID:8294252"
     CDS             complement(129752..131923)
                     /locus_tag="KLTH0H01408g"
                     /note="similar to uniprot|P04819 Saccharomyces cerevisiae
                     YDL164C CDC9 DNA ligase found in the nucleus and
                     mitochondria an essential enzyme that joins Okazaki
                     fragments during DNA replication also acts in nucleotide
                     excision repair base excision repair and recombination"
                     /codon_start=1
                     /product="KLTH0H01408p"
                     /protein_id="XP_002555939.1"
                     /db_xref="GeneID:8294252"
                     /db_xref="GOA:C5E216"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:C5E216"
                     /translation="MLRLVRAEMSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSD
                     PIGAGSGSPSSSPPLATGSSDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAA
                     TKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDI
                     VPITYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQ
                     EARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFL
                     IRSLESKLRIGLAEKSVLVALSKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQ
                     IVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGE
                     RAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKN
                     TILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVP
                     VPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKL
                     KKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEE
                     MLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSS
                     YGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS"
     gene            <132738..>134246
                     /locus_tag="KLTH0H01430g"
                     /db_xref="GeneID:8294253"
     mRNA            <132738..>134246
                     /locus_tag="KLTH0H01430g"
                     /product="KLTH0H01430p"
                     /transcript_id="XM_002555894.1"
                     /db_xref="GeneID:8294253"
     CDS             132738..134246
                     /locus_tag="KLTH0H01430g"
                     /note="some similarities with uniprot|Q12518 Saccharomyces
                     cerevisiae YDL161W ENT1"
                     /codon_start=1
                     /product="KLTH0H01430p"
                     /protein_id="XP_002555940.1"
                     /db_xref="GeneID:8294253"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:C5E217"
                     /translation="MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAE
                     RSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYII
                     KTLREFTHEDETGVDQGQIVRVKARELTALLQDEERLREERELKGRNRRPRRRKNSDS
                     YDDDMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQM
                     QQQMQQAQQQMFGLQQQQTQQPMYYDVFGNPISAEEYLQYQQQMLEQQQMLEQQQQQQ
                     ALAQQLAQQQYLAQQQYLAQQQQQQQALAQQQYMQAYAQQQNAQQQLLPLETGSNNPF
                     AKNAQQPSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQTRTGNQ
                     SVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQGK
                     HNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL"
     gene            complement(<134324..>134584)
                     /locus_tag="KLTH0H01452g"
                     /db_xref="GeneID:8294254"
     mRNA            complement(<134324..>134584)
                     /locus_tag="KLTH0H01452g"
                     /product="KLTH0H01452p"
                     /transcript_id="XM_002555895.1"
                     /db_xref="GeneID:8294254"
     CDS             complement(134324..134584)
                     /locus_tag="KLTH0H01452g"
                     /note="weakly similar to uniprot|Q3E829 Saccharomyces
                     cerevisiae YDL160c-a"
                     /codon_start=1
                     /product="KLTH0H01452p"
                     /protein_id="XP_002555941.1"
                     /db_xref="GeneID:8294254"
                     /db_xref="GOA:C5E218"
                     /db_xref="InterPro:IPR018552"
                     /db_xref="UniProtKB/TrEMBL:C5E218"
                     /translation="MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVRE
                     ALLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGLLLLDM"
     gene            complement(<134657..>135802)
                     /locus_tag="KLTH0H01474g"
                     /db_xref="GeneID:8294255"
     mRNA            complement(<134657..>135802)
                     /locus_tag="KLTH0H01474g"
                     /product="KLTH0H01474p"
                     /transcript_id="XM_002555896.1"
                     /db_xref="GeneID:8294255"
     CDS             complement(134657..135802)
                     /locus_tag="KLTH0H01474g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H01474p"
                     /protein_id="XP_002555942.1"
                     /db_xref="GeneID:8294255"
                     /db_xref="GOA:C5E219"
                     /db_xref="InterPro:IPR008603"
                     /db_xref="UniProtKB/TrEMBL:C5E219"
                     /translation="MIAQWLCSCSTEPNSIYKLNICAKCHRVSCNWCQKPELLIKYCP
                     GCFRVAESEGQLRCVHNCLECPRCELILSVSMEKLASGHKRFEMVCNGCSWRYKTPEV
                     STLKTLTGCVEELRKKEDPYTQRFNSLREFYGFKRELQYMEEGGEVSESIASKELFDR
                     LNETKLYKMINEECPIEFKDTKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPR
                     SSRFLLESFAAHMLPSLEIVHRSKVEPSVSDENAMALVFTASDQSDTPVEITILGSAT
                     IHIPVRQFTLAYDGPVKCESTMETIKRLVTRVPTYQLNSNTNILATEKSRRLTRPETA
                     PHKNNMIDQGSGWCILPMYILEPAKTHRIQLTIPIKGVYVTLQAVLH"
     gene            <135932..>138172
                     /locus_tag="KLTH0H01496g"
                     /db_xref="GeneID:8294256"
     mRNA            <135932..>138172
                     /locus_tag="KLTH0H01496g"
                     /product="KLTH0H01496p"
                     /transcript_id="XM_002555897.1"
                     /db_xref="GeneID:8294256"
     CDS             135932..138172
                     /locus_tag="KLTH0H01496g"
                     /note="weakly similar to uniprot|Q05787 Saccharomyces
                     cerevisiae YLR207W HRD3 Resident protein of the ER
                     membrane that plays a central role in ER-associated
                     protein degradation (ERAD) forms HRD complex with Hrd1p
                     and ERAD determinants that engages in lumen to cytosol
                     communication and coordination of ERAD events"
                     /codon_start=1
                     /product="KLTH0H01496p"
                     /protein_id="XP_002555943.1"
                     /db_xref="GeneID:8294256"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5E220"
                     /translation="MRLQHLWTAAVWCQLVLSTQDPWQEAVALLETLPMKADPMVSSA
                     QESDPYMEQVGRGIKITLPIDYYEREQESNYKSFFENEASPVQQEAYKKLVRSSDEFN
                     NTEATYTLAQMHLVQNFGFPHNKTLAFKYMQRFNELTDFQNASAVFELGVMHITGLFG
                     AIPIDVSKGLAFYEQAAKLGDYRARMALAYRYLNGINTPKDLNRSQFLYSLLARELRE
                     HFNDTEWNIFPPYVESYSVRIPDFSGGLLGSGLSVTASSAKRTRSSRPDITSSILTNL
                     QSGKIVLRFVGGQGDFLEDDDDDENKIVDYYYTALDNYQGTYTQKRNLEKAFYLLNST
                     VHEFRPFLKFMDPLPKYYYARCLELLGHMYLTGEGIERADVDSSEVCLKDAIGIRDAL
                     PQAYLDLGIINHYFRNNITEAVKCYTHLRESQSSTGAELFQLDKIYKSGLLPKDGEFA
                     SLWIEKESSPNVISIGMLPEKFIEHAAIFYGCNRAVYENAVNYESDVFFKGPGGGSLV
                     ALNGFRRFVHSRENLVAPHLREAFVELLLGNTEAALWLYAQAAEQGFETAQTNTAFLL
                     YQPSFLLEDPPQVPQERKLLAATYYKRAYGQHNTDALVVAGNIYYNMGLYVEAAELYR
                     ASSTPQGSWNLGYMYEFGLGVKQSFRLASRHYKSSLSQTRKVYLGVKLTLLKLQLKKW
                     LSWLSDKPIVRPLLGASADEENGSLGTSLPGSGTFKWMKKKQERQTHAPEQTTPWSLL
                     SRFFSF"
     gene            <138469..>139353
                     /locus_tag="KLTH0H01518g"
                     /db_xref="GeneID:8294257"
     mRNA            <138469..>139353
                     /locus_tag="KLTH0H01518g"
                     /product="KLTH0H01518p"
                     /transcript_id="XM_002555898.1"
                     /db_xref="GeneID:8294257"
     CDS             138469..139353
                     /locus_tag="KLTH0H01518g"
                     /note="highly similar to uniprot|Q04491 Saccharomyces
                     cerevisiae YLR208W SEC13 Component of both the Nup84
                     nuclear pore sub-complex and of the COPII complex (Sar1p
                     Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p) which
                     is important for the formation of ER to Golgi transport
                     vesicles"
                     /codon_start=1
                     /product="KLTH0H01518p"
                     /protein_id="XP_002555944.1"
                     /db_xref="GeneID:8294257"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E221"
                     /translation="MVTITNAHTELIHDAVLDYYGKRLATCSSDKSIKIFEVEGETHR
                     LVETLYGHEGPVWQVDWAHPKFGVILASSSYDGKVLIWREENGRWSQIAVHAVHSASV
                     NSVKWAPHEYGPLLLAASSDGKVSVVEFKENGTTAPILIDAHAIGVNTASWASAALQD
                     GAAPQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHSDWVRDVAWSPSVLLRSY
                     LASVSQDRTCIIWTQENSQGPWKKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVT
                     LWKENLEGKWEPAGEVEQ"
     gene            complement(<139430..>140347)
                     /locus_tag="KLTH0H01540g"
                     /db_xref="GeneID:8294258"
     mRNA            complement(<139430..>140347)
                     /locus_tag="KLTH0H01540g"
                     /product="KLTH0H01540p"
                     /transcript_id="XM_002555899.1"
                     /db_xref="GeneID:8294258"
     CDS             complement(139430..140347)
                     /locus_tag="KLTH0H01540g"
                     /note="similar to uniprot|Q05788 Saccharomyces cerevisiae
                     YLR209C PNP1 purine nucleoside phosphorylase specifically
                     metabolizes inosine and guanosine nucleosides"
                     /codon_start=1
                     /product="KLTH0H01540p"
                     /protein_id="XP_002555945.1"
                     /db_xref="GeneID:8294258"
                     /db_xref="GOA:C5E222"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="UniProtKB/TrEMBL:C5E222"
                     /translation="MNVFDLEEQRLLIGYAVEFLKHAFFEHFTRFEPRTLIICGSGLG
                     GIVDKVAPKPAPLVIPYEKIPGFKSSTVAGHQGKLVFGYMKGSPVVLMCGRLHYYEGH
                     ALHETVFPIRVVNELKTVKHLIVTNACGAINPSYQTGDLMCLNDHINMPGIAGQHPLR
                     GPNFEEYGPRFLPLSDAYDLDLRKLLFNKRAELGLERPLHEGVYTYVSGPTFETRAEA
                     RLIRLVGGDVVGMSTVPEVIVARHCGIRVLALSLITNEVVTDFPASAMDESPVPLDRG
                     KATHEEVLEAGFLASVDVERLVEEVVGEL"
     gene            complement(<140915..>142390)
                     /locus_tag="KLTH0H01562g"
                     /db_xref="GeneID:8294259"
     mRNA            complement(<140915..>142390)
                     /locus_tag="KLTH0H01562g"
                     /product="KLTH0H01562p"
                     /transcript_id="XM_002555900.1"
                     /db_xref="GeneID:8294259"
     CDS             complement(140915..142390)
                     /locus_tag="KLTH0H01562g"
                     /note="similar to uniprot|P39517 Saccharomyces cerevisiae
                     YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
                     mRNA decapping coordinates distinct steps in mRNA function
                     and decay interacts with both the decapping and
                     deadenylase complexes may have a role in mRNA export and
                     translation"
                     /codon_start=1
                     /product="KLTH0H01562p"
                     /protein_id="XP_002555946.1"
                     /db_xref="GeneID:8294259"
                     /db_xref="GOA:C5E223"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E223"
                     /translation="MEDDWKSQLNIPKKDTRPQTDDVLNTRGNTFEDFYLKRELLMGI
                     FEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLEKVKPKVNKIQALI
                     MVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNEPVHILVGTPGRVLD
                     LASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLLFSATFPLTVKE
                     FMVKHLHKPYEINLMDELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNST
                     NRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRGIDIQA
                     VNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAI
                     PAQIDKSLYVAEDDSAVPVPFPLASLPNTMANVAGQQQQLPPQLTQPQFTAVPQQYAP
                     QQQQYMPQQQYQYPPQAFMQGPPQSMEQAPSMQGHAPQQTY"
     gene            <143065..>144453
                     /locus_tag="KLTH0H01584g"
                     /db_xref="GeneID:8294260"
     mRNA            <143065..>144453
                     /locus_tag="KLTH0H01584g"
                     /product="KLTH0H01584p"
                     /transcript_id="XM_002555901.1"
                     /db_xref="GeneID:8294260"
     CDS             143065..144453
                     /locus_tag="KLTH0H01584g"
                     /note="similar to uniprot|P06784 Saccharomyces cerevisiae
                     YDL159W STE7 Signal transducing MAP kinase kinase involved
                     in pheromone response where it phosphorylates Fus3p and in
                     the pseudohyphal/invasive growth pathway through
                     phosphorylation of Kss1p phosphorylated by Ste11p degraded
                     by ubiquitin pathway"
                     /codon_start=1
                     /product="KLTH0H01584p"
                     /protein_id="XP_002555947.1"
                     /db_xref="GeneID:8294260"
                     /db_xref="GOA:C5E224"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E224"
                     /translation="MSFASQDVSLRQKSRPGESGLFQPSSLKRKNLKKLTLGGAVGTG
                     RGLRTDNMVPVSITGSSGSNGIEAPLGLNGIPNGDLRGYGSSGVSPTSDPSSAGITPT
                     EEVPGLTSDLENLSLFQDTTIELQDLVQLGKIGSGNSGTVLKTLHVPDSRIIAKKSIP
                     VENKQLVKSQLMRELSIMRNVKPHDNIVGFFGAFYTASTSNEIVILMEYMDCGSLDKI
                     MSTYKAFVARGIQSPTENWFSEPVLSKISFAVLNGLLYLYRGYKIIHRDIKPSNVLIN
                     SKGCVKICDFGVSKKLINSIADTFVGTSTYMSPERIQGSVYSTKGDVWSLGLMIIELV
                     TGEFPLGGHSDTPEGILDLLQRIVNEPPPRLPPQLPNGLQYSREMFDFVNRCCVKDER
                     ERSSLQELLCHDFIEKSRSQGDREFRHWCKRIKKWLKEDKMLRREEQERAKLVKRQLE
                     SAANAATAARHR"
     gene            complement(<144510..>144836)
                     /locus_tag="KLTH0H01606g"
                     /db_xref="GeneID:8294261"
     mRNA            complement(<144510..>144836)
                     /locus_tag="KLTH0H01606g"
                     /product="KLTH0H01606p"
                     /transcript_id="XM_002555902.1"
                     /db_xref="GeneID:8294261"
     CDS             complement(144510..144836)
                     /locus_tag="KLTH0H01606g"
                     /note="similar to uniprot|Q12082 Saccharomyces cerevisiae
                     YDL157C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H01606p"
                     /protein_id="XP_002555948.1"
                     /db_xref="GeneID:8294261"
                     /db_xref="UniProtKB/TrEMBL:C5E225"
                     /translation="MQSNILSVFNPPPQRELSSEETKDCIPCQVMSTMFSLGFGTYLL
                     SGKPFEYSEKEKKRGITAEKFQQMNPKWWRTSLRTMGGSLIIFGLIRGSEGWLWNKKK
                     PGTNEH"
     gene            <144953..>146488
                     /locus_tag="KLTH0H01628g"
                     /db_xref="GeneID:8294262"
     mRNA            <144953..>146488
                     /locus_tag="KLTH0H01628g"
                     /product="KLTH0H01628p"
                     /transcript_id="XM_002555903.1"
                     /db_xref="GeneID:8294262"
     CDS             144953..146488
                     /locus_tag="KLTH0H01628g"
                     /note="similar to uniprot|Q12510 Saccharomyces cerevisiae
                     YDL156W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H01628p"
                     /protein_id="XP_002555949.1"
                     /db_xref="GeneID:8294262"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E226"
                     /translation="MGELSEFQKRRLENIKRNNDLLKKLNLSGVSNQIKNEAGAKDER
                     KPKKKAAKQRVVKKEPKPEKVPTRRSRRLMGESADGKEVPHVSDYELLKGSRSNDPEL
                     LDNLKSTALVGDVKLSDLLKSEDENELLARFQNYNSKGFSSGDFFKELQKHQKVSEDI
                     QELQQEFNLELYEIFQPNEIKIVQDRISALFFHPSVDQKLVVGGDTTGHVGLWNVIDE
                     EPNDDLAEPDITTVQLFSKNVAKIDVYPTDPGKLLTASYDGMIRSIQLDSLKSEELLS
                     LKNEYDESLGVSDFQFSYENPNEIFLTTLSGEFTTFDTRTKPTSINLRRLADKKIGSF
                     SINPKRPYEIATGSLDRTLKIWDLRKTVKNPEWSAFDDYSSHEVVSTYDSRLSVSAVS
                     YSPLDGSLVCNGYDDTLRIFDVKDVPPQDLQPKLTLKHNCQTGRWTSILKARFKANMD
                     VFAIANMSRAIDIYHSSGQQLAHLKTATVPAVVSWHPLKNWIVGGNSSGKVFLFQSPN
                     KDS"
     gene            complement(<146708..>147451)
                     /locus_tag="KLTH0H01650g"
                     /db_xref="GeneID:8294263"
     mRNA            complement(<146708..>147451)
                     /locus_tag="KLTH0H01650g"
                     /product="KLTH0H01650p"
                     /transcript_id="XM_002555904.1"
                     /db_xref="GeneID:8294263"
     CDS             complement(146708..147451)
                     /locus_tag="KLTH0H01650g"
                     /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
                     YDR391C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H01650p"
                     /protein_id="XP_002555950.1"
                     /db_xref="GeneID:8294263"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5E227"
                     /translation="MMKQSPLSPPASPLVDLESKPVVKVNNGHCRTVVPVNKVTNIER
                     ATLTLAKAFHDSKANDYLMKKFANIPSSEEVPKARINEILHQFNLLYAAKGGEIVEAN
                     DFDAVAVWTGPGHHFDQDLTNDPVFNHIFFEVLHDKRDEILKELDCYYLFIVGKDLTN
                     PKVRGSVRAIFDTYKRKADEEGVALVLEAINEHARSVYEYFGFKNYHTFHFGAGEVDA
                     NGKANPNGEGFVGYLMIYYKDELPGAIDN"
     gene            complement(<148024..>150129)
                     /locus_tag="KLTH0H01672g"
                     /db_xref="GeneID:8294264"
     mRNA            complement(<148024..>150129)
                     /locus_tag="KLTH0H01672g"
                     /product="KLTH0H01672p"
                     /transcript_id="XM_002555905.1"
                     /db_xref="GeneID:8294264"
     CDS             complement(148024..150129)
                     /locus_tag="KLTH0H01672g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H01672p"
                     /protein_id="XP_002555951.1"
                     /db_xref="GeneID:8294264"
                     /db_xref="GOA:C5E228"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5E228"
                     /translation="MTATTAAQSPDNPTKHDSGHALRPKRNRSRAGCFTCRLRRKKCD
                     EVHPKCGTCTKHVLKCIWPRKGQGRLTKEMREKMKREVDLYDESSLLVPITSPPVSEG
                     PASRRGSRTQAQHFVNYAIDHASKALVLHSTDLPMNDASQIFNSQSSGEDEEDLEASE
                     TESHTEGSETAQPVAEPTETPLEQSHALIPTRRDREEWASFLDSPGNLPGTPQTGFFW
                     EKLFDMNFTEPIVSPNFSIISPVCASPLPDGDLVAAASIMSAVHTEDDLNAYGLDEEQ
                     TEKFYGKLMEKFVDWTSTNNQTKRTSVAKLMSQYQFTQQDLLLYYTCVYYFLPAVGPQ
                     QTLPQLTTTETFVPLLTQHPIVKDVFLCCGATFLAWCQPQKYSQLAERLYQSSKSRLQ
                     KELASNRIRGDETWAFACFQLLCLTNKLHNGEGISMVDRCVDNLAHSFNIIKRKYQTI
                     KERGSTPTDRMLIESFMYNYTVSLLVARDLSKLPNPFSDMFANLTTLLKSPIFNDCDV
                     EWMNNPVLGPSVDAFGMLAKVSFLSRMPLPLTSPHWTDEAQKLLQDCLYYTPPQLPEE
                     VRNDERKYEVYRPGLLSGSIISKACYLLLSKIIRYDDFDVRNLEIQGVVKYSIQSLRD
                     IEKGNPLLCILLWSLLIIGAFSVDPEDRLVIKEYLKSTSETIHSYGALKIDNLLELIW
                     DRDDINLLFVRENISQVII"
     gene            <151103..>152431
                     /locus_tag="KLTH0H01694g"
                     /db_xref="GeneID:8294265"
     mRNA            <151103..>152431
                     /locus_tag="KLTH0H01694g"
                     /product="KLTH0H01694p"
                     /transcript_id="XM_002555906.1"
                     /db_xref="GeneID:8294265"
     CDS             151103..152431
                     /locus_tag="KLTH0H01694g"
                     /note="similar to uniprot|P24871 Saccharomyces cerevisiae
                     YLR210W CLB4 Involved in mitotic induction
                     G(sub)2-specific B-type cyclin and uniprot|P24870
                     Saccharomyces cerevisiae YDL155W CLB3"
                     /codon_start=1
                     /product="KLTH0H01694p"
                     /protein_id="XP_002555952.1"
                     /db_xref="GeneID:8294265"
                     /db_xref="GOA:C5E229"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:C5E229"
                     /translation="MQYSRFASDENRVFDHAAHARFTNDENAVPQGPAGLAGSKLALG
                     VAESVQTSGRRVALGDVTSQANKQAHGKPGVLAHAHSRHASENHNGPATAQLEHTGAQ
                     PMSPPMELRSPEKMYSDDTLQGADHVGEDFNDDTSSVSSDSEPLLLVSTEESMRAVQL
                     ANQEFYSESPDPLDEDTYDLVMVVEYTQEVFQYLHELEEKYRPHPRYMHFQPELKWSY
                     RSTLIDWIVQVHARFQLLPETLYLTVNIIDRFLSRKTVTLNRFQLVGAAALFLAAKFE
                     EINCPTLKEILYMLDNSYTKDELLRAERYMINTLEFELGWPGPMSFLRRVSKADDYEY
                     DIRTLAKYLLETTIMDCRLVSAQPSWLAAGAYYLSRVILGFNNWTKQHIYCSGYTAEQ
                     LFPLATIILENCRHASKRHQAIFEKYSERRHRRSSQVVARWIAMAEERIS"
     gene            complement(<152669..>154462)
                     /locus_tag="KLTH0H01716g"
                     /db_xref="GeneID:8294266"
     mRNA            complement(<152669..>154462)
                     /locus_tag="KLTH0H01716g"
                     /product="KLTH0H01716p"
                     /transcript_id="XM_002555907.1"
                     /db_xref="GeneID:8294266"
     CDS             complement(152669..154462)
                     /locus_tag="KLTH0H01716g"
                     /note="similar to uniprot|Q05842 Saccharomyces cerevisiae
                     YDL153C SAS10 Component of the small (ribosomal) subunit
                     (SSU) processosome required for pre- 18S rRNa processing
                     essential nucleolar protein that when overproduced
                     disrupts silencing"
                     /codon_start=1
                     /product="KLTH0H01716p"
                     /protein_id="XP_002555953.1"
                     /db_xref="GeneID:8294266"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="InterPro:IPR018972"
                     /db_xref="UniProtKB/TrEMBL:C5E230"
                     /translation="MARRKNARQAPKGGQEDFYGLNEVDDFAKKREKVMLDKAGLTEY
                     PESGDSDGLMSDENEEGVMNVDDESSEGDQDEEPEEDDEPLDGEKAYRQVFGRKLDLG
                     DARDAEDGGETMLDNESAWGSTKNEYYGADDLDDEEAAKEIEREALRQQKKHLEDLDM
                     NDYLDEEVEEDWAKSAKDFSLGQFQEATNQPQTQVRARDILKMSADGKEKLLKVWCPE
                     FFPLSKELAHLAPQLDELKAQQNSSETTSIKITALSSYLGAISSYFTILLHEIQTNDD
                     FKSMKEHPIMESILLCKEVWRQAQELPEEVPVEEEQDSEGIASDVENMEDDLLEDENA
                     QESDKESAGAVGSDHEPEYHSDDLDIDISRPRVNQSASNKVPSAEIDDYVESEVADVD
                     AQEKKARKKTLRFYTSKIDQQATKKGDKFKGDDDIPYKERLYERQQRLLEEARKRGQS
                     GPDGTELNAQDYDSEDEKVAKNVNTGSSTDYYNEIQQSGLNKKQARKQAHKDAVLASR
                     EGKLAELAGEVGENGKRAISYQIMKNKGLTPRRKKENQNSRVKKRKKYDQAKKKLKSV
                     RSVYSGGLSGVYEGEKTGIKKNLTKSVKFKN"
     gene            <154705..>155961
                     /locus_tag="KLTH0H01738g"
                     /db_xref="GeneID:8294267"
     mRNA            <154705..>155961
                     /locus_tag="KLTH0H01738g"
                     /product="KLTH0H01738p"
                     /transcript_id="XM_002555908.1"
                     /db_xref="GeneID:8294267"
     CDS             154705..155961
                     /locus_tag="KLTH0H01738g"
                     /note="similar to uniprot|P25441 Saccharomyces cerevisiae
                     YDL150W RPC53 RNA polymerase III subunit C53"
                     /codon_start=1
                     /product="KLTH0H01738p"
                     /protein_id="XP_002555954.1"
                     /db_xref="GeneID:8294267"
                     /db_xref="GOA:C5E231"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="UniProtKB/TrEMBL:C5E231"
                     /translation="MSGTGRLPTLSQGNAKPSLKFKPKALARRSKEEREASVPKPAPE
                     EIKKPFNNKKKYSKRENGPNGQRRIPKYLLNTRVVNAGFGAENFTGGGGDMRTGFIKT
                     EGSNHDYLQKGLKAANEGDEGLDSEGEGATKINMGREYKSSELYASEEEDEDESSSAD
                     IDEEALQSKRLARFFPVRALRVKHDEVELVKKEIQDTMSDPTTRDPTPGLPKLEDPQD
                     GGQGLQEVLNNRSLELQDKLNDLRLQNEFASVDSGEAMQEVALLNQDYRHIQKKIIKI
                     NNQPGKFMFFQLPAVLPDFEEPKPPAPDAVEEPTVKPENEDEKTEEPTKESQDSSKKP
                     EDSAKKPEPETIQEPKPLAGRIGSLRIHKSGRLSVKIGNVEMDVSRGAENTFLQEVVA
                     LDEREEERTVELLGQIVGKAVVTPKF"
     gene            <156245..>159010
                     /locus_tag="KLTH0H01760g"
                     /db_xref="GeneID:8294268"
     mRNA            <156245..>159010
                     /locus_tag="KLTH0H01760g"
                     /product="KLTH0H01760p"
                     /transcript_id="XM_002555909.1"
                     /db_xref="GeneID:8294268"
     CDS             156245..159010
                     /locus_tag="KLTH0H01760g"
                     /note="similar to uniprot|Q12142 Saccharomyces cerevisiae
                     YDL149W ATG9 Transmembrane protein involved in formation
                     of Cvt and autophagic vesicles cycles between the
                     pre-autophagosomal structure and other cytosolic punctate
                     structures not found in autophagosomes"
                     /codon_start=1
                     /product="KLTH0H01760p"
                     /protein_id="XP_002555955.1"
                     /db_xref="GeneID:8294268"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="UniProtKB/TrEMBL:C5E232"
                     /translation="MDGSSSKYHEPERNTFLSRVFGPHSTEGNSMGNTEMTQIQASEQ
                     SFVQSGGMRMIESDQGSSSDDDASFEREEDDSRVRAFHGIQSVVLDADSDAGSSSGAG
                     SIASVQKLGQGADSDSEYQERRPGAEEDNNDEDSPLFRQNLKSLDFKSPSPVPAGPSV
                     GFGPEVSDRRAFKSKFIDKHTQFLKLGKDEAEAESFLFRKNSAWDEENQQPKAQTNVP
                     RIFGNFAAIGNTPAARLHTLSPRERALWKWANVENLDIFLQEVYNYYLGNGFYCICIE
                     KALNIATLLFVVFISTFMGCCIDYSKLPHSTKISEVYVHKCYSTQISGTTKVLLWGFY
                     IFVALKVAQFYFDVRALRDIHNFYSFLLNISDKELQTVSWQKVIKQIMLLKDQNAVTA
                     NVAEVKAKNRIDAHDVANRIMRRENYLIALFNNDILDLTLPIPLYRTSTLTKTLEWNL
                     NLCIIGFAFNESGYLKQSFLKSSQRSYLEEELRKRFMLAGFLNIILSPFLVAYFILLY
                     FFRYFNEYKTSPSALSSRQYTPIAEWKFREYNELYHLFQKRLGLSVEVANNYIDQFPK
                     EKTNIIMKFIAFVSGSFVAILALLTVFDPENFLNFEITKDKSVLFYISVFGTVWAICK
                     NSVSGQYRVFDPEESLREVVSYLHYKPKEWEGKYHTEDVKQDFCKLFNLRVILLLREL
                     ASLVMTPFILWFSLPKSSGKIVDFMREVSVYVDGLGYVCKYATFEVQGRHHDAKSRAS
                     RIIKNHQNFDAPQGYDESEHSSASDSEDDDKSVNKMMRSYMYFLDSYQNNDNEVGKHQ
                     LPKSGRNGKGPGNVDWLNTNYSWKRQFQPGQRPGDFQGNNVGYSSSMPTGTKDPVTKR
                     SSEFKADSRSTGRGQTRFDSSLGESFINSVPLGEYRHLDRAEEVPGGNGVLGLLNQYY
                     KKSDVGR"
     gene            complement(<159110..>161554)
                     /locus_tag="KLTH0H01782g"
                     /db_xref="GeneID:8294269"
     mRNA            complement(<159110..>161554)
                     /locus_tag="KLTH0H01782g"
                     /product="KLTH0H01782p"
                     /transcript_id="XM_002555910.1"
                     /db_xref="GeneID:8294269"
     CDS             complement(159110..161554)
                     /locus_tag="KLTH0H01782g"
                     /note="similar to uniprot|Q99207 Saccharomyces cerevisiae
                     YDL148C NOP14 Nucleolar protein forms a complex with Noc4p
                     that mediates maturation and nuclear export of 40S
                     ribosomal subunits also present in the small subunit
                     processome complex which is required for processing of
                     pre-18S rRNA"
                     /codon_start=1
                     /product="KLTH0H01782p"
                     /protein_id="XP_002555956.1"
                     /db_xref="GeneID:8294269"
                     /db_xref="GOA:C5E233"
                     /db_xref="InterPro:IPR007276"
                     /db_xref="UniProtKB/TrEMBL:C5E233"
                     /translation="MAGSQLKNLKNALKEQGFTGQTNVKGSKKLKRKAKEYDRDERTK
                     AIARIREQFNPFDVKMNRDKRGAEAKRVAQPVGKPGISKQIGEEQRKQVYEAKKKSKN
                     RLGGLLDRRFGENFKGLTEEEKMLERFTREKQSQASSRRSLFNLDDDDDAGDDDVYGE
                     KLTHYGKSLSFQDDFQEDDLGLDEDTGNKGSSKRSEREFGDENAELPARKKTKAEVMK
                     EVIAKSKFYKQERQKAQEKLEDDIQDVDDEFEDVMAELNSLPKAKKTDQNNSKEFDKE
                     YDTKVRELGLDRRAAPAERTKTEEELEKENEEKRQKLEQARLDRMRGMFGEEEDQGVE
                     DLGEEFWAGEDSENEDLNETDGSELEDVELPGGDETKSFGGKSKAVSVIPCPQTEEEL
                     KDFLQSYELREHPNMVKEIIRTYQPSLAMGNKGKLGVFTGVLLRHILSLSVSYDDSHL
                     ELFGSVQNSLIAILRSMAQKYNEPLSETCREITSEIQERFKNERSHGLSTADLIFFTL
                     VGYIFSTSDHYHLVVTPCNVLIGELLEQTKLNSFQNVFFCAVLARISLSYQNMGKRLV
                     PELVYFFEKSLVTLLPLTSKEKSSSGLAHIIQDSEDLNAPQKLDLAAIGSHNLNLRQA
                     MSQDYVPNDQEKSALLCNILASLEEAISLVWKELSSFQELTLSFKRILSAFSQIYEDF
                     EKPKVILEKIEKFEKFHEHFPLSLQNHRPVSIPSHVPKYEENFNPDKKSYDPDRTRNE
                     VNKMKAQLKKERKFTMKEIRKDTRFEARQQIETKKKDYADYHSKMARIINQISTEEGM
                     EKGKYEREKKLRNSKK"
     gene            <161820..>163145
                     /locus_tag="KLTH0H01804g"
                     /db_xref="GeneID:8294270"
     mRNA            <161820..>163145
                     /locus_tag="KLTH0H01804g"
                     /product="KLTH0H01804p"
                     /transcript_id="XM_002555911.1"
                     /db_xref="GeneID:8294270"
     CDS             161820..163145
                     /locus_tag="KLTH0H01804g"
                     /note="highly similar to uniprot|Q12250 Saccharomyces
                     cerevisiae YDL147W RPN5 Essential, non-ATPase regulatory
                     subunit of the 26S proteasome lid"
                     /codon_start=1
                     /product="KLTH0H01804p"
                     /protein_id="XP_002555957.1"
                     /db_xref="GeneID:8294270"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5E234"
                     /translation="MSRDAPLKAEKDYTEILKEELPKIEVLAQNDTQGALDKLLVLEK
                     KTRQSSDLESSKKVLASIVELLVGKNQWGELDEQLIALSKKHGQLKMSVQFMVQKIME
                     HLEQLQDLKTKVKAIETIRTVTENKIFVEVERARVTRILTEIRRSEGDIDQATDLLCS
                     LQVETFGSMDMYEKIGFILEQMELSILRGDYSQATVLSRKVLRKTFKNEKYEALKLDY
                     FELLIKIGLHKRDYLQVAQYYQEIYNTESIKKDEAKWKHALTHVVLFLVLTPYDNLQN
                     DLIHKVQLDNNLKKLEKPESLVKLFTTAELMRWPFVKESYESFLNSDDVAFGKNNAHW
                     EDLRKRVIEHNLRVVSKYYTRINLSRLNELLDLTETETERFISDLVNQGVIYAKINRP
                     AKIVNFGRPKNSSLLLNEWSQNVDQLLEHIETIGHLITKEEILHGLKGN"
     gene            complement(<163221..>163757)
                     /locus_tag="KLTH0H01826g"
                     /db_xref="GeneID:8294271"
     mRNA            complement(<163221..>163757)
                     /locus_tag="KLTH0H01826g"
                     /product="KLTH0H01826p"
                     /transcript_id="XM_002555912.1"
                     /db_xref="GeneID:8294271"
     CDS             complement(163221..163757)
                     /locus_tag="KLTH0H01826g"
                     /note="weakly similar to uniprot|Q05789 Saccharomyces
                     cerevisiae YLR211C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H01826p"
                     /protein_id="XP_002555958.1"
                     /db_xref="GeneID:8294271"
                     /db_xref="UniProtKB/TrEMBL:C5E235"
                     /translation="MQLRDRKFSESIETYKKSAEAINQLEIQHKSIANVGDLKQALNL
                     LKKDLNRKIREIQILGKFSAQSSPIETNDTASHEPMAAYRLSGFQNNILAIVRGKTDP
                     KSGVSASEIENSISKEVSQLFKSFALIDQQKFKEYDNKVEQLVRENRKLTGQIVKLKE
                     RWDSLVESARQKRNQQNE"
     gene            <164062..>165513
                     /locus_tag="KLTH0H01848g"
                     /db_xref="GeneID:8294272"
     mRNA            <164062..>165513
                     /locus_tag="KLTH0H01848g"
                     /product="KLTH0H01848p"
                     /transcript_id="XM_002555913.1"
                     /db_xref="GeneID:8294272"
     CDS             164062..165513
                     /locus_tag="KLTH0H01848g"
                     /note="similar to uniprot|Q12342 Saccharomyces cerevisiae
                     YDL146W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery cytoplasm bud and bud neck"
                     /codon_start=1
                     /product="KLTH0H01848p"
                     /protein_id="XP_002555959.1"
                     /db_xref="GeneID:8294272"
                     /db_xref="InterPro:IPR018556"
                     /db_xref="UniProtKB/TrEMBL:C5E236"
                     /translation="MERGSSSPDDEEPNAAYSPSIFWEEMEHLLKVPDVTDETQVNTA
                     LVKYIKHGSDSYQKCVKTEQGLYRLGVTFTESTMFHRNKMFVVSKLLSLLSVDLLECN
                     LKFIISYIILCASKSDLSVLELLVEFQGFTVVYNNLYSTFAYLNRYGEDIAPSSSSGP
                     RSDAGTEIESEIIESLKQVSTILMDILFQIFKYSKCDIVNLSIVDDFFVYYLMRTMRS
                     ETTEDIFNNAKFKLLLALNEQYMIFSYQYELENRVYKYLVDSTVSKSFVELLLLKFNR
                     VTDRSLQIMLCKIVYLILTMDESYAKDFFYLNDLHVLVDVLIRELNNIADDEELIRNT
                     VLRVLFPLLRNTELAQTQYRRSDLIDILQHLSSLDNVCSSGETKDEHRTTVRLAQKCL
                     KQIDWLQVPVVDTSDQTVPVYSDDSREMSVSTGSLSSPYDFQEKHLYGNYDASLSAES
                     ITKRLQPPPPPPARKHPHRLGSGQKIAQFRPKS"
     gene            complement(<165566..>166972)
                     /locus_tag="KLTH0H01870g"
                     /db_xref="GeneID:8294273"
     mRNA            complement(<165566..>166972)
                     /locus_tag="KLTH0H01870g"
                     /product="KLTH0H01870p"
                     /transcript_id="XM_002555914.1"
                     /db_xref="GeneID:8294273"
     CDS             complement(165566..166972)
                     /locus_tag="KLTH0H01870g"
                     /note="similar to uniprot|P53378 Saccharomyces cerevisiae
                     YLR212C TUB4 Gamma-tubulin involved in nucleating
                     microtubules from both the cytoplasmic and nuclear faces
                     of the spindle pole body"
                     /codon_start=1
                     /product="KLTH0H01870p"
                     /protein_id="XP_002555960.1"
                     /db_xref="GeneID:8294273"
                     /db_xref="GOA:C5E237"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:C5E237"
                     /translation="MTGEIITLQIGQCGNQVGKQFWSQLIKEHGISRDGQSLSTNESD
                     TVEEDDPTIFFKQNDSNRYTPRALLFDLEPSAIADVQNSFPGLFNERNVWVSKDELGA
                     GNAWSKGYDHGLENQEEFINMVDKEIDATESFEGFQLLHSVAGGTGSGLGSNFLEALS
                     DRYHKKIITTYSVFPSSESEVVIQPYNTILTLRRLIEHSDASVVFDNKALLNLATRVF
                     RDRNTSYEQTNQLIASVLSSITNSLRFPSYMYNSLPSIFSTLVPTADLHFLVPSFTPF
                     TSDFIPGVRDFKKSSAYDVILDLFDKSNSMVLRNNDTPVYLSIYNSILGPTDQADITR
                     AILKSQQRIKFPPWSSSALHVNVGKKSAYNVTPDSDKVSGMMLANTTSVNALLQTACS
                     SFDVLFKRGAFLHMYQDGKMFQNGAEEFIESREVVQSCINEYYAAEQETFMDDVLMEE
                     ENIVGNGGMLDADGDDII"
     gene            complement(<167262..>170891)
                     /locus_tag="KLTH0H01892g"
                     /db_xref="GeneID:8294274"
     mRNA            complement(<167262..>170891)
                     /locus_tag="KLTH0H01892g"
                     /product="KLTH0H01892p"
                     /transcript_id="XM_002555915.1"
                     /db_xref="GeneID:8294274"
     CDS             complement(167262..170891)
                     /locus_tag="KLTH0H01892g"
                     /note="highly similar to uniprot|P53622 Saccharomyces
                     cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
                     coatomer complex which surrounds transport vesicles in the
                     early secretory pathway"
                     /codon_start=1
                     /product="KLTH0H01892p"
                     /protein_id="XP_002555961.1"
                     /db_xref="GeneID:8294274"
                     /db_xref="GOA:C5E238"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5E238"
                     /translation="MKMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGT
                     LLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVF
                     FHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDET
                     VRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFH
                     PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKT
                     IRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSAINQ
                     NQLIFVNKEKQVQTFDYNKKVVSLPYVSLKNIGHAWNAFRSLSYNPSQHSVLVNCSDN
                     QGSKFALCPLPKQATGAIEPTGVLEDSGSFATFVARNRFVVYNSSTSSLEVRGLDNKI
                     TKSIKIDGDNTVKDIVYGGPGSVLLLQAKSVTLFDVQQARKLAEVPSKNVKYVSWSLD
                     NQFIALMSKHTITIVTKNLEVVTSMHETIRIKSAAWDETGVLIYSTLNHIKYTLLNGD
                     NGIIKTLENTLYINKVHGKFVYALNREGEVEVVTIDPTEYRFKKALVNKNFPEVLRII
                     KNSNLVGQNIISYLQKSGFPDIALQFVQEPQTRFDLALEYGDLNIALEEANKLNSSIV
                     WEQLGKAALQQGNIEMVELVYQTQKLFDKLSFLYLITGDLSKLSRMESIAERRGDISS
                     LILNTFYSDSAEKRGSVFAQSGALPLAYAIAKANNDDDAVAQILEKAGVDESDVKLPK
                     NLTSSRLCKSPVVSEAITQWPLESPGASFFEKALSGQVEGLSLEEGADEEELERDAGI
                     VAPEPNDFSDEEEVLEDDGGWDIGEEDLGLEEDAQEAFLADKGTAKIVDENEVTQWTK
                     NCKLPYVLIASGAFEAAAQALNKQAGVANFEPLRPRFLEIYESCRTYMAATPAELPSI
                     TGVIRAVAEEEERGKLLPFVAGIDVVTSKMNEGFSLFKANKLEAAIEIFRDVVYIVTL
                     FATDNEEDESTARKALAKAREYILGITIELARRALPADQVKRNLELASYFTTTKLLPP
                     HRSTAFQVAMSQSFKHKNFIQASYFASEFLKIVTTGPRADQAQKVKDRADLMAHDAIE
                     VDFDPHAEFAICASTLTPIYSGTPTLSDSLTGAKYHASEKGKLDAIALISKIGTPASG
                     LRILI"
     gene            complement(<171281..>172708)
                     /locus_tag="KLTH0H01914g"
                     /db_xref="GeneID:8294275"
     mRNA            complement(<171281..>172708)
                     /locus_tag="KLTH0H01914g"
                     /product="KLTH0H01914p"
                     /transcript_id="XM_002555916.1"
                     /db_xref="GeneID:8294275"
     CDS             complement(171281..172708)
                     /locus_tag="KLTH0H01914g"
                     /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
                     YLR213C CRR1 Putative glycoside hydrolase of the spore
                     wall envelope; required for normal spore wall assembly,
                     possibly for cross-linking between the glucan and chitosan
                     layers"
                     /codon_start=1
                     /product="KLTH0H01914p"
                     /protein_id="XP_002555962.1"
                     /db_xref="GeneID:8294275"
                     /db_xref="GOA:C5E239"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5E239"
                     /translation="MVALALAASLLIGAEFVQCFVETYKSDPAIACSNDNHCPKEWPC
                     CSQYGQCGDGPLCVGGCDPRSSFDAHSCAAIPALVPSASSGIQVLGGSTGGAGDREDQ
                     FLPALDTQFGIYSARHGPKPDAERIQKALESAKMLHYSEFKVEPELSSADYTYSGFLD
                     FDAGPQPALMLTMPPETTGSLLSSARSFLYGRVAVTMKAAPGQGVVSAMVLMSAVKDE
                     VDFEILGGDPEFAQSNYYYQGELVHTRMTKARIQPDSCSEFHTYEFDWNENRIHWLID
                     GAIVRTLRREDTYDPVLKIHKYPQTPMRLEVAIWPGGVPSNNPGTIMWAGGLIDWVNA
                     AAIVNGGRFQLAVKQVTITPYANAFTQVKPAKLQARSEDSVFFYFYDPDCSNFDEACV
                     RAAPQQKEDRVQEAASAPLDSSISVQPSSTPVSSSSVPTPASSRTSAHSSYKPSVFTI
                     TRHENIGPAMSRQNLLYKLRSWLLS"
     gene            <173705..>175792
                     /locus_tag="KLTH0H01936g"
                     /db_xref="GeneID:8294276"
     mRNA            <173705..>175792
                     /locus_tag="KLTH0H01936g"
                     /product="KLTH0H01936p"
                     /transcript_id="XM_002555917.1"
                     /db_xref="GeneID:8294276"
     CDS             173705..175792
                     /locus_tag="KLTH0H01936g"
                     /note="similar to uniprot|P32791 Saccharomyces cerevisiae
                     YLR214W FRE1 Ferric reductase and cupric reductase reduces
                     siderophore-bound iron and oxidized copper prior to uptake
                     by transporters expression induced by low copper and iron
                     levels"
                     /codon_start=1
                     /product="KLTH0H01936p"
                     /protein_id="XP_002555963.1"
                     /db_xref="GeneID:8294276"
                     /db_xref="GOA:C5E240"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:C5E240"
                     /translation="MRVQNLRLLALAVFSFAVTCVRGLELIDSSLASACIYYEKTFDW
                     GCHSHGNGAAAYRCRCGNVNWLGTITNCIANNTKSLRLRNHGFRHVARRCYEKGDFNY
                     TLADMQRFYANGTGYLRDPTTADLSSPVFTTLRVNQTEFDWYYKKMKDLTFSVQRSQW
                     FGWGLVFFWATIIAVTTLFNFNEKFVGLKLTDNWLARSLMIPSLFENMTQRYPRLRAI
                     SPGPHPNRLQALVVTAFVIQTIITVGVGYEMKLPHPYLTTRWFMNLDLVSYRVDLMAL
                     SLFPVIYFFGIRNNPFIPLTGMSYTTFSYFHKWCAYVCVVLAFIHSIIWTVYARHDGG
                     YKMWAMDSYWQYGIAAMTLMALLVFHSFKLLRDKIYEVFLFFHQMMNIFFIVCMYYHL
                     NKLGWLGWVWSMAGILCFDRAARIVRIILSGGLQKSTLTDCGSGVIKLTVMNPRFLTY
                     RPGSYAFIYFMSPQDPWYYPWQSHPFTVLSTAKGKGIHGNEMAVYFKAQKGVTGHMLY
                     KLLRSGEESINIRVMVEGPYGDTLPQIAKVNRRIVGVAAGLGVTAVYAQILHLLEAQV
                     PEMGCKLYWAVNDLSHVSWFEEELKWLLSQKCQITILCTSPKELEETGSSFNTDNKLL
                     EILDVRSLFARPDLRALVSEEVKEASDQSKDLTFISCGPSTFNIDFRASVSNTLRQKQ
                     SIDVALKEESFVW"
     gene            complement(<175829..>176929)
                     /locus_tag="KLTH0H01958g"
                     /db_xref="GeneID:8294277"
     mRNA            complement(<175829..>176929)
                     /locus_tag="KLTH0H01958g"
                     /product="KLTH0H01958p"
                     /transcript_id="XM_002555918.1"
                     /db_xref="GeneID:8294277"
     CDS             complement(175829..176929)
                     /locus_tag="KLTH0H01958g"
                     /note="similar to uniprot|Q05791 Saccharomyces cerevisiae
                     YLR215C CDC123"
                     /codon_start=1
                     /product="KLTH0H01958p"
                     /protein_id="XP_002555964.1"
                     /db_xref="GeneID:8294277"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="UniProtKB/TrEMBL:C5E241"
                     /translation="MTNEYVELSEIKVSVQQVKNCAFSQWYSKFAGHTPQAKVIKPVP
                     GGFLEYLEQDGIKLPNDSQFGKSSYYAEIGNNEDNEYSDWEASSDEEHPQGQDVVQLF
                     PELHKELKDIFREMGSLTPKLTWSSPKDATWILANNTLKCTEVNDMYLLLKASNYITH
                     DLDRALAECFDKNSALEQDGPLQHELVLRKWFDLNPALEFRVFVKDSAIIGVSQRDLN
                     YYDYLELLTETFKDLLDEFVEDIVLPRFPDSSFVCDVYIPRPFEKVWLIDFNPFARKT
                     DSLLFSWNELATIDPYKLESDYELRLVQENNVARFASKEHSENQVPKEVADAITNPKA
                     IQELAEKWGELLNMQKAGDSSDDEPGEQNNSL"
     gene            <177187..>178773
                     /locus_tag="KLTH0H01980g"
                     /db_xref="GeneID:8294278"
     mRNA            <177187..>178773
                     /locus_tag="KLTH0H01980g"
                     /product="KLTH0H01980p"
                     /transcript_id="XM_002555919.1"
                     /db_xref="GeneID:8294278"
     CDS             177187..178773
                     /locus_tag="KLTH0H01980g"
                     /note="highly similar to uniprot|P39078 Saccharomyces
                     cerevisiae YDL143W CCT4 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="KLTH0H01980p"
                     /protein_id="XP_002555965.1"
                     /db_xref="GeneID:8294278"
                     /db_xref="GOA:C5E242"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5E242"
                     /translation="MTGKASTNSTFKNREKPQEVRKANIIAARAVADAIRTSLGPKGM
                     DKMIKTSRGEVIISNDGHTILKQMAILHPVAKMLVEVSAAQDTEAGDGTTSVVILTGA
                     LLGAAEKLLNKGVHPTIIAESFQRAAKRSVEILLDMSQKISLSDKQALTRAAATSLSS
                     KIVSQHSSFLAPLAVDCVLSIIDENATNVDLNDIRLIKKVGGTIDDTEMVDGVVLTQN
                     VVKTAGGPTRIEKAKIGLIQFQISPPKPDTENNIVVNDYRQMDKILKEERAYLLNICK
                     KIKKAKCNVLLIQKSILRDAVNDLALHFLSKLGIMVIKDVEREEIEFLSKSLNCKPIS
                     DPEFFTEDRLGAADLIEEVDSDGSKIVKITGVKSNVARPTVSVIVRGANNVILDETER
                     SLHDALCVIRCLVKERALIAGGGAPEIEASRTLMKEARTLQGVEAFVWQEFAAALEVI
                     PTTLAENAGLYSIRVVTDLRTLHENGEKNAGISIRRSATTNTFDEHVLQPVLVSTSAI
                     TLASECVKSILRIDDITFSR"
     gene            complement(<179383..>180156)
                     /locus_tag="KLTH0H02002g"
                     /db_xref="GeneID:8294279"
     mRNA            complement(<179383..>180156)
                     /locus_tag="KLTH0H02002g"
                     /product="KLTH0H02002p"
                     /transcript_id="XM_002555920.1"
                     /db_xref="GeneID:8294279"
     CDS             complement(179383..180156)
                     /locus_tag="KLTH0H02002g"
                     /note="similar to uniprot|Q07560 Saccharomyces cerevisiae
                     YDL142C CRD1 Cardiolipin synthase produces cardiolipin
                     which is an important constituent of mitochondrial
                     membranes required for normal mitochondrial membrane
                     potential and function"
                     /codon_start=1
                     /product="KLTH0H02002p"
                     /protein_id="XP_002555966.1"
                     /db_xref="GeneID:8294279"
                     /db_xref="GOA:C5E243"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="UniProtKB/TrEMBL:C5E243"
                     /translation="MLARPGIFVGQKLPLLCRSTAIRFSSTTPPAPQKMRSVLSSIYT
                     IPNMLTITRIAAAPLIGHCIMTNNLVPALGLFSYSCLTDFLDGYMARKYNMKSVAGTV
                     LDPMADKILMLVTTVSLACPGGPQVIPIPLASLIIGRDVLLALSAIYYRISSLRHTYG
                     KATWKSFWDVFRYPSAEVRPTKVSKWNTFLQMIYLGWAVATMIFQTRDEDKENDSEQT
                     NIYQRAFEWLGYVVGCTTVLSGASYVFSKNAVKYLKKVR"
     gene            <180518..>182566
                     /locus_tag="KLTH0H02024g"
                     /db_xref="GeneID:8294280"
     mRNA            <180518..>182566
                     /locus_tag="KLTH0H02024g"
                     /product="KLTH0H02024p"
                     /transcript_id="XM_002555921.1"
                     /db_xref="GeneID:8294280"
     CDS             180518..182566
                     /locus_tag="KLTH0H02024g"
                     /note="similar to uniprot|P48445 Saccharomyces cerevisiae
                     YDL141W BPL1 Biotin:apoprotein ligase"
                     /codon_start=1
                     /product="KLTH0H02024p"
                     /protein_id="XP_002555967.1"
                     /db_xref="GeneID:8294280"
                     /db_xref="GOA:C5E244"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR019197"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5E244"
                     /translation="MNVLVYNGPGASPDSVKHALNTLRRLLEPFYAVCTTNARVLQTE
                     PWAGKTSAVVFPGGADLPYTKECASVISQLKKFVSKQGGTFIGFCAGGYFATNCVEFA
                     QGDPQLEVVGKRELKFFPDTGRGPAFHGFKYNSEAGARAASLRLSNGEELKTYYNGGC
                     VFVNAEKYENVEVLAHYNEALDVPYSQDPSSLGAAVVLCQIGKGRALLTGPHPEFVPK
                     LLQKTNDDKYNSSVVEVLLEYEKGRLNFMKDILTKAGLHCNNDFADRVAPSLTPLLVM
                     ASSNNHLIEELENNVRNSDGIFEDGAAILEGETDSFRIYKGFDQYEAAKSELLGEEPD
                     EVPKSIIISSASEPFAPRKLTPNFDTAKYFQYLNPQSSVGSLLMYGEVITSTSSLLNN
                     NKKLLSLFPRNSMLHVGTIQVSGRGRGGNTWVNPKGVSASTACINLPLVSPTTGRPVS
                     IVFVQYLAMLAYCKAILSYAPGFEDLPVKIKWPNDLYAMKPEYYRTKKLRLTGRGLAG
                     SKTPLTDVEPAYVKISGLLVNTNFLNNCYSLLLGCGLNVSHDGPTTSLNSWVSILNKE
                     REKANMNPLPFVEIEKLQALYMNNLNVVLDTFLNKGPVSVLPEYYDLWLHNDQIVTLT
                     DHQNVKAKIVGITKDYGLLIAKELVSGTNTQFTGNVYHLQPDGNTFDIFKGLISKKVI
                     "
     gene            complement(<182788..>188010)
                     /locus_tag="KLTH0H02046g"
                     /db_xref="GeneID:8294281"
     mRNA            complement(<182788..>188010)
                     /locus_tag="KLTH0H02046g"
                     /product="KLTH0H02046p"
                     /transcript_id="XM_002555922.1"
                     /db_xref="GeneID:8294281"
     CDS             complement(182788..188010)
                     /locus_tag="KLTH0H02046g"
                     /note="highly similar to uniprot|P04050 Saccharomyces
                     cerevisiae YDL140C"
                     /codon_start=1
                     /product="KLTH0H02046p"
                     /protein_id="XP_002555968.1"
                     /db_xref="GeneID:8294281"
                     /db_xref="GOA:C5E245"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:C5E245"
                     /translation="MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDET
                     QMRAKVGGLNDPRLGSIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKV
                     CECVCMHCGKLLLDEHSELMRQAIKIKDPKRRFNAVWSLCKAKMVCETEVPSDNDPAQ
                     YVSRGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRVISADEVLNVFKHISPED
                     SVRLGFNEDFARPEWMILTVLPVPPPPVRPSISFNETQRGEDDLTYKLGDILKANINV
                     QRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSGRPIKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQLV
                     RNGPNEHPGAKYIIRDNGDRIDLRYSKRAGDIQLQYGWKVERHIIDEDPVLFNRQPSL
                     HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     QQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGVIPTPIIL
                     KPKPLWSGKQILSIAIPSGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSIGIGDTIADEKSMREITEA
                     IIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNEARDKAGRSAEVNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT
                     RNSLGNVIQFIYGEDGMDAAHIEKQTIDTIASSDAAFERRFRIDLLNPRHALDPSLLE
                     SGSEIIGDLKLQALLDEEFKQLVEDREFLRKIFVDGEQNWPLPVNIRRIIQNAQQTFR
                     IDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQEAQQNAVTLFCCLLRSRLATRR
                     VIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSI
                     TVASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMND
                     KDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLK
                     RIENTMLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCV
                     PGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTS
                     QGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAP
                     IGTGAFDVMIDEESLVKFMPQQKMEEVADGHDGARTPYNNESGLVNADIDVKDELMFS
                     PLVDSGSTDAMSGGFTAYGGADYGGASSPFSGYGDAPTSPGFGGVASPGFSPTSPAYS
                     PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT
                     SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP
                     SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPGSPSYSPGSPKK
                     ENDNDNNNNNNNNN"
     gene            complement(<188834..>189946)
                     /locus_tag="KLTH0H02068g"
                     /db_xref="GeneID:8294282"
     mRNA            complement(<188834..>189946)
                     /locus_tag="KLTH0H02068g"
                     /product="KLTH0H02068p"
                     /transcript_id="XM_002555923.1"
                     /db_xref="GeneID:8294282"
     CDS             complement(188834..189946)
                     /locus_tag="KLTH0H02068g"
                     /note="similar to uniprot|P53691 Saccharomyces cerevisiae
                     YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues binds to
                     Hsp82p and contributes to chaperone activity"
                     /codon_start=1
                     /product="KLTH0H02068p"
                     /protein_id="XP_002555969.1"
                     /db_xref="GeneID:8294282"
                     /db_xref="GOA:C5E246"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5E246"
                     /translation="MSRSKVFFDISIGGIPKGRMVFELYNDVVPKTAENFYKLCEGKS
                     GNCKSKPEIPLCYKGSIFHRIIKGFMCQFGDFTNFNGTGGESIYGEKFEDENFTMKHD
                     KPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGELIQGKRIARAIESQATDSAD
                     KPLSDVKVDDCGVLPADYVVPEDAEKTPTDEFGDNYDDSLADDSKVDLENVDSVLKAV
                     SAVKDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIA
                     LCAIKTGDYQKALTSTTEVVHDAAADDKSKAKALYRRGLAYYHLKDPEMAITDLEFAT
                     TYQQNDAAILKAISDAKKLKKEQVAKQKKSLSKMFS"
     gene            complement(<190131..>190814)
                     /locus_tag="KLTH0H02090g"
                     /db_xref="GeneID:8294283"
     mRNA            complement(<190131..>190814)
                     /locus_tag="KLTH0H02090g"
                     /product="KLTH0H02090p"
                     /transcript_id="XM_002555924.1"
                     /db_xref="GeneID:8294283"
     CDS             complement(190131..190814)
                     /locus_tag="KLTH0H02090g"
                     /note="some similarities with uniprot|Q12334 Saccharomyces
                     cerevisiae YDL139C SCM3 Suppressor of chromosome
                     missegregation"
                     /codon_start=1
                     /product="KLTH0H02090p"
                     /protein_id="XP_002555970.1"
                     /db_xref="GeneID:8294283"
                     /db_xref="GOA:C5E247"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="UniProtKB/TrEMBL:C5E247"
                     /translation="MIRRYIAALKEEVGDESTNNCMSGVNKKRDKRKVLKNLKGALKG
                     LLAADNGSASARPSAEVALTKPSTSEEPKRATPPRSLHTPHVPEQMSQSPKLSKQEPP
                     SSDKVVYIMSKESHLIPKLTDEQVMSRHKQADENMKRVWAHLIEKYGSLEDQGDVLDL
                     ATGEIIEDNGHVRGLGTQTTDNNERYVSVLSDLLDIDTTTDNVWDMSSETEEEASEEA
                     GEPPLSPET"
     gene            complement(<190872..>191120)
                     /locus_tag="KLTH0H02112g"
                     /db_xref="GeneID:8294284"
     mRNA            complement(<190872..>191120)
                     /locus_tag="KLTH0H02112g"
                     /product="KLTH0H02112p"
                     /transcript_id="XM_002555925.1"
                     /db_xref="GeneID:8294284"
     CDS             complement(190872..191120)
                     /locus_tag="KLTH0H02112g"
                     /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
                     YLR218C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H02112p"
                     /protein_id="XP_002555971.1"
                     /db_xref="GeneID:8294284"
                     /db_xref="UniProtKB/TrEMBL:C5E248"
                     /translation="MAQKEDSKYYKEALEEYKELCNDEEDVWDKRINDTGCYVENMAL
                     QLCHADTNDWRQCLGEMALFRKCWDQKGNRERVSTVDK"
     gene            <191540..>195439
                     /locus_tag="KLTH0H02134g"
                     /db_xref="GeneID:8294285"
     mRNA            <191540..>195439
                     /locus_tag="KLTH0H02134g"
                     /product="KLTH0H02134p"
                     /transcript_id="XM_002555926.1"
                     /db_xref="GeneID:8294285"
     CDS             191540..195439
                     /locus_tag="KLTH0H02134g"
                     /note="similar to uniprot|P38968 Saccharomyces cerevisiae
                     YDL195W SEC31 involved in protein transport from
                     endoplasmic reticulum to Golgi Component (p150) of COPII
                     coat of secretory pathway vesicles"
                     /codon_start=1
                     /product="KLTH0H02134p"
                     /protein_id="XP_002555972.1"
                     /db_xref="GeneID:8294285"
                     /db_xref="GOA:C5E249"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021614"
                     /db_xref="UniProtKB/TrEMBL:C5E249"
                     /translation="MVKLAEYPRTATFAWSYDRSPLLATGTASGTIDADFSSESTLEI
                     WSLLSPHEATPQASITADAKFNDLDWSHDNAIIAGALENGVVEFFAPEEPRSVAKLAQ
                     HTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSL
                     AWNQNQAHVFASAGSSGYASIWDLKAKKEVIHLSYASPVTGQRNQLSIVEWHPNNSTR
                     IATASGNDSDPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRDNVC
                     VLWNPEEGQSLTQYPTRGNWCFKTKFAPQTPDLFASASFDNKIEVQTLQNVTCSLDTD
                     ATATKQRESETEFWNNVSVQDANEKPIVKKLQAPAWYGNKSQAAQWAFGGKLVQITSD
                     KKGVKISKPAIPGAEKNVLLDKALETKDFNPIINKRLVQSIDATNEEDWNLLEKLSLD
                     GKDAFLSEALAFDDEDTDETKEKDVKDDGGDFFSSLNEKFVPEGSFRLDASDKLNDLF
                     KSLVRGDKKSAISSALEQDLLLESLLIALDSDDQTLKQKVKNAYFTKHGKTSSLARVL
                     HCVSEGDADDLVKNIEVDQWKYAVKAIDSYTSDLSKKNELFIALGDRLSDAGNRQDAL
                     LLYLSAQSLDKVASIWLKEFVGLESKLESKKETVYEAHLECLTEFVERFTVFISLISD
                     DQHQSLANEELIAKFLEFVNLTSSNGDFDLALKFLEILPGDNEDVVTEKQRVLIASNK
                     LPSAATKSQKPRYAGGNVLSGTSVAGLGLTNDRTPGGVKMPPAQPMQTVNPSAPFAPS
                     TPFNQQTPLRSRAASFAAPAPELLKSNPYAPASTQATTGSKYAPPPITSPSSAPRGSS
                     VASSVPITHKNAGTYAPAVAQPSVAGAVPPNPYAPSAGAYGNFSGQPAYSQPLKPVAN
                     VIGASAPGANSMSPPLAPPASNAASGQTPHLNKNANDGWNDLPLNVKEKPTRAKAVSV
                     APVSVAPSSAAPGPQVNFGSIPPPPLSRVTSSANLQTPVPQRVPSKTYTPPNGSASPA
                     SVNPYAPPLASAAPAPVVPSNPYAPSAVSTGQPVPGNPYAPAAAMPSNPYASPPPNGA
                     PQPHLGKSYGPGSGLNGLSAPPASQKAPIGPPPKHMKRRTHASNDIDSANAILESVQK
                     RSEAPTPQVGGAPPTSIPKNQPLSEVTSSGTTPAPLAAEQGSSSGIPVEQQPIVDFLS
                     SELGRVTPLIPQEYTKQLKDCNKRLRILFGHLERQDLLTQPTVDKLHSIVALMKERRY
                     ADAMQVHVDIATNHAQEAGNWLTGVKRLIGIAEVTSS"
     gene            <195794..>197944
                     /locus_tag="KLTH0H02156g"
                     /db_xref="GeneID:8294286"
     mRNA            <195794..>197944
                     /locus_tag="KLTH0H02156g"
                     /product="KLTH0H02156p"
                     /transcript_id="XM_002555927.1"
                     /db_xref="GeneID:8294286"
     CDS             195794..197944
                     /locus_tag="KLTH0H02156g"
                     /note="similar to uniprot|P10870 Saccharomyces cerevisiae
                     YDL194W SNF3 glucose sensor"
                     /codon_start=1
                     /product="KLTH0H02156p"
                     /protein_id="XP_002555973.1"
                     /db_xref="GeneID:8294286"
                     /db_xref="GOA:C5E250"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E250"
                     /translation="MAKGKTLKSMHDHAGELEKRSVLDRNVREFSKKLSSLWFKRRLS
                     DKSPQEINMGTGIENEVTNDDGSTGSHLNFNNLESTLFLQPSRPQSSFMSILVGVFVA
                     VGGFLYGYDTGLINNITEMDYVKTHFASNKQQFTAKEMSILVSFLSLGTFVGALAAPF
                     ISDTWGRKSTIIISTFLIFMVGNSLQVAANGTTLLVIGRVFSGVGVGFISAVVPLYQS
                     EAAQKWVRGAIISTYQWAITWGLLVSSAVSQGTHNRQDASSYRIPIGLQFVWSCILGF
                     GMLFLPESPRYYVLKDQLDLAAKSLAFLRGVPEDDSGLLEELVEIKANYDYEMSFGSF
                     SYLDCFKSSKSRTKQKLRMFTGIAIQAFQQFSGINFIFYYGVNFFSKTGIGGSYLVSF
                     ITYAVNVGFNIPGLFLVEYMGRRKVLIFGGILMTAANFVIAIVGCVEKSVIADKIVIA
                     FVCLFIASFSATWGGCVWAISAELYPLGVRSKCTAICAASNWLVNFICALITPYLIDT
                     GNHTSSLGTKIFFIWGSLNAVGVVIVYVAVYETRGLTLEEIDLLYRLSPNSLASDSWN
                     NRIRKAPGTIQQIRNNESRFESEATTVDSHRQNQAPDLGHASQPSASGSSYEDPAPLK
                     RAESPVHNYVDLGNGLALTTYNRGPPSLLMDSSDDGESQIGAEGGSFSRDTDENSSSL
                     NDYMIQWMNCQSQRSCGSNAEKGSHNSHTQGPRT"
     gene            <198169..>199221
                     /locus_tag="KLTH0H02178g"
                     /db_xref="GeneID:8294287"
     mRNA            <198169..>199221
                     /locus_tag="KLTH0H02178g"
                     /product="KLTH0H02178p"
                     /transcript_id="XM_002555928.1"
                     /db_xref="GeneID:8294287"
     CDS             198169..199221
                     /locus_tag="KLTH0H02178g"
                     /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
                     YDL193W NUS1"
                     /codon_start=1
                     /product="KLTH0H02178p"
                     /protein_id="XP_002555974.1"
                     /db_xref="GeneID:8294287"
                     /db_xref="GOA:C5E251"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:C5E251"
                     /translation="MSKIKERVLRAQDDECKTSHRDKQRVSVVTNATRKSGKPGVTDV
                     KGAVGSVLLTPPDSEAVRRKLESQKGVLGKSSGKIEFIFYKILLCVLYMLYACARYTQ
                     YHYNRAKILILNLAYSPSNTPQLIRQDVLKLQKLPKRLAAIVEKKREGDVGGGVSGVL
                     NDGSDLVAWTISAGIKHLALYDFDGHLKRNVDEFRKSVFHKLTKYYDPSNVPKFAIRI
                     PQWNKVYFNAPGQEADDTTSKKVAIEISLLSNRDGRETIIELTRTMADLCAQNEMQLS
                     DITMKLIDSELTQLVGHEPDLLLYFGPNLDLQGFPPWHIRLTEFYWEQDNDQVTYSVF
                     IRGLKKYAACKINVGK"
     gene            <199831..>200376
                     /locus_tag="KLTH0H02200g"
                     /db_xref="GeneID:8294288"
     mRNA            <199831..>200376
                     /locus_tag="KLTH0H02200g"
                     /product="KLTH0H02200p"
                     /transcript_id="XM_002555929.1"
                     /db_xref="GeneID:8294288"
     CDS             199831..200376
                     /locus_tag="KLTH0H02200g"
                     /note="highly similar to uniprot|P11076 Saccharomyces
                     cerevisiae YDL192W ARF1 ADP-ribosylation factor GTPase of
                     the Ras superfamily involved in regulation of coated
                     formation vesicles in intracellular trafficking within the
                     Golgi functionally interchangeable with Arf2p"
                     /codon_start=1
                     /product="KLTH0H02200p"
                     /protein_id="XP_002555975.1"
                     /db_xref="GeneID:8294288"
                     /db_xref="GOA:C5E252"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E252"
                     /translation="MGLYISKLFNSLVGSKEMRILMVGLDGAGKTTVLYKLKLGEVVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISE
                     AREVLQRMLNEDEIRNAALLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWFIQATCA
                     TSGEGLYEGLEWLSNSLKNQN"
     gene            <201281..>201826
                     /locus_tag="KLTH0H02222g"
                     /db_xref="GeneID:8294289"
     mRNA            <201281..>201826
                     /locus_tag="KLTH0H02222g"
                     /product="KLTH0H02222p"
                     /transcript_id="XM_002555930.1"
                     /db_xref="GeneID:8294289"
     CDS             201281..201826
                     /locus_tag="KLTH0H02222g"
                     /note="highly similar to uniprot|P19146 Saccharomyces
                     cerevisiae YDL137W ARF2 ADP-ribosylation factor GTPase of
                     the Ras superfamily involved in regulation of coated
                     formation vesicles in intracellular trafficking within the
                     Golgi functionally interchangeable with Arf1p"
                     /codon_start=1
                     /product="KLTH0H02222p"
                     /protein_id="XP_002555976.1"
                     /db_xref="GeneID:8294289"
                     /db_xref="GOA:C5E253"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E253"
                     /translation="MGTSFSKLFSSLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVT
                     TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISE
                     AREVLQRMLNEDEIRNAVLLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWFIQATCA
                     TSGEGLYEGLEWLSNNLKNQS"
     gene            <203853..>204632
                     /locus_tag="KLTH0H02244g"
                     /db_xref="GeneID:8294290"
     mRNA            join(<203853..203855,204273..>204632)
                     /locus_tag="KLTH0H02244g"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_002555931.1"
                     /db_xref="GeneID:8294290"
     CDS             join(203853..203855,204273..204632)
                     /locus_tag="KLTH0H02244g"
                     /note="highly similar to uniprot|P39741 Saccharomyces
                     cerevisiae YDL191W RPL35A and YDL136W RPL35B, proteins
                     component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_002555977.1"
                     /db_xref="GeneID:8294290"
                     /db_xref="GOA:C5E254"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="UniProtKB/TrEMBL:C5E254"
                     /translation="MAGIKAYELRTKSKEQLESQLLDLKKELAALKVQKLSRPSLPKI
                     HTVRKDIARVLTIVNENQRNAVKELYKGAKYQPKDMRAKKTRALRRALTKFEASRTTE
                     KQRKKQIAFPQRKFAIKA"
     gene            complement(<204726..>207569)
                     /locus_tag="KLTH0H02266g"
                     /db_xref="GeneID:8294291"
     mRNA            complement(<204726..>207569)
                     /locus_tag="KLTH0H02266g"
                     /product="KLTH0H02266p"
                     /transcript_id="XM_002555932.1"
                     /db_xref="GeneID:8294291"
     CDS             complement(204726..207569)
                     /locus_tag="KLTH0H02266g"
                     /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
                     YPR105C COG4 component of oligomeric Golgi complex"
                     /codon_start=1
                     /product="KLTH0H02266p"
                     /protein_id="XP_002555978.1"
                     /db_xref="GeneID:8294291"
                     /db_xref="GOA:C5E255"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:C5E255"
                     /translation="MASFEDILLVTKNPADPRGYAVLPEEFEEPLDANQVDAILLYQL
                     VENPNLPLQPFVYLKDCFQKVQQQKRLLKKSQQDIEALQEIDRLVVGYGLILFQVEEF
                     SHGDGNFLTYMKGIVARVDDYTDFLTQLINRATQEDTLMEFIENFFVTLKKYIDSLGL
                     FNLNDSLNFSSVLTLFELFVSFKPVAASFTKISGFFAAYNAKPNDFEKVTLLGPILTL
                     SPLNASVALQNYGDNLERSQQQTNMIHESLQTQHKMVLDRLFYIVDKIIRGSVESRTD
                     VLTYFAQIINKNHLRRGDHAQLNKLASNAFVSNIALLLVRFSQPFLDVSYRKIDKIDV
                     NYFNNLNLFLDLSSETRMNSDFKEADEFYDKNKKSEDNKPNFISDCFFLTLAYLHYGI
                     GGTLLYDEKVSPQIKRMREEVERITRATQSGDMFARFASMQLPALEKNLQTMQSIQQT
                     LQGFFSHKSLQLEVFEFISGACTFLVRVIDPNHQYPHKQIKLPLIPDQVGVENVDNAD
                     YLREHAPVPFKYYPEFVIEGIINYAQYISKYSLNPMFGNPRLHSFVEMATVILRCPEL
                     VSNPHLKGKLVQVLSIGAMPIRDNTPGFMMGIFENNELVRENLLYALLDFYVIVEKTG
                     SSSQFYDKFNSRYSISIILEEIYQFSEYRRQIIWQSQSNADFFVRFVARMLNDLTFLL
                     DEGLSSLAEVHNIQRELENRVRGSAPTREENDQELQSKLASAERQAKSSCGLAEKSIT
                     LFNIFSKDIPSAFCTPEIVDRLAGMLDYNLASLVGPKCRELKVKNPKKYSFDAKSLLR
                     SLCTVYTNLADQPEFISAVAKDGRSFNKELFDRSVHILGNKTGLVNDEFCVKLLQFAR
                     DAQDQKVAEEEADLEMGEAPDEFLDPLMFTLMKDPVILPASRVTIDRSTIKAHLLSDS
                     TDPFNRMPLKLEDVIPNEELKHRIEMFRRNKRE"
     gene            <207932..>208915
                     /locus_tag="KLTH0H02288g"
                     /db_xref="GeneID:8294292"
     mRNA            <207932..>208915
                     /locus_tag="KLTH0H02288g"
                     /product="KLTH0H02288p"
                     /transcript_id="XM_002555933.1"
                     /db_xref="GeneID:8294292"
     CDS             207932..208915
                     /locus_tag="KLTH0H02288g"
                     /note="some similarities with uniprot|Q870H2 Saccharomyces
                     cerevisiae YDL189W RBS1 Protein of unknown function
                     identified as a high copy suppressor of psk1 psk2
                     mutations that confer temperature-sensitivity for
                     galactose utilization proposed to bind single-stranded
                     nucleic acids via its R3H domain"
                     /codon_start=1
                     /product="KLTH0H02288p"
                     /protein_id="XP_002555979.1"
                     /db_xref="GeneID:8294292"
                     /db_xref="GOA:C5E256"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:C5E256"
                     /translation="MTSNNGMAIGKLTPALVAALFERAHDKQFIIQLENSMVEFMGSP
                     AEAYQLEPMNSYYRLLAHHVAEYHGLGHSLSRNNDACVVVFKGETFLRDKSIVLLQNL
                     DPSCVTNAVDTQRSESKQSASKSMIAQETRQVYNSAGLKPLAAVSEKEGTRTPETPST
                     PKKPIPIEDDSPQPHQFETSRYRFRQQSEKPRRRKNYKGSTNRTAQPVYFPPPPAFPV
                     PYMLYNPYPMMFVPPERQFSQFAPVAPVGQYPNPNPFIYGHPAHNKVEPYGPNGSSST
                     FSSMRTYKTEDSESLESLSKDASEKQEPRMSRKDSETSVGKISDKMDKLGL"
     gene            complement(<209037..>209639)
                     /locus_tag="KLTH0H02310g"
                     /db_xref="GeneID:8294293"
     mRNA            complement(<209037..>209639)
                     /locus_tag="KLTH0H02310g"
                     /product="KLTH0H02310p"
                     /transcript_id="XM_002555934.1"
                     /db_xref="GeneID:8294293"
     CDS             complement(209037..209639)
                     /locus_tag="KLTH0H02310g"
                     /note="highly similar to uniprot|Q12434 Saccharomyces
                     cerevisiae YDL135C RDI1 Rho GDP dissociation inhibitor"
                     /codon_start=1
                     /product="KLTH0H02310p"
                     /protein_id="XP_002555980.1"
                     /db_xref="GeneID:8294293"
                     /db_xref="GOA:C5E257"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="UniProtKB/TrEMBL:C5E257"
                     /translation="MSDDTEFKEFQDENPDRYKVSAKKTLAEYQKLDAEDESLAKWKE
                     SLGLSSDTLPLEFPGDKRKVVIQKIQLLVDTESQPITFDLTNDQTLKELASTRHKIKE
                     KSIYKLKITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTTKKPFYEVELP
                     ESEAPSGFLARGSYSAISKFIDDDKTNHLTLNWGVEIVKK"
     gene            <209858..>210418
                     /locus_tag="KLTH0H02332g"
                     /db_xref="GeneID:8294294"
     mRNA            <209858..>210418
                     /locus_tag="KLTH0H02332g"
                     /product="KLTH0H02332p"
                     /transcript_id="XM_002555935.1"
                     /db_xref="GeneID:8294294"
     CDS             209858..210418
                     /locus_tag="KLTH0H02332g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H02332p"
                     /protein_id="XP_002555981.1"
                     /db_xref="GeneID:8294294"
                     /db_xref="InterPro:IPR018020"
                     /db_xref="UniProtKB/TrEMBL:C5E258"
                     /translation="MSLPEFNTFKAADTDFQTAVLETLFEKSNSLIKLTLEDEQFMNA
                     VGSSYSEFIEKVRERLVQLCESQGQQESEESRRSELSDIIAAHPKLGEPKKGLSVHSQ
                     NEQRNLGNGDTLEVQQALKHLNEVYEQHYPGLRFVVFVNGRSRPEIIRVMEGRINSGN
                     AWLEEAGLACNEMCDIANDRVLKYVQ"
     gene            complement(<210576..>211646)
                     /locus_tag="KLTH0H02354g"
                     /db_xref="GeneID:8294295"
     mRNA            complement(<210576..>211646)
                     /locus_tag="KLTH0H02354g"
                     /product="KLTH0H02354p"
                     /transcript_id="XM_002555936.1"
                     /db_xref="GeneID:8294295"
     CDS             complement(210576..211646)
                     /locus_tag="KLTH0H02354g"
                     /note="highly similar to uniprot|P23594 Saccharomyces
                     cerevisiae YDL134C PPH21 Catalytic subunit of protein
                     phosphatase 2A functionally redundant with Pph22p
                     methylated at C terminus forms alternate complexes with
                     several regulatory subunits involved in signal
                     transduction and regulation of mitosis"
                     /codon_start=1
                     /product="KLTH0H02354p"
                     /protein_id="XP_002555982.1"
                     /db_xref="GeneID:8294295"
                     /db_xref="GOA:C5E259"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5E259"
                     /translation="MEIDSDVPMQDATEETLDPTLDEDALSKAQEGPGSSGIADHKAS
                     KPLQLDSGNIGQLDQWIEHLGKCQVLSEDDVSRLCKMAVDVLQFEENVQPVNVPVTIC
                     GDVHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPKRITI
                     LRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKVFCLHGGLS
                     PMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFN
                     HTNDLSLIARAHQLVMEGYAWSHQQSVVTIFSAPNYCYRCGNQAAIMEMDENHNRQFL
                     QYDPSMRPGEPTVSRKTPDYFL"
     gene            <212454..>213176
                     /locus_tag="KLTH0H02376g"
                     /db_xref="GeneID:8294296"
     mRNA            <212454..>213176
                     /locus_tag="KLTH0H02376g"
                     /product="KLTH0H02376p"
                     /transcript_id="XM_002555937.1"
                     /db_xref="GeneID:8294296"
     CDS             212454..213176
                     /locus_tag="KLTH0H02376g"
                     /note="some similarities with uniprot|P48568 Saccharomyces
                     cerevisiae YDL186W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H02376p"
                     /protein_id="XP_002555983.1"
                     /db_xref="GeneID:8294296"
                     /db_xref="UniProtKB/TrEMBL:C5E260"
                     /translation="MSVLERPLSHNSPVFVPSPECTARAYTLPANTTGVRQLVIRKQN
                     GRVVAAKSQLIDRMEDALVRWRPPASCHAGSTAALKGKHPYQQELDTDVDLTSVPLHA
                     SLDSIRHYFDNLGHTISRPCSQRPPKTEQLAGSTQSPASSPASSASGMAVQIRQSVQS
                     AGTRGTTPRAMAYDADPDNIEARPASYSFPIPAYYLPHTDACPVGESTRENNEEAHGC
                     WAQWTTFWDELCDDLAALCSCN"
     gene            <214364..>216220
                     /locus_tag="KLTH0H02398g"
                     /db_xref="GeneID:8294297"
     mRNA            <214364..>216220
                     /locus_tag="KLTH0H02398g"
                     /product="KLTH0H02398p"
                     /transcript_id="XM_002555938.1"
                     /db_xref="GeneID:8294297"
     CDS             214364..216220
                     /locus_tag="KLTH0H02398g"
                     /note="uniprot|Q8J0L0 VMA1 Putative vacuolar membrane
                     H-ATPase"
                     /codon_start=1
                     /product="KLTH0H02398p"
                     /protein_id="XP_002555984.1"
                     /db_xref="GeneID:8294297"
                     /db_xref="GOA:C5E261"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005725"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022878"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E261"
                     /translation="MAGAMENARKEIKRLSLEDHSESEYGSIYSVSGPVIVAENMIGC
                     AMYELVKVGHDNLVGEVIRIEADRATIQVYEETAGVTVGDPVLRTGKPLSVELGPGLM
                     ETIYDGIQRPLKAIKDKAQSIYIPRGIDAPALSRDIKWQFKPSADKKVGDHIAGGDIF
                     GSIFENSLLEDHKILLPPRARGTITWIAPAGDYTIDEKVLEVEFDGVKYDYTMYHTWP
                     VRVPRPVTEKLSADYPLLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSN
                     SDAIIYVGCGERGNEMAEVLMEFPELFTERNGKKEPIMKRTTLVANTSNMPVAAREAS
                     IYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLAS
                     FYERAGKAVALGSPDRIGSVSIVAAVSPAGGDFSDPVTTSTLGITQVFWGLDKKLAQR
                     KHFPSINTSVSYSKYTNVLDKYYDEHYPEFPQLRNRIREILSNAEELEQVVQLVGKSA
                     LSDSDKITLDVATLIKEDFLQQNGYSTYDAFCPVWKTYDMMKAFISYHEEAQKSIANG
                     ANWAKLADATGDVKHAVSSSKFFEPSRGEQEVHGEFEKLFSNIQERFAESTD"
     gene            complement(<217847..>218743)
                     /locus_tag="KLTH0H02420g"
                     /db_xref="GeneID:8294298"
     mRNA            complement(<217847..>218743)
                     /locus_tag="KLTH0H02420g"
                     /product="KLTH0H02420p"
                     /transcript_id="XM_002555939.1"
                     /db_xref="GeneID:8294298"
     CDS             complement(217847..218743)
                     /locus_tag="KLTH0H02420g"
                     /note="similar to uniprot|P48569 Saccharomyces cerevisiae
                     YDL183C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H02420p"
                     /protein_id="XP_002555985.1"
                     /db_xref="GeneID:8294298"
                     /db_xref="InterPro:IPR018786"
                     /db_xref="UniProtKB/TrEMBL:C5E262"
                     /translation="MSTAGPSGLGKRLLSQGLPPQRATVQKYVLDPVKLIAIPITNKR
                     IFLYHKHSSEILNMNSRIVRYETRITEKARKIWSKLEKSPREINQKLVRMVNSQLDKT
                     PWTEDSLNTVPSEGYILKTVMENQESRNLTYQEWFKNVDKLDVRPVCMYYPQSVMSER
                     AVREQLKSLWDHGLNYHKKQMWLSILGLPLTLPVVLVPVVPNVPGFYLLYRAYRNFKA
                     FCGAKHLKSLVENKSHKLVFTDLPQFSDILRSETEIPEEHLVLNEKNLERVLDMLQIH
                     ELRAPLEKAVLQERKRLDGHRK"
     gene            <219117..>220556
                     /locus_tag="KLTH0H02442g"
                     /db_xref="GeneID:8294299"
     mRNA            <219117..>220556
                     /locus_tag="KLTH0H02442g"
                     /product="KLTH0H02442p"
                     /transcript_id="XM_002555940.1"
                     /db_xref="GeneID:8294299"
     CDS             219117..220556
                     /locus_tag="KLTH0H02442g"
                     /note="similar to uniprot|Q12516 Saccharomyces cerevisiae
                     YDL133W"
                     /codon_start=1
                     /product="KLTH0H02442p"
                     /protein_id="XP_002555986.1"
                     /db_xref="GeneID:8294299"
                     /db_xref="UniProtKB/TrEMBL:C5E263"
                     /translation="MSSSRPEGETSNGEKKYSHALDAEPSDFGGQNSRVSQGHSSTAS
                     GSDSRDQDGSRSKFLNSYGLVATTVPPFALDEQLKQQNLRQVQTHSALVAEKELGRYC
                     KDPFLVSHNLRWGPFAENVGSNAAYFNKATKPATGSPGFTLYEDDAGPSSSAVSTKEE
                     EDQDINKTAGESSSYEEDKSVSKQTRTEAPHDVFADLNGSWGGSERLNAIFNGPLLDS
                     DKLTSHKDRNDWSEYLESVKAFYYTNGPLNQDLEAGLRREGSSNLDDTEENKLHTFLE
                     KQRSDFKETRKHWRQLERQKKQKWVPTLRKLLLDSQYLPLSFRMFIVILSAIALGLAI
                     RIFQNSKGELEFSGSSVPQQASTIMAICVNSIAVLYLFYIAYDEFSGKPLGLRDPVGK
                     LRLILLDLLFIIFSSANLALTFNTLYDKQWVCTEGKYSEDELPKMEYICRKQRALASF
                     LFVVLFMWVVTFTVSILRVVEKMSSGSPR"
     gene            <220805..>223228
                     /locus_tag="KLTH0H02464g"
                     /db_xref="GeneID:8294300"
     mRNA            <220805..>223228
                     /locus_tag="KLTH0H02464g"
                     /product="KLTH0H02464p"
                     /transcript_id="XM_002555941.1"
                     /db_xref="GeneID:8294300"
     CDS             220805..223228
                     /locus_tag="KLTH0H02464g"
                     /note="similar to uniprot|Q12018 Saccharomyces cerevisiae
                     YDL132W CDC53 Cullin structural protein of SCF complexes
                     (which also contain Skp1p Cdc34p and an F-box protein)
                     involved in ubiquitination SCF promotes the G1-S
                     transition by targeting G1 cyclins and the Cln-CDK
                     inhibitor Sic1p for degradation"
                     /codon_start=1
                     /product="KLTH0H02464p"
                     /protein_id="XP_002555987.1"
                     /db_xref="GeneID:8294300"
                     /db_xref="GOA:C5E264"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:C5E264"
                     /translation="MSDTLPRADDLEATWNFVEPGIHQILGRDGTASSTLKRVDKVLS
                     PAMYMEVYTAIYNYCVNKSSSAGQFNTDSSRQNQSSLLVGGEIYQKLKDCLQNYLSGL
                     QRDANESFLQFYVRRWKRFTVGAVFLNHAFDYMNRYWVQKERSDGKRHIFDINTLCLM
                     TWKEVMFDKNVDLLVKEVLEQIELQRDGHVILQTDTTVAIRSFVALGIDPQDLKKLNL
                     NVYIQHFEKPFLESTRQYYRKLSREYLASHSVTEYIFEAQEKIKDEETKIVLYLDEHT
                     KKLLSEALNSVLITDHSEALENEFISLLDSRDENKIATLNSLMQRDILLLPKLAQAYE
                     EYVKKTGEQEISRLLAEHRAKLSENAEENAGSKKSAAGPAVPPNEYVKKLIEVYETFI
                     KITRDCFQNGSLFTKALDNACRAYINANELAIPPGSPKSVTSKTPEMLAKYSDQLLKR
                     SAKATEGASELSADDIMTIFKFLTDKDAFETHYRRLFARRLIHGTSTSEEDEEMVIQR
                     LQSENSMEYTGKITKMLQDIRLSKQLEKEFESAIKIAPDYSRAKYPEFQPFVLAETMW
                     PFSYQDVEFNLPQELVPTHRGLEKLYTNKHNGRVLKWLWPLCRGEVVADIGKPGKPPF
                     IFTVTLFQMAILLAFNDRSTFTLEEIQEHTSLSASNIASSIIPFIRWKLIQQQPPGLD
                     ALSRMDTQFKLSTPYKALKTRINFAAGVKSEAPGSIGGKSGEPSELQKIEKELSTERQ
                     IFLEACIVRIMKARRKLPHATLVNECIAQSHQRFNAKVSLIKRAIDNLIAKEYLQRCD
                     DGESYEYLA"
     gene            <223641..>224963
                     /locus_tag="KLTH0H02486g"
                     /db_xref="GeneID:8294301"
     mRNA            <223641..>224963
                     /locus_tag="KLTH0H02486g"
                     /product="KLTH0H02486p"
                     /transcript_id="XM_002555942.1"
                     /db_xref="GeneID:8294301"
     CDS             223641..224963
                     /locus_tag="KLTH0H02486g"
                     /note="highly similar to uniprot|Q12122 Saccharomyces
                     cerevisiae YDL131W LYS21 and to uniprot|P48570
                     Saccharomyces cerevisiae YDL182W LYS20 homocitrate
                     synthase"
                     /codon_start=1
                     /product="KLTH0H02486p"
                     /protein_id="XP_002555988.1"
                     /db_xref="GeneID:8294301"
                     /db_xref="GOA:C5E265"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5E265"
                     /translation="MSNSGFQQVTESTTQVERPNPYGPNPADYLSNVANFQLIDSTLR
                     EGEQFANAFFTTEKKIEIAKALDDFGVDYIELTSPVASEQSRSDCEAICKLGLKAKIL
                     THIRCHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKG
                     IEIRFSSEDSFRSDLVDLLNIYKTVDSIGVNRVGIADTVGCANPRQVYELLRTLKTVV
                     HCDVECHFHNDTGCAIANAYTALEGGARLIDVAVLGIGERNGITPLGGLMARMIVAAP
                     EYVKSKYKLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYE
                     ILNPHDFGLKRYIHFANRLTGWNAIKSRVDQLNLNMSDEQCKEVTMKIKKLGDIRPLS
                     IDDVDSIIKDFHSEITTPQLRNMDAQGSDDLNNLDISAPAAKKAKKSQ"
     gene            complement(<225069..>225998)
                     /locus_tag="KLTH0H02508g"
                     /db_xref="GeneID:8294302"
     mRNA            complement(<225069..>225998)
                     /locus_tag="KLTH0H02508g"
                     /product="KLTH0H02508p"
                     /transcript_id="XM_002555943.1"
                     /db_xref="GeneID:8294302"
     CDS             complement(225069..225998)
                     /locus_tag="KLTH0H02508g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H02508p"
                     /protein_id="XP_002555989.1"
                     /db_xref="GeneID:8294302"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E266"
                     /translation="MPSAPAPLELASAHDHAVLACRLLRAGSLALSAGLDPHLSLWDL
                     DSGQNYTIDSYHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQLLRGLAGHRRV
                     VNQVRALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYAS
                     GLEPVIRAYDLRRSADHAFSSWPAAHSDAVTSLDVSASGKLCTLAFDHQIHVSDAKLE
                     PTREGSRLLASATLPASANPHKFLQRCKFVRQDRFVAAQGSLFDATSGRQVLDFASQV
                     SARAFDVIDMDYDSRSDKLLISTEQGSLYVCQV"
     gene            <226577..>226873
                     /locus_tag="KLTH0H02530g"
                     /db_xref="GeneID:8294303"
     mRNA            <226577..>226873
                     /locus_tag="KLTH0H02530g"
                     /product="KLTH0H02530p"
                     /transcript_id="XM_002555944.1"
                     /db_xref="GeneID:8294303"
     CDS             226577..226873
                     /locus_tag="KLTH0H02530g"
                     /note="some similarities with uniprot|P01097 Saccharomyces
                     cerevisiae YDL181W"
                     /codon_start=1
                     /product="KLTH0H02530p"
                     /protein_id="XP_002555990.1"
                     /db_xref="GeneID:8294303"
                     /db_xref="GOA:C5E267"
                     /db_xref="InterPro:IPR007648"
                     /db_xref="UniProtKB/TrEMBL:C5E267"
                     /translation="MLSQSARASLKKSLKLQLPAMPAMPAVGGRFYSEGSVGSPRGEG
                     ADDSFVRRERAQEDYFIRQHEKEQLEKLRQQVKQQQQKIEHLEGRLGDKLKEGQ"
     gene            <227237..>227523
                     /locus_tag="KLTH0H02552g"
                     /db_xref="GeneID:8294304"
     mRNA            join(<227237..227276,227330..>227523)
                     /locus_tag="KLTH0H02552g"
                     /product="KLTH0H02552p"
                     /transcript_id="XM_002555945.1"
                     /db_xref="GeneID:8294304"
     CDS             join(227237..227276,227330..227523)
                     /locus_tag="KLTH0H02552g"
                     /note="similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
                     YMR194C-B"
                     /codon_start=1
                     /product="KLTH0H02552p"
                     /protein_id="XP_002555991.1"
                     /db_xref="GeneID:8294304"
                     /db_xref="GOA:C5E268"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR027179"
                     /translation="MTDPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKFYNER
                     GADARTPCCPVPSLLRLKLEQRACGPLDAKRVR"
     gene            complement(<227944..>228507)
                     /locus_tag="KLTH0H02574g"
                     /db_xref="GeneID:8294305"
     mRNA            complement(<227944..>228507)
                     /locus_tag="KLTH0H02574g"
                     /product="KLTH0H02574p"
                     /transcript_id="XM_002555946.1"
                     /db_xref="GeneID:8294305"
     CDS             complement(227944..228507)
                     /locus_tag="KLTH0H02574g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H02574p"
                     /protein_id="XP_002555992.1"
                     /db_xref="GeneID:8294305"
                     /db_xref="UniProtKB/TrEMBL:C5E269"
                     /translation="MLRSTRRYYSTPPTYFGSLGPRLAPATPAAPMAPFHAPREPARK
                     PFLELATLFSVLALSFFAVDNYRARLAAELRLEEQALKARQAQELIAKQMNAQRKKRE
                     LQILNERKLVQTRQMKVALHVAMLRKQLLDVGLAPATIEDALQEFERSVRMENSISNV
                     SGTRLWVTDESPAKQFVPDVREYEARD"
     gene            complement(<228747..>229425)
                     /locus_tag="KLTH0H02596g"
                     /db_xref="GeneID:8294306"
     mRNA            complement(join(<228747..229033,229410..>229425))
                     /locus_tag="KLTH0H02596g"
                     /product="60S ribosomal protein L36"
                     /transcript_id="XM_002555947.1"
                     /db_xref="GeneID:8294306"
     CDS             complement(join(228747..229033,229410..229425))
                     /locus_tag="KLTH0H02596g"
                     /note="highly similar to uniprot|P05745 Saccharomyces
                     cerevisiae YMR194W RPL36A and to uniprot|O14455
                     Saccharomyces cerevisiae YPL249C-A RPL36B Proteins
                     component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_002555993.1"
                     /db_xref="GeneID:8294306"
                     /db_xref="GOA:C5E270"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:C5E270"
                     /translation="MAVKSGIATGLNKGKKVTQMTPAPKISYRKGASSNRTKFVRSLV
                     KEVAGLAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNDIITASRRH"
     gene            complement(<229993..>230814)
                     /locus_tag="KLTH0H02618g"
                     /db_xref="GeneID:8294307"
     mRNA            complement(<229993..>230814)
                     /locus_tag="KLTH0H02618g"
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /transcript_id="XM_002555948.1"
                     /db_xref="GeneID:8294307"
     CDS             complement(229993..230814)
                     /locus_tag="KLTH0H02618g"
                     /note="similar to uniprot|P36525 Saccharomyces cerevisiae
                     YMR193W MRPL24 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /protein_id="XP_002555994.1"
                     /db_xref="GeneID:8294307"
                     /db_xref="GOA:C5E271"
                     /db_xref="InterPro:IPR001383"
                     /db_xref="InterPro:IPR026569"
                     /db_xref="UniProtKB/TrEMBL:C5E271"
                     /translation="MLEHRHGDPRASDTTQAMSVNWPRLQRGFSTIPCLFREWRLVEC
                     RNVAKKPDYKVGDARPIFVPKARKAFPDYEFGESQIFKQSNKGLYGGSFIQYGNNVAE
                     SKTKTRRRWLPNVIKKGLWSEALSRNVSIRMTAKVLRTVTKEGGIDNYLTKEKSARIK
                     ELGPTGWKLRYRVLQRQELRENPPHKDAAVVRGIDGAEHTVYFEEALDGETVRVTCGR
                     RKLLQLLYPLEKLEHRADGETLTYKQFLDAYAGTSVRDILAALSSYGFDLKTITV"
     gene            complement(<230918..>233359)
                     /locus_tag="KLTH0H02640g"
                     /db_xref="GeneID:8294308"
     mRNA            complement(<230918..>233359)
                     /locus_tag="KLTH0H02640g"
                     /product="KLTH0H02640p"
                     /transcript_id="XM_002555949.1"
                     /db_xref="GeneID:8294308"
     CDS             complement(230918..233359)
                     /locus_tag="KLTH0H02640g"
                     /note="weakly similar to uniprot|Q12344 Saccharomyces
                     cerevisiae YPL249C GYP5 GTPase-activating protein (GAP)
                     for yeast Rab family members Ypt1p is the preferred in
                     vitro substrate but also acts on Sec4p involved in ER to
                     Golgi trafficking interacts with the yeast amphiphysins
                     Rvs161p and Rvs167p"
                     /codon_start=1
                     /product="KLTH0H02640p"
                     /protein_id="XP_002555995.1"
                     /db_xref="GeneID:8294308"
                     /db_xref="GOA:C5E272"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5E272"
                     /translation="MSDTQSTEVPSLKDVEAFDRNEEESGVTEEMRTEVSDAALMSPA
                     AEEAPANASQTESDLKPKITPATSDLTNQASLVESDLTEELQQKAPENADHSPQTLDS
                     EQQDDSDRSSAHSELNFAAYEEDTGEDYNAETTNPSAINDDSGVGDEDQNHDLIHSSP
                     EKLDGPDHTVKQVDQETAPPPLLPDGSGARPLPALPPRSLNTSSPPLPPRGSAALPAS
                     TLKKSQVHPVPPPLSEELKSEKFRKNAALTHAQPSPPSLPPRSGHKRSASADFDLVIS
                     RFNDYEEEYLSKDGVTQESLQEGTRMLKSSYTAFLETISAEKEPSQDPEEHRELVEID
                     WPFWTRLVNNYAEVAKKDSVKLEQEITGGIPPQIRGIIWQLMANTKSKGVEEIYGALE
                     ACESPHEKAIQRDILRTNYIPDDKTDSLFNVLKAYSIYDDAVGYTQGMGFITTALILN
                     VESEAEAFGLLISLMKGYGLRDLFLPGMPGLHVKLYQFDRLLEENSPSLYYHLARQGV
                     RSSMYASQWFLTCFAYRFPLCFVLRIFDIILVEGVDAILKFAVVLMIRNEKTLLALQF
                     DQLLEFLKDGLFAYYLKDSVKERRRAKATKGDSGSTVSLLSRAIPKKESSPEITDEDY
                     DIDAFVEDAMKEVQITPITLKRYVAEYEEIHLLESQKEAQFEALRIKNKQLHNEVRKL
                     EHDHTILNREHISIANELIENRLAMETLQDENRDLVAEVAHLKTQLKEEVRKRSLPNP
                     DAELPTDLKADLQETMARNLQVMSENQELQDKIAQLEQEVALLRQSPSHRCEPGAGQK
                     PANLGNWKGLRKVWK"
     gene            complement(<233610..>234716)
                     /locus_tag="KLTH0H02662g"
                     /db_xref="GeneID:8294309"
     mRNA            complement(<233610..>234716)
                     /locus_tag="KLTH0H02662g"
                     /product="KLTH0H02662p"
                     /transcript_id="XM_002555950.1"
                     /db_xref="GeneID:8294309"
     CDS             complement(233610..234716)
                     /locus_tag="KLTH0H02662g"
                     /note="weakly similar to uniprot|P42933 Saccharomyces
                     cerevisiae YMR191W SPG5 Protein required for survival at
                     high temperature during stationary phase not required for
                     growth on nonfermentable carbon sources"
                     /codon_start=1
                     /product="KLTH0H02662p"
                     /protein_id="XP_002555996.1"
                     /db_xref="GeneID:8294309"
                     /db_xref="UniProtKB/TrEMBL:C5E273"
                     /translation="MSANSWRQWLKLTKRQLKQIRQTLDDEIQTVLERNIPRPQKSLV
                     RIPVSTRPSAGFRNGSRYIHTQTQNVARGTGNAQSVGYARSVQGGARGTRPVLSSFNG
                     MYRAPGGVPRGLFSNWNMTTSRFKSGRAYSTSAIKITHDAVQNLSISLRCFYNLWDDF
                     LPANESADCQRVPLQACQAPKRSLGAREVSTVRAMEVFRMIQAHKQDLPPSILEELDA
                     MGCVVQFELPHLDMSTMPSMVFASDEALNEWRDKMVACHAKLRHIEESVRKIYEHYGA
                     LPLEFGESFVRVRFPNITAPEAEILMRDLGLTLGLVLPEPQPSTEPSSSPECFEYCSN
                     FSASYCGSSRCASQFAPVLSTPSESSFSVLSSQG"
     gene            complement(<235527..>237776)
                     /locus_tag="KLTH0H02684g"
                     /db_xref="GeneID:8294310"
     mRNA            complement(<235527..>237776)
                     /locus_tag="KLTH0H02684g"
                     /product="KLTH0H02684p"
                     /transcript_id="XM_002555951.1"
                     /db_xref="GeneID:8294310"
     CDS             complement(235527..237776)
                     /locus_tag="KLTH0H02684g"
                     /note="weakly similar to uniprot|P04386 Saccharomyces
                     cerevisiae YPL248C GAL4 DNA-binding transcription factor
                     required for the activation of the GAL genes in response
                     to galactose repressed by Gal80p and activated by Gal3p"
                     /codon_start=1
                     /product="KLTH0H02684p"
                     /protein_id="XP_002555997.1"
                     /db_xref="GeneID:8294310"
                     /db_xref="GOA:C5E274"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR005600"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E274"
                     /translation="MFSLDEAEQACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKK
                     VRSPLTRAHLTEVENRLHQLERLFGTLFPGYDWKDTSKDPSLSKLRHMLKNQKDQYER
                     TLPITTDNLHAPSNVPSHPSQRPPLDQLPRDPLFGFEWSEEEDSQFLQNDGMGVLNVN
                     INNKGYFGVGSNSVLLRALYVVDSLFTIQRVPSSSEDLSILSSKQIMDEYVEAYFGQF
                     HAAFPIVDESYFRLCYAKKIIPTSEKAWQTLLYAVLALGSWSVVGEDSNIDIEYYKSA
                     KYHLCSSVFETGSHSLLASLVLLSNYTQKRNKPNTSWNYLGLAASMAISLGLHREMRD
                     SARTDNSGLEIRRRMWWVLYGYDCSMAMTFGRPGQLPKLPDVDILLPSNLDKNGVEVD
                     SPTEFSFIIETAKLTKNAHKIISSSTGPYANLAETLKCHQKLDDLANKLPDYFSTGFA
                     RWHQKLGADNKWFPLNRFRLRWMYYNLTITIFRPLFLGILNGEKVRVDNHDFTKCLNL
                     CHEAAGSTIESVSEFVSHYKLTTLSAWYATFFLVSATIIPAVGLVTEPGSSQAARWKL
                     RVTTARNTFDVLKEKNATAEKFIHVIDSVCGYLLDTSEALSSTPKSFSSILHTEKRPG
                     VAGTSSQQPTKDKSMTSISDLANILSPRDFTIPTDTVRSGSSETPDIAVQPENQDEDP
                     FAWRSSSAQPLKQDATVFPNWNDQSVQTLFNPGTSNMFNTTTMDDIFNYVFNDNELAP
                     SISNSSNQS"
     gene            <238367..>242578
                     /locus_tag="KLTH0H02706g"
                     /db_xref="GeneID:8294311"
     mRNA            <238367..>242578
                     /locus_tag="KLTH0H02706g"
                     /product="KLTH0H02706p"
                     /transcript_id="XM_002555952.1"
                     /db_xref="GeneID:8294311"
     CDS             238367..242578
                     /locus_tag="KLTH0H02706g"
                     /note="similar to uniprot|P35187 Saccharomyces cerevisiae
                     YMR190C SGS1 Nucleolar DNA helicase of the RecQ family,
                     involved in maintenance of genome integrity"
                     /codon_start=1
                     /product="KLTH0H02706p"
                     /protein_id="XP_002555998.1"
                     /db_xref="GeneID:8294311"
                     /db_xref="GOA:C5E275"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR022758"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E275"
                     /translation="MQDNLRAQINWLKKEKAYQPKNEFLLRLLSSDVGGKKQKSQNGS
                     EAQSQPEMSVIDLTADSRTIKASSDLGSSARVWNASAVFSTIEGNSTQRPGISYSNPA
                     VTSRFGRTSESTQHSQKPASLPATSYVESGSLSANHISDQSSDAVRRTPNRQASLAEL
                     VPLQDRVIELLKKQTGLLMHKCSIIESTSLSEDAKRVKIQSEVNPSLSTLESEIRTAG
                     SLVEAMKSEASHPVARTVGNLATTITHTPAISTVSIRTVANNSILRPPPRPQAPVVGV
                     PQDLITVLDDDDDDDDDDVDVDGEEEPRVIAKVHTSAIGTEDRSSNPAKRSLRPHKEI
                     NYRIPELEDSLNYNMKPALAQSRQEDNAEEDTTMEAELEDSQFLLTAEEEHDEIHTSD
                     HDFVADGLENLLDETDDGEYHEAVSNADGINSSQGGTFPEGPTQGSTFAGELSNIEVI
                     GSSPVRQISEHQEYSRPKTPELDLVGTGYADDPEFDPIVDSIQQTFPNSYAHRSPVTG
                     SITDNNIGRNQALQNSIDDTFTHSDSDDFEDFDAERENLTQKSGIRKLDDDLKIISEQ
                     KLDVSNARPSNIKQEVINVESLLDEGVENFQGGALSLSSIGAAGHGNTGPQFEWTAEV
                     YHRLHNVFKLPGFRPNQLEAINASLEGKDVFVLMPTGGGKSLCYQLPAVVRSGKTSGT
                     TVVISPLISLMQDQVEHLLAKNIKACMFSSKGTADQKRQTFNLFINGLLDLIYISPEM
                     ISASEQCKKAIGKLYRDKKLARIVVDEAHCVSNWGHDFRPDYKELKYFKREYPDIPMI
                     ALTATASEQVRLDIVHNLQLNNPVFLKQSFNRTNLYYEVLKKSKNVVFDICNAVKTRF
                     KNQTGIIYCHSKNSCEQTASLLQRNGINSAYYHAGMEPDERLEVQQAWQANRIRIICA
                     TVAFGMGIDKPDVRFVYHLTIPRTLEGYYQETGRAGRDGKFSFCIMYYTFRDVRTMQT
                     MIQKDKNLDRENKEKHLTKLQQVMQYCENLADCRRQLVLSYFNENFDSALCRRNCDNC
                     KNSINTTTEERDVTHEALNIVKLVSSVQGDKVTLIHCQDIYKGSRNSKIVQAGHDQLE
                     YHGMGKALPKSDIERVFFRLVTTQILQEYTVMNGRGFASNYLKVGPKATQLLNGNLKI
                     VMQFAAAGESGSRQSSVPPAPATRAASTEFRKGHTNARQTTSSGSLARKTSSLIPDLG
                     GFVYDDNGAGASSAPKKVSRPIVLGDKTNLLSHQEQLSVTSAYQELKERAISTARELR
                     FNGFMSVISETALRKAAVVLPSTEQQFRQLPGLTSTQAQHYHFFKDLFVRLNVLRKSL
                     PKDSSQRLSQTQTTSPFFHGPGASENNEERERDEEILRQIRDSQAPSRTSAVGKAPGT
                     KPAGSQSKARRGRKSKWHSKSWSKR"
     gene            complement(<242682..>244436)
                     /locus_tag="KLTH0H02728g"
                     /db_xref="GeneID:8294312"
     mRNA            complement(<242682..>244436)
                     /locus_tag="KLTH0H02728g"
                     /product="KLTH0H02728p"
                     /transcript_id="XM_002555953.1"
                     /db_xref="GeneID:8294312"
     CDS             complement(242682..244436)
                     /locus_tag="KLTH0H02728g"
                     /note="similar to uniprot|P39709 Saccharomyces cerevisiae
                     YAL067C SEO1 Putative permease member of the allantoate
                     transporter subfamily of the major facilitator superfamily
                     mutation confers resistance to ethionine sulfoxide"
                     /codon_start=1
                     /product="KLTH0H02728p"
                     /protein_id="XP_002555999.1"
                     /db_xref="GeneID:8294312"
                     /db_xref="GOA:C5E276"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5E276"
                     /translation="MEVVKTSLTNFSKEWVVEPYARLKWGFIPVRRIVDENEVESEEE
                     HSEQVVEEAFSDKQVSDDRKTELEVEQKSSVSNSGGAGEMEYRDEANRKWWSFFNEQE
                     YRMPQKRANSAKWWQWFGSDVPAQEKKLLLKLDILLAFYSCMAYWVKYLDTANLNNAY
                     VSGLKEELNFKGNELVETQAMYTVGNIVFQLPFIFFLDKVPLNYVLPALDLCWSILTI
                     GASQVDSVPHLKAIRFFIGVFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYAGIL
                     SASGIQSAIYAAMDGKHGLSGWRWNFIVDGLISVVVGLIGFYSLPGDPHNCYSIFLTD
                     DEIRLARKRLRENNTDKSDFSSKVLDKAVWKRIFTNWRIYVLTLWNIFCWNNNNGTSG
                     AYLLWVKSLKKYSVAKVNQLGMITPALGMVYLFGTGVFADKLHSRWGAIIVTQIFNFI
                     GNVILAVWAVPESAKWFAFMLQYFGWAMAPVLYSWQNDICRRDSQARAITLVVMNMLA
                     QTTTAFMSVLVWKTTEAPRYLKGYTWTAVCAFCLSAWTILVLWLYKRDEKQHAEENGI
                     IIYNSKTGENYPPEKQNA"
     gene            complement(<245136..>248195)
                     /locus_tag="KLTH0H02750g"
                     /db_xref="GeneID:8294313"
     mRNA            complement(<245136..>248195)
                     /locus_tag="KLTH0H02750g"
                     /product="KLTH0H02750p"
                     /transcript_id="XM_002555954.1"
                     /db_xref="GeneID:8294313"
     CDS             complement(245136..248195)
                     /locus_tag="KLTH0H02750g"
                     /note="highly similar to uniprot|P49095 Saccharomyces
                     cerevisiae YMR189W GCV2 P subunit of the mitochondrial
                     glycine decarboxylase complex required for the catabolism
                     of glycine to 5 10-methylene-THF expression is regulated
                     by levels of levels of 5 10-methylene-THF in the
                     cytoplasm"
                     /codon_start=1
                     /product="KLTH0H02750p"
                     /protein_id="XP_002556000.1"
                     /db_xref="GeneID:8294313"
                     /db_xref="GOA:C5E277"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/TrEMBL:C5E277"
                     /translation="MLRSRLLTSTKFIARSLHSGRPSLYAASVANVSSNQYAKIYKPA
                     ARSLEPLDTFQRRHLGPNPDNVQDMLKTMGYEDLDKFIETLVPPQVLERRPLQLEAPQ
                     KGFSEQEMLQHLQEIANKNKFQARNFIGKGYYGTVLPPVIQRNLLECPEWYTSYTPYQ
                     PEISQGRLESLLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLLSFNTAKRKKSKFIV
                     DKRLHPQTKSVLKTRATPFNIELVEVDPLEVEANKTILADKAVFGGLIQYPATDGTII
                     PGEIVKSIAESLHANKALLSVASDLMALTLLKPPSEFGADIALGSSQRFGVPFGYGGP
                     HAAFFAVTEKLNRKIPGRIVGVSKDRLGSPALRLALQTREQHIKRDKATSNICTAQAL
                     LANIAANYCVYHGPQGLKDIAGRIYGFTTVLANKISAETPHTVVNNTWFDTLTIKLAE
                     GTSSERLLKAAYEKYSINLFGVDENTVSVSLDETVTRKDLLNLLQVFGASEELPELLP
                     EFPEELSRTDSILSNEVFNQHHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNST
                     VEMMPVTWPQFANMHPFQPVEQAEGYLELIKSLEADLADITGFDNVSLQPNSGASGEY
                     AGLRVIKSYLEAQGQSHRNVCLIPISAHGTNPASAAMCGMKVVPVNCLSDGALDLQDL
                     EAKAEKHKDDLAAMMITYPSTYGLFGPGIRAAIDAVHKHGGQVYLDGANMNAQVGLTS
                     PGDLGADVCHLNLHKTFAIPHGGGGPGVGPICVKSHLGPFLPGHDLVNIATGAPSDLR
                     ISAVASAPYGSASILPISYAYIKMMGSTGLPFSSVVAILNANYMMSRLKPHYSILFAG
                     DNSTTKHCGHEFIVDLREFKAAGVEAIDVAKRLQDYGFHAPTLAFPVPGTLMVEPTES
                     ENLQELDRFVDALIAIRREIDLYAAGDPKGAVLKNAPHSLTDLVCSTDWDARGYSREF
                     AAFPLPFLKHNKFWPPVARLDDTYGDLNLICTCPSVEDVANDNAEHD"
     gene            complement(<248747..>250009)
                     /locus_tag="KLTH0H02772g"
                     /db_xref="GeneID:8294314"
     mRNA            complement(<248747..>250009)
                     /locus_tag="KLTH0H02772g"
                     /product="KLTH0H02772p"
                     /transcript_id="XM_002555955.1"
                     /db_xref="GeneID:8294314"
     CDS             complement(248747..250009)
                     /locus_tag="KLTH0H02772g"
                     /note="similar to uniprot|Q12523 Saccharomyces cerevisiae
                     YPL247C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H02772p"
                     /protein_id="XP_002556001.1"
                     /db_xref="GeneID:8294314"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E278"
                     /translation="MDTYKAGKRSSISFGSYQRPVVSFNQNELPYYAPRQLYSAQQSA
                     QQPDVVYPCRYEAHFPLYAMDWSNEDYVAVGSYKEDTFNKLQILHSSDLVSWEKAGEE
                     NCVFPISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVA
                     ALGQLPPVSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFL
                     TQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNS
                     ASSGSNALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQW
                     HPSRHNVLLTCGDDCQALLWDLNTHLSTPASNTVSSKWNSSKVARCIDTPQEAYSDAN
                     YEINNIVWRPQGNWFGCNLGRHFQSVRV"
     gene            <250363..>251052
                     /locus_tag="KLTH0H02794g"
                     /db_xref="GeneID:8294315"
     mRNA            <250363..>251052
                     /locus_tag="KLTH0H02794g"
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /transcript_id="XM_002555956.1"
                     /db_xref="GeneID:8294315"
     CDS             250363..251052
                     /locus_tag="KLTH0H02794g"
                     /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
                     YMR188C MRPS17 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /protein_id="XP_002556002.1"
                     /db_xref="GeneID:8294315"
                     /db_xref="GOA:C5E279"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5E279"
                     /translation="MARQNFVGLVVSQGKMQKTVKVRVETKVFNKRINKELFHRKDYL
                     VHDEQGVSREGDLVRIEATRPLSRRKFFSVAEILKNKGQQFALFESQAKTQVMQEEAQ
                     KTRDFLDRRRAHEADESVLLADVRTIQQALAQGQDAEELSEIKARYGIEHFTPDTLKQ
                     LLQLDVLALEQSVVAQKSKIDTVQARVSELLQNEQDGDLLLRQYGVEDPQMLKSNIKK
                     NLLRKYVMQEL"
     gene            complement(<251152..>252086)
                     /locus_tag="KLTH0H02816g"
                     /db_xref="GeneID:8294316"
     mRNA            complement(join(<251152..251795,251876..>252086))
                     /locus_tag="KLTH0H02816g"
                     /product="KLTH0H02816p"
                     /transcript_id="XM_002555957.1"
                     /db_xref="GeneID:8294316"
     CDS             complement(join(251152..251795,251876..252086))
                     /locus_tag="KLTH0H02816g"
                     /note="similar to uniprot|Q12270 Saccharomyces cerevisiae
                     YPL246C RBD2 Possible rhomboid protease, has similarity to
                     eukaryotic rhomboid proteases including Pcp1p"
                     /codon_start=1
                     /product="KLTH0H02816p"
                     /protein_id="XP_002556003.1"
                     /db_xref="GeneID:8294316"
                     /db_xref="GOA:C5E280"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:C5E280"
                     /translation="MNFRKFIIDKFTKAAMSTMNSLNLSLPDGKPPAALTTGLVIFMS
                     LIYLLSLVVDINGHISLKPNALFKLDLNRLSLYPLGHLSLTHLVLNSLSLFGPLTMFE
                     RSHGTVHTGVVLNLLAVFTAIVYCLMGSLFFSKTEVLGSSGWCFSLFAYFSFKEATIR
                     PQQRIFHSFSAPTKYMPVLILVLVTIFFPGSSFWGHFIGMGMGYVLAWKENFVGKLVP
                     PSSLIQKIESKLDSAIAMIPLGVKFYKEEAANREESYKSLFGDESVLPLHNQTSTNFQ
                     GEGRPLGN"
     gene            <253022..>254389
                     /locus_tag="KLTH0H02838g"
                     /db_xref="GeneID:8294317"
     mRNA            <253022..>254389
                     /locus_tag="KLTH0H02838g"
                     /product="KLTH0H02838p"
                     /transcript_id="XM_002555958.1"
                     /db_xref="GeneID:8294317"
     CDS             253022..254389
                     /locus_tag="KLTH0H02838g"
                     /note="similar to uniprot|Q12179 Saccharomyces cerevisiae
                     YPL245W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H02838p"
                     /protein_id="XP_002556004.1"
                     /db_xref="GeneID:8294317"
                     /db_xref="InterPro:IPR018647"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E281"
                     /translation="MNLKGCLRRTVFDEALANMTRTYKKPKVNDNRTQLEHDAIDKLS
                     HVKLSSEQAQLKTEVLQFVRDQLKRWESSKDGPAMLVIQGDAGTGKSVVLNSLFNELQ
                     RLACPSDAARDELTGTKNYLVVNHPEMLKLYHRISKNFPYIAKSSLERPTSLINKLEK
                     SKSIADVIVVDEAHLLSTSKDAFKRFYGENHLQSLMALGKVLVVVYDDKQSLRMGSYW
                     EESTNDGSSLAHFYEQLPEGHKQWRYLKQQFRVVAEPDVLEWIEQLSTKGKILPFPKS
                     TTNGTSTFDLKIWEDCGAMYSKLKELNEEYGQCRMLATYDFPYRLDGKDYFVTCGDNF
                     KLRWDRYMPKSILPWSERPSSIDEVGSVYTVQGFDLNYAGVILGRSVGYDASNDCIKL
                     MPEFYDDHAGFTKKKNIKNADQVKLKIIMNSINVLMTRGVKGLYLYAYDPELRQRLLR
                     CSGSA"
     gene            complement(<254461..>255453)
                     /locus_tag="KLTH0H02860g"
                     /db_xref="GeneID:8294318"
     mRNA            complement(<254461..>255453)
                     /locus_tag="KLTH0H02860g"
                     /product="KLTH0H02860p"
                     /transcript_id="XM_002555959.1"
                     /db_xref="GeneID:8294318"
     CDS             complement(254461..255453)
                     /locus_tag="KLTH0H02860g"
                     /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
                     YPL244C HUT1 Protein with a role in UDP- galactose
                     transport to the Golgi lumen"
                     /codon_start=1
                     /product="KLTH0H02860p"
                     /protein_id="XP_002556005.1"
                     /db_xref="GeneID:8294318"
                     /db_xref="GOA:C5E282"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:C5E282"
                     /translation="MGSQILLAVCVLGIYATFLTWSLVYEPLTTKVWPNSAEKFHVPC
                     VVSLVQASVAAFTGYAYLRREKTGYRTKEFMKDNYKDLLLISFTQSTSSPLATYSLQY
                     VDFLTYMLAKSCKLIPILAVHLLLYHTKITNNKKAVAIAVTFGVTLFNLGSAKRSSST
                     RGQNVSYVNGFAPLVLSLLLDGFTNATQDTLLKRNRTSNKKPITGGHLMLGLNMCIVF
                     WNFFYLLLIDPEQALKAKNMITEDPEIAYYLLTYAACGALGQICIFYTLQEYGSLVLV
                     MVTVTRKMFSMILSILVYGHHVTRMQWLGISIVFGGITAEALLKRRGASKLKTQ"
     gene            <255761..>257518
                     /locus_tag="KLTH0H02882g"
                     /db_xref="GeneID:8294319"
     mRNA            <255761..>257518
                     /locus_tag="KLTH0H02882g"
                     /product="KLTH0H02882p"
                     /transcript_id="XM_002555960.1"
                     /db_xref="GeneID:8294319"
     CDS             255761..257518
                     /locus_tag="KLTH0H02882g"
                     /note="similar to uniprot|P38687 Saccharomyces cerevisiae
                     YPL243W SRP68 Component of the signal recognition particle
                     (SRP) ribonucleoprotein (RNP) complex that functions in
                     protein targeting to the endoplasmic reticulum (ER)
                     membrane"
                     /codon_start=1
                     /product="KLTH0H02882p"
                     /protein_id="XP_002556006.1"
                     /db_xref="GeneID:8294319"
                     /db_xref="UniProtKB/TrEMBL:C5E283"
                     /translation="MSYYSPLGATFGVRIDRFLETAEDFDKYHQKLNRKLQKLRHHCR
                     LTTKDTKRYSTKEKYSKITSDDYDKNKLFGTLMLLHAERDLALVESLKLKARLRGAMK
                     KSEKKVVMTRLRKACKTSEQLTVLTQNEGDDFTRAEYAIYHKLCIVSYFSMCKPSKTR
                     YTNKIAKELSLAIASLHYLQSKEKVSDEVASSIISQFEYLLRQHADAEVFTTSEVRNF
                     IAKQVRQSSDDVLVQLITRSGYEAPIEDSVMGSEKSNLKEVQWRRFSAKVRDSKVAEL
                     ISEATQIEPTDLAQFSNKLAKWQEAADAHSVFIAQKERDDEDEDVGEDDQILLTYIKY
                     NSHFTTIQRDDIVFQKLWAQWSKSANKSKNLKLTKFKEIERIVHNLATYLQEVMDLPG
                     VYSDDALMANLKLATTYYQLHLTAGCLASFYQSKQKYLEALALYIDGHKTLEVAAGEA
                     VLQEPLPGNILTPEKVAALEDFIKVSWRGVISLAEYEKIASPGGKPSLEPSLIEKLGN
                     PIVPRDVSLTNLFPTRPIVRPVGSKPTLFDLAFNYIGSDSQTPQNEPLIPEESRSVPK
                     SNDAQEAPKKKGLFGLFGL"
     gene            <257821..>259587
                     /locus_tag="KLTH0H02904g"
                     /db_xref="GeneID:8294320"
     mRNA            <257821..>259587
                     /locus_tag="KLTH0H02904g"
                     /product="KLTH0H02904p"
                     /transcript_id="XM_002555961.1"
                     /db_xref="GeneID:8294320"
     CDS             257821..259587
                     /locus_tag="KLTH0H02904g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H02904p"
                     /protein_id="XP_002556007.1"
                     /db_xref="GeneID:8294320"
                     /db_xref="GOA:C5E284"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5E284"
                     /translation="MAEEQNKCWICLCSGDEYPPMGNSKDAHDWVHPCQCSLTAHRKC
                     LLEWVSRTNLDYRNEALNEFNGRRTNIGFESLNIADTYSSLHGRAQFHPFAWLRARSS
                     FTNNSSSRAPFDPGDISRIFAAHAEEAVIRNVTQAMAAGARESQPMASVPSSSRKLVI
                     NTVCPQCHAPILLKTSRGVTVSLSSSVSHLLDWSAKTLIQVTAIGTLGSSILFSFGGI
                     LASWGLRIMTTVAPESTLLKLLDLNSASTLSQAFQKNQIGFKQILLLGFAPLYLISFR
                     CGNAFLGWLKWFYPLAFLRPEEKLQSSVKRFLILQYPLAMLNDFFRMCVYNPVYFRWV
                     HRVKPYFIGDRMTVEQLKIYEAEQEYLETRFDALSRGNQPRSLLTKFKSFFRSASPEP
                     MIQSISARRLVMSTRYDYSQALIETSIWEKIASTLLWPLAGKLISDTVLSKSKWFKRF
                     VAQETATPDDGLYLSNLIGCCAAVLLKDLVHLFVTWRRVKQLESMEVMSYMTPEWEYA
                     INKKIGQVLNDLSSLREDEESYVILEEHANNMLTKPYHDQWTNVGSNIPTILGKVGYF
                     RFLVIKMSIERSLAYTKKAEHL"
     gene            complement(<259800..>264359)
                     /locus_tag="KLTH0H02926g"
                     /db_xref="GeneID:8294321"
     mRNA            complement(<259800..>264359)
                     /locus_tag="KLTH0H02926g"
                     /product="KLTH0H02926p"
                     /transcript_id="XM_002555962.1"
                     /db_xref="GeneID:8294321"
     CDS             complement(259800..264359)
                     /locus_tag="KLTH0H02926g"
                     /note="similar to uniprot|Q12280 Saccharomyces cerevisiae
                     YPL242C IQG1 Essential protein required for determination
                     of budding pattern promotes localization of axial markers
                     Bud4p and Cdc12p"
                     /codon_start=1
                     /product="KLTH0H02926p"
                     /protein_id="XP_002556008.1"
                     /db_xref="GeneID:8294321"
                     /db_xref="GOA:C5E285"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000593"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5E285"
                     /translation="MTSVNGSPSRGKNPFIERYMASLGEGTEAASKSVSPTKHYPPVG
                     SPARSKVVDKENVVDRKSKKSSLLRAAAESPLKPIPPSKQNSGTLAHSFNPKGTETPI
                     KKSTAATIVSTTFDVTSLSKKDAKYYEFLCRVKEAKEWIEAIIEEKLPSELDLATGNS
                     LRDGVYLAKLTQKIEPGLARKIVPSGNTLQFTHTQNINSFFRLVESVGVPDLFRFELT
                     DLYEKKNIPQVFETLHALANVINSKWPGKAPEIQNLSGLCSFSNDDLKTCQRRLPMIH
                     NFRSFKSTKPSTASGTSELPSGLLAAPTISSVEDTPVKIPKLSVPSEEPKTPEKQCEI
                     SKTPSPASHKSEQQDHKTPSLANTLTDTAPLLKFDMRSSPAKSLSYYSPRIYRHLSYR
                     TASPDIYSSRLSTDPYDPDYYNTLKYTTPEYSPIRRKRMTELEFLDSVSSLQAICRGV
                     NTRFGLTLMQRKVDMVVKNLTLLQARARAGLVRSPFKQKLQSEASPGSKSSIGCLQAT
                     IRANQVREKIFRLRVRLLRVEEEVTSIQSLARAAIVFRRAKATLERHSMITEPLIELQ
                     AYAKGLRQRDILRQTKESLSSHLPQIVFLQGLLRSRHLRKHRKLIYFSLNEQLNTIHT
                     LQALARGTTKRRAMQRLDNELELHSGSISKVTALLKGSFKRCSIKSLATAVRDSKDPV
                     VSLQALSKGVLARFALELVADVVEANNLMEFQSLAKGSIIRRANRRLDAYYKGKLPEV
                     VKVQSFIRSHQLRVAYIEFMSSANPSLWAVRKFVHLLNKIYTSHKSQNKLEWLKSQID
                     QANKSRDKLQGNLNLLQRKSEILEDYNIFVGNLNGKASVLQNSVSSSFPGYEKLIYLL
                     QADPFYWKTVARLDQSFASKYLVKTFSSANGIMTQRENVFFVKLVADLMITDIENFNN
                     VQDFLSAKPQGFWQDLLVSYIHRQIPDLMKELFQPVLDFVSSDQVDFESIPAVIYRKI
                     HPHGADLSSSQSIEDDTTKRVFVQNLTSLWNAVEIVSDALTRNVDRISEDVKFLCTAA
                     YKAVADRSPYESDALLAISKILIEVIVASFLKEPAKFGSRKVSIQAEKKISVLLDVLM
                     TVYSFTEFQGYLTPLNQYADQIRTDLALSLKSMLTSPSFENFCDKLIYGDMCQETRAS
                     LSISKQYLVDIGDKLKSTLSSFPHDDPIVQLYKDMSKSQERQALRASTNNIVDLRLNP
                     SAYQLSSSDDRLMSVYNEIKRGLVYMMQVEDVETNLYDLMTSSILMSDEPIFQELVHR
                     TEAIKSDPLLKNLESLSYFNLKQHVLERAYELKQMDSLTIEDGLQSILNDIANTIKSR
                     EYVAESTKNEAQTAQHTLKRIQDSTFQLQEAIRSLETAQKRALKSKQSSNTYAPSKKH
                     GLGNKLKDVYKKVNHKSYGEKNCLSLEWTTRHLHEIGVLNEVAGENLGKVALSFFGSN
                     GPKFPDILFKISTSDGEVYAVEMNDERKGDKTKRSGTDSFAFSKLVDTLAKDKAAKLE
                     LFSKKVEFNVPNLLNLVATSFLGRQ"
     gene            complement(<264580..>265505)
                     /locus_tag="KLTH0H02948g"
                     /db_xref="GeneID:8294322"
     mRNA            complement(join(<264580..265364,265424..>265505))
                     /locus_tag="KLTH0H02948g"
                     /product="KLTH0H02948p"
                     /transcript_id="XM_002555963.1"
                     /db_xref="GeneID:8294322"
     CDS             complement(join(264580..265364,265424..265505))
                     /locus_tag="KLTH0H02948g"
                     /note="weakly similar to uniprot|P46670 Saccharomyces
                     cerevisiae YPL241C CIN2 Tubulin folding factor C
                     (putative) involved in beta-tubulin (Tub2p) folding
                     isolated as mutant with increased chromosome loss and
                     sensitivity to benomyl"
                     /codon_start=1
                     /product="KLTH0H02948p"
                     /protein_id="XP_002556009.1"
                     /db_xref="GeneID:8294322"
                     /db_xref="UniProtKB/TrEMBL:C5E286"
                     /translation="MERLRPIDTFGWLNGPEKLSALQGACEELERELGACKNTNALKE
                     DISLFSSALNASSDQLPPYALEKFAKRLQALLKDLEARNRKGSLTRFKFRRKPTAPPT
                     IGTTPTKTPLSNRAKLSDSSGPTRDQTLVVTHAAASYENLVHCNISYNARDRQNDLNS
                     LQSGSSALSLRSLDSCIVKLLGVPFNRGSVYIENAIDSLVLIKIQSGADIQVRLFGLR
                     NCKLYIIQEGMRRQAVILENCQDCCFHTAMKEGADIQDFSNISKCLTDGGEHFHFEAF
                     DTDDSSIAALSN"
     gene            complement(<265781..>267895)
                     /locus_tag="KLTH0H02970g"
                     /db_xref="GeneID:8294323"
     mRNA            complement(<265781..>267895)
                     /locus_tag="KLTH0H02970g"
                     /product="KLTH0H02970p"
                     /transcript_id="XM_002555964.1"
                     /db_xref="GeneID:8294323"
     CDS             complement(265781..267895)
                     /locus_tag="KLTH0H02970g"
                     /note="highly similar to uniprot|P15108 Saccharomyces
                     cerevisiae YMR186W HSC82 Cytoplasmic chaperone of the
                     Hsp90 family"
                     /codon_start=1
                     /product="KLTH0H02970p"
                     /protein_id="XP_002556010.1"
                     /db_xref="GeneID:8294323"
                     /db_xref="GOA:C5E287"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:C5E287"
                     /translation="MSNGETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALD
                     KIRYQALSDPKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKADLINNLGTIAKSGT
                     KAFMEALSAGADVSMIGQFGVGFYSLFLVADKVQVISKHNDDDQYIWESNAGGSFTVT
                     LDEQNERLGRGSVLRLFLKDDQLEYLEEKRIKEVVKRHSEFVAYPIQLVVTKEIEKDV
                     PVAEEEKTEEKSEDDKKPKLEEVDEDEEGEKKSDTKKVKETVKELEELNKTKPLWTRN
                     PSEVTQEEYNAFYKSISNDWEDPLAVKHFSVEGQLEFRAILFVPKRAPMDLFESKKKK
                     NNIKLYVRRVFITDEAEELIPEWLSFVRGVVDSEDLPLNLSREMLQQNKIMKVIRKNI
                     VKKLIETFNEIAEDSEQFDKFYSAFSKNLKLGIHEDTQNRTALAKLLRYNSTKSVDEM
                     TSLTDYITRMPEHQKNIYFITGESLKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFTQ
                     LKEFEGKPLVDITKDFELEETEEEKAEREKEAKEFEKLAEALKEVLGERVEKVVVSHK
                     LVDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPKSPIIKELKKR
                     VEDNGAQDRTVKDLTNLLYETALLTSGFTLEEPASFATRINRLISLGLNIDEDEEEAA
                     PEASTSAPVEEVPAETEMEEVD"
     gene            complement(<268190..>271054)
                     /locus_tag="KLTH0H02992g"
                     /db_xref="GeneID:8294324"
     mRNA            complement(<268190..>271054)
                     /locus_tag="KLTH0H02992g"
                     /product="KLTH0H02992p"
                     /transcript_id="XM_002555965.1"
                     /db_xref="GeneID:8294324"
     CDS             complement(268190..271054)
                     /locus_tag="KLTH0H02992g"
                     /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
                     YMR185W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0H02992p"
                     /protein_id="XP_002556011.1"
                     /db_xref="GeneID:8294324"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019414"
                     /db_xref="InterPro:IPR019451"
                     /db_xref="UniProtKB/TrEMBL:C5E288"
                     /translation="MSENPKTKSIESVLSKRPEFTNDTPLDRFFESLGEYFSRIKDDS
                     GSPLYEELGCASNAEFVAFLLGQLEVLKSILKENSSGKATNTLVPISLHDMKYFDLLV
                     NLIVVHGICANLPPGIGIPLDQRRIENFRQVDKRFEIHSRHTVSFDTLARVSDVLYGV
                     LTFAPLKENTIGSLLLKGTGFADLITALIVLYHEVQSSRNKVSSMFERIENLQETYQL
                     FSVYTLLVHTTSKAEYRQFVLTKLSTLPIRRQNGVISLVDFVVGVREDEEIDVTKFKR
                     VAEILVSKPKNMTSVTYFTELFSQIYEGLALINKPILVSCLNNVVTEFYFKNKRIVYD
                     FLFKKIAAVLYNTSLQEFSTKTLNDTMNVLISLSKNPSIEVTQELSTYGGEKFYLTLW
                     IYCLFLKKHQKLQPNDGSQQPSVAYYNVVLGMLKTYIIINSDYQALDDIVLNLVNFDH
                     ETWGYSIDLETQLPYVRLIGEKNIGDELTSIGSVNTDQKIKRVQEVFLDIDCAVLLFV
                     ELLKLLNEPEVVKEIFLSVMNRWVVSTNKANKDNSQLPGDVQNSLLILVDLKLLEKMD
                     ESFKSDIIKKPRDVLKLINDLLEFPSPDEEERDDQPDSDDEDEDGEEEADEEEAFQIE
                     QAPSPNTYVTLLKLLSAIIDTTPRKELHKSSDILESISKTLHGHGDDAQAQSIMGRIR
                     DLQENNAGAGQPLGDFSELDADNEFLQKAMANVNDALVPVRAHGLYELRQLIERRSPV
                     IDLNYVLEVHARQLRDKEPFVYLNAIKGLTSLCEIEPERTLNYLLNLFRNRGSKNSLD
                     NTLKVGEVLLNYITLQNELFGGESAGTLVAICLEKIQQHENLDNRLRMSAMSILGICL
                     QTNPRGVRAQIPDILDCAFNILKLENGTQSSSSNLVRRSAIHLLHSLVSSSDLTLFPS
                     QYGGSRLVSLLNYVKEKDDDYLVCEQASALLTVVKVLQVS"
     gene            <271566..>272159
                     /locus_tag="KLTH0H03014g"
                     /db_xref="GeneID:8294325"
     mRNA            <271566..>272159
                     /locus_tag="KLTH0H03014g"
                     /product="KLTH0H03014p"
                     /transcript_id="XM_002555966.1"
                     /db_xref="GeneID:8294325"
     CDS             271566..272159
                     /locus_tag="KLTH0H03014g"
                     /note="similar to uniprot|P46683 Saccharomyces cerevisiae
                     YPL239W YAR1"
                     /codon_start=1
                     /product="KLTH0H03014p"
                     /protein_id="XP_002556012.1"
                     /db_xref="GeneID:8294325"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5E289"
                     /translation="MSLHSDPLDQEDQDAIILDARCGDLESLKDIFTNLVDPKLIVTC
                     RDAVTQSTPLHMAAANGHKEVMQYLASLVTDGAELKKWVNSQNETGNTALHWASLNGS
                     LECVKFLCEELGADPFIRNNFDHDAIFEAERGNKEEVENFYPQKYDVEPENDETAQAE
                     SVEIKEGTEIEQVTKEATEALRLETDKLSLSEDRGQS"
     gene            <272447..>273298
                     /locus_tag="KLTH0H03036g"
                     /db_xref="GeneID:8294326"
     mRNA            <272447..>273298
                     /locus_tag="KLTH0H03036g"
                     /product="KLTH0H03036p"
                     /transcript_id="XM_002555967.1"
                     /db_xref="GeneID:8294326"
     CDS             272447..273298
                     /locus_tag="KLTH0H03036g"
                     /note="similar to uniprot|P09064 Saccharomyces cerevisiae
                     YPL237W SUI3 Beta subunit of the translation initiation
                     factor eIF2 involved in the identification of the start
                     codon"
                     /codon_start=1
                     /product="KLTH0H03036p"
                     /protein_id="XP_002556013.1"
                     /db_xref="GeneID:8294326"
                     /db_xref="GOA:C5E290"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:C5E290"
                     /translation="MSDLANELGFDPNLKKKKKSKKVAPEDVETTVEGSNGDDLFAGL
                     KKKKKKSKEAKGTNDIDSVVDEVGEALGELKLKKKKKKSKEPSFDDFEKELEKAGVAP
                     ATQDNSRESSLVPGEDSAIQQNVGLPYTDLLSRFFQTLRTNNPELAGDRSGPKFRIPP
                     PVCQRDGKKTIFCNIQEISEKLQRNPEHLIQYLFAELGTSGSVDGQRRLVMKGKFMPK
                     QMENVLRRYILEYVTCKTCKSINTDLRKEQSNRLFFLVCKSCGSTRSVSSIKTGFQAI
                     VGKRRRM"
     gene            complement(<273404..>273898)
                     /locus_tag="KLTH0H03058g"
                     /db_xref="GeneID:8294327"
     mRNA            complement(<273404..>273898)
                     /locus_tag="KLTH0H03058g"
                     /product="KLTH0H03058p"
                     /transcript_id="XM_002555968.1"
                     /db_xref="GeneID:8294327"
     CDS             complement(273404..273898)
                     /locus_tag="KLTH0H03058g"
                     /note="weakly similar to uniprot|Q03233 Saccharomyces
                     cerevisiae YMR184W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H03058p"
                     /protein_id="XP_002556014.1"
                     /db_xref="GeneID:8294327"
                     /db_xref="UniProtKB/TrEMBL:C5E291"
                     /translation="MLNRTQSFQNCRETDVPGYNDCPNFIYPSKGASGARKARFSVED
                     TCGNTKPAVAPPPPVRRVKSQQETATPLKGKSELLEELDRLFARNSNLPPAEFQYHKN
                     KVLTNIDQSLSHDHGCQVMSRAMTCIGEKEQLKKVIMEWMMSDTSTSKWCPSFLKIAG
                     NVAL"
     gene            complement(<274038..>275078)
                     /locus_tag="KLTH0H03080g"
                     /db_xref="GeneID:8294328"
     mRNA            complement(<274038..>275078)
                     /locus_tag="KLTH0H03080g"
                     /product="KLTH0H03080p"
                     /transcript_id="XM_002555969.1"
                     /db_xref="GeneID:8294328"
     CDS             complement(274038..275078)
                     /locus_tag="KLTH0H03080g"
                     /note="similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
                     YPL236C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H03080p"
                     /protein_id="XP_002556015.1"
                     /db_xref="GeneID:8294328"
                     /db_xref="GOA:C5E292"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E292"
                     /translation="MTFIGTLCGCCGSSQPSYVSVNGHRYHIKRLLGEGGFSFVYLVE
                     SRENGLMALKKIRCPFGSIGSISPAMKEVDNYQKFKSPYIAQIIDSQVVQERDGSKTV
                     YILLPYFSKGSLQDEINRHLLDCTQVPELEVVRLALGVARGLLCIHDAAPADESDVTY
                     SIVSAPYAEDSSLLNDLELDTFGESHQAYAHHDIKPSNIMISSEGMPVISDLGSCSRA
                     CVEINSRQALLQFQEWRSEHCTLTFMAPEILDVKLNSVITEKCDVWSFGCTIYTMCFG
                     ISPFEREEQISGASVTYSLTTGKYSIPSGTNYSSGLIDVVKKCLNVDPDGRPSVDELI
                     SLLMDLQSQLVS"
     gene            <275767..>277179
                     /locus_tag="KLTH0H03102g"
                     /db_xref="GeneID:8294329"
     mRNA            <275767..>277179
                     /locus_tag="KLTH0H03102g"
                     /product="KLTH0H03102p"
                     /transcript_id="XM_002555970.1"
                     /db_xref="GeneID:8294329"
     CDS             275767..277179
                     /locus_tag="KLTH0H03102g"
                     /note="highly similar to uniprot|Q12464 Saccharomyces
                     cerevisiae YPL235W RVB2 RUVB-like protein TIP49b
                     Homologue"
                     /codon_start=1
                     /product="KLTH0H03102p"
                     /protein_id="XP_002556016.1"
                     /db_xref="GeneID:8294329"
                     /db_xref="GOA:C5E293"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E293"
                     /translation="MSIQTSDSSSNDYGKALSLIAAHSHISGLGLDENLQPKATSQGM
                     VGQSQARRAAGVILKMVQSGTIAGRAVLIAGPPSTGKTALAMGLSQSLGQDVPFTAIA
                     GSEIFSLELSKTEALTQAFRKSIGVKIKEETELIEGEVVEIQIDKSITGGHKQGKLTI
                     KTTDMETIYELGSKMIEGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGAD
                     TRFVQCPEGELQKRKSVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTK
                     VAEWKEEGKADIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVVMATNRGISRTRG
                     TNYKSPHGLPLDLLDRSIIITTHNYNEQEIKTILSIRAQEEEVEVAPDALDLMTKIGL
                     ESSLRYASNLISVSQQIALKRKSNTVEIADIKRAYLLFLDSSRSVKFLQEYQPQYIDD
                     EGKVQIASNMTGTDAMDTTA"
     gene            complement(<277395..>277889)
                     /locus_tag="KLTH0H03124g"
                     /db_xref="GeneID:8294330"
     mRNA            complement(<277395..>277889)
                     /locus_tag="KLTH0H03124g"
                     /product="KLTH0H03124p"
                     /transcript_id="XM_002555971.1"
                     /db_xref="GeneID:8294330"
     CDS             complement(277395..277889)
                     /locus_tag="KLTH0H03124g"
                     /note="highly similar to uniprot|P32842 Saccharomyces
                     cerevisiae YPL234C TFP3 vacuolar ATPase V0 domain subunit
                     c'"
                     /codon_start=1
                     /product="KLTH0H03124p"
                     /protein_id="XP_002556017.1"
                     /db_xref="GeneID:8294330"
                     /db_xref="GOA:C5E294"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:C5E294"
                     /translation="MSEILPVDEYSPFFAPFFGFAGCAFAMVLSCLGAAIGTAKSGIG
                     IAGIGTFKPELIMKSLIPVVMSGILAVYGLVVAVLIAGGLSPTEDYTLFNGFMHMSCG
                     LCVGFACLSSGYAIGIVGDVGVRKFMHQPRLFVGIVLVLIFAEVLGLYGMIIALILNT
                     RSSG"
     gene            <278598..>279245
                     /locus_tag="KLTH0H03146g"
                     /db_xref="GeneID:8294331"
     mRNA            <278598..>279245
                     /locus_tag="KLTH0H03146g"
                     /product="KLTH0H03146p"
                     /transcript_id="XM_002555972.1"
                     /db_xref="GeneID:8294331"
     CDS             278598..279245
                     /locus_tag="KLTH0H03146g"
                     /note="similar to uniprot|Q6B152 Saccharomyces cerevisiae
                     YPL233W NSL1 Essential component of the MIND kinetochore
                     complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
                     kinetochore subunits contacting DNA to those contacting
                     microtubules required for accurate chromosome segregation"
                     /codon_start=1
                     /product="KLTH0H03146p"
                     /protein_id="XP_002556018.1"
                     /db_xref="GeneID:8294331"
                     /db_xref="InterPro:IPR013950"
                     /db_xref="UniProtKB/TrEMBL:C5E295"
                     /translation="MSTQPSKLDVRVEQVRSIYGQFQSILDEKVALHLPQEQDSIKGE
                     VLLQLQKFLAEAMDMASDSLNVVNANERASLTELLAQSRQQFVDPFDLDLNEQVRKKY
                     QEWEDQTVKVAQLRREAPRKLRESYENEAQLALQEADTLINSFSQETPAEQNGAGQAK
                     EEPIELPNLPRLGEDYQEALKNLSAAKTQTPQNRAQIQKLEQLVAFLESELLAGS"
     gene            <279697..>280563
                     /locus_tag="KLTH0H03168g"
                     /db_xref="GeneID:8294332"
     mRNA            <279697..>280563
                     /locus_tag="KLTH0H03168g"
                     /product="KLTH0H03168p"
                     /transcript_id="XM_002555973.1"
                     /db_xref="GeneID:8294332"
     CDS             279697..280563
                     /locus_tag="KLTH0H03168g"
                     /note="highly similar to uniprot|P32867 Saccharomyces
                     cerevisiae YPL232W SSO1 encode syntaxin homolog act in
                     late stages of secretion post-Golgi t-SNARE"
                     /codon_start=1
                     /product="KLTH0H03168p"
                     /protein_id="XP_002556019.1"
                     /db_xref="GeneID:8294332"
                     /db_xref="GOA:C5E296"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5E296"
                     /translation="MSYNNPYQNDNPYTENYAMQDSVGHAQSGGDFVTFMNGINQINV
                     ELDDYANLINQIDSSQRRLLTEVNEDQELAMRQHLDGLVSRASDLQYQLRNKIKSAQQ
                     QGASDPSKQAQAENSRQRFLKLIQDYRITEANYKEQNKDQAKRQYRIIQPEATDDEVE
                     AAISDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKTMAELTQLFNDMEQ
                     LVIEQQENIEVIDKNVEDAQQDVEQGVGHTNKAVKSARRARKNKIRCILILVVIVIVI
                     VLAIALPLGLRK"
     gene            <281852..>287524
                     /locus_tag="KLTH0H03190g"
                     /db_xref="GeneID:8294333"
     mRNA            <281852..>287524
                     /locus_tag="KLTH0H03190g"
                     /product="KLTH0H03190p"
                     /transcript_id="XM_002555974.1"
                     /db_xref="GeneID:8294333"
     CDS             281852..287524
                     /locus_tag="KLTH0H03190g"
                     /note="highly similar to uniprot|P19097 Saccharomyces
                     cerevisiae YPL231W FAS2 Alpha subunit of fatty acid
                     synthetase which catalyzes the synthesis of long-chain
                     saturated fatty acids contains beta-ketoacyl reductase and
                     beta-ketoacyl synthase activities"
                     /codon_start=1
                     /product="KLTH0H03190p"
                     /protein_id="XP_002556020.1"
                     /db_xref="GeneID:8294333"
                     /db_xref="GOA:C5E297"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR026025"
                     /db_xref="UniProtKB/TrEMBL:C5E297"
                     /translation="MTMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKDFNTE
                     RVVEIGPSPTLAGMAQRTIKNKYESYDAALSLQRQVLCYSKDAKEIYYTPDPADLAPK
                     EEAAPEPAASAAATPAAAPASAAAPAAAPAAPAAAGPAAEIPDEPVNAALLLHVLVAQ
                     KLKKTLDQVPMAKTIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEETPLEELAESFQD
                     TFNGQLGKQSSSLISRLMSSKMPGGFTITSARKYLQTRWGLGAGRQDSVLLIALTQEP
                     ASRLGSEADAKQFMDAIAQKYASVSGVDLSVATSAASSGAAAGSGGATIDAAAFDELN
                     KDQKILARQQLEVLARYLKMDLSSGEKKFLQEKNTTEQLQAQLDFLTNELGEYFVQGI
                     STSFSRKKARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDRELVAEAINIMNRSNETLI
                     KFMEYHISQTKVDEGENYQLAKSLGQQLIENCKQALELDPVYKDITKPTAPQTIVDKN
                     GNINYKEVPRPSVRKLSQYVEEMALGGPLTKVEQPTLQEDLTRVYKAINAQAAEHNIS
                     DSTKIEFEKLYGELLKFLEASNEIDTSASSRYAGEVDDALDKDSTKEVASLPTKSEIS
                     NTVSSTIPRETVPFLHLKKKLPSGDWIYDRQLSSLFLNGLERAAINGVTFKDKYVMIT
                     GAGQGSIGAEVLQGLIQGGAKVIVTTSRFSKKVTDYYQSIYAKYGAKGSTLVVVPFNQ
                     GSKQDVEALVSYVYDDEKNGGLGWDLDAIIPFAAIPENGIELENIDSKSEFAHRIMLT
                     NILRMLGNVKKQKSAQGIETRPAQVILPLSPNHGTFGGDGMYAESKLSLETLFNRWHS
                     ESWSNQLTICGAIIGWTRGTGLMSANNIIAEGIEKLGVRTFSQREMAFNLLGLLIPEV
                     VQLCQTSPVMADLNGGFQFLPDLKEFTAKLRQDLTNTSEIRKAVSIETALEHKAVNGD
                     NADAAYAKAEVQPRANIQLNFPTLKPYESLKKIAPSELQGMLDLERVIVVTGFSEVGP
                     WGSSRTRWEMEAKGEFSLEGCVEMAWIMGLIKYHNGNLKGRPYTGWVDAKSNEPVDDK
                     DIKAKYESHILDHAGIRLIEPELFNGYDPKKKQMIQEVVIGEDLEPFEASKETAEQFK
                     HEHGDKVDIFEIPDSGEYTIRLLKGATLYIPKALRFDRLVAGQVPTGWDARTYGIPED
                     TISQVDPITLFVLVSVVEAFISSGITDPYEMYQYVHVSEVGNCSGSGMGGVSALRGMF
                     KDRYKDMPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATAVESLDVGVETI
                     LSGKAKICIVGGYDDFQEEGSYEFGNMGATSNSYDEFDHGRTPAEMSRPTTTTRNGFM
                     EAQGAGMQVIMNADLAIKMGVPIYGILALTATATDKIGRSVPAPGKGILTTAREHQSD
                     LKFPSPLLNIKYRKRQLDSRVSQIKLWVENELEMLQYETEEIPEEDHAAFYAERTEEI
                     HREAERQLKTAQNQWGNEFYKNDPRIAPLRGALATFGLTIDDLGVASFHGTSTKANDK
                     NESATINEMMKHLGRSEGNPVLGVFQKYLTGHPKGPAGAWMLNGGLQILNSGVVPGNR
                     NADNVDKVLEQFEYILYPSRSIKTDGVKAVSVTSFGFGQKGAQAIAVHPDYLYAALDE
                     SAYRAYAAKVSAREQAAHKYFHNGMIYNSLFVAKEHPPYADELEQPVYLDPLARVSAD
                     KKTGAFVFDKKALTASTTYVSDANLKTSEVVSKLAKQAAGDNKGASVGVDVELIKSIN
                     VDNDTFIERNFTAAEVAYCKSQPCVQSSFAGTWSAKEAVFKSLGVKSQGGGASLKDIE
                     ITRKDGSAPQVELHGDAASAASAAGVKGVTVSISHDDFQSVAVAYSQK"
     gene            <288203..>288628
                     /locus_tag="KLTH0H03212g"
                     /db_xref="GeneID:8294334"
     mRNA            <288203..>288628
                     /locus_tag="KLTH0H03212g"
                     /product="KLTH0H03212p"
                     /transcript_id="XM_002555975.1"
                     /db_xref="GeneID:8294334"
     CDS             288203..288628
                     /locus_tag="KLTH0H03212g"
                     /note="some similarities with uniprot|Q99395 Saccharomyces
                     cerevisiae YPL229W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H03212p"
                     /protein_id="XP_002556021.1"
                     /db_xref="GeneID:8294334"
                     /db_xref="UniProtKB/TrEMBL:C5E298"
                     /translation="MPFLTPPLSMAGLNQIAAPHNFVLETPNSQVGQPMHMVNGFESP
                     EMSLKTKNNICKSFEDDLFFCPRGLLSSQELSTCQQMDLLLLDQMRDISGLHAAQVTD
                     VEAPDHAHSQPKFNPYTSQSFSPAPPPLESRPHLRESTL"
     gene            <288945..>290384
                     /locus_tag="KLTH0H03234g"
                     /db_xref="GeneID:8294335"
     mRNA            <288945..>290384
                     /locus_tag="KLTH0H03234g"
                     /product="KLTH0H03234p"
                     /transcript_id="XM_002555976.1"
                     /db_xref="GeneID:8294335"
     CDS             288945..290384
                     /locus_tag="KLTH0H03234g"
                     /note="highly similar to uniprot|O13297 Saccharomyces
                     cerevisiae YPL228W CET1 Interacts with Ceg1p the mRNA
                     capping enzyme alpha subunit removes gamma-phosphate from
                     triphosphate-terminated RNA mRNA capping enzyme beta
                     subunit RNA 5'-triphosphatase"
                     /codon_start=1
                     /product="KLTH0H03234p"
                     /protein_id="XP_002556022.1"
                     /db_xref="GeneID:8294335"
                     /db_xref="GOA:C5E299"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:C5E299"
                     /translation="MSSSKPNFSRGLSLEDLVNHDERSDAKAGQKSNPLPPAEVKHRM
                     SVDGLGSEQNGSASSSRVPREQRGPRRNADGDEETDTDEEVGGPGDIVFETGDFKFDY
                     EKQEGAGKNRDARAGREDTSSSSPSSKAKGGQDVKDIFQERASSQSKRNAIKKDLNVL
                     SEIAATAKPTRYNTAPIWAQKWKPTVKALQSIDTKDLNIDASFTNIIPDDDLTKSVQD
                     WVYATLVSIPPDQRQYVEMEMKFGIIVEGSDSNRVSPPVSSQTVYTDMDAHLTPDVDE
                     RVFTEINRYVKGISELSEYTGKFNIIESHTKDLLYRVGMSTQRPRFLRMSRDVKTGRV
                     GEFIEKRHVSQLLLFSPKDSYDVKISINLELPVPDNDPPEKYKDNTPVNTRTKQRISY
                     IHNDSCTRMDITKVANHNQGVKQRHTESTHEIELEVNTAALLTAFEHIGNNSKEYASI
                     LRTFLNNGTIIRRKLTSLSYEIFEGQKKV"
     gene            complement(<290490..>291488)
                     /locus_tag="KLTH0H03256g"
                     /db_xref="GeneID:8294336"
     mRNA            complement(<290490..>291488)
                     /locus_tag="KLTH0H03256g"
                     /product="KLTH0H03256p"
                     /transcript_id="XM_002555977.1"
                     /db_xref="GeneID:8294336"
     CDS             complement(290490..291488)
                     /locus_tag="KLTH0H03256g"
                     /note="similar to uniprot|P40350 Saccharomyces cerevisiae
                     YPL227C ALG5 UDP-glucose:dolichyl-phosphate
                     glucosyltransferase involved in asparagine-linked
                     glycosylation in the endoplasmic reticulum"
                     /codon_start=1
                     /product="KLTH0H03256p"
                     /protein_id="XP_002556023.1"
                     /db_xref="GeneID:8294336"
                     /db_xref="GOA:C5E2A0"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E2A0"
                     /translation="MWDTFWSRVRELSVSTVLVTFAVAIACSLYLIVLLLSHSPRKPF
                     DEELIFKTNGPRGHIVSGKLDPVTKGSSNKDGIELSVVVPSYNEIGRILVGLTDAVTF
                     LQEHLEDKWEILVVDDGSSDGTSKYCLDLAANHFKLKPGQLRVVKLTQNRGKGGAVRH
                     GLLHMRGKYGLFADADGASRFSDVAKLLDSIKKHEEKGHAAMAIGSRAHMVNTDAVVK
                     RSFIRNLLMYGLHTLVFIFGIRSIKDTQCGFKLFNRSATVQIFPYLHTEGWIFDVEIL
                     ILALRKKVPVEEVAISWHEVDGSKMDLARDSINMAKDLVIIRMAYLLGIYSDKVEC"
     gene            complement(<292114..>294105)
                     /locus_tag="KLTH0H03278g"
                     /db_xref="GeneID:8294337"
     mRNA            complement(<292114..>294105)
                     /locus_tag="KLTH0H03278g"
                     /product="KLTH0H03278p"
                     /transcript_id="XM_002555978.1"
                     /db_xref="GeneID:8294337"
     CDS             complement(292114..294105)
                     /locus_tag="KLTH0H03278g"
                     /note="weakly similar to uniprot|P35209 Saccharomyces
                     cerevisiae YMR179W SPT21 Protein required for normal
                     transcription at several loci including HTA2-HTB2 and
                     HHF2-HHT2 but not required at the other histone loci
                     functionally related to Spt10p"
                     /codon_start=1
                     /product="KLTH0H03278p"
                     /protein_id="XP_002556024.1"
                     /db_xref="GeneID:8294337"
                     /db_xref="UniProtKB/TrEMBL:C5E2A1"
                     /translation="MTTRMSLKVLYTVDKETNSYLTRSKAPVEARIESIPSPSNDGTQ
                     LRVGIVLLNDVLEQVCASSPELFSYGMDNSVDYNVYCRDICELDEPLVSFGLLSKLRG
                     AAQQQSKNDVDDWPLVMGRVCSSFSAILRFQNIANTPPTQQTLEIKIRFSKVATANSS
                     RRSSVSGNNVHTLAKKAPTTTTSMLGSRGTSKAAGEMAKPEAVTKRQTNPMPAPKAAR
                     TQSLPIWNQSKNNQFALPANSIAHKIYLADRAAKDTASSVKAREEKKPVVYQINSLQQ
                     DNTIQKTKVDDSVSKRFDFITKKKGKMAKPSIKKPVAKPKSSVKKVRRDSVVQASTPL
                     PREAQTSSMINKNDALEEFKLLNDDVLVQQLLDRQKLKPTDFFELDQEKGDDSENKEN
                     IPPRPVPLSSRFEDLIGMDIPSFKTPSDSEKTGSVPRSDDTLEWFNDLFGSPIGNQKT
                     VTPTKDPLTCNTLPIEDDEQDPSKALTSDIDRTSPMDTLSMPLYELEHKKESKGSEPV
                     PSCKEQLRRLPILTKNSHSGHQDDVRDADSTTPVVLGYSTSPKSNNNELAAGQKRPAP
                     VPSSPADDEDYMDEYMQERRRKRKTMPSSPTSMFPYREQDGEDEHSMTNDEFSIHERP
                     CRDDANSTPATQYRSSDVENMKHGEESSAETKQNEFLHI"
     gene            <295271..>298801
                     /locus_tag="KLTH0H03300g"
                     /db_xref="GeneID:8294338"
     mRNA            <295271..>298801
                     /locus_tag="KLTH0H03300g"
                     /product="KLTH0H03300p"
                     /transcript_id="XM_002555979.1"
                     /db_xref="GeneID:8294338"
     CDS             295271..298801
                     /locus_tag="KLTH0H03300g"
                     /note="similar to uniprot|Q7LHP2 Saccharomyces cerevisiae
                     YPL226W NEW1 This gene encodes a protein with an Q/N-rich
                     amino terminal domain that acts as a prion termed [NU]"
                     /codon_start=1
                     /product="KLTH0H03300p"
                     /protein_id="XP_002556025.1"
                     /db_xref="GeneID:8294338"
                     /db_xref="GOA:C5E2A2"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2A2"
                     /translation="MPPKKFKSLDDFIGDQAPPKNQFQTPLENYYQNMSSGQSHPKTK
                     GSSYQAQRNWNDGSQYGNNSYNQNRGYQNYQGGYQNYQGGYQNNQSPQHSGRSTPSGS
                     ATPTPSTSTTSLTSLATSLANLGVTSISGILSTLPQCASLAECRQKIQLAVAEFNNEG
                     RSAQDIEDWDVPSIISKLIKPKNPALVQESAMLLISQLSINFSGKSPQEAFLLPLLPI
                     ALDTVASKDSSVKRAAQHAIDSLFGLYPIEAQTSVLLPKVLEYLNSGVKWQCKLAALK
                     LVDRIREESPNDLLELTFKDTVPVLTDVATDFKPELAKQGHKTLLDFVSILDNLDLSP
                     RFQLIVDTLQDPSKVPNSVKSLSSVTFVAEVTEPALSILVPILNRSLNLSSSSQEQLR
                     QTVIVIENLTRLVNNRSEIQHFIPQLMPGVQKVLDTASLPEVRELAGKAMKVLKDDSE
                     DDGKFPGKITYEFGLQFVKEKIQLLAKNPLPELCKDNNTTALVYLSKIVTSDANVNDW
                     KRLREYLLLVFGEENAEAIDTHFIQELRNIFHQETATYDENEGIEIVNTDFSLAYGSR
                     MLLNKTTLRLLKGHRYGLCGRNGAGKSTLMRSIANGQLEGFPDKDTLRTCFVEHKLQG
                     EEGDLDLVSFIALDPILKEVSRAEISAALESVGFDDERRSQTVGSLSGGWKMKLELAR
                     AMLQKADVLLLDEPTNHLDVSNVKWLQDYLLENTEITSLIVSHDSGFLDAVCTDIIHY
                     ENKKLAYYKGNLADFVDQKPEAKAYYTLTDSNAQMRFPPPGILTGVKSNTRAVAKMTG
                     VTFAYAGASKPQLTDASCALSLSSRVAILGPNGAGKSTLIKLLTGELVPQEGKVEKHP
                     NLRIGYIAQHALQHVNLHKEKTANQYLQWRYQFGDDREVLLKESRKISEQEKEMMEKE
                     IDIGDGRGKRAIEAIVGRQKLRKSFQYEVKWKFWLPKYNSWVPKEVLLENGFDKLVQK
                     FDDHEASREGLGYRELTPTVITKHFEDVGLDSEIANHTPLGSLSGGQLVKVVIAGAMW
                     NNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGK
                     MVQKGVSQIDQSRFEDGGKAGSASAAKAASPSVDDDDSPANIKVKQRKKRLTRNEKKV
                     QVERRRLRYIEWLSSPKGTPKPVDTDDEEE"
     gene            complement(<298885..>299754)
                     /locus_tag="KLTH0H03322g"
                     /db_xref="GeneID:8294339"
     mRNA            complement(<298885..>299754)
                     /locus_tag="KLTH0H03322g"
                     /product="KLTH0H03322p"
                     /transcript_id="XM_002555980.1"
                     /db_xref="GeneID:8294339"
     CDS             complement(298885..299754)
                     /locus_tag="KLTH0H03322g"
                     /note="similar to uniprot|Q03219 Saccharomyces cerevisiae
                     YMR178W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H03322p"
                     /protein_id="XP_002556026.1"
                     /db_xref="GeneID:8294339"
                     /db_xref="GOA:C5E2A3"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="UniProtKB/TrEMBL:C5E2A3"
                     /translation="MLPRFLATQTPKIARMPSVKGACVIIGDEVLNGKITDTNSRFFA
                     KYCYRLGIQLREIVTIGDQKEQIVQTIKRLSAENDFIVTSGGIGPTHDDITYESVASS
                     FGLPCELNYECQDRMRKISHPEKRHDPETLKDFYRMATLPAGPEVHSYYVLKEFWVPI
                     VSIQQKVYILPGIPQLFEKLLLAFEPSVKEIYSISEREPHNYERFFVKTPKSESQISS
                     YLRELQTRCLQVSDEIKIGSYPHYGMGFNTVSILGLKKHEVFLKELVKEAIEKLDGTA
                     ITAEMEEKYSDSR"
     repeat_region   300646..302622
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
     gene            <303157..>303603
                     /locus_tag="KLTH0H03366g"
                     /db_xref="GeneID:8294340"
     mRNA            <303157..>303603
                     /locus_tag="KLTH0H03366g"
                     /product="KLTH0H03366p"
                     /transcript_id="XM_002555981.1"
                     /db_xref="GeneID:8294340"
     CDS             303157..303603
                     /locus_tag="KLTH0H03366g"
                     /note="similar to uniprot|Q08971 Saccharomyces cerevisiae
                     YPL225W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H03366p"
                     /protein_id="XP_002556027.1"
                     /db_xref="GeneID:8294340"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="InterPro:IPR021148"
                     /db_xref="InterPro:IPR023139"
                     /db_xref="UniProtKB/TrEMBL:C5E2A4"
                     /translation="MSAPNTFNAETAENLEDMEKQFAVLAVEQAETYWNLISKVPGSK
                     LRLTKFDDEIYEKFQEHFPEYKDLSRLAKFTEEELKTKEAKERWRKFIKLFEKKVDDF
                     NFGTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNKSKLNDWAAGQ"
     gene            complement(<303810..>305315)
                     /locus_tag="KLTH0H03388g"
                     /db_xref="GeneID:8294341"
     mRNA            complement(<303810..>305315)
                     /locus_tag="KLTH0H03388g"
                     /product="KLTH0H03388p"
                     /transcript_id="XM_002555982.1"
                     /db_xref="GeneID:8294341"
     CDS             complement(303810..305315)
                     /locus_tag="KLTH0H03388g"
                     /note="similar to uniprot|Q03218 Saccharomyces cerevisiae
                     YMR177W MMT1 Putative metal transporter involved in
                     mitochondrial iron accumulation closely related to Mmt2p"
                     /codon_start=1
                     /product="KLTH0H03388p"
                     /protein_id="XP_002556028.1"
                     /db_xref="GeneID:8294341"
                     /db_xref="GOA:C5E2A5"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:C5E2A5"
                     /translation="MIKPSAYPVGLQFYHNIGKSRCRQLVWNLCFHQRSIHNSSRRLI
                     NEGKKGGIGKTDAERRLEKQAKFQDLSDAFEESRHIHMKESETEQNDTLHLGSMLYRE
                     AGHTHSHASSQSNPLLKMSRKEFKKNPGVRITWIGLWINVGLALGKFAGAIMFHSQAL
                     IADSVHALSDLVSDFLTLASVKLSSKQPTAEYPGGYGKIETLGSLSVSAILAFAGLSI
                     GWSSLCAIAAPLLPHAVLDVVSTFSHSHSHGGPTDVANINAAWIAGGSIIIKEWIFNA
                     TKKVAIETNSNVLLANAWHHRVDSLTSLVALVTISSGYFFNIQSLDAVGGLLVSALVV
                     KTGADGMIGAMKELVDRAVAGDDPRYVTVKDNTQEILRKLISNNNAKKPYGLKNLTVL
                     SSGPEMHAKMTLEVPLQRWENVLTIKEFEIVTDHLRKTLRENIPTLRNIDIDYVEERP
                     PLSPEQLKEIENQKKLGQFPTPQNESASDGPLPSGHTHSHFGLGSGHTHKH"
     gene            complement(<305531..>309943)
                     /locus_tag="KLTH0H03410g"
                     /db_xref="GeneID:8294342"
     mRNA            complement(<305531..>309943)
                     /locus_tag="KLTH0H03410g"
                     /product="KLTH0H03410p"
                     /transcript_id="XM_002555983.1"
                     /db_xref="GeneID:8294342"
     CDS             complement(305531..309943)
                     /locus_tag="KLTH0H03410g"
                     /note="similar to uniprot|Q03214 Saccharomyces cerevisiae
                     YMR176W ECM5 Non-essential protein of unknown function
                     contains ATP/GTP-binding site motif A null mutant exhibits
                     cellular volume up to four times greater than wild-type
                     also large drooping buds with elongated necks"
                     /codon_start=1
                     /product="KLTH0H03410p"
                     /protein_id="XP_002556029.1"
                     /db_xref="GeneID:8294342"
                     /db_xref="GOA:C5E2A6"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013637"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5E2A6"
                     /translation="MTLEPLPHMPPVGKWQPSTGSNAPLAAALPLAAGKTLPTTSRFK
                     SSLEATPSPLSLDQHSPHLYTQHRIRPNAPFDIAHIKSKRLVQTPEPACQTLKTDSGW
                     SYTLESGSVPCFRIPRSEIPDPITFYHQIEDVGRQYGAVKLQIIQSSPAPVTPFALNT
                     ELFWFKARRQSLCSFQEETRRKLDLHRRLYKYHSSRKSDTGRQLFSKIPSIDKRPLDL
                     YRLRECVQLRGGFQEVCHKKLWAQIGRELGYSGRIMSSLSTSLRSAYLKVFSEFDKEE
                     ERQRASASAATTTVPTKIHIILPSSTEDNHRDPSSKKRSLNEASISLENAVKKHKASK
                     VQAYQVAGSAAEFSRLRDILRYKGFFTNFENLTEPRKGLTKPSPSTLPGYQFTFWKSS
                     SEIYDRSAHETRNAPIYNLRQYYEKAQKHFDSVAALYQQRSSLVLEKSDSVNLRDFEK
                     LFFDILSDESACCNVDTGINLPSSVHGSGFPTVSKSTTNGLDTTSAWNLNNIPLSSDS
                     VLQFMDADFGSHLDTRLDLGMLFSVKGWSIEDNFLPNIDYHHAGSSKLWYVVPPEDMK
                     RFESLVETSKKNQQSPGPEVSNDPVDKSFLNSEVYQCYLDTCPQHQVSTLPPRINTHT
                     IGQFREVTACTLPDDWQFHPEKLKANSIKVLRIVQDPGCYILKFPRTYSTSISCGFSI
                     SENALFAPASWLESALESEKWLSRNGLLPAIQTFQLLFNIVKESGDKKLASKARLLLT
                     GLASEELAAREELARRLSDRFTIESNVFDFISDQTLEPTGASKVLLTSAKDCFTLSLR
                     QFLDNLTCKEEKLLIFGRDLQQDGISISLHEFYSNEELEALLQEDHACTAAAAIFSEK
                     DASQGQVEKPDRDVLVSYDSLVNEELKGQRVPLAKINLFCEALSQESNSQAHQLRRSL
                     KNARSTASRCNQMLAKINKEKRGMKFQGFGRGFALKELAAAPFHYTVAELHNLYLELE
                     GSSIAFPEMSKVFELCHCVESFQLDAQNAIKINDLSRMKETYLQGWSLGIRSKYHDLL
                     ARKICEEMWLSTYEKTIIEHEIIKEDELGYYTPSYLLPYLKYGIKFVSDALHREKLEQ
                     VRNTILLSQETGYELGQLFKKKSSKIPVDRLSSILDTLRQYPFLVEPRLRETLEAIMD
                     TFGKHREGMSSSFDKLDVNHEHYRLIAGSVNARPLFELNLIGKFDGSCDDKRLTLSEV
                     PNRSIFSKHIKDCRLWLQKVNKLVLRKPLWAKIHSSTQLCFANNGDKLTTKSQPDEEP
                     VYCFCRQGDSGSKMVACEVCGEWYHATCINKGKWSLVSNENTVFVCPICCPSNFPDFG
                     LVDFSQIESMAMASLKLKVIPDRRFFGQFFEIFKMSASFKHTMSCDLLKKDGALRGDL
                     SMAQIKFYLRKLVGAGVRMPREISALQRACQEHDANVMLKFAQRNIKVVTGYEATGSR
                     EASEAQPDQVVIKSEGAMVISPEIKPEGNSDMMQ"
     gene            complement(<310426..>310851)
                     /locus_tag="KLTH0H03432g"
                     /db_xref="GeneID:8294343"
     mRNA            complement(<310426..>310851)
                     /locus_tag="KLTH0H03432g"
                     /product="KLTH0H03432p"
                     /transcript_id="XM_002555984.1"
                     /db_xref="GeneID:8294343"
     CDS             complement(310426..310851)
                     /locus_tag="KLTH0H03432g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H03432p"
                     /protein_id="XP_002556030.1"
                     /db_xref="GeneID:8294343"
                     /db_xref="UniProtKB/TrEMBL:C5E2A7"
                     /translation="MSNIIHKMSEKITGHDHHDDERDERGNTLSSEQRQQREQGMPFT
                     EHNDPEQRAIPSQRVGGGMQSERSKLGGYQQQQHDLGGSGGDFGQTRSMPEEQMPGAV
                     RGGSDLNAEDWDDEDEADDEGRGTRRGGDYSDEFQKRYW"
     gene            <311863..>312234
                     /locus_tag="KLTH0H03454g"
                     /db_xref="GeneID:8294344"
     mRNA            <311863..>312234
                     /locus_tag="KLTH0H03454g"
                     /product="KLTH0H03454p"
                     /transcript_id="XM_002555985.1"
                     /db_xref="GeneID:8294344"
     CDS             311863..312234
                     /locus_tag="KLTH0H03454g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H03454p"
                     /protein_id="XP_002556031.1"
                     /db_xref="GeneID:8294344"
                     /db_xref="UniProtKB/TrEMBL:C5E2A8"
                     /translation="MSDLFERARQRLSGSSSAVPEKLRDLYMSHGPRDASGGSGSMSR
                     RMTGADDGAGPGSSALSSGGDSSGDDSPGASSSDLASNGSRDLAHSHMVSHARGGSDN
                     AAADAGAETGSGADPAANATN"
     gene            complement(<312577..>314055)
                     /locus_tag="KLTH0H03476g"
                     /db_xref="GeneID:8294345"
     mRNA            complement(<312577..>314055)
                     /locus_tag="KLTH0H03476g"
                     /product="KLTH0H03476p"
                     /transcript_id="XM_002555986.1"
                     /db_xref="GeneID:8294345"
     CDS             complement(312577..314055)
                     /locus_tag="KLTH0H03476g"
                     /note="weakly similar to uniprot|P18899 Saccharomyces
                     cerevisiae YMR173W DDR48 DNA damage-responsive protein
                     expression is increased in response to heat-shock stress
                     or treatments that produce DNA lesions"
                     /codon_start=1
                     /product="KLTH0H03476p"
                     /protein_id="XP_002556032.1"
                     /db_xref="GeneID:8294345"
                     /db_xref="UniProtKB/TrEMBL:C5E2A9"
                     /translation="MGFLDKVKDFAGNNNDDNGNSGSNDNNLFSKAERAIGQDNVDKI
                     RNKVGGDNYDKFEKTVRDKFSNTSINDDNNSSSYGNSNNDDSYGNNNNSSSYGNNNND
                     DSYGNNNNDDSYGNNNNNNNNNSSSYGNSNDDDSYGNNNNSSSYGNNNNDDSYGNNNS
                     SSYGNGNNNSSSFGNKSSYGSNSYGDDNNDSYGSKKDKNDKKDNKSSYGSSSYGDDSN
                     DTYGSKKDNNTSSYGNSSYGDDNNDSYGSKKDNNSSSYGNSSYGDDNNDSYRSKKDKK
                     DNKSSYGSSSYGDDNTDTYGSKKENNSSSYGNSSYGDDSNDTYGSKKDKKDNNTSSYG
                     NSSYGDDSNDSYGSKKDKKDKKSSSYGNSSYGNDNSTSSYGNDNKSSSYGNDNSTSSY
                     GNDNNTSSYGKKSSYGNDNNTSSYGNSSYGNDNNTSSYGNDNKSSSYGNDSYGNNNSN
                     NNNSNNNNNSSYGNNTSSYGDDSYGGNSDSYGNNSNSYNNDY"
     gene            complement(<315060..>317054)
                     /locus_tag="KLTH0H03498g"
                     /db_xref="GeneID:8294346"
     mRNA            complement(<315060..>317054)
                     /locus_tag="KLTH0H03498g"
                     /product="KLTH0H03498p"
                     /transcript_id="XM_002555987.1"
                     /db_xref="GeneID:8294346"
     CDS             complement(315060..317054)
                     /locus_tag="KLTH0H03498g"
                     /note="weakly similar to uniprot|Q03213 Saccharomyces
                     cerevisiae YMR172W"
                     /codon_start=1
                     /product="KLTH0H03498p"
                     /protein_id="XP_002556033.1"
                     /db_xref="GeneID:8294346"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5E2B0"
                     /translation="MGSSAPAMANGNQASEVRGSLSNDALNLGLNLALPADTHDTAKT
                     VGTVSGSSLADILGSNATPQAGGENGHASGTSNATPASALNEPTHAQIHSASPAQNAG
                     IGPQRYGIIQQVSGSSELGTGNSTTTSVQICQRMDEVSARMIAMEEMFNKLYFKINEQ
                     EATIQHLRLQSEAFLTSILSEVRQVNHNMPILDNPDDNEKDGFVTDLLNSITNVSSNY
                     LKKVNTKHSQKYKRQRQSMGGAGAASTDKPSKDAFGEAATSSSTRAINGTAGVAPNNG
                     ASAGQANLAAQSSKRAAPDSEHSKTHNSSFAESGGQTGQQLVQESHSYPVSEASQLPL
                     PHYLTQQSFTLNPNGIKRRRANTATKPSFSQSHQDISSLNGIGSMSLPNLTLENLTRK
                     NQPHSLGFNVNSDHNVSAGARLRHRNIEIQVGSDNVDSHELDLDSSEDEEGYQEDDED
                     RNSDRSAEAADAGRSYGARGNVINAAEEAEDETESYGGLFEPRNRSPGQQIHQRREDR
                     RNFDRGRPVRAPGPTEQPLKATQVNAETKTAAAPRSGGPAADEHHTRLRERDLNYTLL
                     KAPANVRAIWQEYIEGIDGQPAVKFLEEVYGNKWRLKKNVKTFARRKRLYKFIINGIK
                     HGRSADDMIKILEDKRIYKNEHGEVKKRTIGWLQQSLSGI"
     gene            <317431..>319425
                     /locus_tag="KLTH0H03520g"
                     /db_xref="GeneID:8294347"
     mRNA            <317431..>319425
                     /locus_tag="KLTH0H03520g"
                     /product="KLTH0H03520p"
                     /transcript_id="XM_002555988.1"
                     /db_xref="GeneID:8294347"
     CDS             317431..319425
                     /locus_tag="KLTH0H03520g"
                     /note="similar to uniprot|Q08968 Saccharomyces cerevisiae
                     YPL222W FMP40 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0H03520p"
                     /protein_id="XP_002556034.1"
                     /db_xref="GeneID:8294347"
                     /db_xref="InterPro:IPR003846"
                     /db_xref="UniProtKB/TrEMBL:C5E2B1"
                     /translation="MPEARTVLVALKESGTSRFVQKLLSDQLVPSVGKAIEIEERQDE
                     EEHRKVFHTPRLVSQRAHFAYTVPEKRPHYKPLLTSKKALDDLQLEMSQDLVAILTGQ
                     RIYCDESEGIFPYSMAYAGFQFGQFAGQLGDGRVTNLFDLPDKHGSMQTLQLKGSGLT
                     PFSRFADGKAVLRSSLREFIISEALHHIGVPSTRALQLTALPQTKARRAMYEPCAMYC
                     RYAPSWIRLGNFDLCRWRQDHGSLVKLADFCINDVFEGGKEFPAHLDPESFKHDFFPD
                     KEDEIGTEPKEQERLESNTKYELFFRHVVNLNAESVAYWQTYGFLNGVLNTDNTSIMG
                     LAMDFGPFSIMDKFQPQYTPNHDDVESRYSYANQPTAIWWNLTKFAQSMTTLIGAGPA
                     HVEKIVAEGLAAVDEAMEKDIVSRANSVIASASNEYKFRFTVKYTDLMAKRLGIELNI
                     PKVFTSANLGSIAEKVREFNNAILEPLLQVLYVTQVDYNNFFVKLQGYSGPFKTERGG
                     GFELIEPDLLEVFFSNAQIQKLEKHLAGRPDSDSGETRQLVECAEKLNTWIDDFVSLV
                     PSESNSRSEIAKKVNPLFTPRAYILEQVVDDLTENQKERLNDPQAEVDTSLLQKLYSM
                     SVNPYDSDKWEDNLRPEVVQDWTTHGDDDDKFMKQLTCSS"
     gene            <320024..>322993
                     /locus_tag="KLTH0H03542g"
                     /db_xref="GeneID:8294348"
     mRNA            <320024..>322993
                     /locus_tag="KLTH0H03542g"
                     /product="KLTH0H03542p"
                     /transcript_id="XM_002555989.1"
                     /db_xref="GeneID:8294348"
     CDS             320024..322993
                     /locus_tag="KLTH0H03542g"
                     /note="weakly similar to uniprot|P36775 Saccharomyces
                     cerevisiae YBL022C PIM1 Mitochondrial ATP-dependent
                     protease involved in intramitochondrial proteolysis
                     involved in degradation of misfolded proteins in
                     mitochondria required for bigenesis and maintenance of
                     mitochondria"
                     /codon_start=1
                     /product="KLTH0H03542p"
                     /protein_id="XP_002556035.1"
                     /db_xref="GeneID:8294348"
                     /db_xref="GOA:C5E2B2"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2B2"
                     /translation="MQFLSKRKEQTANYLELPCLLPQVTPSVVPLPGVRYRISIPKDK
                     AAAMLQDLQEFVDISSYELSKGKELLRGPKKNKQTSKSEVRSSFQCIDEKLKVSNRSQ
                     IYICLLPTVQTNYTRGCVSILEEILAEGELVTFCLKGVRRAIIKDPEINLQNRLWISK
                     LLVLDDGPYLTSLSPESCGKLVKQLQNNFTNITSAFDSFRATYRNAVRLQSGNSERFF
                     LLSPLSNTLFILLSKGSFSKSWKLLFELYQSLEVHKPGNQKDAIFSLIDMTVAVLPVT
                     NKQRLRCLELEDPLERAKELDATIHDLVALLASLRDGFKFFEAKVQDFSPGDKAAFVA
                     LQLSALRGFIEEPKKGSRFIRNPKSGPPSGARVGADKVEKENGDEDEDLKTIGAFIDN
                     LEISEVHPDGLKMLKKDFRRLERLTPQSSEYNVLRGYFDTIMDIPFKAKDVSKSNIDL
                     EECKKKLDNDHYGLLDVKKRLIEYLSVLKLNVDFKNEGSKAKPPIMLLVGPPGVGKTS
                     IAKSIAGVLNRRFHRISLGGIHNEAEIRGHRRTYVGSMCGLIINALRKSGSMAPFILL
                     DEIDKVLSVQAGGNRGAGLNGDPGAALLEVLDPEQNSTFTDHYVGFPVDLSNVLFFCT
                     ANNLTGISAPLLNRMEVIEIPGYTPKEKLNIGLKFLLPKQIQLNGLDKASIKVELTKE
                     AWDDLVLEYTREPGVRGLERQIASIVRGKVVEYVQSHESEHKIVTSQELLKYIGFPLH
                     PISRELVKKIKFADKCGVVNGLAYGSDGTGNVLVFEMVKMGKLQGNSSGPRIRTTGNL
                     GKVLNESIEIATTLVKSLSERKIIHGLPSQAFNDFLNSEWHIHVPMGAVSKDGPSAGV
                     AIALALISAALNKPVSPKLCLTGEITLRGKVLPIGGVREKLLGAQLFGMERVLLPLSN
                     RPDVIEAVMKPEEYESCLASSSMPELRRVQQKWQLEAFYIDDFYDVMTKCWPREIQLT
                     DARILISPSDNSIRALL"
     gene            <323465..>325921
                     /locus_tag="KLTH0H03564g"
                     /db_xref="GeneID:8294349"
     mRNA            <323465..>325921
                     /locus_tag="KLTH0H03564g"
                     /product="KLTH0H03564p"
                     /transcript_id="XM_002555990.1"
                     /db_xref="GeneID:8294349"
     CDS             323465..325921
                     /locus_tag="KLTH0H03564g"
                     /note="similar to uniprot|Q08967 Saccharomyces cerevisiae
                     YPL221W BOP1 Protein of unknown function overproduction
                     suppresses a pam1 slv3 double null mutation"
                     /codon_start=1
                     /product="KLTH0H03564p"
                     /protein_id="XP_002556036.1"
                     /db_xref="GeneID:8294349"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:C5E2B3"
                     /translation="MRIFSAILLALNIAHLVVAKRKLVASSLVACMQNSQLTASGFSV
                     VFDPDDRSLHYSLDMVTEINDYIYAEVDVYAYGFKIISRNIDLCSLSWKQFCPLRPGN
                     VQVESIEYISESLAKQIPGIAYQVPDIDAFVRMNIYKSTDKSQTLACIQAFFSNGKTV
                     SQTGVKWATAVIAGIGLLCSAVLSTFGNSNAASHISANTMSLFLYFQSVAVVSMEHVH
                     RMPPIAAAWSENIIWSMGLIRISFMQRIFRWFVQSTGGNPSLYLTSKTISVLVQRSLE
                     GIQRGLESIRAPPVFKRNADTIIGNSNVMILRGIKRLAYTSNIENTSVVCTGFTFFVL
                     CGYFLAGFIIASKYAIDLCIKAGWIRNTRFWAFRHNWRVILKGSLLRYIYIGFTQLTL
                     LSFWEFTQNDSPALIVIAVLFLIQSLGLMLWAAYRTISFARLSVEQRKNPAAILYGDQ
                     RVLDKYGFFYTMFSAKRYWWNCVILVYILLKSIFISFCQASGKTQALAIFIIDLAYFV
                     VLIKFQPYFDRPTNIVNILITTVTLVNSFLFLFFSDLFGQPGRVSSIMGWVFFIMNAA
                     FSLILLILILIFVCMVIFSKNPDLRFKPAKDDRTSFQRVSDSHGKINKSVAAELMALG
                     NTAKNHDENWEEELYNQQKLQKEQSVSGLDYSDEKLTGSRSNSDDQEDATRLTLAEKL
                     KRKLSFKRTKSTKSTSSRARKLANTDDAPVTSLSREPSTSSAPVVKRDYPGVHSRQQS
                     ESKNGLIGSNAVENSKLETLAQEDDAPLVDTDNYQAPHSGSVEFGRDESMDSVNVAAT
                     ANATSSTDLFTNDGSYYNRL"
     gene            complement(<326294..>327442)
                     /locus_tag="KLTH0H03586g"
                     /db_xref="GeneID:8294350"
     mRNA            complement(<326294..>327442)
                     /locus_tag="KLTH0H03586g"
                     /product="KLTH0H03586p"
                     /transcript_id="XM_002555991.1"
                     /db_xref="GeneID:8294350"
     CDS             complement(326294..327442)
                     /locus_tag="KLTH0H03586g"
                     /note="weakly similar to uniprot|P53122 Saccharomyces
                     cerevisiae YGL138C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H03586p"
                     /protein_id="XP_002556037.1"
                     /db_xref="GeneID:8294350"
                     /db_xref="UniProtKB/TrEMBL:C5E2B4"
                     /translation="MLAITNVTNDSITLPSPLRRRFSLFVCIQLFILLLSVVKPVGGL
                     VVSSRLKKLELALATQDRICSMDHVETKTSYRELIGTLTDISFGATGHSSKIYTGFKV
                     HRIYHFGKMLSKAKPSLQLSFCEHGKVKWQTELEYRSDIDWDLPFCVYSQDIEGVGDQ
                     GHSRIWGALKKGNRNQDTVKGPSLKELARQDTANFHCFKMARREKYTKRSTSIYLPNE
                     WVGGLFYCDLTPDGKSRLLDQMGDDLHIDATKSHGVCNRANAIPLQPLISDSYRRHWT
                     SLKPGTRIPFLRRITRTNMDKVIPFLHTPNSDSDFGNFTTKNDITVSKSSTKLRSNWL
                     SAVNWLFASKVEEHLWFNEVEVEESYGVMSAQNNLTNASYIDILKIKH"
     gene            <327747..>330550
                     /locus_tag="KLTH0H03608g"
                     /db_xref="GeneID:8294351"
     mRNA            join(<327747..327764,327941..>330550)
                     /locus_tag="KLTH0H03608g"
                     /product="KLTH0H03608p"
                     /transcript_id="XM_002555992.1"
                     /db_xref="GeneID:8294351"
     CDS             join(327747..327764,327941..330550)
                     /locus_tag="KLTH0H03608g"
                     /note="similar to uniprot|P41811 Saccharomyces cerevisiae
                     YGL137W SEC27 Involved in beta'-subunit of yeast coatomer"
                     /codon_start=1
                     /product="KLTH0H03608p"
                     /protein_id="XP_002556038.1"
                     /db_xref="GeneID:8294351"
                     /db_xref="GOA:C5E2B5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016453"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5E2B5"
                     /translation="MKLDIKKAFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNFET
                     QTEVKSITVTETPVRAGKFIARKNWIVVGSDDFKIRVFNYNTGEKIADFEAHPDYIRS
                     IAVHPTRPYVLSASDDLTMKFWNWEKNWSLEQTFEGHEHFVMGVAFNPKDPSTFASAC
                     LDHTVKIWSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTK
                     SCVATLEGHMANVSFAVFHPALPIIISGSEDGTLKVWNSNTYKLEKTLNLGLERSWCI
                     ATHPTGKRNYVASGFDNGFTVLSFGNDDPKLSLDPVGKLVWCGGKNASATDVFTAAIR
                     GTEGADDGEPLPLQTKELGNVDVFPQSLKHSPNGRFVTVVGDGEYIVYTALAWRNKAF
                     GKCHDFVWGPDSNSYALIDESGHVKFHKNFKELTSWSIPLEFGVEKLYAGALLGVKAD
                     GFVYFFDWDSGSLVRRIDVDANDVVWSENGELLMIINNVDENNTEERAAYVLGFNREA
                     YESFLASEEEPSEDGIDEAFDVLYEVSDPIGSGKWVGDVFIFTTKTNRLNYFVGGKSY
                     NLAHFDKEMYMLGYLPRDNKVYLADRDIHIYSYEISIEVLEFQTLVLRGELEQAKTSV
                     LPNIEGKENLLKISRFLEGQEYHEDALEISPDNDQKFDLALKLSKLSLAHDIVAGDDN
                     EFKWRKLGDKALEGFDFQLAIEAYDNAADLESLFLLYSSFKDQAGLVDVGDRAQRLGK
                     YNLAFNAYWSAGDVDRARDLLVSSGRYSEAAVLSKAYGGKLEDTNAIVAQWKESLIEV
                     GKAGVASRIHELSKADQVSAEEPLIDIETEAGQGEKQPVGEPLEEAATDETPTDGTPT
                     DETPPETHAEDEAAQNLQE"
     gene            complement(<330705..>331637)
                     /locus_tag="KLTH0H03630g"
                     /db_xref="GeneID:8294352"
     mRNA            complement(<330705..>331637)
                     /locus_tag="KLTH0H03630g"
                     /product="KLTH0H03630p"
                     /transcript_id="XM_002555993.1"
                     /db_xref="GeneID:8294352"
     CDS             complement(330705..331637)
                     /locus_tag="KLTH0H03630g"
                     /note="similar to uniprot|P53123 Saccharomyces cerevisiae
                     YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase,
                     required for methylation of U(2791) in 21S rRNA; MRM2
                     deletion confers thermosensitive respiration and loss of
                     mitochondrial DNA; has similarity to Spb1p and Trm7p, and
                     to E. coli FtsJ/RrmJ"
                     /codon_start=1
                     /product="KLTH0H03630p"
                     /protein_id="XP_002556039.1"
                     /db_xref="GeneID:8294352"
                     /db_xref="GOA:C5E2B6"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E2B6"
                     /translation="MTSPMLCALPKFLCQGQCLRWRVAVRFNSSAKSRWLDRQKGDSF
                     TREAKVQGLRSRAAFKLMHLDDKYHLFRKGSSQKVLDLGYAPGAWSQVALDRTGPNGV
                     ILGVDILPCAPPRGVSAIQGNILSKKTHELIRLFFSKHFQLYQEDQLHKDNGYFQHML
                     EQELEGLIPDGSKTGLQIDRSKVEKTPIDVIVSDMYEPWPQTTGFWNNITNSAYDRMA
                     NTTGVAIKDHYMSMDLCDAALVTAIDLMKPGGSFVCKLYTGKEDKLLESRLKKAFENV
                     HRFKPSASRNESKELYFIGLKKKHKVDKLKVFSE"
     gene            <332634..>333287
                     /locus_tag="KLTH0H03652g"
                     /db_xref="GeneID:8294353"
     mRNA            <332634..>333287
                     /locus_tag="KLTH0H03652g"
                     /product="60S ribosomal protein L1"
                     /transcript_id="XM_002555994.1"
                     /db_xref="GeneID:8294353"
     CDS             332634..333287
                     /locus_tag="KLTH0H03652g"
                     /note="highly similar to uniprot|P53030 Saccharomyces
                     cerevisiae YPL220W RPL1A and to uniprot|P53030
                     Saccharomyces cerevisiae YPL220W RPL1B N-terminally
                     acetylated protein component of the large (60S) ribosomal
                     subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L1"
                     /protein_id="XP_002556040.1"
                     /db_xref="GeneID:8294353"
                     /db_xref="GOA:C5E2B7"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023673"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:C5E2B7"
                     /translation="MSKITSTQIRDNVKEVLKYSNETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGALKLPQCPRPNLSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKK
                     LAKKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHNEDLYAKVTDVKSTIKFQLK
                     KVLCLAVAVGNIEMDEDTLVNQILMAVNFLVSLLKKNWQNVGSLVIKSTMGPPFRLY"
     gene            <333755..>335209
                     /locus_tag="KLTH0H03674g"
                     /db_xref="GeneID:8294354"
     mRNA            <333755..>335209
                     /locus_tag="KLTH0H03674g"
                     /product="KLTH0H03674p"
                     /transcript_id="XM_002555995.1"
                     /db_xref="GeneID:8294354"
     CDS             333755..335209
                     /locus_tag="KLTH0H03674g"
                     /note="weakly similar to uniprot|P53124 Saccharomyces
                     cerevisiae YGL134W PCL10 Pho85p cyclin recruits activates
                     and targets Pho85p cyclin-dependent protein kinase to its
                     substrate"
                     /codon_start=1
                     /product="KLTH0H03674p"
                     /protein_id="XP_002556041.1"
                     /db_xref="GeneID:8294354"
                     /db_xref="GOA:C5E2B8"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C5E2B8"
                     /translation="MSGLPSILDESLDRIARGETELDISESMNEDSLDLDDPVDDDTF
                     ELPLKPRRRVLHASNFADLEAEPALDKRVRFEAAGPPWSPLSVEKIAVPEKGIMNSKP
                     PKLNPASSAGARKPHIEDLIQHAHSLNRYLDQNLDRINTFQSHLFEQGLEAPQNTGQI
                     LASNVATAPTTPSGSASNFQLSEIGDSSESLDYEQDIHDESISAAALQADSERDDRKI
                     KQILSRHQTSTYPLSENQSSVNLAGDDSRSEVSALDHFRDLAASTRTSVATSSEDLFN
                     MPHSPVIHDLKFIIPKIAAQRPSAISSLGAGDDAEPPDMDCEAALALYTTTITLLLMM
                     SKQSEDPKQEALPSFATFVMESVPTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFL
                     TRVDEELHCKHHLDPRQVHRLVIASIRLATKLLEDCVHSHSYFSRICGISKKLLTKLE
                     VAFLECLNFEGLKITNQSLLDAAQVQQELSALAA"
     gene            <335581..>336233
                     /locus_tag="KLTH0H03696g"
                     /db_xref="GeneID:8294355"
     mRNA            join(<335581..335602,335689..>336233)
                     /locus_tag="KLTH0H03696g"
                     /product="KLTH0H03696p"
                     /transcript_id="XM_002555996.1"
                     /db_xref="GeneID:8294355"
     CDS             join(335581..335602,335689..336233)
                     /locus_tag="KLTH0H03696g"
                     /note="highly similar to uniprot|P20606 Saccharomyces
                     cerevisiae YPL218W SAR1 GTPase GTP-binding protein of the
                     ARF family component of COPII coat of vesicles required
                     for transport vesicle formation during ER to Golgi protein
                     transport"
                     /codon_start=1
                     /product="KLTH0H03696p"
                     /protein_id="XP_002556042.1"
                     /db_xref="GeneID:8294355"
                     /db_xref="GOA:C5E2B9"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006687"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2B9"
                     /translation="MWDLFGWFRDILSSLGLWNKHGKLLFLGLDNAGKTTLLHMLKND
                     RLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPE
                     RLNEARVELDALFNIAELKDVPFVILGNKIDSPNAVSETELRSALGLLNTTGGARIEG
                     QRPVEVFMCSVVMKNGYLEAFQWLSQYI"
     gene            complement(<336334..>339840)
                     /locus_tag="KLTH0H03718g"
                     /db_xref="GeneID:8294356"
     mRNA            complement(<336334..>339840)
                     /locus_tag="KLTH0H03718g"
                     /product="KLTH0H03718p"
                     /transcript_id="XM_002555997.1"
                     /db_xref="GeneID:8294356"
     CDS             complement(336334..339840)
                     /locus_tag="KLTH0H03718g"
                     /note="similar to uniprot|Q08965 Saccharomyces cerevisiae
                     YPL217C BMS1 Essential conserved nucleolar GTP-binding
                     protein required for synthesis of 40S ribosomal subunits
                     and for processing of the 35S pre-rRNA at sites A0, A1,
                     and A2; interacts with Rcl1p, has similarity to Tsr1p"
                     /codon_start=1
                     /product="KLTH0H03718p"
                     /protein_id="XP_002556043.1"
                     /db_xref="GeneID:8294356"
                     /db_xref="GOA:C5E2C0"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2C0"
                     /translation="MDQSNKEHRKKSEKATAKKKLHTQGHNAKAFAVAAPGRMARNMM
                     RSSDVNERKLHVPMVDRTPEDDPPPVIVTVVGPPGTGKTTLIKSLVRRMTKSTLSEVN
                     GPITVVSGKRRRLTFIECPADDLNSMIDIAKVADLVLLMIDGNFGFEMETMEFLNLAQ
                     HHGMPRVLGVATHLDLFKSQSTLRATKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDR
                     EILNLSRFISVMKFRPLKWRNEHPYLLADRITDITHPELLETQGKQIDRKVAIYGYLH
                     GTPLPSTAGARVHLAGVGDYSISHVEKLPDPCPTPYFQQKLDEYERERVKEQGAGTTG
                     APRRRKRLDDRQKLIYAPMSDVGGVLMDKDAVFIDVGGKKPGDGPSFVPGQEKGEGER
                     LVTSLQSVEKSISENFDGVGLQLFSNGQELHEADSDGENSVSEDEGDSNKDGGRKSLR
                     KPKIYGKSIQEEDEEIDNLESDEEMEAGASDDDRPRQRRLVEVDFDAGNDASVNAHTD
                     SEFELSDHEEELWNRSTASKLQGSKIRPRKWDIGKLIYMENIEPFDCIKRWKGELEDE
                     NEESGEQSEEEDFFKQADKPENKNTEAEDDLEKFKPHFETFKKLAAKWSSFDSLKGRF
                     AGRPNLEQSSADNDEDDEELYGDFEDLENGDQEAASEQDSHSSNEDGDDGSDGAGSDN
                     SFADFEKEEKKDLTTDQERERNAAKKESLRLQFEMEEGDNFKEDDPENEFDTWYELQK
                     AKMAKQQEINNAELESMTPEQRQKIEGFKAGSYVRIVFDALPMEFVENFDARYPIIMG
                     GLLPTELKFGILKARMRRHRWHKKILKTNDPLVLSLGWRRFQTLPIYTTTDSRTRNRM
                     LKYTPEHSYCFASFYGPLCSPNTTFCGVQVVANSDTTGNFRISATGIIEEIDASVEIV
                     KKLKLVGYPYKIFRNTAFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHF
                     RATFEDKILLSDIIILRSWYPVHIKKFYNPVTSLLLKNKSEWKGLRLTGQIRASQGLE
                     TPTNADSAYKKVERVERRFNGLKVPSSVQKTLPFKSQIHQMKPQKKKTYMAKRAVVLG
                     GEEKKARSFMQKVFTISNAKDEKKKAKKQDERKERLKKLAKIEETKTEKEKERKKKFF
                     SEHGKKRQFDSSADGASSKKRR"
     gene            <340497..>343829
                     /locus_tag="KLTH0H03740g"
                     /db_xref="GeneID:8294357"
     mRNA            <340497..>343829
                     /locus_tag="KLTH0H03740g"
                     /product="KLTH0H03740p"
                     /transcript_id="XM_002555998.1"
                     /db_xref="GeneID:8294357"
     CDS             340497..343829
                     /locus_tag="KLTH0H03740g"
                     /note="similar to uniprot|P53125 Saccharomyces cerevisiae
                     YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
                     chromatin remodeling complex required for repression of
                     a-specific genes repression of early meiotic genes during
                     mitotic growth and repression of INO1"
                     /codon_start=1
                     /product="KLTH0H03740p"
                     /protein_id="XP_002556044.1"
                     /db_xref="GeneID:8294357"
                     /db_xref="InterPro:IPR004022"
                     /db_xref="InterPro:IPR013136"
                     /db_xref="UniProtKB/TrEMBL:C5E2C1"
                     /translation="MVLYKRKPIILPPPRPLPSNINVRVWHINESGEWFTKYTEYLER
                     MDFYMRRQFTCEITGTSCLTFFEALNSEEMQFRAVEEKFPLKLREPVAKFLHFNETRR
                     VDLLVEQVYSRFKKDFYPGERVYLRKKIAAPHTPSPTGQAVEENDKHTPMPLQNLQRP
                     YLVKEKASFNAVVDFATKEEIRSAYSKYMITEEFGSKSLMVDEDEIFRDRCTFTKHLI
                     KCFCKITLRRASTKIGAPLCVKDEYLSMYGLTLDWPPSMLQYKVDTPAEPVVPSDALS
                     SPSAYHGYSYQEEKSGKRPNDQIEGELPGIKRSKSPSVFPTPYDVNEFRETKATYNGP
                     NRALQHAFCYSQNLNRVPLNKPGSRFGKMNKLLEVYQFFQTFSKVLYVSPFCLDAFVF
                     SLKYTDVREMEGVKIQAITNIPGVRENTPEIADTPISEMSEIEKWAEEQIPGICEFLE
                     SQKTPLVSYVLRKSRDLNDNFLNDIYSNGTALIIECFVALERLFIDENGEWRCLVMDQ
                     WYDSEEEEQPSDSTKSAHDDAHKIDDEGKSIVEKEDEISNPEVDDLLEKCLNYRNVNW
                     SERLSKRQFKNGSWLIILLGIFQDCIHLPMYTEFIQKFVKAIVPPEPTTPNLNKVLWQ
                     NFCENLRLEDKLEALWVLVDVASNFSQDIKVFIEDTMEVCVQIRSERLKISKRLKTET
                     ANLVDLNVKLKELESSSEKILEITNDEVQAHISAQQEKIDNINKDRETLNQKLIENDI
                     RRLNSLGMDRNGNKYYWQELCGVQRTRGGKDADFGSGRLWVQGTALGDAKRLLHLPSK
                     GASLWKKLLCNSTAGQVVDQLFPGEGPAGNELVPVEYQEDGMVQPNLKHLVEGFSTLS
                     PIQRKILDESIQGLLLGEHAWAYIETPIEINVLITWLTEGGSVDQTLSRQARSIKPAL
                     LDTLDQKEKVYKTEQIPENQEALLKRFEESKINETDAQACQGRTVSDHIPDDEKELEA
                     IAEEIMALDDTASKTRTALNRIKELEERRDFLLNKRTFESHATRVQSRAQHQKISQEI
                     EKKLDAQEAALNECWQLPLSSSRAEAMNWKNELALSAWGLSLYAGATGKVKNGNQLSV
                     KQRMADIFSSLLSYGQNDHDNA"
     gene            <344164..>345174
                     /locus_tag="KLTH0H03762g"
                     /db_xref="GeneID:8294358"
     mRNA            <344164..>345174
                     /locus_tag="KLTH0H03762g"
                     /product="KLTH0H03762p"
                     /transcript_id="XM_002555999.1"
                     /db_xref="GeneID:8294358"
     CDS             344164..345174
                     /locus_tag="KLTH0H03762g"
                     /note="similar to uniprot|P21560 Saccharomyces cerevisiae
                     YPL215W CBP3 protein required for assembly of ubiquinol
                     cytochrome-c reductase complex"
                     /codon_start=1
                     /product="KLTH0H03762p"
                     /protein_id="XP_002556045.1"
                     /db_xref="GeneID:8294358"
                     /db_xref="InterPro:IPR007129"
                     /db_xref="InterPro:IPR021150"
                     /db_xref="UniProtKB/TrEMBL:C5E2C2"
                     /translation="MFRTLFVANKASSCSASTPLKAFRCLARAGYSVKANREEAKELE
                     SPEELAQKSKLKAKPIDYSNNAPVNPKKKRPFLSGSKYESRVYQLPKWKEALGEIVIR
                     SFNLDMDKVRAGPVAGSYYYALCKEQGLQFENEPLSTTARFFYEDLKLPRTFSQWFQI
                     TILHEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFDEMNVNSGRIADQYLKDF
                     NSQLRGAVFAYDEGLFTDDSTLAAAIWRNLFGGRKNVDMVHLEATVRYVRAQIYVLSK
                     MSDREFAMGKFKFVSPDETVYRLTAQQEAEMKENVKRKYEEMDRNPDLLPSERSKLSY
                     DN"
     gene            complement(<345221..>346837)
                     /locus_tag="KLTH0H03784g"
                     /db_xref="GeneID:8294359"
     mRNA            complement(<345221..>346837)
                     /locus_tag="KLTH0H03784g"
                     /product="KLTH0H03784p"
                     /transcript_id="XM_002556000.1"
                     /db_xref="GeneID:8294359"
     CDS             complement(345221..346837)
                     /locus_tag="KLTH0H03784g"
                     /note="similar to uniprot|P41835 Saccharomyces cerevisiae
                     YPL214C THI6 bifunctional enzyme with thiamine-phosphate
                     pyrophosphorylase and 4-methyl-5-beta-hydroxyethylthiazole
                     kinase activities"
                     /codon_start=1
                     /product="KLTH0H03784p"
                     /protein_id="XP_002556046.1"
                     /db_xref="GeneID:8294359"
                     /db_xref="GOA:C5E2C3"
                     /db_xref="InterPro:IPR000417"
                     /db_xref="InterPro:IPR003733"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR022998"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5E2C3"
                     /translation="MFDKNKVDYSLYLVTDSTMLPPGTTLESQVEAALKNGVTLVQLR
                     EKETETKVFIEQALKVQKLCHKFQVPLIINDRVDVALAIDADGVHVGQDDMPIKMVRQ
                     LLGPSKIIGWSVGYEHEVEQLAAMGPGAVDYIGLGMVYPTLTKKNPKKAPMGPRGVSK
                     LLDKLQSTNAEWCRTVAIGGLHPDNIPRVLYQIASSDGKRSLDGISVVSDIMASPEAG
                     NAAQTLRALIDQSSFHYAQGLSPCRKDFSSELAKECVQQMTEASPLVQHITNKVHQNF
                     GANVTLALGSSPIMSEVEPEFEELSQISHATLLLNTGTVAPFNTLLQAMCAYNAAKRP
                     IVFDPVGYSATSTRLELNNQLLAYGQFACIKGNVGEILSLADLNKGKMRGVDAGSVGS
                     DISLCVEATKIVAYRYRTIAVCTGQQDIVVDGTCGGTFELSEGSAARASDLPALIVEA
                     GEIPVMGKITASGCSLGSTIACLVGGISDKQHLFHAVTTAVCLYKSAGKIASERCNGS
                     GSFQVELIDALDQLFTKNQPESWVAKVSRI"
     gene            <347049..>347747
                     /locus_tag="KLTH0H03806g"
                     /db_xref="GeneID:8294360"
     mRNA            <347049..>347747
                     /locus_tag="KLTH0H03806g"
                     /product="KLTH0H03806p"
                     /transcript_id="XM_002556001.1"
                     /db_xref="GeneID:8294360"
     CDS             347049..347747
                     /locus_tag="KLTH0H03806g"
                     /note="weakly similar to uniprot|Q08963 Saccharomyces
                     cerevisiae YPL213W LEA1 Component of U2 snRNP disruption
                     causes reduced U2 snRNP levels physically interacts with
                     Msl1p putative homolog of human U2A' snRNP protein"
                     /codon_start=1
                     /product="KLTH0H03806p"
                     /protein_id="XP_002556047.1"
                     /db_xref="GeneID:8294360"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:C5E2C4"
                     /translation="MKITPSVVLDAPTYYVSHFNGVYDTEKCVVIRDLGIECDDEAMP
                     AVLAKLPKPTHVLDLTNNELNQIPDLSAHDEITTLLLGRNRISKIDGRRLPRRLRRLV
                     LSNNGVEQLAALEGLRDAPKTLENLSLRGNSVCHLEDYRVFALSRAPQLKTLDFTKIS
                     DQERNAGCKFRSSPGKDIAPSRQKFKDKNEEIMDVIVGKMSDEVRNRLKDELAAASTL
                     DEIERIESLLSGGV"
     gene            complement(<348388..>352851)
                     /locus_tag="KLTH0H03828g"
                     /db_xref="GeneID:8294361"
     mRNA            complement(<348388..>352851)
                     /locus_tag="KLTH0H03828g"
                     /product="KLTH0H03828p"
                     /transcript_id="XM_002556002.1"
                     /db_xref="GeneID:8294361"
     CDS             complement(348388..352851)
                     /locus_tag="KLTH0H03828g"
                     /note="similar to uniprot|P53127 Saccharomyces cerevisiae
                     YGL131C SNT2 22% sequence identity with S. pombe Snt2"
                     /codon_start=1
                     /product="KLTH0H03828p"
                     /protein_id="XP_002556048.1"
                     /db_xref="GeneID:8294361"
                     /db_xref="GOA:C5E2C5"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5E2C5"
                     /translation="MASESDASSRRRAVRKINYNEKDADADLVKRIQLMEKTRESVTS
                     LNKTKVSKNKYQSYLSSKSVTWNFIPSLPPSFRKHSRFSNILDLEDALIDVTTDTLSQ
                     DGSALLKRNDHIYMVSEPPGEPYYIGRIVKFVAKPEFRSYIEESLEYVNTFPAKYFQV
                     KMNWYYRPRDVQDKIQNLNPRLLYASLHMDVCPIHSYRGKCNVVHRSALNISEESQNE
                     QVWKPNTFYFEQLFDRYTLKFYDIWSSRKQLLSLDPNSVYLISLANMYPFVFTEESFP
                     IQKIIDKYVLGKETPDRETWDYKCGECGGWCEKTQRIKCDECQVYVHLFCLDPPLERK
                     PIKGVIWICSRCLHHDKESESLTEPHCQTLEFQTLQSRSGKKCALQSIPSNPENLWFH
                     YLGSKVVDFMDDILIPELVLPFPLKNSRIGPRYQWTGYEKEVEKGEPHNGPKNERGGD
                     ETSELLWKFDSSRIGDKELNEYTHKCQKTFPPQLDVLPQTSNFLDMILKLLMSCNYNA
                     NEAFALCQKLLSRETLQEPTFTTEEIKKFEEGVAEYGSELHPVCKHVGTQPMSMIVRF
                     YYYWKKTPNGRRIWGNYKGRRKNQKHANSASEHAVSSFGKKSRIRKPSKTLREDLSSS
                     SKEWKHIDDSSFDSEKISNVKTCFKCMFCEIDYSPLWYRVTGGCDDENIKTRMLTGVD
                     EKTSTSHKLPHQSLKSKKSNENPSLEALCIRCARLWRRYAVKWISPLDVIRRLNGKYA
                     SSIRNALDELLADPADTTIKVAPNQLMEKCVEWELAQDAELILKQRFHMLDDTERYLK
                     MKRNCISMHTQLNKAVKKLVDKDPQADSKMQDELKEYVQSIMQEVRKKEKKAKAVKNK
                     VKTSKAKENHKMIQTSGEQRSFKNNLDTAAFKSSTTTLIDSNGEKNVEVKQERVLTSL
                     NHTLPAGDHKLQVFVESGKKKIGEITVDSNFENLRLSEELYNYLLDLSSENASLQEKD
                     SRTCDIVNVAKAESHITEESKKHYDPTCLQITNGSNVPILPGNDFSRVLETYHCHNPL
                     HYEWSQGALPKVTNDFIQSVIRGVRPITQNNIGRKARNPAIAVEEPNCEGSLTPRNFC
                     CVCLENFSHDYNEEITCSNCGLNAHYFCYGFKPRVCRKSSKDEIKLKNLQWLCDTCSN
                     DLNPICSTNYQCSLCNAKESDYDGGKKRLSRSIPDALKITSNNTWCHVSCSLFNPDLS
                     YNSLARLQIAGNIKSTLIKCGGKACVICGVSGGGIVNCEECDFSCHVTCAQDYQKCSI
                     LFKKLYVDDDAQFYSVINDKGQKFQIKPIILCPKHQSYTKDTTALNYRNEKGTSFLEI
                     YCNNNKCFEEMRSGTVKFRAMDNRGGMALSQKFGSLFLGSQTSNPFGKVACKNCNKTS
                     SIFWYNNVCHACHHHLSNSRSNLLLNEASVVDEKATVNTVLTDYLLKGLESTKPSLPL
                     GKKGIKRQNGSTALKGKKKFKSVEAETPSSGKPPLTMPVVVQNLSGKNMRV"
     gene            <352972..>354378
                     /locus_tag="KLTH0H03850g"
                     /db_xref="GeneID:8294362"
     mRNA            <352972..>354378
                     /locus_tag="KLTH0H03850g"
                     /product="KLTH0H03850p"
                     /transcript_id="XM_002556003.1"
                     /db_xref="GeneID:8294362"
     CDS             352972..354378
                     /locus_tag="KLTH0H03850g"
                     /note="similar to uniprot|Q01159 Saccharomyces cerevisiae
                     YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
                     enzyme), alpha subunit"
                     /codon_start=1
                     /product="KLTH0H03850p"
                     /protein_id="XP_002556049.1"
                     /db_xref="GeneID:8294362"
                     /db_xref="GOA:C5E2C6"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR017075"
                     /db_xref="UniProtKB/TrEMBL:C5E2C6"
                     /translation="MDNRAAPEIPGIRQPANVTQDIRLLVCKLLNSPKPAKTFPGSQP
                     ISFHHSDIEEKLLQQDYYVCEKTDGLRGLMLIVINPVTKEQGCFIIDRENNYYQVNGF
                     RFPRLPKQSRKELLETFQDGTLIDGELVLQTNPVTKVKELRYLMFDCLAINGRCIVQS
                     PTSSRLAHLGKEFFKPYYDLRSLYPAQCATFPFKISMKHMSFSVDLVKVANSLDKLPH
                     VSDGLIFTPVTTPYVVGGKDSLLLKWKPETENTVDFKMILDIPKAEDTSLSKNDPNRF
                     FYNYGVKPSFHLYIWQGGADVNARLHDFEQPFSKKELEVLDRTYKKFADLDVSDSQWT
                     ELKSLGEPLNGRIVECAKDQETGVWRMLRFRDDKLNGNYVSVVQKVLESISDSVKIED
                     LEEATAQMKSNWEKRQIEKKRGFQEVQDARRVTQPAPPTQPAPQNTEQPKYIDDDDEE
                     LWSDDDDESDTEAKRQKL"
     gene            complement(<354482..>355798)
                     /locus_tag="KLTH0H03872g"
                     /db_xref="GeneID:8294363"
     mRNA            complement(<354482..>355798)
                     /locus_tag="KLTH0H03872g"
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /transcript_id="XM_002556004.1"
                     /db_xref="GeneID:8294363"
     CDS             complement(354482..355798)
                     /locus_tag="KLTH0H03872g"
                     /note="similar to uniprot|Q01163 Saccharomyces cerevisiae
                     YGL129C RSM23 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /protein_id="XP_002556050.1"
                     /db_xref="GeneID:8294363"
                     /db_xref="InterPro:IPR017082"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2C7"
                     /translation="MSLIGVRNFSSSSLRAAAPTRGKAQGFAKKVSGAKTTGKKVSAG
                     SLYKPWQQTIATSNLNKNAFPVEVPTFKPSEISQCVDQVMSFSNAHYKYLYTLGSFKQ
                     NQFNELFPRPISMVRRNTTQKLFELLKNSPDRKFILTGESGIGKSVLLSQVHSLAFEE
                     NALVINISYPELFLNGTNDFFYDGASYVQPMYLKRLLNKILKANNKNLLSSIPISGNY
                     KFANADPKDSASRKFVQITGGKSTLLDLISVKTSPRNRGDLFQAVIQELSKQAKVPVV
                     FTVDNFSRITSEPKSAYKNSNNENIHVLELQLGKTIMEIVSGKVLFPHKLSAVVLATS
                     GCDRTNRTLPVGLQKQPHDPYVSRKHYDHDLACLLSKGNVREFPVNKLSKQELQNLLE
                     FYYKAEIILSKDNNEKTIEQLVDEKYLLSGNGNPRELLKSLVLQFS"
     gene            complement(<356036..>357744)
                     /locus_tag="KLTH0H03894g"
                     /db_xref="GeneID:8294364"
     mRNA            complement(join(<356036..357524,357593..>357744))
                     /locus_tag="KLTH0H03894g"
                     /product="KLTH0H03894p"
                     /transcript_id="XM_002556005.1"
                     /db_xref="GeneID:8294364"
     CDS             complement(join(356036..357524,357593..357744))
                     /locus_tag="KLTH0H03894g"
                     /note="similar to uniprot|Q12211 Saccharomyces cerevisiae
                     YPL212C PUS1 Involved in tRNA biogenesis; intranuclear
                     protein which exhibits a nucleotide-specific
                     intron-dependent tRNA pseudouridine synthase activity"
                     /codon_start=1
                     /product="KLTH0H03894p"
                     /protein_id="XP_002556051.1"
                     /db_xref="GeneID:8294364"
                     /db_xref="GOA:C5E2C8"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5E2C8"
                     /translation="MSETNNLRPAYDDDQPGEEAYKRGNQYKWTKARKADYEETGDDT
                     ESSNKKAKIDPTAEVKISGNEEVKEKRLPKRKVAVMIGYCGTGYHGMQYNPPTPTIEA
                     ELFRAFVEAGAISQANSKDLKKSGFMRAARTDKGVHAGGNVVSLKLIIEDPDIIAKIN
                     SKLPEGIRVWDIERVNKAFDCRKLCGSRWYEYLLPTYSLVGPKPGSALYNDIEASKKE
                     IPGVMPDDEESAKFWASFFEEIEQKFTPEELELIKSYTPPPRDEFDDDDPTYQLVKNY
                     KLIENAHRRAYRISESRLEAFRAAMKQYLGPHNFFNFTLGKEFKDPSAIRFMKEIKVS
                     DPFVIGERNTEWVSIKIHGQSFMLHQIRKMISMATLVTRCSCPVDRITDAYKPQKINI
                     PKAPALGLLLECPVYEGYNKRLKEFGYNPIDFSKYQDKMDEFKMKHIYDKIYQEEVSE
                     NVFNAFFSYIDNFSQVTGAQSVDDGTANPASAQKSVFDFLTARGIVPSTEESPKKEAE
                     EAPQTAAPGAISTSPSEGEMEASTNNPSKPSSNEPNVV"
     gene            <359019..>359564
                     /locus_tag="KLTH0H03916g"
                     /db_xref="GeneID:8294365"
     mRNA            <359019..>359564
                     /locus_tag="KLTH0H03916g"
                     /product="ribosome biogenesis protein NIP7"
                     /transcript_id="XM_002556006.1"
                     /db_xref="GeneID:8294365"
     CDS             359019..359564
                     /locus_tag="KLTH0H03916g"
                     /note="highly similar to uniprot|Q08962 Saccharomyces
                     cerevisiae YPL211W NIP7 Nucleolar protein required for 60S
                     ribosome subunit biogenesis"
                     /codon_start=1
                     /product="ribosome biogenesis protein NIP7"
                     /protein_id="XP_002556052.1"
                     /db_xref="GeneID:8294365"
                     /db_xref="GOA:C5E2C9"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005155"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016686"
                     /db_xref="UniProtKB/TrEMBL:C5E2C9"
                     /translation="MRQLTEDETKVVFEKLAGYIGRNIKFLVDNKDQPFVFRLQKDRV
                     YYVPEHIAKLATSVARPNLMSVGLCLGKFTKTGKFRLHITALTILAQHAKYKIWIKPN
                     GEMPFLYGNHVLKAHVGKMSEDIPEHAGVIVFSMHDVPLGFGVSSKSTSESRDVQPTG
                     IVAFRQADIGEYLRDEDTLFT"
     gene            complement(<359677..>361488)
                     /locus_tag="KLTH0H03938g"
                     /db_xref="GeneID:8294366"
     mRNA            complement(<359677..>361488)
                     /locus_tag="KLTH0H03938g"
                     /product="KLTH0H03938p"
                     /transcript_id="XM_002556007.1"
                     /db_xref="GeneID:8294366"
     CDS             complement(359677..361488)
                     /locus_tag="KLTH0H03938g"
                     /note="similar to uniprot|P38688 Saccharomyces cerevisiae
                     YPL210C SRP72 Component of the signal recognition particle
                     (SRP) ribonucleoprotein (RNP) complex that functions in
                     protein targeting to the endoplasmic reticulum (ER)
                     membrane"
                     /codon_start=1
                     /product="KLTH0H03938p"
                     /protein_id="XP_002556053.1"
                     /db_xref="GeneID:8294366"
                     /db_xref="GOA:C5E2D0"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013699"
                     /db_xref="InterPro:IPR026270"
                     /db_xref="UniProtKB/TrEMBL:C5E2D0"
                     /translation="MKDLTSLLSDLNVQYNSNKHFEAAKVCKELIEAGVEDKISVLGQ
                     WLVSLIKSDCYKQGWDLLNQYDQELKGLYHLERLYIFYKLGYTKSFEKLYDELKDIEQ
                     ANSFENRGLLHVRAQFCFKNGKFEEAVKIYQLLATHNEQQLDNETELACNERAAVGST
                     YQSGYESLLVTSLNEDSYDLLFNESLIALRRGDLDLSLKYLNQASSLAAQEGSDDDQN
                     AIELQKAYVLQASGEKSEAKDILNDLVSKTMAGSTMHLLAQNNLKSFHDFSKYTTNVS
                     LLLRELDVAKLSGKVSSLGHEQQQIILNNVLFLNLFNGCGIQSKKSLVSKTLANYRKT
                     IANVVLEPYSTQAKKMFNRTMSAMSCGTGGSVFGSIVLTVQLQVLEKNFDGAIVLCES
                     YLNKNSDSVNYEHRVVCYILLQLYRESGRSSSSNRLLEHLFAIVKDNNVKEDPEFWRF
                     VAFNLLAQGFGSKAEDMFAKLQRISPELQLFNSSSEQHDVLSSDLDSLVSSVDVESLK
                     KLGAAPFEGQRTRMRDTSLGKVAKKRRVHKNRKFPKDFDAEREPNPERWLPLKDRSDF
                     RPKKKLAAKQTQGSAISRKSEQSLDISKKNRTKKGKK"
     gene            <361653..>363323
                     /locus_tag="KLTH0H03960g"
                     /db_xref="GeneID:8294367"
     mRNA            <361653..>363323
                     /locus_tag="KLTH0H03960g"
                     /product="KLTH0H03960p"
                     /transcript_id="XM_002556008.1"
                     /db_xref="GeneID:8294367"
     CDS             361653..363323
                     /locus_tag="KLTH0H03960g"
                     /note="similar to uniprot|P53166 Saccharomyces cerevisiae
                     YGL064C MRH4 Mitochondrial RNA helicase plays an essential
                     role in mitochondrial function"
                     /codon_start=1
                     /product="KLTH0H03960p"
                     /protein_id="XP_002556054.1"
                     /db_xref="GeneID:8294367"
                     /db_xref="GOA:C5E2D1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2D1"
                     /translation="MNPLLRSMSHPVIRSLGSFRCSSTYARGAARIGGKNKSSRHSLV
                     STIKKSPANRNKKDEPSSQIFHYGAFGGLKEINAQDSQKTAGILSKVTDFDQLKILPE
                     VRTAVKKVISRETIAKSPDLTEASEKDIKPSPVQVAVIQKLSKTLTNRQLQVHMVAAE
                     TGSGKTMAYLTPLLDYLKRGEQDDPEGWDQIKDKAIVRSVILVPTHELVEQVYKTVKL
                     NADLLGLHAFRWNMDTSYNDFIEAVKARIDLLVTTPGKVLNMFKVRIINRPERLLSGV
                     RFAVLDEADTLMDRSWLEETHSAIKSFPNANHLIFCSATIPSEFSKTMDRLFPTSEAI
                     TTPKLHKISQKIDFKLIDASLNPYKGSKLKALAQALYAIMKDGTEEGFEKRCLIFVNE
                     KKDAKKVAEQLTERYGHNCVSLTGEDAISERLDKISAFVNPPKRLNEAPSKLSDDSSK
                     TVKREPTMLPNSNIKLTTSSSNLHGKKNTSLKVLVTTDLMARGLNFQGVRNVILFDVP
                     KTSIDLVHRAGRTGRMMQGGRVFMIIDKKTKSWAKAVPKIVRNNKTLS"
     gene            complement(<363432..>364628)
                     /locus_tag="KLTH0H03982g"
                     /db_xref="GeneID:8294368"
     mRNA            complement(<363432..>364628)
                     /locus_tag="KLTH0H03982g"
                     /product="KLTH0H03982p"
                     /transcript_id="XM_002556009.1"
                     /db_xref="GeneID:8294368"
     CDS             complement(363432..364628)
                     /locus_tag="KLTH0H03982g"
                     /note="similar to uniprot|P38991 Saccharomyces cerevisiae
                     YPL209C IPL1 Aurora kinase involved in regulating
                     kinetochore-microtubule attachments associates with Sli5p
                     which stimulates Ipl1p kinase activity and promotes its
                     association with the mitotic spindle potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0H03982p"
                     /protein_id="XP_002556055.1"
                     /db_xref="GeneID:8294368"
                     /db_xref="GOA:C5E2D2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E2D2"
                     /translation="MTTDTRGTIFGKLLGVMNGKSTAGSEMRRNSLHQRNLLLSMRLN
                     SGPGRKSLGTSSRGTTSHRLTKENWRASFSSGSSRLGVAPTFSGQKSLQDSRSRVSSP
                     VKVGADDGRSSPAKVPLLSGTKADSSPARYKDFTLDDFEIGKKLGKGKFGKVYCVKHK
                     QTGFICALKAMKKKEIIQYNVEKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLME
                     YLVNGELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKHIIHRDIKPENILLGFQNT
                     LKLTDFGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGT
                     PPFLEDSKEMTYKRIKRRDLKFPDHISSQARDIISKLLEYEPNARIALRDVKKHPWIL
                     KNRPFW"
     gene            <365097..>366854
                     /locus_tag="KLTH0H04004g"
                     /db_xref="GeneID:8294369"
     mRNA            <365097..>366854
                     /locus_tag="KLTH0H04004g"
                     /product="KLTH0H04004p"
                     /transcript_id="XM_002556010.1"
                     /db_xref="GeneID:8294369"
     CDS             365097..366854
                     /locus_tag="KLTH0H04004g"
                     /note="similar to uniprot|Q08961 Saccharomyces cerevisiae
                     YPL208W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04004p"
                     /protein_id="XP_002556056.1"
                     /db_xref="GeneID:8294369"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5E2D3"
                     /translation="MQAEKLKVLLDWGLDNGVKCPDDVEFVNVGGKGFACIAKSDITE
                     AEFIIPESLIIKSSLAVSFFKVNSNQTSWLKLLIAKLKFDKSSTTVDDENLKAKFAPY
                     IDALPDEIDSPLVWNPSELDLLGNTNLRSSLRIKLYSIFNEWKLIMETLKKHRNEVQA
                     EILNIEETLGQSEDHVYRNITSKVFQHSSETDWWSFPAFLWSHMMFLSRAFPEYVINP
                     STDPSNVVLLPIIDLLNHDYRSKVEWNQRDGAFGVRKLETVLRGEEIFNNYGGKGNEE
                     LLSGYGFVLEENIFDTVALKIQLPLTTVSEITSTTHLFLPTLSDYTTSAFELSSGKET
                     KQMLPKKDSQYKDGVLYLLSKENDAPLRWLLDLFSFLEKSPDESCSSLRVRLQGLQNL
                     RNAIETKLSSTSSTSDRQAAGYDIKEYRARAARIYKSGQTKALKHAVNELKRTEKEWT
                     SQHKGDLLTAKRIMRFDPNFMESELPLLLRTNANSDITLDSYDTLIILWVACKAVFNT
                     CPREAQWAMDAFKAYSDCRENTMASSAEGQHLYQTFFPNGSSRLGQEQFINATEFLQH
                     FSYTRLSNGEVILVKDVNL"
     gene            <367008..>369362
                     /locus_tag="KLTH0H04026g"
                     /db_xref="GeneID:8294370"
     mRNA            <367008..>369362
                     /locus_tag="KLTH0H04026g"
                     /product="KLTH0H04026p"
                     /transcript_id="XM_002556011.1"
                     /db_xref="GeneID:8294370"
     CDS             367008..369362
                     /locus_tag="KLTH0H04026g"
                     /note="similar to uniprot|Q08960 Saccharomyces cerevisiae
                     YPL207W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04026p"
                     /protein_id="XP_002556057.1"
                     /db_xref="GeneID:8294370"
                     /db_xref="GOA:C5E2D4"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013917"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5E2D4"
                     /translation="MELSTKLTDHLVVCAVVAVYLISGGRLSIGISVAVLYALAIHDS
                     GRKVEVSEAGIIQAKSGVAGKPEKKTCCGGKGGSSCCSSGSGGKKGGCCGGSCASKKR
                     AEEKPASTGPVFESSASEPIAIDFTHAFKPARSSKPKSGAKKMPRFISRTAGSAKKDT
                     GFFKKALTVSNEKLSNSQIYVFYSSLQGAAERSAKTVLETLSGMPELKYEPKLLNLDE
                     LSDFDDYFVNVPCSYALYILVLPSYDSDSPLDFFLQSLQENASDFRIDKYVLRKLVGY
                     AVLGIGDSESWPEKFCYQARQADLLLAKQGGRRVFPVGEICMKFGGDPKVSEWSKLLA
                     ETLCDDEPILYEYDETLDDEEPQDPEDELTKEPLIDLEDVGKSSELQDVSSVKKMIVK
                     DSPTFKNLTKQGYTVVGSHSGVKICRWTKNDLRGRGSCYKHSLFNIVSSRCMELTPSL
                     ACSSKCIFCWRHGTNPVSKTWRWEVDDPEYILENALQGHYAKIKQMRGVPGVIAERFA
                     KAFKVRHCALSLVGEPIMYPFISKFVSLLHQKEISSFLVCNAQHPEPLRDLGKVTQLY
                     VSIDAPTKNELKKVDRPLYRDFWERLMECLDILRTTQSHQRTVFRMTLVKGFNMADVS
                     AYADLVQRGLPCFIEVKGATFCGTSDGNGNPLTMQNIPFYEECAKFVKSLAAELQRRG
                     LGYDVAAEHAHSNCILIASTKFKINNEWYTHIDFDRFFELLNSGKDFNHMEYLQKTPE
                     WALFGNGGFAPGNTRFYKKKRGQEAQAKEEQGLQENVSTQPINA"
     gene            complement(<369508..>370734)
                     /locus_tag="KLTH0H04048g"
                     /db_xref="GeneID:8294371"
     mRNA            complement(<369508..>370734)
                     /locus_tag="KLTH0H04048g"
                     /product="KLTH0H04048p"
                     /transcript_id="XM_002556012.1"
                     /db_xref="GeneID:8294371"
     CDS             complement(369508..370734)
                     /locus_tag="KLTH0H04048g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H04048p"
                     /protein_id="XP_002556058.1"
                     /db_xref="GeneID:8294371"
                     /db_xref="InterPro:IPR018961"
                     /db_xref="UniProtKB/TrEMBL:C5E2D5"
                     /translation="MIKRAFNTTVNRFENTQGDWGYLKQRLTQLKEEAAPDDNDALCG
                     LIKGVVKENPSIEKLYDELPRKEYEDRFRSQIQASKLKRFVNKESRETALSRPWTGEE
                     HYTDTSLRMIMDGVKNEGGSSGSSRNLGFSSTFQATKESNRYARRAVKTRLRLETAQD
                     RIIDYKIDKDEHKSDDIEASEFRVLYAEKFTPIGSFEKLKSIADVRIEESMKKGEFDS
                     VKKIRGQKLSSTQPLPYVDRTEHHLNDILVRQNISPPWIEKQGSVNKDIMVFRDDLLR
                     KFQSELIAALNLRGFFRTEVPSNSELNQHGKLNSVKESVFSDWKSTLKIGSRIKQLND
                     SLRSYNLQAPLPAQKFYLQADRELQRVLKETDISRLYRDEFSRQKVLHNNAKAANESQ
                     ATSNSQFSWPKKWRIW"
     gene            <370823..>372388
                     /locus_tag="KLTH0H04070g"
                     /db_xref="GeneID:8294372"
     mRNA            <370823..>372388
                     /locus_tag="KLTH0H04070g"
                     /product="KLTH0H04070p"
                     /transcript_id="XM_002556013.1"
                     /db_xref="GeneID:8294372"
     CDS             370823..372388
                     /locus_tag="KLTH0H04070g"
                     /note="similar to uniprot|P43636 Saccharomyces cerevisiae
                     YGL065C ALG2 Mannosyltransferase mannosylates
                     Man2GlcNAc2-PP-Dol to form Man3GlcNAc2-PP-Dol which is a
                     precursor required for asparagine-linked protein
                     glycosylation"
                     /codon_start=1
                     /product="KLTH0H04070p"
                     /protein_id="XP_002556059.1"
                     /db_xref="GeneID:8294372"
                     /db_xref="GOA:C5E2D6"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR027054"
                     /db_xref="InterPro:IPR028098"
                     /db_xref="UniProtKB/TrEMBL:C5E2D6"
                     /translation="MQGKQEAMKRGNNEGSLPKLNIAFVHPDLGIGGAERLVIDAAVG
                     LQQQGHEVVIYTSHCDKNHCFEEVKSGEIKVEVFGDFLPTNLAGKLFIMFANLRQLYL
                     TTKLMSKGKIHHHDLFIVDQLSTCVPLLSAFGNRSRVLFYCHFPDQLLAQRTNLIKSL
                     YRIPFDLLEQLTMNAADCIVVNSNFTKSVYKRTFRLFSQKPNVVHPCVGLETELVQDK
                     DFALYKKLFPPSTRFYLSVNRYERKKNIELAIKSFALSTESKRSNVKLVIAGGYDDKV
                     LENKEYLKELQNISKNSNLPYFTLHYAHWDQQLSDSGISGATDAKVLFLTSISSSLKD
                     QLLRETDLLLYTPSFEHFGIVPLEAMKLGKPVLAVNNGGPLETIVSLIPNTNENNSTG
                     WLRPSDPKEWADAIEESRDFIKEVDNIFKNNGPERVKKLFSRTAMTNQFEKNIQDISW
                     KTDKKSWLGYIMFISSVLSVIFPAALLMGCNSLSFCVLNATLVILFHSVPTLMCIVSA
                     VLLTRLFEVLIQK"
     gene            complement(<372453..>374153)
                     /locus_tag="KLTH0H04092g"
                     /db_xref="GeneID:8294373"
     mRNA            complement(<372453..>374153)
                     /locus_tag="KLTH0H04092g"
                     /product="KLTH0H04092p"
                     /transcript_id="XM_002556014.1"
                     /db_xref="GeneID:8294373"
     CDS             complement(372453..374153)
                     /locus_tag="KLTH0H04092g"
                     /note="some similarities with uniprot|P53165 Saccharomyces
                     cerevisiae YGL066W SGF73 SaGa associated Factor 73kDa
                     Probable 73KkDa Subunit of SAGA histone acetyltransferase
                     complex"
                     /codon_start=1
                     /product="KLTH0H04092p"
                     /protein_id="XP_002556060.1"
                     /db_xref="GeneID:8294373"
                     /db_xref="InterPro:IPR013243"
                     /db_xref="UniProtKB/TrEMBL:C5E2D7"
                     /translation="MTDIHSEIKGLRKDIQKDLEPRTASSTPNWKELISIAKSERSKS
                     EKPPSHSDYFRDSASIIKNPLDKPLDYRICDGCGKPVSLSAIVEHLQTYCKGLPEHPL
                     PNSVKVEEQEQPVDMSSSSIKKKNNPSNSKRSTPFGHDPDPESSPAIKKQRKTTATPA
                     SSKAKRRIKQRNPTEKHLIDFDKQCGVELPEGGYCGRSLTCKSHSVGTKRAVEGRSEP
                     FDVLLSHYQKKNQLKTGNNTKLRAKPGQQSNSTNQGHSVHSGDGSMSTLTPEEETTQV
                     LNGVSRSFPLPLETNVLASSRSRTKYFRMREMFASSFSVRPGFSAPGYGAIHSRVGCI
                     DLDRTTDYTFRIRTPQLINQMNPNNLTPQQKQKLQQQRMLQAQMLAQQQQQQQQQQQQ
                     QQQQQQQQQQQQQHQQQQQQQQQQQQQLQNQSRQGSQTQHFNPVPQQYQNHPQSQQLS
                     NGLVQPKNYTSLSQGDLETGLTPQGIQKQQQRLRQQQVQQQRFEAAAFHLATATKLMQ
                     SGPKPQNTGMVNGTASSVGSPVNMASNSRSNSSPLNQTTGQQLNSRVSNAEYDSGGAS
                     "
     gene            complement(<374596..>375561)
                     /locus_tag="KLTH0H04114g"
                     /db_xref="GeneID:8294374"
     mRNA            complement(<374596..>375561)
                     /locus_tag="KLTH0H04114g"
                     /product="KLTH0H04114p"
                     /transcript_id="XM_002556015.1"
                     /db_xref="GeneID:8294374"
     CDS             complement(374596..375561)
                     /locus_tag="KLTH0H04114g"
                     /note="similar to uniprot|Q08959 Saccharomyces cerevisiae
                     YPL206C Endoplasmic reticulum protein of unknown function"
                     /codon_start=1
                     /product="KLTH0H04114p"
                     /protein_id="XP_002556061.1"
                     /db_xref="GeneID:8294374"
                     /db_xref="GOA:C5E2D8"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:C5E2D8"
                     /translation="MATAKIIGHRAYRGYYPENTILAFNKAKEANVDVIETDLQMSKD
                     GVVVINHDQDTQRCWDKNYVISETNWDALQSLNCKDARFQDQKMPSLKQVLRWIVDNP
                     SMKLMLDIKFTNDQEIMLKSVAEMLSTKEDLLFWRERVIWGLWTVDWFRYGMETGVIK
                     DFQVACISLSLEVAKSFVEYSRELNSPHFRLSGVSMHFVSTWSKTFQKKWLHYFQQNN
                     VEIFVWTINHAVDFKYCNALPISGFVTDFPVEARGAIGQYERSKTTFKRPFFISREGF
                     RFYGFLVIYRLTIEFLFSPWAQYKVFGNFSFSLLFIKFMRIIHFL"
     gene            complement(<375792..>376874)
                     /locus_tag="KLTH0H04136g"
                     /db_xref="GeneID:8294375"
     mRNA            complement(<375792..>376874)
                     /locus_tag="KLTH0H04136g"
                     /product="KLTH0H04136p"
                     /transcript_id="XM_002556016.1"
                     /db_xref="GeneID:8294375"
     CDS             complement(375792..376874)
                     /locus_tag="KLTH0H04136g"
                     /note="similar to uniprot|P53164 Saccharomyces cerevisiae
                     YGL067W NPY1 NADH diphosphatase (pyrophosphatase)
                     hydrolyzes the pyrophosphate linkage in NADH and related
                     nucleotides localizes to peroxisomes"
                     /codon_start=1
                     /product="KLTH0H04136p"
                     /protein_id="XP_002556062.1"
                     /db_xref="GeneID:8294375"
                     /db_xref="GOA:C5E2D9"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015376"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:C5E2D9"
                     /translation="MSTLATRPLTHSLHYSQEVLNRVSFLRKDPQFLEDALAHNETQF
                     VPFDNYLPYVNERTGFILKLKKAEVANLTSQGSISSNLVFLGLLLSQKSDFVYKSKYR
                     GTPTFAIDVSIQRLSDSSLLDSSKPYKKVESFRDLNKLTVEDSSIVSQARMYLQWLDT
                     HKFCSLCGSKTKPVYAGTQLKCDNDDCKSNKSVSNSCFPRTDAVVISAITNKDYSKIL
                     LCRSGMPRNKERKLYSCVSGFVEPSETLEVAVAREIWEETGLDTQEVEIIASQPWPFP
                     NNLMIGCVAIADDTQTPDLTHDCELDEVRWVPCSALERILKLEDSESGFIQDESTGLN
                     LPNDRSIAHMLMGFVVKKSAELRKGP"
     gene            <378344..>379798
                     /locus_tag="KLTH0H04158g"
                     /db_xref="GeneID:8294376"
     mRNA            <378344..>379798
                     /locus_tag="KLTH0H04158g"
                     /product="KLTH0H04158p"
                     /transcript_id="XM_002556017.1"
                     /db_xref="GeneID:8294376"
     CDS             378344..379798
                     /locus_tag="KLTH0H04158g"
                     /note="similar to uniprot|P29295 Saccharomyces cerevisiae
                     YPL204W HRR25 Protein kinase involved in regulating
                     diverse events including vesicular trafficking gene
                     expression DNA repair and chromosome segregation binds the
                     CTD of RNA pol II homolog of mammalian casein kinase
                     1delta (CK1delta)"
                     /codon_start=1
                     /product="KLTH0H04158p"
                     /protein_id="XP_002556063.1"
                     /db_xref="GeneID:8294376"
                     /db_xref="GOA:C5E2E0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E2E0"
                     /translation="MDLRVGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRS
                     RHPQLDYESRVYKYLSGGIGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSF
                     KTVIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFS
                     THHHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKA
                     TTKRQKYDRIMEKKLCINVDQLCAGLPMEFVEYTRYCRNLRFDERPDYLYLARLFKDL
                     GIKLDYHNDHLFDWTMLRYTKAMIEKQRALGEQPQQPDEGKDEESKTESFNRVKQLAM
                     KKFSTHFHYCKPEDKHHPSPEEIKQQTAQNNNAASSIPQDLLSAIDKDMDSLKQNVVQ
                     APEAVPQPSLQPQMQQQQYQPVQRQAPIAEPLLQRQQEQQQGQQERQLDALQSATNNA
                     SPYAPQQSQARKPALNTTQYPPANAGPSGGDIWL"
     gene            <381111..>382172
                     /locus_tag="KLTH0H04180g"
                     /db_xref="GeneID:8294377"
     mRNA            <381111..>382172
                     /locus_tag="KLTH0H04180g"
                     /product="KLTH0H04180p"
                     /transcript_id="XM_002556018.1"
                     /db_xref="GeneID:8294377"
     CDS             381111..382172
                     /locus_tag="KLTH0H04180g"
                     /note="highly similar to uniprot|P06245 Saccharomyces
                     cerevisiae YPL203W TPK2 Involved in nutrient control of
                     cell growth and division cAMP-dependent protein kinase
                     catalytic subunit"
                     /codon_start=1
                     /product="KLTH0H04180p"
                     /protein_id="XP_002556064.1"
                     /db_xref="GeneID:8294377"
                     /db_xref="GOA:C5E2E1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E2E1"
                     /translation="MEYQNEGYGHSVVPDRPGMGERQRSLLPQRSAVSKGKYSLNDFQ
                     ILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPF
                     LIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAH
                     DIIYRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGTPDYIAPEVIATKPYNKS
                     VDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLSKLITAD
                     LTRRLGNLQSGPQDVKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEE
                     QLDYGSQGDDPFMQYFIDF"
     gene            complement(<382391..>382903)
                     /locus_tag="KLTH0H04202g"
                     /db_xref="GeneID:8294378"
     mRNA            complement(<382391..>382903)
                     /locus_tag="KLTH0H04202g"
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /transcript_id="XM_002556019.1"
                     /db_xref="GeneID:8294378"
     CDS             complement(382391..382903)
                     /locus_tag="KLTH0H04202g"
                     /note="similar to uniprot|P53163 Saccharomyces cerevisiae
                     YGL068W MNP1 Protein associated with the mitochondrial
                     nucleoid"
                     /codon_start=1
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /protein_id="XP_002556065.1"
                     /db_xref="GeneID:8294378"
                     /db_xref="GOA:C5E2E2"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR008932"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:C5E2E2"
                     /translation="MLVRGTRRSALKLARLPAVRARACVRLNSTQAAASVDPKIEKIV
                     QDISKLTLLETSALISELKTQLNIPDIAMPVAGAAPAGAAAPAAEEAKEEEVKEEKTI
                     FAIKLESFDAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKILKDNVAKEDADKIKASL
                     EALGAKVALE"
     gene            <383808..>384176
                     /locus_tag="KLTH0H04224g"
                     /db_xref="GeneID:8294379"
     mRNA            <383808..>384176
                     /locus_tag="KLTH0H04224g"
                     /product="KLTH0H04224p"
                     /transcript_id="XM_002556020.1"
                     /db_xref="GeneID:8294379"
     CDS             383808..384176
                     /locus_tag="KLTH0H04224g"
                     /note="highly similar to uniprot|P27999 Saccharomyces
                     cerevisiae YGL070C RPB9 RNA polymerase II subunit B12.6
                     contacts DNA mutations affect transcription start site"
                     /codon_start=1
                     /product="KLTH0H04224p"
                     /protein_id="XP_002556066.1"
                     /db_xref="GeneID:8294379"
                     /db_xref="GOA:C5E2E3"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:C5E2E3"
                     /translation="MTTFRFCRDCNNMLYPREDKDNQRLLFECRTCTYAEEAGTPMVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPRCHSHENVFFQSQQRRSDTSMVLFFV
                     CLGCSHIFTSDQKNKRTAFS"
     gene            complement(<384406..>385968)
                     /locus_tag="KLTH0H04246g"
                     /db_xref="GeneID:8294380"
     mRNA            complement(<384406..>385968)
                     /locus_tag="KLTH0H04246g"
                     /product="KLTH0H04246p"
                     /transcript_id="XM_002556021.1"
                     /db_xref="GeneID:8294380"
     CDS             complement(384406..385968)
                     /locus_tag="KLTH0H04246g"
                     /note="similar to uniprot|P22149 Saccharomyces cerevisiae
                     YGL071W RCS1 Transcription factor involved in iron
                     utilization and homeostasis binds the consensus site
                     PyPuCACCCPu and activates the expression of target genes
                     in response to changes in iron availability"
                     /codon_start=1
                     /product="KLTH0H04246p"
                     /protein_id="XP_002556067.1"
                     /db_xref="GeneID:8294380"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="UniProtKB/TrEMBL:C5E2E4"
                     /translation="MDQSALDAFHGELIQTSPSLDFLLAEDSPLSTVDTVGTGTTSNT
                     ESSGPDFTNGTPSWNDTASLNNMLSENALESINRQRSQNKLIHLDPIPDFQDRNEIKP
                     WLQKIFYPQGIEIVIERSDNIKVVFKCKASKRGRASRKQAGCGSLPEEKENPESPLAV
                     KRVQQANKKKRSVSPYNTCPFRVRATYSLKRKKWNIVVMNNGHSHPLKFNADSDDYKK
                     FKNYLRENEDWDAVKKFDELECRTRFNLPTQPQPIPCDCGLTQEIESFNIVLPTSDSL
                     ANSTDKTVSKPRHKSTRKGNKQMATALSRNSTPLGFLDKSPSQSARSGQEPQRIKQES
                     TGAPQEPHSGMTGLSPMQNFDTSMSGWDPNTLTSQSEEIDFTDLFLRPLPRTKQDPIF
                     EKPQTLNSPGRDQPWNASKNFMDDLQFQLAPVCEPSHTSNAHCILPSSTEAHMNCDAM
                     DAGSQHEFPHHRVQQQDPSMLHSSPANGMLSSDLGNMHLTGQQMQVPHPDPGLPWEPQ
                     HSNDPHGYSNDF"
     gene            complement(<386347..>387456)
                     /locus_tag="KLTH0H04268g"
                     /db_xref="GeneID:8294381"
     mRNA            complement(<386347..>387456)
                     /locus_tag="KLTH0H04268g"
                     /product="KLTH0H04268p"
                     /transcript_id="XM_002556022.1"
                     /db_xref="GeneID:8294381"
     CDS             complement(386347..387456)
                     /locus_tag="KLTH0H04268g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H04268p"
                     /protein_id="XP_002556068.1"
                     /db_xref="GeneID:8294381"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2E5"
                     /translation="MGIPVTIFDGGLLWPNGGIKGFFESCQSEHVEHASRPGLAQRRS
                     SGWDLDSGPCWRLERAYTCEDTELTRLPSYKRVDGQFWCFWRPDGSKVGIVAADGNTV
                     LSNSMSLSLPSGISAMDIVNAHSVAFGTYDGVHGMYDLGTNRVVYANTSFSQPITHVW
                     CRVTADGGSVVTFSSHNTSISVVGLSGVRSETTFLRGGQPTLRPIESVDLNAAATKIA
                     MCDARNVWVHELTSYTYQPVPGLFLQEGEFVVSLKFASTRDSLLVATSQRLLIYEPGT
                     TYAVPVCNMRHGAVFEFFEEDSRIMVEQQHLYGTHMACFALDEHTSQWSQVGYSDVRA
                     QFGIRKVHYFFALRSQLHVLSDSGNYSRFTSTEDY"
     gene            complement(<387890..>389599)
                     /locus_tag="KLTH0H04290g"
                     /db_xref="GeneID:8294382"
     mRNA            complement(<387890..>389599)
                     /locus_tag="KLTH0H04290g"
                     /product="KLTH0H04290p"
                     /transcript_id="XM_002556023.1"
                     /db_xref="GeneID:8294382"
     CDS             complement(387890..389599)
                     /locus_tag="KLTH0H04290g"
                     /note="similar to uniprot|P10961 Saccharomyces cerevisiae
                     YGL073W HSF1 Trimeric heat shock transcription factor
                     activates multiple genes in response to hyperthermia
                     recognizes variable heat shock elements"
                     /codon_start=1
                     /product="KLTH0H04290p"
                     /protein_id="XP_002556069.1"
                     /db_xref="GeneID:8294382"
                     /db_xref="GOA:C5E2E6"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C5E2E6"
                     /translation="MQANNAHHSAGPALNEDEIENIINPSDPIVGGTHGTGLGADDGS
                     HSVVEDIVNPSWDPAMTMSPGQLDHPSQNIAPFSPFMANSPLAAPPDHNNVIRRGTPV
                     GLYQQQGSPSQPPAADSLLSDSILMPYRNRLLKQSRPKTSSPQPPPRRKLTTTKTRPA
                     FVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNM
                     YGWHKVQDVRSGSIHGNSDERWQFENENFVRDCEDLLENIVRQKPSTNPSKDVLVGQN
                     GEEMDIGILLSELETVKFNQIAIAEDLKRMSKDNELLWKENMMARERHQAQQQALNKI
                     LHLLASLMGSNTQKLLGSDLVNELAQTNANLNDASNVAHGGWDLANMNGLTRPRLLLK
                     NRTPATSQHSSTGDLSSLHIGHSNSPIQEIDRSSIYPSNGSSSAGASTTPGGGRAPDT
                     MLESNSPVDTSFFNDLHSNIKKQGESIQELQDWITKMSPSQEELGSITPEGTVPQQLA
                     QSPAKTQQPNSKFDLQDYLSTSDPSALAPLLPEEPLVQEEKRSSDSDIEEISNPPKKQ
                     RTS"
     gene            <390454..>391614
                     /locus_tag="KLTH0H04312g"
                     /db_xref="GeneID:8294383"
     mRNA            <390454..>391614
                     /locus_tag="KLTH0H04312g"
                     /product="KLTH0H04312p"
                     /transcript_id="XM_002556024.1"
                     /db_xref="GeneID:8294383"
     CDS             390454..391614
                     /locus_tag="KLTH0H04312g"
                     /note="weakly similar to uniprot|P53159 Saccharomyces
                     cerevisiae YGL075C MPS2 Essential membrane protein
                     localized at the nuclear envelope and spindle pole body
                     (SPB) required for insertion of the newly duplicated SPB
                     into the nuclear envelope potentially phosphorylated by
                     Cdc28p"
                     /codon_start=1
                     /product="KLTH0H04312p"
                     /protein_id="XP_002556070.1"
                     /db_xref="GeneID:8294383"
                     /db_xref="GOA:C5E2E7"
                     /translation="MDTERHATLLLDLVWPEVDEKAQGFIYAKDFPLVVSRMEEILNR
                     GKLERDRAQLVSETGREILRKFGSDQEFFKVYKEDFRELFDGLVGTSFKSAVKSCAGD
                     GVLDRLQDSQAVDGIQDEKTSSHALQEEVMRLREQVRVLSSKNDEKDREITARDEIIA
                     DLQGKDASPAGSPRSLQRMRTLQARVTSLEDELSFRDEVIREKDRELLNLTKRVGEFK
                     DKYQFLEREFQFYKGHREQKSPDSIKEATRHEFIISELRRKITEQSEIIGQMRMQVEA
                     KPGALHPQGIGSTAGLPLNLPLRLVLRLIIGAILAYLAFDIGIRSLKAVGGLFGSSSP
                     ATLTPKSELSWWEQNTLLSKLLWFFKDLFDTYNLDAGRDEVVSANYDKLFGV"
     gene            complement(<391678..>392478)
                     /locus_tag="KLTH0H04334g"
                     /db_xref="GeneID:8294384"
     mRNA            complement(<391678..>392478)
                     /locus_tag="KLTH0H04334g"
                     /product="KLTH0H04334p"
                     /transcript_id="XM_002556025.1"
                     /db_xref="GeneID:8294384"
     CDS             complement(391678..392478)
                     /locus_tag="KLTH0H04334g"
                     /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
                     YPL199C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04334p"
                     /protein_id="XP_002556071.1"
                     /db_xref="GeneID:8294384"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:C5E2E8"
                     /translation="MSAAAVASRGQPLSQERDYNHATDSEYKRLRDLADQAYKKRQQL
                     SQQSQNAYKNGDRSGAHTLSEQAKEQLQVAEKYNLQAAEFVFTQNNADSSSNEIDLHG
                     LYTKEAVWILQKRIAAAVSARESVLKVIVGKGLHSANGIAKIKPAVEDLCQQANLPNY
                     VDSKNAGVLVIELQNASVPASWSSTDYATYAHGVPSKPQASHQAQQHQYTGQQQPQYQ
                     QQQQSQYQQQQSNYQQQQQQQQSQSQAGNNDLLSTLLGLLCTCVRKNL"
     gene            <393543..>394142
                     /locus_tag="KLTH0H04356g"
                     /db_xref="GeneID:8294385"
     mRNA            <393543..>394142
                     /locus_tag="KLTH0H04356g"
                     /product="KLTH0H04356p"
                     /transcript_id="XM_002556026.1"
                     /db_xref="GeneID:8294385"
     CDS             393543..394142
                     /locus_tag="KLTH0H04356g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H04356p"
                     /protein_id="XP_002556072.1"
                     /db_xref="GeneID:8294385"
                     /db_xref="UniProtKB/TrEMBL:C5E2E9"
                     /translation="MLQDPVRSYPRTKFWSAVSESVHVSAGLTRNSRQCRDRFNLLFS
                     RALLTDGQDVGAGVGLGTDATLDAKLAQCTARFRFGNGRSLELKQRRSHVQAPTRVPQ
                     RGCAVHELIHPPEHTPGPMPEPGPLPSPAPGPTPADLSLIHTQLREVHRVLEALTAEV
                     VGIQHQVRHLQQAFRELQDARQNQKPPVACDEDSVNRDK"
     gene            394987..395091
                     /gene="SNR39b"
                     /locus_tag="KLTH0H04378r"
                     /db_xref="GeneID:8294386"
     ncRNA           394987..395091
                     /ncRNA_class="snoRNA"
                     /gene="SNR39b"
                     /locus_tag="KLTH0H04378r"
                     /product="snR39b"
                     /note="C/D snoRNA monocistronic SNR39b"
                     /transcript_id="XR_002432219.1"
                     /db_xref="GeneID:8294386"
     gene            <395550..>396923
                     /locus_tag="KLTH0H04400g"
                     /db_xref="GeneID:8294943"
     mRNA            join(<395550..395560,395924..396017,396294..>396923)
                     /locus_tag="KLTH0H04400g"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_002556027.1"
                     /db_xref="GeneID:8294943"
     CDS             join(395550..395560,395924..396017,396294..396923)
                     /locus_tag="KLTH0H04400g"
                     /note="highly similar to uniprot|P05737 Saccharomyces
                     cerevisiae YGL076C RPL7A and to uniprot|Q12213
                     Saccharomyces cerevisiae YPL198W RPL7B Proteins component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_002556073.1"
                     /db_xref="GeneID:8294943"
                     /db_xref="GOA:C5E2F0"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:C5E2F0"
                     /translation="MAAEKVLVPESQLKKSKAQQKSAEQIAAERVARKAANKEKRAAI
                     LERNAAYQQEYADAERAVIEAKREAKANGSFYVDAQPKLVFVVRIKGINKIAPKPRKI
                     MQLLRLNQINTGVFVKVTKATSELLKLIEPYVAYGYPSYATVRKLVYKRGYGKINKQR
                     VALSDNAIVEANLGKFGIISVDDLIHEIVTVGPHFKQASNFLWPFKLSNPSGGWGVPR
                     KFKHFIQGGSFGNREGFINKLVNSMN"
     gene            396102..396194
                     /gene="SNR39"
                     /locus_tag="KLTH0H04422r"
                     /db_xref="GeneID:8294387"
     ncRNA           396102..396194
                     /ncRNA_class="snoRNA"
                     /gene="SNR39"
                     /locus_tag="KLTH0H04422r"
                     /product="snR39"
                     /note="C/D snoRNA intronic SNR39/SNR59"
                     /transcript_id="XR_002432220.1"
                     /db_xref="GeneID:8294387"
     gene            <397467..>399065
                     /locus_tag="KLTH0H04444g"
                     /db_xref="GeneID:8294942"
     mRNA            <397467..>399065
                     /locus_tag="KLTH0H04444g"
                     /product="KLTH0H04444p"
                     /transcript_id="XM_002556028.1"
                     /db_xref="GeneID:8294942"
     CDS             397467..399065
                     /locus_tag="KLTH0H04444g"
                     /note="similar to uniprot|P19807 Saccharomyces cerevisiae
                     YGL077C HNM1 Choline transporter (permease) that also
                     controls the uptake of nitrogen mustard expression is
                     co-regulated with phospholipid biosynthetic genes and
                     negatively regulated by choline and myo- inositol"
                     /codon_start=1
                     /product="KLTH0H04444p"
                     /protein_id="XP_002556074.1"
                     /db_xref="GeneID:8294942"
                     /db_xref="GOA:C5E2F1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004756"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:C5E2F1"
                     /translation="MAQAASTAYEERSLNSGDNVRELRKEDDILVTESVSKNGEEHGE
                     VHLRKQFSLWSILGVGFGLTNSWFGISTSMITGIMSGGPMMVVYGIIIIALISICIAV
                     SLGELSSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSLAWAGSVFTSASTTLSVAAEI
                     VGMYALTHPEFEVKRWHTFVCFEVLHLFLMLFNCYGKALPLISSSSLYISLFSFITIT
                     ITVLACSHGKYNDAKFVFATFYNETGWKNSGIAFIVGLINPAWSFSCLDCATHMAFEV
                     EKPERVIPISILGTVAIGFVTSFCYVIAMFFSLQNLDKVVNSNTQVPILDIYYQALGS
                     KAGAIVLGCLLLFTSFGCVIACHTWQARLCWSFARDEGLPFSRYWARVSPELGVPLNA
                     HLMSSFWIVLLGCLYLASSTAFNSLITGCIMFLLLSYTIPVVCLLLKKRNIKHGPFWL
                     GKFGCFSNVVLLGWMLFSIVFFCFPSQMPVVKDNMNYASVVIVGYLLFSLLFWQFRGR
                     HTFHALEEEAGEDNMFPIENLETK"
     gene            <399689..>401350
                     /locus_tag="KLTH0H04466g"
                     /db_xref="GeneID:8294388"
     mRNA            <399689..>401350
                     /locus_tag="KLTH0H04466g"
                     /product="KLTH0H04466p"
                     /transcript_id="XM_002556029.1"
                     /db_xref="GeneID:8294388"
     CDS             399689..401350
                     /locus_tag="KLTH0H04466g"
                     /note="similar to uniprot|P20447 Saccharomyces cerevisiae
                     YGL078C DBP3 Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /codon_start=1
                     /product="KLTH0H04466p"
                     /protein_id="XP_002556075.1"
                     /db_xref="GeneID:8294388"
                     /db_xref="GOA:C5E2F2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2F2"
                     /translation="MSSTLSEEESVKHIGRMSKDHAAERKRKHDDVDLAESTAVKKDK
                     KEKKSKKEKKDKKDKKEKKDKKDKKSKDKSKVDDAVASAKTKSEPLSTESATKEKSHG
                     STGYTESEKLSKVPQSQIDQFFQDNEVSVEDPAKLNLRPLLSFDQISLSSEIQEEISK
                     FPKPTPIQAVSWPYLLSGKDVVGVAETGSGKTFAFGVPAIHNLKTADAKSQGVQVLVI
                     SPTRELASQIYDNLILLTKKAGVNCCCVYGGVPKDEQRSQLKKSQVVVATPGRLLDLI
                     EEGSARLSNVKYLVLDEADRMLEKGFEEDIKRIIGSTKATGRQTLMFTATWPKEVREL
                     ANTFMDSPVKISIGNRDELSANKRITQIVEVIDPFKKDRKLLELLKKYQSGARKNDKV
                     LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGESNMLLATDVAA
                     RGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFTEQEKHLAGALVNVL
                     NGANQPVPEELKKFGTHTKKKEHSAYGAFYKDVDTTKKPKKITFD"
     gene            <401548..>403272
                     /locus_tag="KLTH0H04488g"
                     /db_xref="GeneID:8294389"
     mRNA            <401548..>403272
                     /locus_tag="KLTH0H04488g"
                     /product="KLTH0H04488p"
                     /transcript_id="XM_002556030.1"
                     /db_xref="GeneID:8294389"
     CDS             401548..403272
                     /locus_tag="KLTH0H04488g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H04488p"
                     /protein_id="XP_002556076.1"
                     /db_xref="GeneID:8294389"
                     /db_xref="GOA:C5E2F3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR012171"
                     /db_xref="UniProtKB/TrEMBL:C5E2F3"
                     /translation="MTTILERSEIEERICRGQAIVIYDGNVLRLDKWIKYHPGGDKAI
                     HHMIGRDATDEMKAYHCDETVSTFLKWRIGRVSGRWHNFLPPIQGGVFKSREDQEGSG
                     PSCEPESEWRDVDTSDAFQDISKTKRMCGEPDVKIYPKIPQGVVPTLDLKLAFEKKVV
                     TDPQDITENYDNEQVKHDLLTLPSLDAETQDWLSQEYNEMHQEVIQAGLYKCNYFRYA
                     KELLRIGALFGLSYFLLFHKNQKFWSAVSMGAAWQQLVFIAHDAGHIGITHNYQADNI
                     IGMVIASWIGGLSLGWWKRNHNVHHLVTNDPIHDPDIQHLPFFAVSTRLFNNIYSTYY
                     ERFLWFDKFAQKVIPLQRFLYYPILAFGRFNLYRLSWMHVLLGQGPRRGKAAWFRYFE
                     LAGLIFFNYWFFYLIVICRLHTGWERFQYIMVSHITTMLVHVQITLSHFAMSTSDLGV
                     AEGFPMRQLRTSMDVDCPRWLDFLHGGLQFQVVHHLFPRLPRHNLRDAQPFVIKFCEK
                     VGLTYSIYGFKKGNGVVLGRLEEIAQQAKTMLKCAQTMEQEANSRPKPNISAPIDHTC
                     SSKRHKLA"
     gene            <403524..>404264
                     /locus_tag="KLTH0H04510g"
                     /db_xref="GeneID:8294390"
     mRNA            <403524..>404264
                     /locus_tag="KLTH0H04510g"
                     /product="KLTH0H04510p"
                     /transcript_id="XM_002556031.1"
                     /db_xref="GeneID:8294390"
     CDS             403524..404264
                     /locus_tag="KLTH0H04510g"
                     /note="similar to uniprot|Q08952 Saccharomyces cerevisiae
                     YPL196W OXR1 Protein of unknown function required for
                     normal levels of resistance to oxidative damage null
                     mutants are sensitive to hydrogen peroxide"
                     /codon_start=1
                     /product="KLTH0H04510p"
                     /protein_id="XP_002556077.1"
                     /db_xref="GeneID:8294390"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:C5E2F4"
                     /translation="MFKGRLSSLRRSFTSPEADSSSNETKEESGRSSFFDEEPLPEVS
                     FHGYAATTKHRLLTPEISDEVRNQMPTRIQLYPDWQLLYSLEQDGASLHSLYGKVAPD
                     AKNPGRVGYVLLIEDRKGGIFGAYTNEPFRPTERKRYYGNGECFLWKIEKAATINIGN
                     AKASCSRSSDHHWRFRSYPFTGLNEFVIYCTSEFLSMGAGNGHYGLWCDSSLINGVSD
                     PSLTFGNDVLSREGNKFHIVNLEVWRVG"
     gene            complement(<404281..>404928)
                     /locus_tag="KLTH0H04532g"
                     /db_xref="GeneID:8294391"
     mRNA            complement(<404281..>404928)
                     /locus_tag="KLTH0H04532g"
                     /product="KLTH0H04532p"
                     /transcript_id="XM_002556032.1"
                     /db_xref="GeneID:8294391"
     CDS             complement(404281..404928)
                     /locus_tag="KLTH0H04532g"
                     /note="similar to uniprot|P53158 Saccharomyces cerevisiae
                     YGL079W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04532p"
                     /protein_id="XP_002556078.1"
                     /db_xref="GeneID:8294391"
                     /db_xref="InterPro:IPR019371"
                     /db_xref="UniProtKB/TrEMBL:C5E2F5"
                     /translation="MNEWCKVPVGPVIFPEKVTNRCAMDEDGSGSVGLRTRTASVNSQ
                     MYAIPEPEEIDIQLSEGSSRSEFEDSDYDAESDYDAESGGDAFLDQMVPETSNTFVMG
                     QLDTPMFDTSKYLFQSLSQALNAADFSEAIALQTRTSGLINSKSRELEKLSQEVQQKL
                     RYFETRFAQGAQTSKRISRNLQHIAKQVDKIGSAFETRYPIEFNQAREEIFERKT"
     gene            <405046..>407877
                     /locus_tag="KLTH0H04554g"
                     /db_xref="GeneID:8294392"
     mRNA            <405046..>407877
                     /locus_tag="KLTH0H04554g"
                     /product="KLTH0H04554p"
                     /transcript_id="XM_002556033.1"
                     /db_xref="GeneID:8294392"
     CDS             405046..407877
                     /locus_tag="KLTH0H04554g"
                     /note="similar to uniprot|Q7LIB1 Saccharomyces cerevisiae
                     YPL195W APL5 Delta-like subunit of the yeast AP- 3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway suppressor of loss
                     of casein kinase 1 function delta-like subunit of the
                     yeast AP-3 adaptin component of the membrane-associated
                     clathrin assembly complex"
                     /codon_start=1
                     /product="KLTH0H04554p"
                     /protein_id="XP_002556079.1"
                     /db_xref="GeneID:8294392"
                     /db_xref="GOA:C5E2F6"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="UniProtKB/TrEMBL:C5E2F6"
                     /translation="MTSLYAPSADDVMRRLRPFGLFFEKSLKDLIKGIRSCGENSEEL
                     ERFLSKTLSECRQEVESPDLDLKTNAVVKLTYLEMYGFDMSWANFYILEVMSSNRLQH
                     KRVGYLAASQSFHKDPDILMLATNLLKKDLKYDGNNDVLKMGVTLSGLSTMVTAPLAR
                     DICGDLFSMLGSSKPYIRKKAISALFKVFLQYPEALRDNFDKFVAKLEDEDMSVVSAT
                     VSVICELSKKNPHPFVQLSPLLYETLFTIDNNWIIIRLLKLFTNLSQVEPKLRVKVLP
                     KILELMEVTSATSVIYESINCIVKGHMLEPDDYDTALSCLEELTKFCNSNDPNLRYIS
                     VVLFYKIGKINTSFISEFNTLVIRLLKDVDISIRSRALELLEGITDDENIAQIVQILV
                     KQFADKDVVLANKLFKQTRQENIEIEVPNSYKIKMVSTILRICSLNNYANVPDFDWYL
                     AVLSDLCVISQDLNDEAIGLQLGAELRNIMVKVPSMRETCISTIVGLVSNNDICRQLP
                     MVLKECLWCIGEYPSSISNGDDIIKLITRQRRLTPEVQQIAAQALIKIFSSWCNTNGN
                     VPINDVKHTIQELISFFESLSSSKSFEVQERCVEFLEFFKLCAESLEQNDEELPLLIT
                     EVLPSFFNAYELNPILHGTLKKVQNSLSIDLETPFLSEDEVKNLLEEESSKHEAESML
                     ASDLDMDDEFEEDDAIENPAHEDKLLGDRSRDDLAEEERRVLEEERRKEKLTNPFYLE
                     GDYEDFAAKRENPLIDFNDNQDQNYPESSSLIAGELKHVSETSKKTKKERKKKKKKAE
                     VLIDEGVPEITSDVAAIPEPQPAKSISSSKNSSRINLKMQTKLESFNFDQPQKYVEDS
                     GAAGTEGQQEIDQLRAKFAESSLGQDMDEEVVIVKRKKKKRSKDKKHSKKKDVEHHSA
                     HGEPAKCDSGQNPQAENASAHDQTAHESL"
     gene            <408053..>409687
                     /locus_tag="KLTH0H04576g"
                     /db_xref="GeneID:8294393"
     mRNA            <408053..>409687
                     /locus_tag="KLTH0H04576g"
                     /product="KLTH0H04576p"
                     /transcript_id="XM_002556034.1"
                     /db_xref="GeneID:8294393"
     CDS             408053..409687
                     /locus_tag="KLTH0H04576g"
                     /note="similar to uniprot|Q08949 Saccharomyces cerevisiae
                     YPL194W DDC1 DNA damage checkpoint protein part of a
                     PCNA-like complex required for DNA damage response
                     required for pachytene checkpoint to inhibit cell cycle in
                     response to unrepaired recombination intermediates
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0H04576p"
                     /protein_id="XP_002556080.1"
                     /db_xref="GeneID:8294393"
                     /db_xref="GOA:C5E2F7"
                     /db_xref="InterPro:IPR007268"
                     /db_xref="InterPro:IPR026217"
                     /db_xref="InterPro:IPR026584"
                     /db_xref="UniProtKB/TrEMBL:C5E2F7"
                     /translation="MIFKASIIKAENHSVWRRAVQMLSTLHEDIKLTITSSELIVWSM
                     NSADTSMSQIRFKRNFFDEYEFQPENTVFGEDGLQQVEDRALVVHKLYSFKTNGKHLS
                     VLFRKPENDNIKSLELAIHNGAACPESLANKLQITIHTENLMLKEYVPHIIPIKYDPI
                     VINLRYKKRFLEVYGSSSETQEEQLDPRLLEIFRKFDRELSESYFNNDIVSNTKRSRD
                     LVPEDEINYLCCNIQLLKNFIDSCNTGATEEVKLEVSLSKLCLTAFTRGVYSKNNDIL
                     RNAMRASNTVGTSDLEHYCLFTTTGDDDQRRPPSKVVSFGMKDFRNFINTVAFWRNDQ
                     EIHMWFCRPGDPVFLELDKDDLCLELVQVTSSNEDLVPSGNKIKTQTTSPLKEIVHIK
                     LGSPRKSPLKGLTPSKTPSSNETTSPLKPKTLFVKEKSFDADQQRWKNPVRGKRLPDS
                     QEEIPKSLHHAPNEPAFKAQRTQTTIEWGQSVPESANDAAATALDQRDLLKQEKRKFL
                     QNIRNEREKDVEKDEPTQGVDEFGPTQVDKPKGLFD"
     gene            <411070..>412059
                     /locus_tag="KLTH0H04598g"
                     /db_xref="GeneID:8294394"
     mRNA            <411070..>412059
                     /locus_tag="KLTH0H04598g"
                     /product="KLTH0H04598p"
                     /transcript_id="XM_002556035.1"
                     /db_xref="GeneID:8294394"
     CDS             411070..412059
                     /locus_tag="KLTH0H04598g"
                     /note="similar to uniprot|Q08932 Saccharomyces cerevisiae
                     YPL193W RSA1 RiboSome Assembly"
                     /codon_start=1
                     /product="KLTH0H04598p"
                     /protein_id="XP_002556081.1"
                     /db_xref="GeneID:8294394"
                     /db_xref="InterPro:IPR019496"
                     /db_xref="UniProtKB/TrEMBL:C5E2F8"
                     /translation="MNYNHGSNYNGGDQYYNRPNIPKPTSSGQLPNQHPHSNQRADAN
                     FQPHQTSAYFQGHQTFGATQGYGQNYYGSYPQYYYPAQQAPYYAGGYQGYIANYASPA
                     EPPKEAVKNNSAERKSVISYDDTDTETNIISQDQNGGSKEKRHSEVGTPDDPKETIEA
                     ENKEAKIIAIPGTSITLESEEDIKKWREERRKMWLVKISNQREKHKSDLGIEEEDVSR
                     NEAFQQVKRDKQFIQSIQNQINRSGPSPNLDLKLIQRTMAKENIKLLNFIKELGDAGL
                     LQYELKEEEKQKLFGSNSRQPGARTNFNNKRPNTPHEGPSRYEGSKKRQHKPN"
     gene            complement(<412730..>413935)
                     /locus_tag="KLTH0H04620g"
                     /db_xref="GeneID:8294395"
     mRNA            complement(<412730..>413935)
                     /locus_tag="KLTH0H04620g"
                     /product="KLTH0H04620p"
                     /transcript_id="XM_002556036.1"
                     /db_xref="GeneID:8294395"
     CDS             complement(412730..413935)
                     /locus_tag="KLTH0H04620g"
                     /note="some similarities with uniprot|P53156 Saccharomyces
                     cerevisiae YGL081W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04620p"
                     /protein_id="XP_002556082.1"
                     /db_xref="GeneID:8294395"
                     /db_xref="UniProtKB/TrEMBL:C5E2F9"
                     /translation="MSFAMFNARDQTGCRRVVFEVRKTEGQGLQFPIGRASLKDPERR
                     DREDNFMFCEKSLSKKHAILCIKRLVPSESDPFVPLLSQFRISVQDLGSTHGLVDLQS
                     QDADASVIDLKNGERFGLIKLCQPVAPGQSRGAKLKFQVFIKTNESDDTHETLELVLR
                     NVTHEWSPYVSRPATAAEEELEMPLSPSSCSTSSSSSDLNYSEDIDLDLGKYGSNEST
                     EQGSQDEQAELSRMAEDCIETDSSHHTLFVSDEPACLADNAPTTYVRMPAPYEPLFAP
                     RAECEGAYNRDETEMFDDKNTPEGTPECFDCSKSINPYNEDELCDSVRDLAEEDYSLT
                     SRKRSFEPEKDQDVCLEKCKKAKTDIELDKGTEVGGSRRQVIIGSMMGFVAGSLGTLG
                     LLVGIANMG"
     gene            complement(<414364..>415497)
                     /locus_tag="KLTH0H04642g"
                     /db_xref="GeneID:8294396"
     mRNA            complement(<414364..>415497)
                     /locus_tag="KLTH0H04642g"
                     /product="KLTH0H04642p"
                     /transcript_id="XM_002556037.1"
                     /db_xref="GeneID:8294396"
     CDS             complement(414364..415497)
                     /locus_tag="KLTH0H04642g"
                     /note="similar to uniprot|P53155 Saccharomyces cerevisiae
                     YGL082W and similar to uniprot|Q08930 Saccharomyces
                     cerevisiae YPL191C Hypothetical ORFs"
                     /codon_start=1
                     /product="KLTH0H04642p"
                     /protein_id="XP_002556083.1"
                     /db_xref="GeneID:8294396"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:C5E2G0"
                     /translation="MSLSFQVKAIEINGYPYRIVLQSDNGPCALIALCNVLLLSPQYA
                     RYVGALSRLVETRTDVGLDELITTLANIGMQMPRGAQSDVNRLLELLPQLHTGLTINP
                     VFNGSFEDGDEMALFRLFNVSIVHGWVADYAEDRGQYEHVSKYSYEGAQRALIDAYDI
                     QHGSEPAGAAGRDYDAQALLEDATYIKSFLARSATQLTDYGLHHLRELLLENSYAVLF
                     RNDHFSTIIKHNNELYALVTDLGFKDDEDIVWQSLKSVNGSQDTFYSGRFIPSTLQKS
                     NTEVTSATSGSRARNPFLDPTNSRADAQASSGPNTMTDEQYARQLQEQEDARVARSYN
                     RQYNAARSQRRTTQDSADGGSRPGKKSSSMRKRDKLKKKCIIM"
     gene            complement(<415939..>418380)
                     /locus_tag="KLTH0H04664g"
                     /db_xref="GeneID:8294397"
     mRNA            complement(<415939..>418380)
                     /locus_tag="KLTH0H04664g"
                     /product="KLTH0H04664p"
                     /transcript_id="XM_002556038.1"
                     /db_xref="GeneID:8294397"
     CDS             complement(415939..418380)
                     /locus_tag="KLTH0H04664g"
                     /note="similar to uniprot|P38996 Saccharomyces cerevisiae
                     YPL190C NAB3 Single stranded DNA binding protein acidic
                     ribonucleoprotein required for termination of non-poly(A)
                     transcripts and efficient splicing interacts with Nrd1p"
                     /codon_start=1
                     /product="KLTH0H04664p"
                     /protein_id="XP_002556084.1"
                     /db_xref="GeneID:8294397"
                     /db_xref="GOA:C5E2G1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E2G1"
                     /translation="MSAEEPNSMDPTREDDLAPAALEGAPVEETNVLLADEVAGDDEE
                     QEDDQESLYSHEEERDAAEKEDSATPEIQTATVQAENEGEVGAEGQDEEEDAQGGSDQ
                     VIEAVEIGDVQERKEEEEAQGPESTLIEPDVVTVGQPVDASADELDAAEASDSRERAE
                     DDAEGSGQEAHPEEQTALVDFGSEDEKGQSVSSESGAQEQEASEDAGSDGDEKEQEQD
                     ADQPNHEAAESSEQESSSGTQSVEPQPFDVARYDMSSENVDYGLLQKQATYIVSSNML
                     NTPGFQQLVEPDKINAVLSFLNSNPETAFQAFAGQVAQPSNPQRASQHEPRPDLSQPM
                     TAVERKRYNEYLRGENRITEIQNIPPKSRLFIGNLPLKNVAKDDLFRIFSPYGHIYQI
                     NIKNAFGFIQYDNPQSVKAAIAGESNELNFGKKLILEISSSNSRPQYDHGDHGTNSSS
                     TFISSSKRPFEEEEEEDMYSDSSYKRGKRRVPDCQIYVKRTADRSYANEVFNRFKQAS
                     GLETDMIFLKPRMELRKMINDAAYDGVWGVVLVNKTRNVDIQTFYKGPQGETKFDEYA
                     SVSCEDAIAIFNNLKSNRGDRMAAPVQHAPQQHAPQPHAPQQHAPQQQYYGGYGAAPA
                     PQPPHQGQPYIQQPPYGGAPQGPAPGYGGPPPMAQGYGAYPGAQAHVSPPPPVVAPPM
                     AAGPQMDQQQLFSAIQNLPPNVVSSLLAMAQQQPQQQQQLLGIIQSMQPQAQPHGAQH
                     GGPSVPPAYQGYHQMQSQPINSPPVQQHQQQPPAFAAKSPPAQNPIPQQSQAPASGNN
                     NVQSLLDSLAQLQQK"
     gene            complement(<419384..>421726)
                     /locus_tag="KLTH0H04686g"
                     /db_xref="GeneID:8294398"
     mRNA            complement(<419384..>421726)
                     /locus_tag="KLTH0H04686g"
                     /product="KLTH0H04686p"
                     /transcript_id="XM_002556039.1"
                     /db_xref="GeneID:8294398"
     CDS             complement(419384..421726)
                     /locus_tag="KLTH0H04686g"
                     /note="similar to uniprot|P53009 Saccharomyces cerevisiae
                     YGL083W SCY1 Suppressor of GTPase mutant"
                     /codon_start=1
                     /product="KLTH0H04686p"
                     /protein_id="XP_002556085.1"
                     /db_xref="GeneID:8294398"
                     /db_xref="GOA:C5E2G2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E2G2"
                     /translation="MFWSSKSSISSNYSYSSSPTFTAEPWSVHAGRAKNGSSANTSAR
                     VSVFIFDKRHFENFLLTSGAIKSKSSSKDKQFILSAYDILRAQVNQLAKLKHPNILAL
                     IEPLEEHSKNFMFVSEYVTGNLESVFGDKVSDELDFLKQTRDSGSSDVVVQRGILQVA
                     QGLDFIHNRANSVLLDLRPASILVSENSDWKIAGLGHLAKLPSGSNTGQYTPDFNPRF
                     PHFMHIPLNYSAPEIIMENMLTPKNDFFSLGLLIYFLYYKKNLFSCQDYIGDYKEDYS
                     KYERDLVRLSFENVFSKVPQKLRFNLPKLMNRDVFSRFDNITEFLDIEFFQDPLVKTL
                     AFLDDLPTKDSQERSIYLQGLLDILPQFPSQILQKKFLTVLLELLDQMCSSEVIDSKC
                     LNTLLTVISKIGMTLSQLSFQERVYPHFAAKNNFSKLLENATRSLIDNIDILQEKIKG
                     DLFVEKVLKPLCTYVFSKNNGEDAVQLQESLMGKLDVILKSFDFPTVKNFLFTLLSQL
                     FVKTTSLTVKNACVASFKKMIELKTLDKYTCVEDVLPLFKSMKTRDSRILMKSLELLQ
                     LFPSVVENEDVLVEQVLPLLWNFSMAMTLKPNQYLAYNTAINKISGDIQRVHLQKLKE
                     TTGHQMAGEEADFSKVIEKPVQKPRDPDAQASRSISVPAMMPKSTPSAQTPPITPRPR
                     TKQPSKPLVLTKGSASAASRLPSRSAPKKLPTPPPKTTAEPDPDDFDDFVTSPSSPVI
                     NTSAQSSPSFPPGFSMAIQPQRKPSSLQSSSFVQDQSSLL"
     gene            complement(421972..422042)
                     /locus_tag="KLTH0H04708r"
                     /db_xref="GeneID:8294399"
     tRNA            complement(421972..422042)
                     /locus_tag="KLTH0H04708r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=62.63"
                     /db_xref="GeneID:8294399"
     gene            <422975..>424768
                     /locus_tag="KLTH0H04730g"
                     /db_xref="GeneID:8294400"
     mRNA            <422975..>424768
                     /locus_tag="KLTH0H04730g"
                     /product="KLTH0H04730p"
                     /transcript_id="XM_002556040.1"
                     /db_xref="GeneID:8294400"
     CDS             422975..424768
                     /locus_tag="KLTH0H04730g"
                     /note="similar to uniprot|P53154 Saccharomyces cerevisiae
                     YGL084C GUP1 Multimembrane-spanning protein and similar to
                     uniprot|Q08929 Saccharomyces cerevisiae YPL189W GUP2"
                     /codon_start=1
                     /product="KLTH0H04730p"
                     /protein_id="XP_002556086.1"
                     /db_xref="GeneID:8294400"
                     /db_xref="GOA:C5E2G3"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:C5E2G3"
                     /translation="MIVEIGNMLLQQILYFFSLKMLDSRLDPSTDAKRAQKVSMGASK
                     SRWRTFEFKVYYVMFILVVPLMIRTAISATSERNPNYARFEPLLSKGWILGRKVDNTD
                     SQYRFFRDNMPLLAGLIVLHTGLKKAVLRTTNVRRVRFDLVFGLLFLFAAHGVSALRV
                     LLHLVINYAIAKTLRKNYRLATFLTWVYGISTLFFNNSYRKYPFGNVLSVLTPLDGAF
                     KGIIERWDVFFNFTLLRMISFNMDFLEKWEQVVTGKKNNSPSPSPSHVSNLKPELKRA
                     ASSATTLETICENGTTNVLLDERARMNAPHHIQDYLFANYLAYVTYTPLFIAGPIVTF
                     NDYLYQCQQTLPSINTKRILYYAGRFVLCVLTMEFVLHYIYAVAVSKTKAWDGDTPFQ
                     ISMIGLFNLNIVWLKLLIPWRLFRLWAMIDGVDAPENMIRCVDNNFSALAFWRAWHRS
                     FNKWVVRYVYIPLGGSKNRILTSLAVFSFVAIWHDIELKLLLWGWLIVLFLLPEIFAQ
                     RYFAPYRKRPWYRFVRAMGAILNIWMMMIANLYGFCLGYDGTVHLIKGLFFTWAGLRF
                     LMGANVALFIAVQVMFEQREHEKRNGVDVKC"
     gene            complement(<424818..>425618)
                     /locus_tag="KLTH0H04752g"
                     /db_xref="GeneID:8294401"
     mRNA            complement(<424818..>425618)
                     /locus_tag="KLTH0H04752g"
                     /product="KLTH0H04752p"
                     /transcript_id="XM_002556041.1"
                     /db_xref="GeneID:8294401"
     CDS             complement(424818..425618)
                     /locus_tag="KLTH0H04752g"
                     /note="similar to uniprot|P53153 Saccharomyces cerevisiae
                     YGL085W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04752p"
                     /protein_id="XP_002556087.1"
                     /db_xref="GeneID:8294401"
                     /db_xref="GOA:C5E2G4"
                     /db_xref="InterPro:IPR016071"
                     /translation="MSEDRAVRLSSQQILYTKAAILSAALTGSILTSYALFNRYLKQY
                     TRVTQIPLSAFRKNWLYGKVTSVGDGDNFHLFHTPGGILGGWGWARSAPKLDKVNNKR
                     SDSLKRLFFPRFLRRQKEQEKFQSLNVPFKGRRNLPTLSIRLCGVDAPERAHFGNAAQ
                     PFSEEALIWLRHTLIGKFVWIKPLSLDQYGRCVAKVKFWSWTGWKNVSLEMVKNGIAV
                     VYEGKTGAEFDDERDIYIFHEQVARKERRGLWSLKKFETPGNYKKRVG"
     gene            complement(<426645..>428621)
                     /locus_tag="KLTH0H04774g"
                     /db_xref="GeneID:8294402"
     mRNA            complement(<426645..>428621)
                     /locus_tag="KLTH0H04774g"
                     /product="KLTH0H04774p"
                     /transcript_id="XM_002556042.1"
                     /db_xref="GeneID:8294402"
     CDS             complement(426645..428621)
                     /locus_tag="KLTH0H04774g"
                     /note="similar to uniprot|P40957 Saccharomyces cerevisiae
                     YGL086W MAD1 Coiled-coil protein involved in the
                     spindle-assembly checkpoint phosphorylated by Mps1p upon
                     checkpoint activation which leads to inhibition of the
                     activity of the anaphase promoting complex forms a complex
                     with Mad2p"
                     /codon_start=1
                     /product="KLTH0H04774p"
                     /protein_id="XP_002556088.1"
                     /db_xref="GeneID:8294402"
                     /db_xref="GOA:C5E2G5"
                     /db_xref="InterPro:IPR008672"
                     /db_xref="UniProtKB/TrEMBL:C5E2G5"
                     /translation="MSDSTGSSPFLERPMSPDSTQRHAVSLKYRMNAMQNEFEIEKLS
                     LQRELSTLDKKYRTNLDELEKALGDTKYLYDTNTELESKVKALEEQLSELKTTQDTQS
                     FILRQKLAEKERDIEQLRSESRSKVSELENKYQNSKIESESSKSLLKRYEEEIESQNR
                     QLKELQSAVAQRDDEIASIKASRVVMAHHNYSTEELAELTTLNNLLEEQIKFSKTLEK
                     ANLEQANELKKLRVSRDSYQFLLSENERLKTRQEQQGPLERQVQDLELENINLQSQLS
                     FWNSFSTSKDEGTKTRPEEIVKEWTLLKHENLGLVNTNSKLQLDINNVKVLNDELALE
                     RNQLLEINKNYETSILNLKKLNYEIEQQKLLSFEECKILRNQLDNLLPIEDNPEDHNK
                     ENAGSLGDLVENYKNKTEDLTNELKRLNEELMTRGDAVSSFKKRKTSDDIALNYSQRL
                     NELQLENVDLNRKLTASLETIAMLETKVTKLRQLDQKKLRIMQLRDNPFSKDQLVKRK
                     QLDLLLKENKDLLAGGAISHQHSVPRSLYDRLEFDVKQLENEIFKLNKKTTRLREVFN
                     RKSLEFIEVVNSLLGFKMEFQSDGKVKMISCYKPEKYLVADLHHNSLKSNLQSDIDSW
                     DALLEEFVVKRGQMPGFLASVTLQLWEKQQKSLD"
     gene            <428760..>429239
                     /locus_tag="KLTH0H04796g"
                     /db_xref="GeneID:8294403"
     mRNA            join(<428760..428770,428834..>429239)
                     /locus_tag="KLTH0H04796g"
                     /product="KLTH0H04796p"
                     /transcript_id="XM_002556043.1"
                     /db_xref="GeneID:8294403"
     CDS             join(428760..428770,428834..429239)
                     /locus_tag="KLTH0H04796g"
                     /note="highly similar to uniprot|P53152 Saccharomyces
                     cerevisiae YGL087C MMS2 Protein involved in error-free
                     postreplication DNA repair forms a heteromeric complex
                     with Ubc13p that has a ubiquitin-conjugating activity
                     cooperates with chromatin-associated RING finger proteins
                     Rad18p and Rad5p"
                     /codon_start=1
                     /product="KLTH0H04796p"
                     /protein_id="XP_002556089.1"
                     /db_xref="GeneID:8294403"
                     /db_xref="GOA:C5E2G6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C5E2G6"
                     /translation="MSRVPRSFRLLEELEKGEKGMGPESCSYGLAHSDDITMTHWNGT
                     ILGPPHSNHENRIYSVAIECGEAYPDQPPKIRFLSKVNLPCVDQNTGEVKKEQFSTLR
                     DWKRSYTMETLLLDLRKEMALPSNKKLPQPAEGTTF"
     gene            <429493..>430752
                     /locus_tag="KLTH0H04818g"
                     /db_xref="GeneID:8294404"
     mRNA            <429493..>430752
                     /locus_tag="KLTH0H04818g"
                     /product="KLTH0H04818p"
                     /transcript_id="XM_002556044.1"
                     /db_xref="GeneID:8294404"
     CDS             429493..430752
                     /locus_tag="KLTH0H04818g"
                     /note="highly similar to uniprot|Q06892 Saccharomyces
                     cerevisiae YPL188W POS5 Mitochondrial NADH kinase
                     phosphorylates NADH also phosphorylates NAD() with lower
                     specificity required for the response to oxidative stress"
                     /codon_start=1
                     /product="KLTH0H04818p"
                     /protein_id="XP_002556090.1"
                     /db_xref="GeneID:8294404"
                     /db_xref="GOA:C5E2G7"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:C5E2G7"
                     /translation="MIRVLRPQCFFRRLHTVDPLNVKLRDTSQFVRVKPVSKLRSISS
                     PDFISSPNSKLQSLIWHRPLQNVFVTKKPWADNTRQAMVEFIAHLHDSYPEINVIVQP
                     DVAEEIAQDFVKNPQSNPGQPHILYTGEMKDIVDKVDLLVTLGGDGTILRAVSLFASM
                     QVPPVLAFSLGTLGFLLPFNFKEHKRVFEEVLNSRAKCLHRTRLECHVIRRGSNGKEG
                     KSVAHHAMNDIFLHRGNSPHLTNLDIFIDGEYLTRTTADGVTLATPTGSTAYSLSAGG
                     SIVSPLVPSILLTPICPRSLSFRPLLLPHSSHIKIKVGCKASQGPDNKLVRLSIDGVP
                     LEDLNVGDEIHVVNEVGTIYVNGSQLPSTTDAATIKRRGQDIKNAGVYCVAKTENDWT
                     RGINELLGFNSSFRFMSQREKEGENSK"
     gene            complement(<431325..>432656)
                     /locus_tag="KLTH0H04840g"
                     /db_xref="GeneID:8294405"
     mRNA            complement(<431325..>432656)
                     /locus_tag="KLTH0H04840g"
                     /product="KLTH0H04840p"
                     /transcript_id="XM_002556045.1"
                     /db_xref="GeneID:8294405"
     CDS             complement(431325..432656)
                     /locus_tag="KLTH0H04840g"
                     /note="similar to uniprot|P34163 Saccharomyces cerevisiae
                     YKL140W TGL1 Steryl ester hydrolase one of three gene
                     products (Yeh1p Yeh2p Tgl1p) responsible for steryl ester
                     hydrolase activity and involved in sterol homeostasis
                     localized to lipid particle membranes"
                     /codon_start=1
                     /product="KLTH0H04840p"
                     /protein_id="XP_002556091.1"
                     /db_xref="GeneID:8294405"
                     /db_xref="GOA:C5E2G8"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5E2G8"
                     /translation="MCGRMESLWNFCLSLCLRIPMWIYNHCILPLICVLPFFQKYKTF
                     NYSYHNRLVKEVVHANDILDIAMAHGFDVQEHLVRTQDGYLLTVHRVLGKKSEVYRSQ
                     AKKPVVYFHHGLLTNSELFLLGQTSDKCLPFLLVERGYDVWLGNNRGNKYSRKHINLS
                     SRSAKFWDFSLDEYAIFDIPNTISYILNLTGLEKLTYIGFSQGSSQAFAAFSINPQLR
                     DKIQLFVGLSPAMIPRSLSHPVAKFLVTCPPELLYFIFGTRAILPSVVFWQRLFGPIN
                     YMKIVDWSLVYLFNWKSEHISSAQKQVGYTHMFSPSSVKSVAHWFQIIHNKRFQMFQE
                     DISKIYSSVPSLHRKLHRCAPFPVQVIENMPMMLLYGDQDILIDMETTKQNLVRNLSD
                     LTLVELPGYEHMDTLWAENVVEEVFNPILKKIDQIHAEKPYQNGLEVTASA"
     gene            <434269..>434814
                     /locus_tag="KLTH0H04862g"
                     /db_xref="GeneID:8294406"
     mRNA            <434269..>434814
                     /locus_tag="KLTH0H04862g"
                     /product="KLTH0H04862p"
                     /transcript_id="XM_002556046.1"
                     /db_xref="GeneID:8294406"
     CDS             434269..434814
                     /locus_tag="KLTH0H04862g"
                     /note="similar to uniprot|P01149 Saccharomyces cerevisiae
                     YPL187W MF(ALPHA)1 Mating pheromone alpha-factor made by
                     alpha cells interacts with mating type a cells to induce
                     cell cycle arrest and other responses leading to mating
                     also encoded by MF(ALPHA)2 although MF(ALPHA)1 produces
                     most alpha-factor"
                     /codon_start=1
                     /product="KLTH0H04862p"
                     /protein_id="XP_002556092.1"
                     /db_xref="GeneID:8294406"
                     /db_xref="GOA:C5E2G9"
                     /db_xref="InterPro:IPR006742"
                     /db_xref="InterPro:IPR008675"
                     /db_xref="InterPro:IPR016326"
                     /db_xref="UniProtKB/TrEMBL:C5E2G9"
                     /translation="MLKSFSLFLAFALTSITVSAAPINITDSDPVIPRESICGFLDLT
                     DAEDLALLPVSNGTHSGILVVNTTILAQAFGSDDILTKRDANAEAEADPWRWLSLSRG
                     QPMYKRDANAEADAEPWRWLSLSRGQPMYKRDANAEADAEPWRWLSLSRGQPMYKRDA
                     NAEADAEPWRWLSLARGQPMY"
     gene            complement(<435202..>435855)
                     /locus_tag="KLTH0H04884g"
                     /db_xref="GeneID:8294407"
     mRNA            complement(<435202..>435855)
                     /locus_tag="KLTH0H04884g"
                     /product="KLTH0H04884p"
                     /transcript_id="XM_002556047.1"
                     /db_xref="GeneID:8294407"
     CDS             complement(435202..435855)
                     /locus_tag="KLTH0H04884g"
                     /note="some similarities with uniprot|Q08926 Saccharomyces
                     cerevisiae YPL186C UIP4 Protein of unknown function"
                     /codon_start=1
                     /product="KLTH0H04884p"
                     /protein_id="XP_002556093.1"
                     /db_xref="GeneID:8294407"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5E2H0"
                     /translation="MSKIVFKHQQAGLGSLSLAGNFTKWEIKPMVFNGDEGQWEFEIE
                     PEMLGNCELQDGKAVTFFKFVDERGDWFTDDNFAKEADENGNENNALYLQVDGDAARS
                     ENQPSEVEHQTEGDQEAEPSTPDPTPVVQMKTPRANEREESPVMITESDLEEDFHDTN
                     NQDQGELTETRNHSADTSVSATQNPAEYKNFLQSIVFFFKNLFRRWFGMGTKQQESR"
     gene            complement(<436720..>438429)
                     /locus_tag="KLTH0H04906g"
                     /db_xref="GeneID:8294408"
     mRNA            complement(<436720..>438429)
                     /locus_tag="KLTH0H04906g"
                     /product="KLTH0H04906p"
                     /transcript_id="XM_002556048.1"
                     /db_xref="GeneID:8294408"
     CDS             complement(436720..438429)
                     /locus_tag="KLTH0H04906g"
                     /note="similar to uniprot|Q08925 Saccharomyces cerevisiae
                     YPL184C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H04906p"
                     /protein_id="XP_002556094.1"
                     /db_xref="GeneID:8294408"
                     /db_xref="GOA:C5E2H1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E2H1"
                     /translation="MSSHYHQQFMNTPMYAYDVPSAGLESIDDGLYRSLSPTSQVAYQ
                     NDRQAVWPNAGYQSNGAGYLEQHQMGYPPQSGILEQQPTFGVIPNETDNASSQISTGS
                     SSYSSTPRNSKFVVAAAAAAAAANAPLSHKPLQLNNPRDFTSAPSRTVYLGNIPPNLE
                     VRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRLNIGGRDIKVGW
                     GKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADPRDLIATEEKLRADLDF
                     YGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVNPYYSNKKIFYGKDRCAFVTKT
                     QQHNAAQFLGLQPGMEHLVQYTDRDFISNTLLQQSAAAAAIATAAGGANNLGNRTIYL
                     GNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLHGLTIH
                     NKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDVPVFTEQNLRKLF
                     EEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSNEQFKDLKINFGKDRCGNVPR
                     QYR"
     gene            complement(<439113..>440429)
                     /locus_tag="KLTH0H04928g"
                     /db_xref="GeneID:8294409"
     mRNA            complement(<439113..>440429)
                     /locus_tag="KLTH0H04928g"
                     /product="KLTH0H04928p"
                     /transcript_id="XM_002556049.1"
                     /db_xref="GeneID:8294409"
     CDS             complement(439113..440429)
                     /locus_tag="KLTH0H04928g"
                     /note="weakly similar to uniprot|P53150 Saccharomyces
                     cerevisiae YGL090W LIF1 Protein involved in DNA
                     double-strand break repair physically interacts with DNA
                     ligase 4 (Lig4p) homologous to mammalian XRCC4 protein"
                     /codon_start=1
                     /product="KLTH0H04928p"
                     /protein_id="XP_002556095.1"
                     /db_xref="GeneID:8294409"
                     /db_xref="GOA:C5E2H2"
                     /db_xref="InterPro:IPR014751"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="UniProtKB/TrEMBL:C5E2H2"
                     /translation="MRFISCVPVISEDDDTGVVLCQAQFSEDRCDNLKNLQHIYIKEL
                     IASEGSEIAAVKNVSFEKLHCFSHADALKSWYELLDLLSAGFFRLDMDRSWTEKAQWR
                     FYYVGNTWKLAFETQVRGLTKRFCELELVPAREKEVDLFEMSMKLYQNCVTGNQKIHR
                     LEQRCKDLQNLVDESQKRQDEDHKMIKKRDERTRAFVINLLNEKKAMIRKLQRRLEEN
                     RAPEDIPDGYLVNRFVSQPVSRMTSPRKRTSLRKSGTPSPKKSTIKSLVKEEEEDQWD
                     DFGGNDVEILGINRERTVSAPNLRLETPSLMKNPFLDETRDLNTVKEQDFASKEQLAP
                     SAGSAPGFTLDVSQKEESAIPEVAEMSSQKEEEVEQETGKAPEEGVREDTAQEIGKGT
                     EKETEEETEEETEEETEEETEEETEGYTEQDTEKDTEEETEVETDA"
     gene            <440614..>441585
                     /locus_tag="KLTH0H04950g"
                     /db_xref="GeneID:8294410"
     mRNA            <440614..>441585
                     /locus_tag="KLTH0H04950g"
                     /product="KLTH0H04950p"
                     /transcript_id="XM_002556050.1"
                     /db_xref="GeneID:8294410"
     CDS             440614..441585
                     /locus_tag="KLTH0H04950g"
                     /note="highly similar to uniprot|P52920 Saccharomyces
                     cerevisiae YGL091C NBP35 Essential nuclear protein
                     evolutionarily conserved putative ATPase exhibits genetic
                     interaction with CDC2 encoding the catalytic subunit of
                     DNA polymerase delta"
                     /codon_start=1
                     /product="KLTH0H04950p"
                     /protein_id="XP_002556096.1"
                     /db_xref="GeneID:8294410"
                     /db_xref="GOA:C5E2H3"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028601"
                     /db_xref="UniProtKB/TrEMBL:C5E2H3"
                     /translation="MTEVSQILPPDYQLKEAEPEHCPGPESEKAGQGDACAGCANKEI
                     CESLPKGPDPDIPLITENLSQIKHKVLVLSGKGGVGKSTFTTMLCWALSSDEDLQIGA
                     MDLDICGPSLPRMLGCVNETVHESNTGWTPVYVADNLATMSIQYMLPEDDSAIIWRGS
                     KKNALIKKFLKDVDWDALDYLIVDTPPGTSDEHISINKFMKESGIDGALVVTTPQEVA
                     LLDVRKEIDFCRKAGIKILGLVENMSGFVCPSCKGESQIFKPTTGGGEKLCEELNIPF
                     LGSVPLDPRVGKSCDEGQSFLDQHPESPASLAILDVVEKLRDAVGDI"
     gene            complement(<441659..>445576)
                     /locus_tag="KLTH0H04972g"
                     /db_xref="GeneID:8294411"
     mRNA            complement(<441659..>445576)
                     /locus_tag="KLTH0H04972g"
                     /product="KLTH0H04972p"
                     /transcript_id="XM_002556051.1"
                     /db_xref="GeneID:8294411"
     CDS             complement(441659..445576)
                     /locus_tag="KLTH0H04972g"
                     /note="similar to uniprot|P49687 Saccharomyces cerevisiae
                     YGL092W NUP145 Essential nucleoporin catalyzes its own
                     cleavage in vivo to generate a C-terminal fragment that
                     assembles into the Nup84p subcomplex of the nuclear pore
                     complex"
                     /codon_start=1
                     /product="KLTH0H04972p"
                     /protein_id="XP_002556097.1"
                     /db_xref="GeneID:8294411"
                     /db_xref="GOA:C5E2H4"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR021967"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C5E2H4"
                     /translation="MFGSNSGGSSLFGGGLNTSTPTSKITQTDNAFQPRQKSASGSLF
                     GDVSTSRLNGASTPSPSGGLFGNKNNTSASQEAPNALFGGNANQDSNSGGLFGNNTNS
                     SSTPNTNSSAGVNTNAPTGGLFGSASQSANVGGLFNKPNANPSNSRPLFGGSTSNSLN
                     ANSNGGIFGNSASASKPGQANAPGLFSATSSIPSSTGNFSNTTFSGGQGATSFGGNGV
                     MLSSGNQGSIQGSTAASNPYGLQFNAIAKSAGSMPESITTSLFKSNAHSNKDGGANNA
                     QKTSGSSSSPASSLKSNGTLIGKLSSRLRNTRSNELTQGLFSPVRKPIFRQEIVPTSS
                     TTESNLKDHSHFQRGLENSAKANRSEAADMRKLKIDTGRSAAKKMKLLSGQSTTTSTK
                     ILGSRDLHQDLEEPRSVLQKRETTEPELTGKELNDKTVGYWCSPTIEQLSRLPIKQLC
                     SVSNFVIGRQGFGSISFDSDVDLSSYVSDLKTSLFGKIVIFHGNKTVEVYPDGTSKPP
                     LGYGLNVPATITLEQIYAVGKNSRTPLKEHSAEEVQLLIKKLRRLKGMSFVSYNPLEG
                     LWTFKVQHFSIWGLIDEDGTEKKEQEPSSEADHKQRKIAVPKHRSIAAKSCQAFDKQA
                     MDETSMHPRGGLDIDGVAFGTLVQNEIESGDTEFNELVEEKQYEPSDVDPEDFEGMEV
                     QTALGVANNWATQLELADDPYNSAFRSTNLQRTGNREASSLSQAFDETFNTNKSAKRT
                     LRLSHIPKLAKFSKDSKLLCNSKKDVSGCTLVDVLAWDNESRCRISQTLEKNYINAKV
                     NMRGSNGYPMVKSFSVTISEMEATLAVGEGHNIWKLFSILFDEKGISPKKDRKAELDE
                     LVKGKRYQLLCSWVVQEVSKSVLNRIESTQNPNESIFYQLIIGDIIGATKAAIKLKNP
                     HLSALITLLNTNNPNVRFLASQQLRKWKALNRKVDLFVVKIYQLLSGQPFDQTCVVDL
                     TRELSWLECLSVYLLFSDMNASSLEEFVAQFLEAHPTSSKPVSYEVIFSVLKFFCSEV
                     RDERMLKRMRVSKNVFDDRAFWFLVQTLRFKKCCNFTSDQTDSITLQFQEQLEANELY
                     GEALFTLLFVHSDVLAKQHIDDLIRRHVHFFSGASGRDILKRFQVPDSLIFQAIALRH
                     KFDENYLAEAENLLEGGLVEDAVQTLLTNVAPEMILRSTTDKQSLKTLRDILDKVPSE
                     FLDTSGRDLGVFSEYLNFALDGHTDLATLEKLIHALPPFYATYGHVSKISICCSVMAY
                     AVSLAYLMTENAEAAASSMKDRLLELPLGEPEARYIRKNLKAP"
     gene            complement(<445934..>448648)
                     /locus_tag="KLTH0H04994g"
                     /db_xref="GeneID:8294412"
     mRNA            complement(<445934..>448648)
                     /locus_tag="KLTH0H04994g"
                     /product="KLTH0H04994p"
                     /transcript_id="XM_002556052.1"
                     /db_xref="GeneID:8294412"
     CDS             complement(445934..448648)
                     /locus_tag="KLTH0H04994g"
                     /note="weakly similar to uniprot|P53148 Saccharomyces
                     cerevisiae YGL093W SPC105"
                     /codon_start=1
                     /product="KLTH0H04994p"
                     /protein_id="XP_002556098.1"
                     /db_xref="GeneID:8294412"
                     /db_xref="InterPro:IPR013253"
                     /db_xref="UniProtKB/TrEMBL:C5E2H5"
                     /translation="MVVVYTSWATSFMNQEFGKTSKTSLDGKAQVKERSKSMVPGRSI
                     LKQKFLFNDGGSENLTLSNIPIFSSSQEHEDADGRNNTTSRLNTSKLQSKLDRRVSFA
                     PDVTLHRVDFVPQDRSTFREPRRKPAAEAFTDDFSKEHVQNSQERTYNEESMQLTNNY
                     GGPLVDNSMILNSEQGNQSTPYTPAYDKEVSMEITQLFSKHSAGPENNSEEIIGSRQS
                     SAHQEEEDMEVTQLHKEGIQHEEEGESMVMTEVFQPPQKESYISQPDRSRNSPKNNGE
                     ETSDMETTEIVRANQAGMSKPNDASLTDEVSHATSLTVPMQAERDVFDIRSSQFVTST
                     QKDREEQNFGAQKDRNIETSGRVFDENISRKKRRVSSAHGFDEDGASAAKIPHGAETD
                     EDMEITMMERLSPIAISINMSNSPKTSIPKENINASSAYDRNFPDVTVDKTREQASLK
                     AFLHSVGISSLLSDTELELLPINRMSFVSSQKGRKWPVVEVYYGLYANMPILEIYAFC
                     CKELLRRILKSRELFKELEEEIARNPAPALFKRYFESGTLEREKLSDQITLLRRFSRL
                     EAEKVWLEWRSRHLNGIKNVLQENLLLLKDEYNSIMDHVDKVNRAKRNILNTRQNILT
                     EIRLAQSLTQSKSPSPGIPDRLKLEALKAELVQEMQALKSSSEFEKRMKAVRSDIKNV
                     KLEIERTRSAINSLRSEVKGSPAFAAHQAENLRATFDIVQKICGISFKSYRKSLLTVQ
                     LNDPPITATFDIKRAQQVGDVDLAFPNSLKGIAKEIYARSVRTASSCESNVYQFIRAL
                     SHDSFNAHLLLTEYKRLKLLLPCKVVEVSGSIDIEITCFDSKKKKFLLLELSLNEFVS
                     AVKGLASSGPKLRVRGLCSERLQPEDALKFLQTKASGVLPWLKEPTLI"
     gene            <448816..>449112
                     /locus_tag="KLTH0H05016g"
                     /db_xref="GeneID:8294413"
     mRNA            join(<448816..448965,449041..>449112)
                     /locus_tag="KLTH0H05016g"
                     /product="KLTH0H05016p"
                     /transcript_id="XM_002556053.1"
                     /db_xref="GeneID:8294413"
     CDS             join(448816..448965,449041..449112)
                     /locus_tag="KLTH0H05016g"
                     /note="some similarities with uniprot|O14464 Saccharomyces
                     cerevisiae YPL183W-A"
                     /codon_start=1
                     /product="KLTH0H05016p"
                     /protein_id="XP_002556099.1"
                     /db_xref="GeneID:8294413"
                     /db_xref="GOA:C5E2H6"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="UniProtKB/TrEMBL:C5E2H6"
                     /translation="MFSLLRTNFSRLLPQTGAGFLKAPLGNSSPFLTRGFKVRTAIKK
                     FCSDCYMVRRKGRVYVYCKSNKKHKQRQG"
     gene            complement(<449230..>452217)
                     /locus_tag="KLTH0H05038g"
                     /db_xref="GeneID:8294414"
     mRNA            complement(<449230..>452217)
                     /locus_tag="KLTH0H05038g"
                     /product="KLTH0H05038p"
                     /transcript_id="XM_002556054.1"
                     /db_xref="GeneID:8294414"
     CDS             complement(449230..452217)
                     /locus_tag="KLTH0H05038g"
                     /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
                     YPL183C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05038p"
                     /protein_id="XP_002556100.1"
                     /db_xref="GeneID:8294414"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E2H7"
                     /translation="MSQLRQLSHTGPSVCVKFHGKYVLAGYGVFVHVYNYESGELVSI
                     SRVFHRNKVHGLAIREKSVLLYGGRSVSLLDIDYLWGNADNTRFEKLCHEWVVSGEHS
                     MDGSSVFLLTSYNKVLCCDLSFRVLQTKAVYGERSILYSGTITVLNQDKVLVNAGTVM
                     DGVLVWDLKTEKTIHHFTDHEGSIFYVAASIKGRYAASCSDDRSIKLWDLHSGHLVST
                     GWGHTARIWNLKFYDNDSKLISVSEDCTCRVWEISERGTLIQKSIHELHQTKSIWGVD
                     VNDEKMIAVTSGNDGRIKITDLNARTKSDSDSRIFSLDDISKHGVKLRPNEIIKGFYW
                     LRFGLLAMTSEGQVLKFDQKAEMWTSVMTDSRFTSYSATSGVQEFDMVIFSNSRCELL
                     ILKFSEDGNEILENKQLQINELTKSTNCLVRGYNSKLFLVMESPNPKDPFFCLRMDAS
                     NLQHEERLYFKKPKNFTASSFAFYENFAIFGSRFSTLAIFDLENCEREATVLRKILPG
                     DTITSIDFVEKNSESDCLFSVSDRDGFYCFISINFLKRSHKVLLQNRIPKGFLEGAHY
                     NAQGDFITYGFKSNLFYVFNETKQYEVFSELCGGAHRQWRYLPNFGLDEFIFIYIKAS
                     SINFRKIHKAAYPEILRNGLHGREIRDLCVRTEPLHLGKTVFCSASEDTTIKLNVLNV
                     KDGETKTVWTFRKHTSGLQRCKFINNKFMISSAAREELYLWELTDTFMSNPYMTIICA
                     LPSSSEIPDLRIMDFACKAIEGTEDFILTTVYSDSAIKVWLYSSDENTFKLLISDKYQ
                     TCCLLNVALVTLDTELILVVSPTDGHLVCWNLTKYIPYVIQNNKLVKVLEGFQPQIHL
                     PDISERIAVHSAGIKSFEFKIIAENRFFVYTGGDDNAVAISEFVLDKSHKTIQGCVRS
                     FISAGAASTITSVKLIRRDMTLLTASVDQVVRYYDVSAGDLVLKNKFYTTNADTGCID
                     TLSSATGSIALIGGVGFSVWTLE"
     gene            <452490..>455876
                     /locus_tag="KLTH0H05060g"
                     /db_xref="GeneID:8294415"
     mRNA            <452490..>455876
                     /locus_tag="KLTH0H05060g"
                     /product="KLTH0H05060p"
                     /transcript_id="XM_002556055.1"
                     /db_xref="GeneID:8294415"
     CDS             452490..455876
                     /locus_tag="KLTH0H05060g"
                     /note="similar to uniprot|P53010 Saccharomyces cerevisiae
                     YGL094C PAN2 Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease complex which acts to control poly(A)
                     tail length and regulate the stoichiometry and activity of
                     postreplication repair complexes"
                     /codon_start=1
                     /product="KLTH0H05060p"
                     /protein_id="XP_002556101.1"
                     /db_xref="GeneID:8294415"
                     /db_xref="GOA:C5E2H8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5E2H8"
                     /translation="MNNWQLTFQSPVDLTEHLRKPYLLYDERDKNVTRTMFDEHANLV
                     WAGDTYGRISSYDPSYSLYTRYAGHIGGLPVVDMLSHPGGVMSLSADSIHFASRQGVT
                     RLNLTSADIAQLCEMKAMCFSSIAGNHVYCAGSNSGSGIIDIDLQKGALFNNIDYASK
                     VKMMRSDNKTILIGKQTGTIDLLDQSSNQLIRSFAAHSATISDMDLRDNTLVTVGKSR
                     RFNQMCSDPFVNVYDLRMMRQLTPVAFSHNQNIGSSGSAGADFVRLHPVLPTVMTVAS
                     TSGAFDFIDLADPTLRSQYCHPCHSISQFQLSPSGDYIAVLEHDNTISTWSRSGGMSG
                     FTNSSAILEYPDYPDDGPPGNVSVNDESYPLSSVGMPYYSEKLLSSWPHVIFRSGGTL
                     PRKMQDSGGLIQTPSSRLFQLSTHNSQTYSLVPYNTAKYGRRNVMRPYKSLRERKKKL
                     LITDEDGTDKRELMRYKALNDYEVPPAYTKLQMVYGKYGVEDFDFKAFNKTQLSGLEC
                     DIENSYTNAILQLYRFVPEFYNFVVSCLREEPGPENSILAELGYLYDMMDKAKGVVCR
                     SANFQKLLTSLPSAKDLGLLRDSLATELSDSLAGLDIDYHGNAMEAENKIAVPGTDVP
                     QAFNKFLLSKLIAEEVQKKINTTHSIALEELVGIRLSTETRSISSCGSYERGTSIVPS
                     LDVTSPATNNTKYSNKKLSNQTVLPYIESSMNRIRHKRALCEKCQKLENIEQEQTVRN
                     LPPLLSLNICLSSSEWDIAKTVKNWLAKDFYATLSKDRPILKLHPTDLKTNSAIFKYD
                     LNAYVARVTDDMSEPHLVTYAKVFDPKTKQDKWFMFNDYLVIEVDEDEALDITPWWKT
                     PEILIYSDAEELRKPFVPVSSFRIDDSVLYRDYFANGIREGVKKEYQHLTASEAPQPG
                     SLVAMDAEFVILADEEVEISCRGQRTLIKPKKTALARISVLRGDDGDDFGVPFIDDYV
                     VNTNHIENYLTRYSGIEPGDLDPETSNKTLVPRQMVYRKIWLLLQMGCVFVGHGLYND
                     FRNISIYVPPEQIRDTALYFLQGKRYLALRFLAHALLDADVQSGNHDSIEDAYTALVI
                     YKKYLQLESSNLFENTLNQLYEEGRACGFKVPGDRSVAPM"
     gene            complement(<456119..>458281)
                     /locus_tag="KLTH0H05082g"
                     /db_xref="GeneID:8294416"
     mRNA            complement(<456119..>458281)
                     /locus_tag="KLTH0H05082g"
                     /product="KLTH0H05082p"
                     /transcript_id="XM_002556056.1"
                     /db_xref="GeneID:8294416"
     CDS             complement(456119..458281)
                     /locus_tag="KLTH0H05082g"
                     /note="weakly similar to uniprot|Q08921 Saccharomyces
                     cerevisiae YPL180W TCO89 Tor Complex One"
                     /codon_start=1
                     /product="KLTH0H05082p"
                     /protein_id="XP_002556102.1"
                     /db_xref="GeneID:8294416"
                     /db_xref="InterPro:IPR018857"
                     /db_xref="UniProtKB/TrEMBL:C5E2H9"
                     /translation="MSVAQSRGRSLRLDSEFASAMNNKHTASNSGKKLRQFTTNSRSK
                     SAASFKGLNKLRRVLSHDGALEIEDYAKERPDFMKKSKSSDSLSRKRAISGLSMTALG
                     KVRSHPGHSSASDANGGSGSNSGQHHVGLRPHRGNSVKSVLALQGGDDELYEDHSTTD
                     EEVEYFTDEEHEGQNGGQSLRARQQPRSRSRQKQNTSSNRVYDELQRSASRSSREDQT
                     LRGSVKELSSSLGQGTVDTELLREDSNKTLGNNQLHYGVPSNLRDQDEDHIDNGDHIN
                     AGDHINNEDHINNEDHIGNGDHIDAGDHINNEDHIDQGNPDEDTINANSNIEIIANSL
                     KRHGPSTRNDELIYGNDANTENATQNHSLQSTGRFSPVMILSQSTGVEKRFDRPANIA
                     EDPTSQRFNSKDQDSENKVQSNNFNYINSDFTASYASSSISERQPQNVSKPDFSTSIS
                     SLSSHLHKPAQVTADNRTTSILHQRAPQASLPTNNGNSSRLEGHSSSANRLDPLSNFN
                     NFSQFLQSETSGAVSRTQQKLWLQRESSIMDLSANNSGADTIFLASNIEVKREFERIS
                     REYTNVRRFSNPLNASLNRVVPRSKIEVKKHRSPFSQGDELSKVFKNEFSKDAKTFKE
                     FCRENLNQKLDIDRVLARIWNQESEDFNKESELLGDNEPEGASSMPAGQRTHNRHSLR
                     NNGPNSNTNHLRTVSSLQPTTRAVHRRMESALGQQQRL"
     gene            <458594..>460333
                     /locus_tag="KLTH0H05104g"
                     /db_xref="GeneID:8294417"
     mRNA            <458594..>460333
                     /locus_tag="KLTH0H05104g"
                     /product="KLTH0H05104p"
                     /transcript_id="XM_002556057.1"
                     /db_xref="GeneID:8294417"
     CDS             458594..460333
                     /locus_tag="KLTH0H05104g"
                     /note="similar to uniprot|P38932 Saccharomyces cerevisiae
                     YGL095C VPS45 Protein of the Sec1p family essential for
                     vacuolar protein sorting required for the function of both
                     Pep12p and the early endosome/late Golgi SNARE Tlg2p"
                     /codon_start=1
                     /product="KLTH0H05104p"
                     /protein_id="XP_002556103.1"
                     /db_xref="GeneID:8294417"
                     /db_xref="GOA:C5E2I0"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C5E2I0"
                     /translation="MNLFQVSDFYIDRIVNSKSKSVLNGSLDKPRIKALLLDKDTTGT
                     ISMCTTQSELLEHEVYLIDTLENQNRDVMRHLKCLVYAKPTDETIEHLVKELQDPKYG
                     EYQIFFNNTVAKTQLERLAESDDLEVVSKVEEVFQDYQVLNQDLFSLDVRSSKLFSHQ
                     MIWEPSGLADTTHSLISLLLSLKVKPLIRYEAGSRLTSKLAKEVMQEIHKNERALFDF
                     PVMDSPPQLLILDRHQDPLTPLLQPWTYQSMINEYIGIKRNVVDLSKVPDIDDSLEQV
                     VLSSKQDPFFHDTMYLNFGELGDKVKQYVSSYKDKTKSNAQINTIEDIKQFIGKFPEF
                     KKLSGNVSKHMAIVSELDRQLQVQHIWDVSEVEQNISAHMGDSQVYQDLKGVLSDERV
                     SGFHKLKLACIYSLRNATSPHMNEISATLAANVSPEELNFFHHFNSVFQTRTKSANTG
                     KEREDLISELAKKFNQKGQHKSDNVFMQHVPDLSAILSDLSKNKLPEDRFPFLEKPGA
                     RTFCQDVIIFHVGGTTFEEARIVHEFNSGMAGDGGGKIRTILGGTTILNTREFLNDCR
                     EVGQGSTELTDLL"
     gene            complement(<460360..>461550)
                     /locus_tag="KLTH0H05126g"
                     /db_xref="GeneID:8294418"
     mRNA            complement(<460360..>461550)
                     /locus_tag="KLTH0H05126g"
                     /product="KLTH0H05126p"
                     /transcript_id="XM_002556058.1"
                     /db_xref="GeneID:8294418"
     CDS             complement(460360..461550)
                     /locus_tag="KLTH0H05126g"
                     /note="similar to uniprot|Q6B1X3 Saccharomyces cerevisiae
                     YPL181W CTI6 Protein that relieves transcriptional
                     repression by binding to the Cyc8p-Tup1p corepressor and
                     recruiting the SAGA complex to the repressed promoter
                     contains a PHD finger domain"
                     /codon_start=1
                     /product="KLTH0H05126p"
                     /protein_id="XP_002556104.1"
                     /db_xref="GeneID:8294418"
                     /db_xref="GOA:C5E2I1"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5E2I1"
                     /translation="MTKVQDPAKQDEVAAPQEVKAEDVPKADEEDEEEEGETRCVCGE
                     VDPPDDSGLYIQCEECSVWQHGFCVGITEGEDSAPDKYWCERCRPDLHHLYDTDLGEH
                     RSAYQPVQQNKRQNRRLRREDVPSVESGVEDEEAVKSESSKTSLPAEAPKPRKRHQRR
                     KDSASGLPTTIQGGRRDSNEDRRSLDRRRATSSAREEKQYQLMLEKALKESRRTSQHG
                     DESDVPVLPDGIHGKHEADEEAVIETEASEPPKKRSKLNTPSGTPPTSSEDETRRRGK
                     RGPQRKLKSRSNSRPSSNDNNCNGSDIGINKPIKPRIPTQRTSINEMRRRVSAILEFI
                     SRTQVELSQDQIEKQQLTEFVENEDFIKKVDSIYSNYDESLKMMDDLTRKLLLWEKKY
                     ALDQ"
     gene            <462699..>464246
                     /locus_tag="KLTH0H05148g"
                     /db_xref="GeneID:8294419"
     mRNA            <462699..>464246
                     /locus_tag="KLTH0H05148g"
                     /product="KLTH0H05148p"
                     /transcript_id="XM_002556059.1"
                     /db_xref="GeneID:8294419"
     CDS             462699..464246
                     /locus_tag="KLTH0H05148g"
                     /note="similar to uniprot|P32945 Saccharomyces cerevisiae
                     YPL179W PPQ1 Putative protein serine/threonine phosphatase
                     null mutation enhances efficiency of translational
                     suppressors"
                     /codon_start=1
                     /product="KLTH0H05148p"
                     /protein_id="XP_002556105.1"
                     /db_xref="GeneID:8294419"
                     /db_xref="GOA:C5E2I2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5E2I2"
                     /translation="MGNSPSKSNYAIPSTKTASATTQGLTTTGDDLNSNEPNDPDDSR
                     SLPTQVIKIHKVAPGEPKNNVIPSAAASGRGARRKSPAAYDLEIDMSFAKALSATTSS
                     QGSSSGSSSGSSSGSHDSNMTPPSYSTDSSFLNYSFPDEPQTPGSANGAPVAASLPPI
                     KEEMAVTASLVRRNRLQQRGHPHIPHDRNAAPPVILKRYAHDLQSTEHLDIDDVIEKL
                     LKIGETRYYQAKEFPFSSWKVQLICARARELFLEQPSLLRLQAPIKIVGDVHGQFTDL
                     MRILKLSGVPPNTSYLFLGDYVDRGKQSLETMLLLLCYKIKFPDRFFMLRGNHESANV
                     TKMYGFYDECKRRLSTKCWKMFVDVFNTLPLAAVVQDKIFCVHGGISPDLKDLGQIER
                     IARPTDIPEEGLFTDLLWSDPDPQVSDWSVNDRGVSVTFGKRNVLDFCSRFNFDLIIR
                     GHMVVEDGYEFFARKKFVTVFSAPNYCGEFQNWGAVMSVTTGLMCSFELLKPHGAKGG
                     AAHKHKG"
     gene            complement(464733..464804)
                     /locus_tag="KLTH0H05192r"
                     /db_xref="GeneID:8294420"
     tRNA            complement(464733..464804)
                     /locus_tag="KLTH0H05192r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=62.09"
                     /db_xref="GeneID:8294420"
     gene            <465108..>465710
                     /locus_tag="KLTH0H05214g"
                     /db_xref="GeneID:8294421"
     mRNA            <465108..>465710
                     /locus_tag="KLTH0H05214g"
                     /product="KLTH0H05214p"
                     /transcript_id="XM_002556060.1"
                     /db_xref="GeneID:8294421"
     CDS             465108..465710
                     /locus_tag="KLTH0H05214g"
                     /note="highly similar to uniprot|Q08920 Saccharomyces
                     cerevisiae YPL178W CBC2 Small subunit of the heterodimeric
                     cap binding complex that also contains Sto1p component of
                     the spliceosomal commitment complex interacts with Npl3p
                     possibly to package mRNA for export from the nucleus
                     contains an RNA-binding motif"
                     /codon_start=1
                     /product="KLTH0H05214p"
                     /protein_id="XP_002556106.1"
                     /db_xref="GeneID:8294421"
                     /db_xref="GOA:C5E2I3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR027157"
                     /db_xref="UniProtKB/TrEMBL:C5E2I3"
                     /translation="MSLAEFDEINYDHSASRLDVPSNYLMKKARRNPNGLEDLRRSMR
                     SATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALD
                     AVKYLSGTKLDDRNISLDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASRGGFTVPLV
                     DRIGFSNTHNFGARRVRDTYVPEEPEDDEEEPDTYVPGED"
     gene            complement(<465998..>466702)
                     /locus_tag="KLTH0H05236g"
                     /db_xref="GeneID:8294422"
     mRNA            complement(<465998..>466702)
                     /locus_tag="KLTH0H05236g"
                     /product="KLTH0H05236p"
                     /transcript_id="XM_002556061.1"
                     /db_xref="GeneID:8294422"
     CDS             complement(465998..466702)
                     /locus_tag="KLTH0H05236g"
                     /note="some similarities with uniprot|P41817 Saccharomyces
                     cerevisiae YPL177C CUP9 Homeodomain-containing
                     transcriptional repressor of PTR2 which encodes a major
                     peptide transporter imported peptides activate
                     ubiquitin-dependent proteolysis resulting in degradation
                     of Cup9p and de-repression of PTR2 transcription"
                     /codon_start=1
                     /product="KLTH0H05236p"
                     /protein_id="XP_002556107.1"
                     /db_xref="GeneID:8294422"
                     /db_xref="GOA:C5E2I4"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR008422"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5E2I4"
                     /translation="MNSNAQCFAQLEQGVKLPSIRSLLDSIGAEQEGGAETRRPLPAL
                     ALPALASTLPERQQQPDNQLSQPRNQQPGQQPNNLQLSHPHNQQPSQQAPSAARRAAA
                     PPRRNNLPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRK
                     VFSDYYQMSRARRAGAPDEATDAVGAAGAPTATDADLELRFQAAPLTRRKKLIDRLDE
                     LKKASQDSARQCRGPY"
     gene            <467504..>469522
                     /locus_tag="KLTH0H05258g"
                     /db_xref="GeneID:8294423"
     mRNA            <467504..>469522
                     /locus_tag="KLTH0H05258g"
                     /product="KLTH0H05258p"
                     /transcript_id="XM_002556062.1"
                     /db_xref="GeneID:8294423"
     CDS             467504..469522
                     /locus_tag="KLTH0H05258g"
                     /note="weakly similar to uniprot|P33757 Saccharomyces
                     cerevisiae YBR250W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05258p"
                     /protein_id="XP_002556108.1"
                     /db_xref="GeneID:8294423"
                     /db_xref="UniProtKB/TrEMBL:C5E2I5"
                     /translation="MFSATWPRSCVSRGPCPLSLCHGLACVAPHGHALSGPAASLFPP
                     RSQCSSGKTLYMTNSAKRGGSRAGYRCTAETHIVRAYRSTDDSLAILTKAKTLFFRAR
                     VCKQAPSCSATFHSGGTTSAGSGDESFAQYGSAFVTLDSVYKGGAQGRYRRRGAARRD
                     THTPKRACHKMNSSTPSTATQISLPRDSGCAPAPPSYTAAAGEAARQPRRLELSSLAA
                     RGTLLKHPEPTPPSFGYNAFDRGKNPCITSHDSSLLHVTLVPDRDCFYMAALEPQLLS
                     RRDAADHAPAFEGRGVVSGTLRVVVKGPDALLLENVHVRLSGFCSEFARCASAGSATH
                     SMRMVSATNCGTTPFVQDFIRFGTPASAGAANAASGPSAGLVLLPPGEYEYRFEFVVD
                     AATFPASIETAYGSTIYRLEALVSMPKRKRRFGNKYESVFLTSAVTLKKALQHRYAAL
                     YQGFTAVTSLREEMLACDIFLSSRVVEFDAPLQVSLQMVKRDAQECQVLFTDVLVQQT
                     LSIPCVDTATGVLEPTNFHQVQTVRLGNMDFCDEQQQCLNAAFPELRVPSTLKTVERN
                     RSFFPHYEEPSLAARGLEPVRSRLRVAHELKIVIGVHINQPGDQQRPKSVRLTIKFPI
                     ALVDPDMGCCVNLPRYEPKSLIPLPSGLCKLDSDSAPSTPPEYSDAEL"
     gene            complement(<469755..>471596)
                     /locus_tag="KLTH0H05280g"
                     /db_xref="GeneID:8294424"
     mRNA            complement(<469755..>471596)
                     /locus_tag="KLTH0H05280g"
                     /product="KLTH0H05280p"
                     /transcript_id="XM_002556063.1"
                     /db_xref="GeneID:8294424"
     CDS             complement(469755..471596)
                     /locus_tag="KLTH0H05280g"
                     /note="similar to uniprot|P38156 Saccharomyces cerevisiae
                     YBR298C MAL31 Maltose permease high-affinity maltose
                     transporter (alpha-glucoside transporter) encoded in the
                     MAL3 complex locus member of the 12 transmembrane domain
                     superfamily of sugar transporters functional in genomic
                     reference strain S288C"
                     /codon_start=1
                     /product="KLTH0H05280p"
                     /protein_id="XP_002556109.1"
                     /db_xref="GeneID:8294424"
                     /db_xref="GOA:C5E2I6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E2I6"
                     /translation="MSNNFDKNKLVHVETTVSSQTNMAESSLDLPYSASKKTDTQHLE
                     FAGQEVEETGYATTAVGSDTIAKFLGLSEDARQADGAEKQMPLLQAIRQYPKAAMWSV
                     VLSSALIMEGYDTALLSSLYALPAFAKRYGSYNPANGIYEIDAKWQTALSMCINVGEV
                     IGLQFAGIAADRVGYRWTLIASLIAVFGFIFILFFAVSCPMLAVGEILCGIPWGCFQT
                     LTVSYATEVCPLALRYYLTTYVNICWILGQIMASGVLKNSQENLANSSLAYRLPFALQ
                     WIWPLPIAVGIYLAPESPWWLVKKGRMNEAGRSLSRLISGLKSGEKAAVIDAMLKKIQ
                     LTTQKEDAMTRDTTYWDCFRGPDGRRTRIACLTWVTQNACGSAMMGYSTYFYTKAGLS
                     ESYAFSFSIIQYCLGLVGTVLSWFFSKKYGRFTIFAGGLAVQSLLLIAIGASGFSHSD
                     GAKWAAGSLLLIFVFVYDVGVGPVTYCLVPELPSNKLRTKTVILARNFYNLMGIINAI
                     WTPYMLNSEKWNWGAKTGLFWGGISLVMLTWAILDLPETKGRTFGEIDELFLQGVPAR
                     KFKSTEVNPYDSAKLMAELNDEQIEHIVRTDERQKADPMTTIMEDSE"
     gene            <472845..>474605
                     /locus_tag="KLTH0H05324g"
                     /db_xref="GeneID:8294425"
     mRNA            <472845..>474605
                     /locus_tag="KLTH0H05324g"
                     /product="KLTH0H05324p"
                     /transcript_id="XM_002556064.1"
                     /db_xref="GeneID:8294425"
     CDS             472845..474605
                     /locus_tag="KLTH0H05324g"
                     /note="similar to uniprot|P53051 Saccharomyces cerevisiae
                     YGR287C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05324p"
                     /protein_id="XP_002556110.1"
                     /db_xref="GeneID:8294425"
                     /db_xref="GOA:C5E2I7"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5E2I7"
                     /translation="MSAVDKWWKEAAVYQIYPASFYDSNGDGWGDLPGITAKLPYLRQ
                     LGVDALWICPFYDSPQQDMGYDISDYEKVWPRYGTNEDCYQLIREAHAAGIRVVVDLV
                     INHCSSEHAWFRESRSSKTSAKRDWFIWRPAKGFTADGKPIPPNNWQSFFGGSAWEWD
                     ERTQEFYLRLFASGQPDFNWELSEVRKAIYESAAGFWLDHGVDGFRIDTAGLYSKIGG
                     LPDAEVRDATNEHQHPGHNTQNGPRIHEFHKEMRAFFDKRTAGRANEIFTVGEVGRCD
                     LAGLLQYTSEQEREMSQLFNFAHTECGVGTHLRYHAQPFTLKEWKLGIAASFLFANRT
                     DSWSTVYLENHDQPRSVTRFGDDSPAWRQVSAKLLAILEVALTGTLYVYQGQELGQIN
                     NHGWTLDQYQDVDMITNRDIIAKRYGKNSVEMAKFAQGVALLSRDHSRTPFPWTSREP
                     DASFSAVCQSGVKPWISMNDSFRDGINAEDELKDPNSVFHFWRAALRLRKQHKDILVY
                     GQGFEFFDLDNPDLFMFTKKSRDGAKTLFAALNFSSEDREFPLPDEDAAYKAFFGNYD
                     LESAQERTLRPWEGRLFYVE"
     gene            <475454..>476554
                     /locus_tag="KLTH0H05346g"
                     /db_xref="GeneID:8294426"
     mRNA            <475454..>476554
                     /locus_tag="KLTH0H05346g"
                     /product="KLTH0H05346p"
                     /transcript_id="XM_002556065.1"
                     /db_xref="GeneID:8294426"
     CDS             475454..476554
                     /locus_tag="KLTH0H05346g"
                     /note="highly similar to uniprot|P32449 Saccharomyces
                     cerevisiae YBR249C ARO4
                     3-deoxy-D-arabino-heptulosonate-7-phosphate (DAHP)
                     synthase"
                     /codon_start=1
                     /product="KLTH0H05346p"
                     /protein_id="XP_002556111.1"
                     /db_xref="GeneID:8294426"
                     /db_xref="GOA:C5E2I8"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5E2I8"
                     /translation="MSGQAPSPAALEKAEDVRILGLDPLVSPALLQSQIPATSECLKT
                     VQKGRVGASKIITGEDDRLLVIVGPCSIHDLDIAQEYARRLKKLSDELEGELCIIMRA
                     YLEKPRTTVGWKGLINDPDVDNSFNINKGLQSARQLFVNLTSAGVPIGSEMLDTISPQ
                     YLADMLSFGAIGARTTESQLHRELASGLSFPVGFKNGTDGTLGVAIDAMLAASHSHHF
                     MGVTKHGFAAIITTKGNEHCFVILRGGKKGTNYDAKSVAEAKAQLPPGGTLMIDCSHG
                     NSNKDYRNQPKVNDVVCEQVANGEDKIIGVMIESHINEGKQNIPPEGKQGLKYGVSIT
                     DGCIGWETTDQVLRKLADAVKQRRALKKKSSA"
     gene            <477523..>479175
                     /locus_tag="KLTH0H05368g"
                     /db_xref="GeneID:8294427"
     mRNA            <477523..>479175
                     /locus_tag="KLTH0H05368g"
                     /product="KLTH0H05368p"
                     /transcript_id="XM_002556066.1"
                     /db_xref="GeneID:8294427"
     CDS             477523..479175
                     /locus_tag="KLTH0H05368g"
                     /note="highly similar to uniprot|P33734 Saccharomyces
                     cerevisiae YBR248C HIS7 Imidazole glycerol phosphate
                     synthase (glutamine amidotransferase:cyclase) catalyzes
                     the fifth and sixth steps of histidine biosynthesis and
                     also produces 5-aminoimidazole-4-carboxamide ribotide
                     (AICAR) a purine precursor"
                     /codon_start=1
                     /product="KLTH0H05368p"
                     /protein_id="XP_002556112.1"
                     /db_xref="GeneID:8294427"
                     /db_xref="GOA:C5E2I9"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014640"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5E2I9"
                     /translation="MSTVHIIDVESGNLKSLRNAVEFLGFNVKIVKSADDIELSKAER
                     LILPGVGNFGHFVDNLTLKNFEKPIREYIASGKPIMGICVGLQCLFLGSEESPKSTGL
                     KYLDLQLTKFDTSEKPVPEIGWNTCTPQDNLFGLDPCNRYYFVHSYAAIIDAEDKARL
                     SEAGWNIAAAKYGSQEYIAAVARDNIFATQFHPEKSGHAGLEILKNFINQTHPTIKHT
                     DREKAALQNDYSNYGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKQEGGNVRNLGK
                     PVELAQKYYEQGADEVTFLNITSFRDCPLKDTPMLEVLKQAAKTVFVPLTVGGGIKDI
                     VDVDGTHIPALQVAALYFASGADKVSIGSDAVYAAEKYYELGERGDGASPIETISKSY
                     GAQAVVISVDPKRVYVDGPESVKHKTFETKFPNEKGQTWCWYQCTIKGGRESRDMGVW
                     ELTRACEALGAGEVLLNCIDKDGSNSGYDLELINHAKEAVKIPVIASSGAGEPKHFKE
                     AFESTGADACLGAGMFHRGEYTVNDVKQYLLDSGFKVRMESQ"
     gene            complement(<479388..>480833)
                     /locus_tag="KLTH0H05390g"
                     /db_xref="GeneID:8294428"
     mRNA            complement(<479388..>480833)
                     /locus_tag="KLTH0H05390g"
                     /product="KLTH0H05390p"
                     /transcript_id="XM_002556067.1"
                     /db_xref="GeneID:8294428"
     CDS             complement(479388..480833)
                     /locus_tag="KLTH0H05390g"
                     /note="similar to uniprot|P21827 Saccharomyces cerevisiae
                     YGL097W SRM1 Nucleotide exchange factor for Gsp1p
                     localizes to the nucleus required for nucleocytoplasmic
                     trafficking of macromolecules potentially phosphorylated
                     by Cdc28p"
                     /codon_start=1
                     /product="KLTH0H05390p"
                     /protein_id="XP_002556113.1"
                     /db_xref="GeneID:8294428"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:C5E2J0"
                     /translation="MSKRSASPPLTPGKRARKHLVSTIHKHYELINSQDDYKYMYLSL
                     QPLDIFCWGTGSMCELGLGPSAKNKEVKRPRLNPYLPRDQAKIVSFAVGGMHVLALDQ
                     DNHVWSWGTNDSGALGRDTSHANEQLKDMDADDSSDDEDGDLNDQESTPIKLPDESLP
                     LKDHKVVQLAATDNLSCVLLDNGEVYAWGTFRCNEGILGFYKDTIKIQNTPWKVPSFT
                     TSKVVQMAAGKDHILFLDEGGVVYAWGNGQQYQLGRKIMERSRLRTLDPRAFGLDKVK
                     YIATGENHSFALTRDGRLYSWGLNQFGQCGVSEEVDDGALVTVPTEVLLPEGTRVKMV
                     SAGEHHSMVLTEEGELYTFGRLDMFEIGIPKAKLPEQTYIDAHGKPRAVPVPTKLVEV
                     PRFKNIAAGSHHSLAISEDGVVFSWGFGETYAVGLGPSGDDIEVPTRIKNTATQDHDI
                     IFVGGGGQFSVSGGIKLNDQDAEKRADKYDD"
     gene            <481190..>482041
                     /locus_tag="KLTH0H05412g"
                     /db_xref="GeneID:8294429"
     mRNA            <481190..>482041
                     /locus_tag="KLTH0H05412g"
                     /product="KLTH0H05412p"
                     /transcript_id="XM_002556068.1"
                     /db_xref="GeneID:8294429"
     CDS             481190..482041
                     /locus_tag="KLTH0H05412g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H05412p"
                     /protein_id="XP_002556114.1"
                     /db_xref="GeneID:8294429"
                     /db_xref="UniProtKB/TrEMBL:C5E2J1"
                     /translation="MKIQTLFCVGLLLAFATSSASFWEGLSQLTHKKTSFLKWDFNVD
                     RLANNVGRLTGDTHFLAVTDAVVRNAERQMLNLFIQNPAVGITKDVNRLCREIESSSA
                     RLVISLDHPAWEPARQQVTQYLEGRSREFGLRLASHIRGDARSPSAGLVDLLASFSKS
                     LQNAVSLVENPSKSSDAFEEFTFASRMDDLTVGRIVGEGIAEKIRDKVVGGDTHAALT
                     DIANIFCDFGTLMTAYVTGLAICTAGLGAALCGVSIIICGGGTIIYICRLLQNLDKVF
                     KTLGVGL"
     gene            <482267..>483655
                     /locus_tag="KLTH0H05434g"
                     /db_xref="GeneID:8294430"
     mRNA            <482267..>483655
                     /locus_tag="KLTH0H05434g"
                     /product="KLTH0H05434p"
                     /transcript_id="XM_002556069.1"
                     /db_xref="GeneID:8294430"
     CDS             482267..483655
                     /locus_tag="KLTH0H05434g"
                     /note="similar to uniprot|P38333 Saccharomyces cerevisiae
                     YBR247C ENP1 Protein associated with U3 and U14 snoRNAs
                     required for pre-rRNA processing and 40S ribosomal subunit
                     synthesis localized in the nucleus and concentrated in the
                     nucleolus"
                     /codon_start=1
                     /product="KLTH0H05434p"
                     /protein_id="XP_002556115.1"
                     /db_xref="GeneID:8294430"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="UniProtKB/TrEMBL:C5E2J2"
                     /translation="MGRVASSKSRKQRHDPLLKDLDSAQGNLRKAPKKREDQKDEDDQ
                     EEYVDAASSRRILQLAKEQQQELEEEQENEKNGGNNFARFRLAGNYEEDEEEDEDQER
                     EENISDFEPEYDEEQEEEEVVEIDEEDAAMFEQYFKRSTDYNSDFQSYNLADKIMASI
                     REKEMELNAGSASARDETQPEGVALPPKVIRAYSTVGVILKTWTHGKLPKLFKVIPSL
                     NNWQDVLYVTNPADWSPHVVYEATKLFVSNLPAKEAQKFINAVLLDRFRDNIETAEDH
                     SLNYHIYRALKKSLYKPSAYFKGFLFPLLEMGCNIREATIAGSVLAKVSVPALHSAAA
                     LSYLLRLPFSPATTVFIKILLEKKYALPYQTVDDCVYYFMRFRILSDGSNGEDSSRTL
                     PVVWHKAFLSFAQRYKNDITQDQRDFLLETVRQRGHKDIGPEIRRELMAGESREFVNN
                     LESKDDLMLDVQ"
     gene            <484160..>485866
                     /locus_tag="KLTH0H05456g"
                     /db_xref="GeneID:8294431"
     mRNA            <484160..>485866
                     /locus_tag="KLTH0H05456g"
                     /product="KLTH0H05456p"
                     /transcript_id="XM_002556070.1"
                     /db_xref="GeneID:8294431"
     CDS             484160..485866
                     /locus_tag="KLTH0H05456g"
                     /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
                     YMR088C VBA1 Permease of basic amino acids in the vacuolar
                     membrane"
                     /codon_start=1
                     /product="KLTH0H05456p"
                     /protein_id="XP_002556116.1"
                     /db_xref="GeneID:8294431"
                     /db_xref="GOA:C5E2J3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E2J3"
                     /translation="MGEEEGRPGSIELDEIHSSKGESTVPSFPDTGEEEDLEKDFRDP
                     NTFPYILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPL
                     YGKTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNII
                     LSDLAPLSQRSIYWGWGSVIWGFSQSVGGPLGGLLLNWFGVRGLFVVQIPFCLFSLSL
                     TVKYIHDLSNQTQGTWRDIDFAGSFCLITGISAFIFLCSSSGDVTDDSAVSLFKVGCF
                     LITVLSVSGFIYVEKNVAAKSILPAEVLKGSLGVISFIYGLASMLSYVGLFVVPLYLQ
                     LVWGVSVAGSGGYIMYAVISTSIGSFGSGWLLRKYGAPDKDATLLNSGMMLIGSTLIN
                     TLGFFVMFKNILEIKPAFEGVKSPSPDQKFWFLLGFAIMGLSAGFQSVSVMLYTVAKV
                     GRKGQASSTSVTFLFRSLGNVLSVSISLSVFVASLKGKLKSYFQGQQSDLYRKLLKEN
                     AFLRSGEVPSDQLKDLLQVFKSAIVKAFWPSVVCCFLSVTFAGVLFVMIRRSRRFAGL
                     SA"
     gene            complement(<485876..>486706)
                     /locus_tag="KLTH0H05478g"
                     /db_xref="GeneID:8294432"
     mRNA            complement(<485876..>486706)
                     /locus_tag="KLTH0H05478g"
                     /product="KLTH0H05478p"
                     /transcript_id="XM_002556071.1"
                     /db_xref="GeneID:8294432"
     CDS             complement(485876..486706)
                     /locus_tag="KLTH0H05478g"
                     /note="similar to uniprot|P53146 Saccharomyces cerevisiae
                     YGL098W USE1 Use1p is a SNARE and forms a complex with the
                     SNAREs Sec22p Sec20p and Ufe1p. The protein is localized
                     to the ER and use1 mutants show defects in retrograde
                     traffic from the Golgi to the ER Protein required for cell
                     viability"
                     /codon_start=1
                     /product="KLTH0H05478p"
                     /protein_id="XP_002556117.1"
                     /db_xref="GeneID:8294432"
                     /db_xref="InterPro:IPR019150"
                     /db_xref="UniProtKB/TrEMBL:C5E2J4"
                     /translation="MVMSVLPQLQTHKAMYGGPFDNWKRALEPVIAEELSFSDDPVLQ
                     DIISTKALANLALLRKSAVESQLRAPKHGSSELDDYRNAFEELECSALMTRHSSRAKL
                     TAEHEHLMESMKSKRYSVDFDSEDTGRQEEDFENIEKAAGPEGEEEESLGQLRSRLLG
                     NRRGSSSGADQSANTEKQMQVHNNLQEELISDMSQLVSGLKMGAEAFQNALEEDSTVL
                     KATELGLQATSRSLTNLGGKLKKYHNSKVGLLFYLGCILFMFLSLLLTYMIVKIFPKM
                     "
     gene            <487381..>489102
                     /locus_tag="KLTH0H05500g"
                     /db_xref="GeneID:8294433"
     mRNA            <487381..>489102
                     /locus_tag="KLTH0H05500g"
                     /product="KLTH0H05500p"
                     /transcript_id="XM_002556072.1"
                     /db_xref="GeneID:8294433"
     CDS             487381..489102
                     /locus_tag="KLTH0H05500g"
                     /note="similar to uniprot|P27614 Saccharomyces cerevisiae
                     YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
                     induced under low-nitrogen conditions"
                     /codon_start=1
                     /product="KLTH0H05500p"
                     /protein_id="XP_002556118.1"
                     /db_xref="GeneID:8294433"
                     /db_xref="GOA:C5E2J5"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:C5E2J5"
                     /translation="MSDYLPIGGSKPRGIFERRRLLATVVLGACALLSVILLAGHTVN
                     SPNNKDSICSECAGFKALRPAFNKSLNHILYNQDYKMSVIEKLAGAVKIPTEIFDFTP
                     SPSDDPEAWVHFQELHEYLETQFPYVYEKAQVEKIDGFGLLFTWQGSKPDLKPLLLMA
                     HQDVVPVEPNTVDMWTHPPFSGFYNSSEDLIYGRGTADIKQLVVSHLEAVERLMLDGF
                     KPQRTIMISFGCDEEASGSCAAKIAQHIEKRYGANSIYAILDEGGQVGEVDGVYFAEP
                     VTSEKGYLDAEITVFTPGGHSSVPPDHTSIGILGELIVDLEKDPYDILIEENNPALET
                     IKCFIKFGAIKDEEIAKHLSKNNLKKLGTALDNRLALKYLFKTSQALDIVSGGIKANA
                     LPESATVLVNNRIGMHSSVNETLGHIMKHVQSKAETYNLGIKVLAGRYSKEETAEVIK
                     PVTESGRFVIRLLDPLEPAPFSPTSGSQVWDIISGTTVSTYKQKLFGGEDAKVYITPA
                     LSTGNTDTKSFWNLTRNIYRYSGSLQYKESNEHTVDEKNSGLSLLSGVAFMYQYIPNV
                     DAYATDA"
     gene            complement(<489992..>491911)
                     /locus_tag="KLTH0H05522g"
                     /db_xref="GeneID:8294434"
     mRNA            complement(<489992..>491911)
                     /locus_tag="KLTH0H05522g"
                     /product="KLTH0H05522p"
                     /transcript_id="XM_002556073.1"
                     /db_xref="GeneID:8294434"
     CDS             complement(489992..491911)
                     /locus_tag="KLTH0H05522g"
                     /note="highly similar to uniprot|P53145 Saccharomyces
                     cerevisiae YGL099W LSG1 Putative GTPase involved in 60S
                     ribosomal subunit biogenesis localized to the cytoplasm"
                     /codon_start=1
                     /product="KLTH0H05522p"
                     /protein_id="XP_002556119.1"
                     /db_xref="GeneID:8294434"
                     /db_xref="GOA:C5E2J6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2J6"
                     /translation="MPPKEPPKKWKAPKGPKPIQRKNKNTIGLGRAIRTARQKENEVQ
                     ILPDGEMRFTTDKHEANWVKLRSVTQESALDEFLNTAELADKDFAADRHSNVKIIRMD
                     AGSDARSQGVTLSNAQKQQLNEKQRSQARNLIVPRRPAWNESMTRFQLERQEKDAFLE
                     WRRKLATLQESNEDLLLTPFERNIEVWRQLWRVIERSDLVVQIVDARDPLLFRSVDLE
                     LYVKELNEGKQNLLLVNKADLLTRKQRIIWAKYFISRNISFTFFSAARANEILEKQNE
                     LGEDYVHKEIEEEEISEIDGEKVDQEVLDKIQILKIDQLEELFLSKAPNHPLISPLPG
                     QEPLIQIGLVGYPNVGKSSTINALVGSKKVSVSSTPGKTKHFQTIKLSERVMLCDCPG
                     LVFPNFAYNKGELVCNGVLPIDQLRDYIGPCSLVAERVPKYFLEAIYGIHIQTKSADE
                     GGTGKPTAQELLVSYARARGYMTQGFGAADESRASRYILKDYVNGKLLYINPPPHLED
                     DTPYTREECEEFNEDIYTFDKLPQTRQEQLADAVKSKNLEDFDLARDLGKLTFSAHIG
                     KEGDSKEARSVNHGGKQAALYNAAEDLDNEFFKMSSVKGQLTNPFHKTQAESSGGKKH
                     NKKNKKGKTRAKFSD"
     gene            complement(<492106..>493374)
                     /locus_tag="KLTH0H05544g"
                     /db_xref="GeneID:8294435"
     mRNA            complement(<492106..>493374)
                     /locus_tag="KLTH0H05544g"
                     /product="KLTH0H05544p"
                     /transcript_id="XM_002556074.1"
                     /db_xref="GeneID:8294435"
     CDS             complement(492106..493374)
                     /locus_tag="KLTH0H05544g"
                     /note="similar to uniprot|P38332 Saccharomyces cerevisiae
                     YBR246W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05544p"
                     /protein_id="XP_002556120.1"
                     /db_xref="GeneID:8294435"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2J7"
                     /translation="MDLPVRDTNQHEKFTIFWNHKRRPQVNAGELNALKVPALSLLSY
                     MTAPESEAKAVSHTNKPPCCLRIFRDDFIILGTYDLDKPSGARTGSIDVLDKNLGPLG
                     TYDTYGAVLDLKLSPFDDTLMASAHSTGNVELWRIEYESIASDRTLKLLRIANLQVFD
                     ADTLITSLHFSPRTPENLLVTATNGETRVLDLKHESEVFTSQALSTQYSKLETNLLDV
                     QGRQASVLNVDSVTLDYQHALECWTAEYGCLAPFENVVFTGGDDSAIAAHDLRTLETV
                     WSNSRIHEAGVVAIKCSSSTFRANKPTSILTGSYDDHIRSLELRMMGDSIYPGVNVPV
                     ANSSSSNLGGGVWRFAESPQNAQDSESNKLLVCCMYDGAKILRVDGDDFIIETYTKKN
                     HESMCYGGDWGHKFVATCSFYDKVVQLWDE"
     gene            <493448..>496768
                     /locus_tag="KLTH0H05566g"
                     /db_xref="GeneID:8294436"
     mRNA            <493448..>496768
                     /locus_tag="KLTH0H05566g"
                     /product="KLTH0H05566p"
                     /transcript_id="XM_002556075.1"
                     /db_xref="GeneID:8294436"
     CDS             493448..496768
                     /locus_tag="KLTH0H05566g"
                     /note="highly similar to uniprot|P38144 Saccharomyces
                     cerevisiae YBR245C ISW1 Member of the imitation-switch
                     (ISWI) class of ATP-dependent chromatin remodeling
                     complexes ATPase that forms a complex with Ioc2p and Ioc4p
                     to regulate transcription elongation and a complex with
                     Ioc3p to repress transcription initiation"
                     /codon_start=1
                     /product="KLTH0H05566p"
                     /protein_id="XP_002556121.1"
                     /db_xref="GeneID:8294436"
                     /db_xref="GOA:C5E2J8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2J8"
                     /translation="MDDQEYLEKLKPFQEGLPPSDPESNKKRYLIKGQQKSEFDLEGT
                     IKRFQHLLNLSGLFRHFIERKAAKDEKFQKVLNILDNPSGRKGSKGSSHQDKRRRKTE
                     TEEDQELLKDEEGEEQDQVGYQFRESPPFVNGQLRPYQIQGLNWLVSLHQSNLAGILA
                     DEMGLGKTLQTISFIGYMRYVEKKRGPFVVIAPKSTLNNWLREINRWTPEVNAFILQG
                     DKEERAKLVSNKLMACDFDIVVASYEIIIKEKSSFKKIDWEYIIIDEAHRIKNEESML
                     SQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDVFSDSQAFDDWFSSESSEEDK
                     GTIVKQLHTVLQPFLLRRLKNEVETSLLPKKELNLYIGMSAMQKRWYKQILEKDLDAV
                     NGANGSKESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSAKLKVLDKL
                     LRKFKEEGSRVLIFSQMSRLLDILEDYCFFRNYEYCRIDGSTAHEDRIEAIDEYNAPD
                     SKKFVFLLTTRAGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRL
                     VTDNSVEEKILERATQKLRLDQLVIQQSRNGVANKEAKKGDSKDALLSMIQHGAADVF
                     SSNSGDSSTKGTPQPGSTDDVDGDIDLDNLLANSEDKTQSLNQKYEALGLDDLQKFNQ
                     DSAYEWNGQDFKKRANKDIISTAWINPSKRERKENYNIDGYYKDVLNPGRSTTPAQPK
                     MPRPQPFHSHQLLSPQLKVLYEKERMWNTKKNNYVPTLEDVKTTYGEIEDEEEKQAKL
                     NMLLLAVANAQPLTEEEEKQKAQLESEGYTNWNKNDFRKFIAACGKYGRNSIKAIAFE
                     FAPHKTEEEVRDYAKAFWTNIQRVEDYERYLKNIEAEEDRIRRTKLQQEALRRKIAQC
                     SNPLFDLTLKHPPSNSNKRVFSEEEDRFLLLMLFKYGIDRENVYELVRDEIRDSPLFE
                     LDFFFQSRTPIELNRRAITLLQCLEKEFNAGVVLDDGMKRRLAEEDENAKNMAEEVKE
                     GAAEAGSEAAPGPGGADVAGKAMEPAPANGELNGKRPREEEDTAATAVAAAMTSTEPG
                     PADKPSVNGDAKKPKTEQ"
     gene            complement(<496922..>497407)
                     /locus_tag="KLTH0H05588g"
                     /db_xref="GeneID:8294437"
     mRNA            complement(<496922..>497407)
                     /locus_tag="KLTH0H05588g"
                     /product="KLTH0H05588p"
                     /transcript_id="XM_002556076.1"
                     /db_xref="GeneID:8294437"
     CDS             complement(496922..497407)
                     /locus_tag="KLTH0H05588g"
                     /note="highly similar to uniprot|P40581 Saccharomyces
                     cerevisiae YIR037W HYR1 Thiol peroxidase that functions as
                     a hydroperoxide receptor to sense intracellular
                     hydroperoxide levels and transduce a redox signal to the
                     Yap1p transcription factor or similar to YBR244W
                     uniprot|P38143 Saccharomyces cerevisiae YBR244W GPX2
                     Phospholipid hydroperoxide glutathione peroxidase induced
                     by glucose starvation that protects cells from
                     phospholipid hydroperoxides and nonphospholipid peroxides
                     during oxidative stress"
                     /codon_start=1
                     /product="KLTH0H05588p"
                     /protein_id="XP_002556122.1"
                     /db_xref="GeneID:8294437"
                     /db_xref="GOA:C5E2J9"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:C5E2J9"
                     /translation="MSKFYDLAPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEE
                     LQELYKRYHDKGFEIIGFPCNQFGHQESGTDEEIGQFCKLNYGVTFPVMKKVHVNGDN
                     ADPVYEYLKNEKAGMLGFKGIKWNFEKFLIDKHGNVYERYSSLTKPANLDAKVQKLLG
                     A"
     gene            complement(<498715..>499734)
                     /locus_tag="KLTH0H05610g"
                     /db_xref="GeneID:8294438"
     mRNA            complement(<498715..>499734)
                     /locus_tag="KLTH0H05610g"
                     /product="KLTH0H05610p"
                     /transcript_id="XM_002556077.1"
                     /db_xref="GeneID:8294438"
     CDS             complement(498715..499734)
                     /locus_tag="KLTH0H05610g"
                     /note="highly similar to uniprot|P53011 Saccharomyces
                     cerevisiae YGL100W SEH1 Nuclear pore protein homologous to
                     Sec13p"
                     /codon_start=1
                     /product="KLTH0H05610p"
                     /protein_id="XP_002556123.1"
                     /db_xref="GeneID:8294438"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2K0"
                     /translation="MKPFITGHEDLVHDVVYDFYGRHVATCSSDQHIKVFRLDRETNE
                     WQLSDSWKAHDSSVVGLDWASPEYGRIIASVSYDKLVNLWEEEPDAEECSGRRWTKLC
                     TLNDATGPLFSVKFAPGHLGLKLGAIGNDGTLRIYEAMEPSDLRSWTLTSEVKVLPSP
                     PASHLQSDFCLTWCPSRFSPEKLLVCALDQALIYQKDKAGKPYVAAKLEGHTALIRSV
                     SWAPSVGRWYQLIATACKDGKVRIFKLTETLGASEDAMSVDQDEDADADAGSADTSAD
                     TPPELKVELVSESDDHHGEVWSVSWNLTGTILSSAGDDGKVRLWKASYSNEFKCMSVI
                     SAEQK"
     gene            <499881..>501227
                     /locus_tag="KLTH0H05632g"
                     /db_xref="GeneID:8294439"
     mRNA            <499881..>501227
                     /locus_tag="KLTH0H05632g"
                     /product="KLTH0H05632p"
                     /transcript_id="XM_002556078.1"
                     /db_xref="GeneID:8294439"
     CDS             499881..501227
                     /locus_tag="KLTH0H05632g"
                     /note="similar to uniprot|P07286 Saccharomyces cerevisiae
                     YBR243C ALG7 UDP-N-acetyl-glucosamine-1-P transferase
                     transfers Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in
                     the first step of the dolichol pathway of protein
                     asparagine-linked glycosylation inhibited by tunicamycin"
                     /codon_start=1
                     /product="KLTH0H05632p"
                     /protein_id="XP_002556124.1"
                     /db_xref="GeneID:8294439"
                     /db_xref="GOA:C5E2K1"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="UniProtKB/TrEMBL:C5E2K1"
                     /translation="MHQALLLVVAIAAIYVSRYYSPLLAALGFAIIGFLASDALIPRV
                     SQSFIKIGCFGKDLSKPGRPVIPESIGAISATVYLFIMFFYIPFLFYKYLVVITPGGG
                     HRDASIMQSPVSDEYRFPHGKMSEYLSAVLCLQSTVLLGIADDLFDLRWRHKFFLPAV
                     AAIPLLVVYYVDFGVTHVLIPDVIQRWLGTSKTIFNLGALYYVYMASMAIFCPNSINI
                     LAGVNGLEVGQSIVLGVIFLINDSLYLLLGNEASKEAHLFSAILIIPFLGVAFSLWKW
                     NKWPAKVFVGDTFCYFAGMIFSVVGILGHFSKTTLIFFIPQTFNFAYSCPQLFGLVPC
                     PRHRMPRFNEADGLLYPSRANLVEKPPKKVFVPVLKLLSSLKLIDLEVDPQTGALKSC
                     SNMTLINLVLVWFGPTREDKLCNRILAIQFTVGLCAIVARHSIGSIIFGHDNIQFL"
     gene            complement(<501335..>502036)
                     /locus_tag="KLTH0H05654g"
                     /db_xref="GeneID:8294440"
     mRNA            complement(<501335..>502036)
                     /locus_tag="KLTH0H05654g"
                     /product="KLTH0H05654p"
                     /transcript_id="XM_002556079.1"
                     /db_xref="GeneID:8294440"
     CDS             complement(501335..502036)
                     /locus_tag="KLTH0H05654g"
                     /note="similar to uniprot|P38331 Saccharomyces cerevisiae
                     YBR242W Hypothetical ORF or YGL101W uniprot|P53144
                     Saccharomyces cerevisiae YGL101W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05654p"
                     /protein_id="XP_002556125.1"
                     /db_xref="GeneID:8294440"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:C5E2K2"
                     /translation="MNKFIGSTVFNRLLTRNTRMTAPVWKPQDHVPQEVKDLLQSSGD
                     NHVLAFLHIVQLLKVQRRTGWLDHNISPCESIADHMYRMGITAMLIRDPKINRDKCVR
                     IALVHDIAEALVGDITPLDPVGKEEKHRREWETIQYLCEDLVKPYNAQAAQEIMDDWL
                     AYENIASPEARYVKDIDKFEMLVQCFEYEKLHNGKRDLDQFWGAMSSIKTEEVKGWAQ
                     DLLQKREQFYNSLKK"
     gene            complement(<502254..>502989)
                     /locus_tag="KLTH0H05676g"
                     /db_xref="GeneID:8294441"
     mRNA            complement(join(<502254..502654,502941..>502989))
                     /locus_tag="KLTH0H05676g"
                     /product="60S ribosomal protein L28"
                     /transcript_id="XM_002556080.1"
                     /db_xref="GeneID:8294441"
     CDS             complement(join(502254..502654,502941..502989))
                     /locus_tag="KLTH0H05676g"
                     /note="highly similar to uniprot|P02406 Saccharomyces
                     cerevisiae YGL103W RPL28 Ribosomal protein L29 of the
                     large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L28"
                     /protein_id="XP_002556126.1"
                     /db_xref="GeneID:8294441"
                     /db_xref="GOA:C5E2K3"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:C5E2K3"
                     /translation="MPTRFTKTRKHRGHVSAGHGRIGKHRKHPGGRGMAGGQHHHRTN
                     LDKYHPGYFGKVGMRYFHRQQNRFWKPVLNLDKLWTLVPAEKRDEYMSSASKSAAPVI
                     DTLAAGYGKILGKGRIPDVPVIVKARFVSKLAEEKIRAAGGVVELIA"
     gene            <503691..>505202
                     /locus_tag="KLTH0H05698g"
                     /db_xref="GeneID:8294442"
     mRNA            <503691..>505202
                     /locus_tag="KLTH0H05698g"
                     /product="KLTH0H05698p"
                     /transcript_id="XM_002556081.1"
                     /db_xref="GeneID:8294442"
     CDS             503691..505202
                     /locus_tag="KLTH0H05698g"
                     /note="similar to uniprot|P53142 Saccharomyces cerevisiae
                     YGL104C VPS73 Mitochondrial protein involved in vacuolar
                     protein sorting"
                     /codon_start=1
                     /product="KLTH0H05698p"
                     /protein_id="XP_002556127.1"
                     /db_xref="GeneID:8294442"
                     /db_xref="GOA:C5E2K4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E2K4"
                     /translation="MSENQALLGPKPKVTSSLVFATIVVCFGSIQYGYHMAELNAPGQ
                     VLSCTEFIEPWPEAGPYADTWFGKHGFQQCLPLTEEQMGFATSIFSIGGLVGSLYAGR
                     VADRYGRKKYSFTNCVIGIIGSLLLFRANSYAQLIAGRFIAGISCGSCIVVTPLFINE
                     ISPKELRGSLGSMNQVCINVGILLTQLLALKYADSYRWRWLMLAGAILALIQFLLLFK
                     IDESPLWLASRGDLDGAEHVLRGLRGGDRRRSRGEVDEWLQSRGSSRPATGSADYTQM
                     NSHASQQSASPESVTSSSSQQDVSVKNYFTDPRYSKSRWAITVILVSQQFCGIGSIIF
                     YGVKLVSGQLPQYAVLVNFGISILNVVVTLGASSLVDHWGRKPLLTASAGAISISSIF
                     LSTGIVTNNAAMLVASTFMYIAVFAIGLGPIPFLVISELSPPEASGIAQSYGTTCNWI
                     GTFIVGYGFPILNEWLHGYSFLVFAAYAAAFTLYIHLKVPETKGKQDYDLVWN"
     gene            <505672..>507006
                     /locus_tag="KLTH0H05720g"
                     /db_xref="GeneID:8294443"
     mRNA            <505672..>507006
                     /locus_tag="KLTH0H05720g"
                     /product="KLTH0H05720p"
                     /transcript_id="XM_002556082.1"
                     /db_xref="GeneID:8294443"
     CDS             505672..507006
                     /locus_tag="KLTH0H05720g"
                     /note="similar to uniprot|P38141 Saccharomyces cerevisiae
                     YBR240C THI2 Zinc finger protein of the Zn(II)2Cys6 type
                     probable transcriptional activator of thiamine
                     biosynthetic genes"
                     /codon_start=1
                     /product="KLTH0H05720p"
                     /protein_id="XP_002556128.1"
                     /db_xref="GeneID:8294443"
                     /db_xref="GOA:C5E2K5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5E2K5"
                     /translation="MSNCNKTKARSFTGCWACRFKKRRCDENKPFCSLCLRHGDQCSY
                     DIRLVWQNENIFSVNENKELVSWKKLRNLCKQPNRNRISRRRFQQMTQFRQISPPNSD
                     DEDSDKKDAAHDDGESDEDRDEENDSSKKNTFTISVRRLKIYDNALDCVHGQTDKNFD
                     QRFVDQQLGQLLTKLESSSQVAGDDRSGPFCVFKVDSFKKRNDSEKPVISRTSHETHN
                     ELSSLPNTPISETNSFLAMRLSTAEATSKFLSHHWPNLLLANDTNFCLQQPAYVKWLT
                     THIGSMGHLLHPDFLEELMNGSVDSSKWLSMIPHFSMECQALYLVLLVMAEREKDMVD
                     FVSRWVLSQTQVSYLSFPLIAHSLKSCNKIAFLFHCHELLADATLQDLFQYELTSMLK
                     INTVRLILQYWSNLMMDQICQCQDTTNSEMQLKFWEMQLQCNEEFYRDICLV"
     gene            complement(<507109..>508227)
                     /locus_tag="KLTH0H05742g"
                     /db_xref="GeneID:8294444"
     mRNA            complement(<507109..>508227)
                     /locus_tag="KLTH0H05742g"
                     /product="KLTH0H05742p"
                     /transcript_id="XM_002556083.1"
                     /db_xref="GeneID:8294444"
     CDS             complement(507109..508227)
                     /locus_tag="KLTH0H05742g"
                     /note="similar to uniprot|P46672 Saccharomyces cerevisiae
                     YGL105W ARC1 Protein that binds tRNA and methionyl- and
                     glutamyl-tRNA synthetases (Mes1p and Gus1p) delivering
                     tRNA to them stimulating catalysis and ensuring their
                     localization to the cytoplasm also binds quadruplex
                     nucleic acids"
                     /codon_start=1
                     /product="KLTH0H05742p"
                     /protein_id="XP_002556129.1"
                     /db_xref="GeneID:8294444"
                     /db_xref="GOA:C5E2K6"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5E2K6"
                     /translation="MSVLIEKFKSLSLSTELNKEQLAQAAQWESVVKSGQIQGHIDEL
                     NLRLRDHSFILGTLVPTETDTVVFESVFPLIKDLIASSKDVKGHYAKFRHILRWIAYL
                     QELLEIPNNEQLEINFDLELPREVIEKKKKEDAKKPAEAAEGKKKEASAPKEGADKGK
                     QPRGKPDEETLKKLREEAKAKKAAKKAANAQAQPQDQQPQKPKPSAIDFRVGFIQKAV
                     KHPDADSLYVSTIDVGDEEGPRTVCSGLVKYFPLEAMQERYVVAVCNLKPVNMRGVKS
                     TAMVLCGSDENNVEFVQPPEGSKAGDKVFFEGFGDEEPAKQLNPKKKIWEQLQPHFST
                     NENLEVYFNDEDEKKARKLTNAKGESFKVASIANANVR"
     gene            <508783..>510153
                     /locus_tag="KLTH0H05764g"
                     /db_xref="GeneID:8294445"
     mRNA            <508783..>510153
                     /locus_tag="KLTH0H05764g"
                     /product="KLTH0H05764p"
                     /transcript_id="XM_002556084.1"
                     /db_xref="GeneID:8294445"
     CDS             508783..510153
                     /locus_tag="KLTH0H05764g"
                     /note="similar to uniprot|P38140 Saccharomyces cerevisiae
                     YBR239C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05764p"
                     /protein_id="XP_002556130.1"
                     /db_xref="GeneID:8294445"
                     /db_xref="GOA:C5E2K7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR013767"
                     /translation="MSSRRQKTSVACINCSKSHVTCQAERPCSRCVKKGLEATCVDAP
                     RKRRKYLADVPDEQLPVAVKRGNIHEEQQLSNENRYIAHKPRFMSNAADLEYSILSDI
                     IQQDTLLSKIPMDLLYSRDGAKDEESQYNTPNSASSVPSLGAQGRPPSARRTGSPVDS
                     QRVKYATLLGPRGRQALKTEVDLFTTHFPLLPQEVNNSRFRRRIHFDANVRQYYLNDK
                     TTFPEILDQIEPKPKSISLALDISSPDARAVQNFPDVPHSLRYATPMEIYTLISKPFS
                     HTSGFHSLLQYLRSRFNREDIVEMCRSLAEFRPTFIAIAVTLTEEDMIFMEQCYQRTL
                     LEYDQFISQMGTPTCVWRRNGQVSYVNDEFSLLTGWTRADLLFKMTFIVELMDDESVR
                     EYFKTFNRVAYRDFKGSERMKTCKLLTPFRGREVECCCIWTLKRDVFGLPLMIIGNFM
                     PIIGQS"
     gene            complement(<510256..>510687)
                     /locus_tag="KLTH0H05786g"
                     /db_xref="GeneID:8294446"
     mRNA            complement(<510256..>510687)
                     /locus_tag="KLTH0H05786g"
                     /product="KLTH0H05786p"
                     /transcript_id="XM_002556085.1"
                     /db_xref="GeneID:8294446"
     CDS             complement(510256..510687)
                     /locus_tag="KLTH0H05786g"
                     /note="similar to uniprot|P53141 Saccharomyces cerevisiae
                     YGL106W MLC1 Essential light chain for myosin Myo2p may
                     stabilize Myo2p by binding to the neck region may interact
                     with Myo1p Iqg1p and Myo2p to coordinate formation and
                     contraction of the actomyosin ring with targeted membrane
                     deposition"
                     /codon_start=1
                     /product="KLTH0H05786p"
                     /protein_id="XP_002556131.1"
                     /db_xref="GeneID:8294446"
                     /db_xref="GOA:C5E2K8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:C5E2K8"
                     /translation="MSEKTQKDIFTLFDRQAKGTISKQQLGDYLRAIGFNPTNALVEE
                     VGADAADALTLEETTALVTQHRDALEKTTQGKVDDFIKAFQVFDKENKGKVSVGDIRY
                     MLTGLGERLSDAEVDELLKGVEVDSDGGVDYRKFIEDILRQ"
     gene            <511833..>513776
                     /locus_tag="KLTH0H05808g"
                     /db_xref="GeneID:8294447"
     mRNA            <511833..>513776
                     /locus_tag="KLTH0H05808g"
                     /product="KLTH0H05808p"
                     /transcript_id="XM_002556086.1"
                     /db_xref="GeneID:8294447"
     CDS             511833..513776
                     /locus_tag="KLTH0H05808g"
                     /note="similar to uniprot|P38330 Saccharomyces cerevisiae
                     YBR238C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05808p"
                     /protein_id="XP_002556132.1"
                     /db_xref="GeneID:8294447"
                     /db_xref="UniProtKB/TrEMBL:C5E2K9"
                     /translation="MLRFVQQSHVLKSRVSNQFVSASARSPFHHSLRFNSAVAMDRTP
                     SQEAAAVAPAPPNVAKAVDKVRAMRKNIKINKQLSATPDSPWFHKVCAFEDCVAQTLY
                     MSQTPRRRNNNNNNNGRRGQQQPLAASNTNPLFWDSIGRAMGLYRELLGTPELNSDRV
                     SKLVHLLHNGLRANRNQLTRMNKKPDYDSQSFHKEMTNYLCESLREISQDVLSAKVEL
                     NEYGAMHLITAFKELLLFEEAVSIWRSAINGNSNYTANIFLNPRVVGVVLPILYDNGV
                     TYAEIQELYEKSSAMINYFHPNLSVGMIRASLSAGENEMALTLFQKLCEESSEMKYGY
                     LIETHLSFIGECKDLNISQAFFDKALNNEMPYKIDLQVSYVKSFLKNIWSQTHDFQKV
                     YDIWYKSSVHYGRDVNHGISSSLNDTFFDIFFEHYSQDKIIGLQQLQEMISIYNNIKP
                     IDEPFFNIILTKCTVWRDRQIIESIDKAYDLYQIPRTIVAYRILLKSMGSVHVTNEEI
                     FQRWCNLVKKSDEIGQSFIANADWAALRDATVTWTQLYSQPDDLYSDGFNAAMQAANA
                     SGAFDDIPQQTQQQQPNDRLELYMKIVKRYSPFCRDSRQLSRLTSGTAVKYPVLQQAL
                     SKFNDLDVSDVYIPQFHNLVAQN"
     gene            <513953..>514327
                     /locus_tag="KLTH0H05830g"
                     /db_xref="GeneID:8294448"
     mRNA            <513953..>514327
                     /locus_tag="KLTH0H05830g"
                     /product="KLTH0H05830p"
                     /transcript_id="XM_002556087.1"
                     /db_xref="GeneID:8294448"
     CDS             513953..514327
                     /locus_tag="KLTH0H05830g"
                     /note="similar to uniprot|P53139 Saccharomyces cerevisiae
                     YGL108C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery"
                     /codon_start=1
                     /product="KLTH0H05830p"
                     /protein_id="XP_002556133.1"
                     /db_xref="GeneID:8294448"
                     /db_xref="UniProtKB/TrEMBL:C5E2L0"
                     /translation="MGLCASKEDRSQGKGAHTSVQRSKPKQSARGSAQGDSKPQTSRL
                     HKKSGSGKALSDSGETDKDVSAKRAAGQAAAERFEKSQKQLDKGELGKKLAEERAKTL
                     QTHLRETAEIRQLEKDQRLVYD"
     gene            complement(<514352..>516787)
                     /locus_tag="KLTH0H05852g"
                     /db_xref="GeneID:8294449"
     mRNA            complement(<514352..>516787)
                     /locus_tag="KLTH0H05852g"
                     /product="KLTH0H05852p"
                     /transcript_id="XM_002556088.1"
                     /db_xref="GeneID:8294449"
     CDS             complement(514352..516787)
                     /locus_tag="KLTH0H05852g"
                     /note="similar to uniprot|P21372 Saccharomyces cerevisiae
                     YBR237W PRP5 RNA helicase in the DEAD-box family"
                     /codon_start=1
                     /product="KLTH0H05852p"
                     /protein_id="XP_002556134.1"
                     /db_xref="GeneID:8294449"
                     /db_xref="GOA:C5E2L1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2L1"
                     /translation="MSTVSAEEKKRLLLERRNKWKQKKAEFDALKVRQETNKESRVES
                     SGTLSKIENGTQKALNRNEESSKPVGKRSSKVKKRAFEESDEEEEPAKVELFRPDEHP
                     DVNSPLNLDAGTTVVDEDPLDLFMQRLNTDNNDKDRGILDADVLDDALSEEEAVHEID
                     GVEAEFMRLKKLKSKKRVKRLNTQTQKLEPFVKDFYIEPEEIKNMSETEIDELRLGLD
                     NVKIKGQGCPRPIVKWSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGI
                     SKTGSGKTVSFLLPLLRQIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPV
                     SKLRSICCTGGSELKQQIKELKKGVEIVVATPGRFIDLLTLNSGKLLNTERVTFVVMD
                     EADRLFDLGFEPQITEIMKTIRPDKQCVLFSATFPTKLKSFASRILDRPISITINSKS
                     LINENIEQQLRIYDNDESKFEGLLDILRKQTQMSSDDERDEKIIVFLSSQQICDLIYY
                     RLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLCTEVLSRGLNVPEVSLVIIYN
                     AVKTFAQYVHTTGRTARGDKHGTAVTLLLSDELAASYILNKSLRDTEIELLDEGTIEK
                     LKAMANKFDSGMKTGKYRLTKGFGGKGLEHMEKLNDEKHNQELKQYNVPEQSKGSEKE
                     DDNHPEADQVIVPKLEYVFLQNKNPNGRITYSAEVNVNDLPQLVRWEATKNTTLSFIK
                     HETACSITNRGRFYPEGSGPKSASDEPKLYLLIEAHEEKDVRLAIELLEDKVKEGVKK
                     VSINEAKSSKFSL"
     gene            <516956..>518197
                     /locus_tag="KLTH0H05874g"
                     /db_xref="GeneID:8294450"
     mRNA            <516956..>518197
                     /locus_tag="KLTH0H05874g"
                     /product="KLTH0H05874p"
                     /transcript_id="XM_002556089.1"
                     /db_xref="GeneID:8294450"
     CDS             516956..518197
                     /locus_tag="KLTH0H05874g"
                     /note="highly similar to uniprot|P32783 Saccharomyces
                     cerevisiae YBR236C ABD1 Methyltransferase catalyzes the
                     transfer of a methyl group from S-adenosylmethionine to
                     the GpppN terminus of capped mRNA"
                     /codon_start=1
                     /product="KLTH0H05874p"
                     /protein_id="XP_002556135.1"
                     /db_xref="GeneID:8294450"
                     /db_xref="GOA:C5E2L2"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR016899"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E2L2"
                     /translation="MNVRPEKPVWMSQEQYDKQYGSPNETIVKKPTPKPAEEEQSKVE
                     EVEQEGDDDKKELEKPVFKIQKRKHQRYDSEERRKKHQLHKMREEQIKRHEIDMTANK
                     VVNVDQIIRKHYNERTFVAKRRRRHLSPIIKLRNFNNAIKYMLIDKFTFPGNVVLEMG
                     CGKGGDLRKYGAAGISQFIGIDISNASIVEAQKRFSSMGNLDYQVILITGDCFGESLG
                     VAVEPFPECRFPCDVVSAQFCLHYAFESEEKARRTLLNVTKSLKIGGYFIGTIPDSEF
                     IRYKLNKITKDVDKPSWGNAIYKVTFENSDYQKNNNEFTSPFGQMYTYWLEDAIDNVP
                     EYVIPFETLRSLADEYGLELELQMPFNAFFVQEIPKWINKFSPKMQEGLQRSDGKYGV
                     EGDEKEAASYFYTVFAFKKVK"
     gene            complement(<518252..>521623)
                     /locus_tag="KLTH0H05896g"
                     /db_xref="GeneID:8294451"
     mRNA            complement(<518252..>521623)
                     /locus_tag="KLTH0H05896g"
                     /product="KLTH0H05896p"
                     /transcript_id="XM_002556090.1"
                     /db_xref="GeneID:8294451"
     CDS             complement(518252..521623)
                     /locus_tag="KLTH0H05896g"
                     /note="similar to uniprot|P38329 Saccharomyces cerevisiae
                     YBR235W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H05896p"
                     /protein_id="XP_002556136.1"
                     /db_xref="GeneID:8294451"
                     /db_xref="GOA:C5E2L3"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5E2L3"
                     /translation="MSKFFEIPGSHKPTKKGEEQALSRPQNESLSYFNYGSTKRVPKT
                     SSKLDPDNPNKSKLGTFDGVFVPTTLNVLSILMFLRFGFIIGQMGVLGTLFLLLLSYG
                     INLLTTLSISAISTNGTVRGGGAYYMISRCLGPEFGGSIGLIFFLGQMLNSGMNVVGI
                     IEPIMYNFGTSIDSETPALYPLLRRGYWWEFGYASFILLICLIISMVGSAMVSRAGKV
                     LFWLLLFSTFSIPLSALLVAPFNDGEVNYTGLSSETLKMNLYPQFTKHAAGSLLKGKE
                     TFNDLFGIFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLALTFACYLLVIVTIGSC
                     VPRDSLHKDVQIIQTVSASQIVILVGELSTSIFSIIVGIVGAAYVLEAIAKDSIFPGI
                     SIFEKKPLYSVLFSWFLTQLCLFSDVNKIATIITMAFLMTFLVMNLACFLLEISSAPN
                     FRPSFNYFDRYTAFIGGSLSLIAMFIVDMISAAVVILTISTIFVVIHFFSPPKPWGDV
                     SQNIIYHQVRKYLLRLRQDNVKYWRPQILLLVDNPRTSWNLIKFCNHLKKGGLYVLGH
                     VTVSKTFQGEYEEMRRQTKAWVKIRDMANIKAFVQVGTGPTLPWGVRNVFLGSGLGGM
                     KPNITVIGFFDLKNYHETRNKASDALERGKYSKNFQGLRAARRDDGSVAVEIPDNVGL
                     LPTDDCKNERKIKVQQWVQIIEDLSLMHSNIAVARGFLDLSLPSKGDHSKKKRFIDLY
                     PIQMSAKVILEENSSEGILATNFDTYTLILQLGAILVTVPSWKKTHQLRVVVFVESES
                     ERHDENKRITNLLGILRIEAEVVVLSLDQFRVYNTIIKGDPIQVQEVSDVLKDDPWWA
                     ELVDARTTHKTRRRFSAGAHPMAEIPKNARRTTPKYNVSQLQRLGVSMTMTSNFLKAN
                     LSITDLSDDEDTYMDQDSEVLGDSSSKINSDREDNNQRPATNSSRDNLRPKTSRVSDE
                     RSVRSLMPVFSSDAIPKTKVIEDASGDEPSLVPVVEGAELHPPAFDKRTTKNRVQTPL
                     SPCQSSESLLADLRGLTFNDVPSRAQHLILNDVMSQVSKDSDLIFSTLPIPPLNTHKS
                     EEGSLEYVENLHVWLAGLPPTMLINSKSTTVTTAL"
     gene            <521968..>523767
                     /locus_tag="KLTH0H05918g"
                     /db_xref="GeneID:8294452"
     mRNA            <521968..>523767
                     /locus_tag="KLTH0H05918g"
                     /product="KLTH0H05918p"
                     /transcript_id="XM_002556091.1"
                     /db_xref="GeneID:8294452"
     CDS             521968..523767
                     /locus_tag="KLTH0H05918g"
                     /note="similar to uniprot|P53137 Saccharomyces cerevisiae
                     YGL110C CUE3 Protein of unknown function has a CUE domain
                     that binds ubiquitin which may facilitate intramolecular
                     monoubiquitination"
                     /codon_start=1
                     /product="KLTH0H05918p"
                     /protein_id="XP_002556137.1"
                     /db_xref="GeneID:8294452"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:C5E2L4"
                     /translation="MNLNRYQRVIEINGGDKISLPIVKFPPFKLRAAMVEKDPVIWLH
                     LLETYNQYFTYLMSEGHLEQLEDSTYENLCMFIKSYLKELSNEEGKLLSLGMNTNVCE
                     QLQVLRSWVLTVIKTCGLLHLQISCDVLWDFVRLYVKENPGTVRLLIDGSLKPAINTQ
                     KAQINRIYQLHQHLKQLIETSKFTRVDLKALENLLSAGDIHTKPFTNQFLTTKWAEIL
                     ESWFSSDLKPLRDIAKKIGILSYLTASEDRIVELISESNVFDLESLHFHPLMGSLLIN
                     EQFQAHFSGLKAKLPFLRALLTKNNNKAPTISVEDVQTIIEVFPHLTVGQVERRLQAH
                     DGDVERTINSFFESPTETDKAPLIDEVTRNKQEEMKNTNFESELGKADRFSKPDEVTT
                     RDHVPDEVRNKTLTRALALLYQADEDEKDDTYDDAEVQRDALGNLDSDDRQSANGNNY
                     DKIEGHLWELLKENKELFDRSNRNSKARKELKTSTSWSDEQIEGWARMLERSPKRAQI
                     LEERYMFRGNVRTGKRAFVQNKNESAAAQNKTERNNSVREAKGNSVAPKSTQQNGASD
                     KKKQNARKEKHKSARANHNRKSGHDKKISRVSP"
     gene            complement(<523846..>525180)
                     /locus_tag="KLTH0H05940g"
                     /db_xref="GeneID:8294453"
     mRNA            complement(<523846..>525180)
                     /locus_tag="KLTH0H05940g"
                     /product="KLTH0H05940p"
                     /transcript_id="XM_002556092.1"
                     /db_xref="GeneID:8294453"
     CDS             complement(523846..525180)
                     /locus_tag="KLTH0H05940g"
                     /note="similar to uniprot|P53136 Saccharomyces cerevisiae
                     YGL111W NSA1 Constituent of 66S pre-ribosomal particles
                     involved in 60S ribosomal subunit biogenesis"
                     /codon_start=1
                     /product="KLTH0H05940p"
                     /protein_id="XP_002556138.1"
                     /db_xref="GeneID:8294453"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2L5"
                     /translation="MRLLIACDDSGSIKELICNKNTNTSVQTAPQPFHLGAHLPEGFG
                     SRVEIMKMIGPQHLLVARANGSIQLIELKRVDRDVSVKDPAKEPIFQVSEMHAASTIS
                     GLFDEARLLSIHKSSKKRSRPRDGFVALELVPQTSDRVFSATKSGLVHVLSIENGELK
                     LISSNSVKAPLEFAQVYDLVAAQKTRQKKRASAKLTFAYGGEENLVKIAQFTSSYKTI
                     EQIWEAKNVSNDRLDLKVPVWPMKLKFLEPASAAVDEGKVNYQFVTINRLGLFREYRT
                     LTGRKPMLSKALLPKNEFATQLQVINSDVTPAGNIRSNSFENLQFVTSDLKKNVFSFN
                     AASGSLGKYGNGDITGHASFLNIEKKYLLQGGLDRYVRVFDAESRAVICKCYTGSKIS
                     SVVLVDEEEIDVPQLNENKKRRPKHKDDKAEAEDDEKLWSTLESSAKKLKKS"
     gene            <525898..>527019
                     /locus_tag="KLTH0H05962g"
                     /db_xref="GeneID:8294454"
     mRNA            <525898..>527019
                     /locus_tag="KLTH0H05962g"
                     /product="KLTH0H05962p"
                     /transcript_id="XM_002556093.1"
                     /db_xref="GeneID:8294454"
     CDS             525898..527019
                     /locus_tag="KLTH0H05962g"
                     /note="highly similar to uniprot|P38328 Saccharomyces
                     cerevisiae YBR234C ARC40 Essential subunit of the ARP2/3
                     complex which is required for the motility and integrity
                     of cortical actin patches"
                     /codon_start=1
                     /product="KLTH0H05962p"
                     /protein_id="XP_002556139.1"
                     /db_xref="GeneID:8294454"
                     /db_xref="GOA:C5E2L6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017383"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2L6"
                     /translation="MSNSIVANLKLAKAPIYSHCFSQDRSLVAVTLNSDCLVFKLTPG
                     GKPALVATLPDHDKTVTAVDISIHGRIVTCSQDRNAIVWEPLSDGTYKPTLVLLRINR
                     AATCVQWAPSGYKFAVGSSARIIAVCYYEQENDWWVSKHIKKPIKSTINCVSWHDNGI
                     MLACGGTDGYVRAFSGFVKGLDSRDQVANSPWAEKFPFGALIREWYHGAWIHDVQWRS
                     SQEKLAYVAHDGSFNVVDPSDHVSTTFSPEGLPLMALVWINDHEALCGGFSCHPVLFG
                     EGASGWQFSKNIDKDIAPSTPASASTGDDDDEGNAPFGMSALKKFKELDLKGKVSAQV
                     QESTHENAIVELAPYSVTAGNVTEVSSCGLDGKIVIYRV"
     gene            complement(<527082..>527327)
                     /locus_tag="KLTH0H05984g"
                     /db_xref="GeneID:8294455"
     mRNA            complement(<527082..>527327)
                     /locus_tag="KLTH0H05984g"
                     /product="KLTH0H05984p"
                     /transcript_id="XM_002556094.1"
                     /db_xref="GeneID:8294455"
     CDS             complement(527082..527327)
                     /locus_tag="KLTH0H05984g"
                     /note="similar to uniprot|P69850 Saccharomyces cerevisiae
                     YBR233W-A DAD3 Essential protein component of the DASH
                     complex involved in spindle integrity and kinetochore
                     function interacts with Duo1p and Dam1p localizes to
                     intranuclear spindles and kinetochore"
                     /codon_start=1
                     /product="KLTH0H05984p"
                     /protein_id="XP_002556140.1"
                     /db_xref="GeneID:8294455"
                     /db_xref="GOA:C5E2L7"
                     /db_xref="InterPro:IPR013965"
                     /db_xref="UniProtKB/TrEMBL:C5E2L7"
                     /translation="MDELTPLQRSILSKYETLADSLHNLDETIKDLSRRDVPESPEEV
                     LRQLREIEIKIALVGTLLKGSVYSLVLQRRGLKQGEA"
     gene            <527432..>528967
                     /locus_tag="KLTH0H06006g"
                     /db_xref="GeneID:8294456"
     mRNA            <527432..>528967
                     /locus_tag="KLTH0H06006g"
                     /product="KLTH0H06006p"
                     /transcript_id="XM_002556095.1"
                     /db_xref="GeneID:8294456"
     CDS             527432..528967
                     /locus_tag="KLTH0H06006g"
                     /note="highly similar to uniprot|P53040 Saccharomyces
                     cerevisiae YGL112C TAF6 Subunit (60 kDa) of TFIID and SAGA
                     complexes"
                     /codon_start=1
                     /product="KLTH0H06006p"
                     /protein_id="XP_002556141.1"
                     /db_xref="GeneID:8294456"
                     /db_xref="GOA:C5E2L8"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E2L8"
                     /translation="MASQQQSYTIWSPQDTVKDVADSLGITNISDDVLRSLAMDVEYR
                     ILEIVEQAVKFKRHAKREVLTTEDIARALRVLNVEPLYGYQDGSARAKDASFSKVNAP
                     GGQTLYYLNDEEVDFDKLINEPLPKVPRLPTFTTHWLAIEGVQPTIPQNPSLNDIRMS
                     QPPIVRGAIVTTINDTSFQTSASDEKETQHISLIKPGQANEVKPLVKHVLSKELQIYF
                     DKVVGALISKDRDDKAHHLRAAALTSLRSDTGLHQLVPYFIQFIAEQITHNLSDLDLL
                     TTMLEMIYSLLSNTHVFLDPYIHSLMPSILTLLLAKKLGDNPPPNSSKEQREASEKVS
                     KDTGTEFLEKTNALRDFAASLLDHVLRKFPQVYKSLKPRVMRTLLKTFLDTNRSFGTY
                     YGCIKGVAVLGPESVRFFLGNLQSWANLVFEEHTTKENDKDEGGHTGRFTEQETKLLC
                     DVIIESLVVLKSDLPPGQKYDEEITQSQKENLVKRCGSTIADRLLERSDASELVAAIF
                     FGE"
     gene            complement(<529035..>531251)
                     /locus_tag="KLTH0H06028g"
                     /db_xref="GeneID:8294457"
     mRNA            complement(<529035..>531251)
                     /locus_tag="KLTH0H06028g"
                     /product="KLTH0H06028p"
                     /transcript_id="XM_002556096.1"
                     /db_xref="GeneID:8294457"
     CDS             complement(529035..531251)
                     /locus_tag="KLTH0H06028g"
                     /note="weakly similar to uniprot|P53135 Saccharomyces
                     cerevisiae YGL113W SLD3 Protein that interacts with Cdc45p
                     in initiation of DNA replication gene exhibits synthetic
                     lethality with dpb11-1"
                     /codon_start=1
                     /product="KLTH0H06028p"
                     /protein_id="XP_002556142.1"
                     /db_xref="GeneID:8294457"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="UniProtKB/TrEMBL:C5E2L9"
                     /translation="MSVNGADEEYVGGRDSTKNQKPNELTFQGNEKQSIKYIGACSEV
                     PISWLDHSQEPVLLVETDLRKEFLYILEQSSDHEKHVFELCESGYTKTFVFERYFNKS
                     WVRWHLGTIDPSSLKLKQSDNCSQSKRPPPKSRMANTKKWVETNLLNLLELWKEERVL
                     VPGSEEVKTTAFLEMKPPLPVSGEGKLTGSVQHKHPTIDPGTYLRRKYYEALFTFRIP
                     LAYFAKSNLVRARNMSNTSTNEVISYQMHLADLLLEIHDFDQRHDNGGKGILTYELSP
                     DDISDIRDSSLGRFEDLKKRYSSQCLGDLRLLIKVREIKLQMMLLLELIAINQMDIKL
                     KDFEEKYKTKLKKRAKRVARKNMSSRTALKRGKAEFANPSLDFCEKLDIYADKLCIID
                     TMLLSSVPPQKDSQVESSSSASLVTKISEYKKNLTNSGKESSTIGFMTYVLIPYFTRK
                     TPHAVKFISRKFKGLRLNNSTRPEKPNTLGLVSSLNDPSNERATVEIPSSPPSEDSSK
                     TASVCTNITSPPMQQPPKAFKRVSFPNRPLPSNIRSKSQLSEFLELESGLSKKLTSAT
                     RANSDLLLDKLQKRQMPATEFSLHNTNSLTRESSFMQKQVQSTRNSSSVMFQRVGKRL
                     KEQKRASLETANYLNVQVEATPHGKKSDSNALPKFDSAIIESPLATTEKPSHPSGVPV
                     KAGAPLRTPSRQFGSPTGDVQVPASGAKELANTTDVIASPQIVKTRRVRRRLFAPD"
     gene            complement(<531454..>532632)
                     /locus_tag="KLTH0H06050g"
                     /db_xref="GeneID:8294458"
     mRNA            complement(<531454..>532632)
                     /locus_tag="KLTH0H06050g"
                     /product="KLTH0H06050p"
                     /transcript_id="XM_002556097.1"
                     /db_xref="GeneID:8294458"
     CDS             complement(531454..532632)
                     /locus_tag="KLTH0H06050g"
                     /note="similar to uniprot|P38151 Saccharomyces cerevisiae
                     YBR233W"
                     /codon_start=1
                     /product="KLTH0H06050p"
                     /protein_id="XP_002556143.1"
                     /db_xref="GeneID:8294458"
                     /db_xref="GOA:C5E2M0"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5E2M0"
                     /translation="MGTSEKNEELPNSPNVLKRKKEDCQEELLEAEIKRVALDDTEET
                     NDPGNEINKDYIHLRMLCLVKQASMIVGPGGEKISRMKEETNTRINVSDNIRGVPERV
                     IFIRGRCEDVAKVFGMVVRAINGETDGESSEQSATLTLNILIPHHMMGCVIGRQGSRL
                     REIEELSAAKLMAGPQTLPMSNDRILCVSGVADAIHIATYYVGQTILNHKATFASKKC
                     IFYLPSLLHSVLVNSYGVSLQHQQQHQYRPGENGKKRLHRYSASPDFGYAYPGVPSAP
                     HMAVHNVRVADTLAAATIPPALAPQLSLIQQEVYIDDNYVGNVIGKGGKHINSIKETT
                     GCSIQIDDHVEGCSERKILIRGTPIGSQTAILLINNKIEMDRRNKQSIGDKLENPLSS
                     "
     gene            <533185..>534087
                     /locus_tag="KLTH0H06072g"
                     /db_xref="GeneID:8294459"
     mRNA            <533185..>534087
                     /locus_tag="KLTH0H06072g"
                     /product="KLTH0H06072p"
                     /transcript_id="XM_002556098.1"
                     /db_xref="GeneID:8294459"
     CDS             533185..534087
                     /locus_tag="KLTH0H06072g"
                     /note="similar to uniprot|P38326 Saccharomyces cerevisiae
                     YBR231C SWC5 Protein of unknown function, component of the
                     Swr1p complex that incorporates Htz1p into chromatin"
                     /codon_start=1
                     /product="KLTH0H06072p"
                     /protein_id="XP_002556144.1"
                     /db_xref="GeneID:8294459"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="InterPro:IPR027124"
                     /db_xref="UniProtKB/TrEMBL:C5E2M1"
                     /translation="MPNYLSQKLLRSTAMSKDNEEVQDTKGVLFNDEEDYNEEEDLDF
                     DPSKEEGAQPNESDNDADGDTGDDDKNYEETNPDYSNIESGQGGLVRTRRARELEDEL
                     ARRQKYEHIKQEGISQEAKSVWDELQQESTKRLHKSTSIMSQTKDSLGEGLTEELILI
                     DRKYEFAGEVMHEKKWVPKSSAEAQEFLQSTKFTKNPDPSTKTKSAVNDQGLKLRRPL
                     KRPAILEQIIAGALKPKLTTLEKSKLDWATYVDKENLNEELILHNKDGYLAKQDFLNR
                     VETFKDDKYREMRKIQLQQRISDT"
     gene            complement(<534093..>536276)
                     /locus_tag="KLTH0H06094g"
                     /db_xref="GeneID:8294460"
     mRNA            complement(<534093..>536276)
                     /locus_tag="KLTH0H06094g"
                     /product="KLTH0H06094p"
                     /transcript_id="XM_002556099.1"
                     /db_xref="GeneID:8294460"
     CDS             complement(534093..536276)
                     /locus_tag="KLTH0H06094g"
                     /note="similar to uniprot|P53134 Saccharomyces cerevisiae
                     YGL114W Putative member of the oligopeptide transporter
                     (OPT) family of membrane transporters"
                     /codon_start=1
                     /product="KLTH0H06094p"
                     /protein_id="XP_002556145.1"
                     /db_xref="GeneID:8294460"
                     /db_xref="GOA:C5E2M2"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:C5E2M2"
                     /translation="MSEVPFEHKALTRQVSLRATIAGLAIGSLVLISNFQFGLQTGWV
                     SMMSLPSALLACAIFKQVVPLFYPNAAVFTDVENVYVQSLAVAVGTGPLAYGFVGVIP
                     AIENFLTAEESGYTRELGQRFSFQQLLLWSLALAFFGIFFAVPLRKQVIVREKLPFPS
                     GSATATLIAVLNGSEILQEISPKELEEMRARRLREYSDVLANDEQTPLVEERVGNSAV
                     EESEESNGGSSRTCLDFGCPAYEATPEPAPTAHCGSYERNISILSKTFLVSSSYTILS
                     YFLPFMKAIPVFGQHLSKTYLWNLQPSPAYIGQGIIMGLPTVSYMVFGCVLGWAVLAP
                     LARHKKWVDPKADINDWENGVQGWILWSSLAVMVVDSVVGFIVFTTKSLVQFCLRNDK
                     RHLLESMIDDSVQSMLLEEERIINKGNGAGRRRVSTVKLVRTDMDHEVDHRQLVKFTT
                     VVSGLVVSSIICIVCTLYLFGTEIVPLSSVIIALFVALFLSILAVRALGETDLNPVSG
                     IGKLSQLIFTILMPHKKGAILLNLVAGGIAEAGAQQAGDLMQDLKTGHLLGASPKAQF
                     FAQLIGASWSIVFSSVMHIFYNRIYEIPSSQFRVPTAVIWIDCARLVTGKGLPDKALE
                     CTIILGSIFAILSLIKNLYRDRGHKWLLWIPSGVAVGVGIYNAPSFTLARFIGGCTAQ
                     YWLRTHGSDSSAKTCMIVFSSGLVLGEGICSIFNMIFTSYNVPHL"
     gene            complement(<536730..>537692)
                     /locus_tag="KLTH0H06116g"
                     /db_xref="GeneID:8294461"
     mRNA            complement(<536730..>537692)
                     /locus_tag="KLTH0H06116g"
                     /product="KLTH0H06116p"
                     /transcript_id="XM_002556100.1"
                     /db_xref="GeneID:8294461"
     CDS             complement(536730..537692)
                     /locus_tag="KLTH0H06116g"
                     /note="highly similar to uniprot|P12904 Saccharomyces
                     cerevisiae YGL115W SNF4 involved in release from glucose
                     repression invertase expression and sporulation associates
                     with Snf1p"
                     /codon_start=1
                     /product="KLTH0H06116p"
                     /protein_id="XP_002556146.1"
                     /db_xref="GeneID:8294461"
                     /db_xref="GOA:C5E2M3"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5E2M3"
                     /translation="MSMAATDSVLIEQQLAVQSIRRFLKSKTSYDVLPVSYRLIVMDT
                     SLLVKKSLNILLQNNIVSAPLWDSNTSKFAGLLTSSDFINVIQYYFSNPDKFELVDKL
                     QLDGLKDIERAIGVRPLDTGSIHPFKPLYDACCKMIESRSRRIPLIDQDEETHREIVV
                     SVLTQYRILKFVALNCRETRHLRRPIGELGIITEGKLLSCNMHTPVIDVIQLLTQGGV
                     SSVPIVDEQGHLVNVYEAVDVLGLIKGGMYNDLSLSVGEALMRRPDDFEGVYTCTKND
                     KLFTIMDTIRKSRVHRFFVVDEQGLLTGVLTLSDILKYILFEEN"
     gene            538093..538207
                     /gene="SNR20"
                     /locus_tag="KLTH0H06138r"
                     /db_xref="GeneID:8294462"
     ncRNA           538093..538207
                     /ncRNA_class="snRNA"
                     /gene="SNR20"
                     /locus_tag="KLTH0H06138r"
                     /product="U2 RNA"
                     /note="LSR1 SNR20 (U2 RNA)"
                     /transcript_id="XR_002432221.1"
                     /db_xref="GeneID:8294462"
     gene            complement(<538741..>540465)
                     /locus_tag="KLTH0H06160g"
                     /db_xref="GeneID:8294940"
     mRNA            complement(<538741..>540465)
                     /locus_tag="KLTH0H06160g"
                     /product="KLTH0H06160p"
                     /transcript_id="XM_002556101.1"
                     /db_xref="GeneID:8294940"
     CDS             complement(538741..540465)
                     /locus_tag="KLTH0H06160g"
                     /note="similar to uniprot|P26309 Saccharomyces cerevisiae
                     YGL116W CDC20 Cell-cycle regulated activator of
                     anaphase-promoting complex/cyclosome (APC/C) which is
                     required for metaphase/anaphase transition directs
                     ubiquitination of mitotic cyclins Pds1p and other anaphase
                     inhibitors potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0H06160p"
                     /protein_id="XP_002556147.1"
                     /db_xref="GeneID:8294940"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E2M4"
                     /translation="MADNRRNKLDFANNASKSVLSLTSPAKLNVVSSDWSKMTSKRPS
                     GKISKRQASSGGTLSNVTNIPTNSKSSGSRPTLQYVPPLLRRSSSLYKEDLESGERKT
                     IKSQDSEEGFLNTDRFIPLRKENSFSHSKIDPMNLEEEVPPPNASPSTHLKAQTKRVF
                     KQNVAEACGLEMNQRILQYLPKPPAASHRKQTYSMGSRSHYSYSAVQNPGSSQELAKL
                     RKINSNPERILDAPGFQDDFYLNLVSWSNKNVLAIALDSALYLWNGSSGDVSLLVDFE
                     QPGSITSVTWSDDDCHISIGKLEGNTEIWDIETMSHVRTMRSGLGVRIGSQSWLETLI
                     ATGAKSGEIHINDVRIKNHIVSTWEEHRGEVCGISYRPDGLQVASGSNDNTVVIWDTR
                     TSLPQHIKRQHTAAVKALAWSPDINNLLATGGGQTDKHIHFWNTTTGARTGSINTGSQ
                     VSSLHWGQSYNANTIQREIVATGGNPENAVSVYNYDTKFKVAEIVHAHEARICSSQLS
                     PDGTVLATVGGDENLKFYKVFEPRRKRPQGVCDGESLLGLLNVGEACDDDPTRSPNRR
                     KTSEFLIR"
     gene            complement(<542052..>543836)
                     /locus_tag="KLTH0H06182g"
                     /db_xref="GeneID:8294463"
     mRNA            complement(join(<542052..543392,543465..>543836))
                     /locus_tag="KLTH0H06182g"
                     /product="KLTH0H06182p"
                     /transcript_id="XM_002556102.1"
                     /db_xref="GeneID:8294463"
     CDS             complement(join(542052..543392,543465..543836))
                     /locus_tag="KLTH0H06182g"
                     /note="similar to uniprot|P27697 Saccharomyces cerevisiae
                     YGL119W ABC1 Protein required for ubiquinone (coenzyme Q)
                     biosynthesis, which in turn is required for respiratory
                     growth; has similarity to prokaryotic proteins involved in
                     early steps of ubiquinone biosynthesis"
                     /codon_start=1
                     /product="KLTH0H06182p"
                     /protein_id="XP_002556148.1"
                     /db_xref="GeneID:8294463"
                     /db_xref="GOA:C5E2M5"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E2M5"
                     /translation="MSSRKALYHAFCVASSFKELAKGSLSISKESLRSWFETSSLTRP
                     ALSNYQWFYDKEWEKARKLSERVRSDYEKSEHATKHGTRTKASGPKKTVRHYSTRAKQ
                     SSHQLQSRQSEKTDAAVQNTQETSEDTPRKLQSSSIPSSRISRLFHYGSLAAGVGFSA
                     ATDGLSQAVRGQSPNFKSLLLSDANIERIVKKFSKMRGAALKIGQMMSFQDESVLPKE
                     LYIVLSRVQNGANYMPQRQLDRLMTRELGKGWKDKFAHFDLVPMAAASIGQVHDAVLP
                     SGEEVVVKVQYPGVKDSIDSDLNNVLMFLTASRLLPRGLFLDKTVANARTELRWECDY
                     KREAAALQKFEQLLKNEPDLVTPRVYEDLTTDSIITMSKMHGKEIMKLPLTVSQETRN
                     FISETIMRLCLREIAEFQFMQTDPNWANFLYNGSTQKLELLDFGASRNFPEEFIYKYR
                     RMLTAGTQRDREKVAHFSKELGYLTGLESKAMVDAHVDSVMVLAEPFCGDTESYFDFS
                     EQTVTDRIRGNIGLMLKERLCPPPEETYSLHRKFSGVFLLCARMRAQVPMAKLFQEHF
                     ALYE"
     gene            <544108..>546423
                     /locus_tag="KLTH0H06204g"
                     /db_xref="GeneID:8294464"
     mRNA            <544108..>546423
                     /locus_tag="KLTH0H06204g"
                     /product="KLTH0H06204p"
                     /transcript_id="XM_002556103.1"
                     /db_xref="GeneID:8294464"
     CDS             544108..546423
                     /locus_tag="KLTH0H06204g"
                     /note="highly similar to uniprot|P53131 Saccharomyces
                     cerevisiae YGL120C PRP43 RNA helicase in the DEAH-box
                     family involved in release of the lariat-intron from the
                     spliceosome"
                     /codon_start=1
                     /product="KLTH0H06204p"
                     /protein_id="XP_002556149.1"
                     /db_xref="GeneID:8294464"
                     /db_xref="GOA:C5E2M6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2M6"
                     /translation="MTSKRRHSSHSEHKSAVESSIPEHAAEVAEELSKKQRVPSKEPL
                     THHDAGEFHDLVRHKTTAAQAEVLESGAKNPFTGQVFSPRYFDILKVRRDLPVHAQRE
                     EFLKIYQKNQVMVFVGETGSGKTTQIPQFVLFDEMPHLLNTQVACTQPRRVAAMSVAQ
                     RVAEEMDVKLGEEVGYSIRFENKTSDKTILKYMTDGMLLREAMEDHDMKRYSCIILDE
                     AHERTLATDILMGLLKQVVVRRPDLKIIIMSATLDAEKFQKYFLDAPLLAVPGRTFPV
                     ELYYTPEFQRDYLDSAIRTVLQIHATEEPGDILLFLTGEDEIEDAVRKISLEGDQLIR
                     EQNCGPLSVYPLYGSLPPHQQQRIFEPAPEPFNGRPGRKVVVSTNIAETSLTIDGIVY
                     VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCYRLYTEEAFKKE
                     LIEQSYPEILRSNLSSTVLELKKLGVDDLVHFDFMDPPAPETMMRALEELNYLACLDD
                     DGNLTPLGRLASQFPLDPMLAVMLIGSPEFHCAQEILSIVAMLSVPSVFIRPVKDKKR
                     ADDAKAIFAHPDGDHITLLNVYHAFKSDEAYEYGINKWCRDNFLNYRALSAADNIRSQ
                     LERLMVRYNLVLNSTEYEDPRYFDNIRKALAAGFFMQVAKKRSGGKGYITVKDDQDVL
                     IHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIDLAPAYYDLDNFRKGDVKL
                     SLERVKQKVDRINELNEEKSKKKKKSKKDKS"
     gene            <546809..>548341
                     /locus_tag="KLTH0H06226g"
                     /db_xref="GeneID:8294465"
     mRNA            <546809..>548341
                     /locus_tag="KLTH0H06226g"
                     /product="KLTH0H06226p"
                     /transcript_id="XM_002556104.1"
                     /db_xref="GeneID:8294465"
     CDS             546809..548341
                     /locus_tag="KLTH0H06226g"
                     /note="some similarities with uniprot|P32505 Saccharomyces
                     cerevisiae YGL122C NAB2 Nuclear polyadenylated RNA-binding
                     protein related to human hnRNPs has a nuclear localization
                     signal sequence that binds to Kap104p required for both
                     poly(A) tail length control and nuclear export of mRNA"
                     /codon_start=1
                     /product="KLTH0H06226p"
                     /protein_id="XP_002556150.1"
                     /db_xref="GeneID:8294465"
                     /db_xref="GOA:C5E2M7"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR021083"
                     /db_xref="UniProtKB/TrEMBL:C5E2M7"
                     /translation="MSDPKEEIFNNLKVVIAENLKTLPNFNEDVNYVAEYIVLLMSNG
                     GNLESVVQELTSLFDTVPPEAFHNVVQNAYKVLGYLQGGDSLEVAVSKLTGGSNAPAG
                     QEQHNQQAMFSQEQQQQQQSQQQPQHQAHQQQPQQQAAVPSIFQTAPPATAAQPQSAF
                     AGLVEFSPAPSGDISKSGGAQRGGGVGKASTRGGRNERPGRGGKNGVGKRNNYQNNNA
                     LAMALGMDDPNTNVVQKKQGRCKLFPRCPLGRQCPHAHPTQACREYPNCPNPPGTCNY
                     LHPNEDVELMKEIEKTREEFREKRAAVAASRAKPINTGIVLCKFGNLCSNPQCPFGHP
                     TPANEDAKVITFAWCPENLKCENPTCDRAHSSHSKIKEVAPIAARKPSRPPVEKSLEQ
                     CKFGQNCTNKRCKFRHARSHIMCREGANCTRIDCLFGHPINEDCKFGVECRNIYCLYR
                     HPEGRQLPDKSQQAQSNSNNTWVNPNLGTGNSSSNERPFAVPENQVIEAAPAQEQDAM
                     MN"
     gene            complement(<548756..>549532)
                     /locus_tag="KLTH0H06248g"
                     /db_xref="GeneID:8294466"
     mRNA            complement(<548756..>549532)
                     /locus_tag="KLTH0H06248g"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_002556105.1"
                     /db_xref="GeneID:8294466"
     CDS             complement(548756..549532)
                     /locus_tag="KLTH0H06248g"
                     /note="highly similar to uniprot|P25443 Saccharomyces
                     cerevisiae YGL123W RPS2"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_002556151.1"
                     /db_xref="GeneID:8294466"
                     /db_xref="GOA:C5E2M8"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5E2M8"
                     /translation="MSAPAPAPAQGDQRRGGFGGRNKGRQQRRGRRDQEEKGWTPVTK
                     LGRLVKAGKITSVEEIFLHSLPVKEFQIVDTLLPTLKDEVMNIKPVQKQTRAGQRTRF
                     KAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGNNLGQPHSLAT
                     KTSGKCGSVTVRLIPAPRGKGIVASPAVKKLLELAGVEDVYTSSNGSTRTLENTLKAT
                     FVAIGNTYGFLTPNLWAAQPLPVSPLDIYSDEASAEKKRY"
     gene            <550420..>551015
                     /locus_tag="KLTH0H06270g"
                     /db_xref="GeneID:8294467"
     mRNA            join(<550420..550427,550541..>551015)
                     /locus_tag="KLTH0H06270g"
                     /product="KLTH0H06270p"
                     /transcript_id="XM_002556106.1"
                     /db_xref="GeneID:8294467"
     CDS             join(550420..550427,550541..551015)
                     /locus_tag="KLTH0H06270g"
                     /note="some similarities with uniprot|P38325 Saccharomyces
                     cerevisiae YBR230C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H06270p"
                     /protein_id="XP_002556152.1"
                     /db_xref="GeneID:8294467"
                     /db_xref="UniProtKB/TrEMBL:C5E2M9"
                     /translation="MPNGQNEVDSSNIPDAAKRAAQELREEAQDLREEANKEFEELER
                     NGTIDKYKDNAAGILKNVANRASAAASYVATRVKTVSQRVAYELRNPVVIVNAALGVG
                     LVSTLLKGYTKNQRYLKGKSDSVILSTVVGATAAVALDVYLSGKYYQKFDQKSNKKRL
                     "
     gene            <551263..>553176
                     /locus_tag="KLTH0H06292g"
                     /db_xref="GeneID:8294468"
     mRNA            <551263..>553176
                     /locus_tag="KLTH0H06292g"
                     /product="KLTH0H06292p"
                     /transcript_id="XM_002556107.1"
                     /db_xref="GeneID:8294468"
     CDS             551263..553176
                     /locus_tag="KLTH0H06292g"
                     /note="similar to uniprot|P53129 Saccharomyces cerevisiae
                     YGL124C MON1 Protein required for fusion of cvt- vesicles
                     and autophagosomes with the vacuole associates as a
                     complex with Ccz1p with a perivacuolar compartment
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0H06292p"
                     /protein_id="XP_002556153.1"
                     /db_xref="GeneID:8294468"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="UniProtKB/TrEMBL:C5E2N0"
                     /translation="MVGEPHEDYLDAPKSRAKSPVPARLSPFASGVTEPTTSVDFASS
                     FPAPPRPFFEEPRPSSSSVYLDLASERQSVRTTHQDLEHELLQSMRSLDLMPKKHAVS
                     NEIPSIFEGCAPETKPLPLHHDKQFFIMSSAGKPIYTMHGQDELVMGLMGIIHTVINY
                     FKLHDTKVHSIVNSSGSSVKQRFVFLDKSPIILMAMSAREESTNDLLQQLDFLYSYLI
                     STLSRKQLTRLFSKRENFDLRRFLTDSDFQNLNHICDSISRGFNPEFLLGALRCLPLR
                     KSTRQIIDNTMLAQIQDPGTNVGRGTLLYGLIVAPGGQLCSVLRPRGHTLHTTDLHLL
                     FSLVFNQFQGLQDDQELWLPICFPKFNSSGFLHCYIRLLPHHASKPRPADARSTVSHS
                     QEPLDSLSQIRNRTDLSSTRLRPALVLISAQKESFFALKKIGQGIIDELDRQGITNQI
                     SMASDSGFTMADIPAKFVHHFIYKSKRHVQYVMPHLGPLADLSFPIIDDDSRSTFSVE
                     GNQDNRSEENGPGAASSNDKTRQKLYLQKLMSYYTHIRNNAVSDNGKSFNNSTLTFIK
                     WSNDQPSLEGLPSGEPINVLCLAWLTPTFELLLICNNGVSDRNTALKSAKNIVDWCRK
                     NEHRLFVSNGAIF"
     gene            complement(<553271..>554539)
                     /locus_tag="KLTH0H06314g"
                     /db_xref="GeneID:8294469"
     mRNA            complement(<553271..>554539)
                     /locus_tag="KLTH0H06314g"
                     /product="KLTH0H06314p"
                     /transcript_id="XM_002556108.1"
                     /db_xref="GeneID:8294469"
     CDS             complement(553271..554539)
                     /locus_tag="KLTH0H06314g"
                     /note="some similarities with uniprot|P40209 Saccharomyces
                     cerevisiae YMR136W GAT2 Protein containing GATA family
                     zinc finger motifs; similar to Gln3p and Dal80p;
                     expression repressed by leucine"
                     /codon_start=1
                     /product="KLTH0H06314p"
                     /protein_id="XP_002556154.1"
                     /db_xref="GeneID:8294469"
                     /db_xref="GOA:C5E2N1"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C5E2N1"
                     /translation="MHTDALFRSDRFQELRSATDQPTIKVLQKSPKATPSLPGIRQLL
                     HNICAHTIERTTVINDFTNREIKAQMGFLSTNNEEYPSFKLGQLGQLGSPKQSHSGRR
                     HEKLPFHSSPTRFEHPQLVKFYTGDTAPRQLLRVGKIQKPSGDLLRLANLVEASPKMH
                     EVHITGNSIKDEVISSNGEYQLKVAEILTSSRCVFENLQEWPLSVHSQDTSGDDGMYF
                     LTEFINMESLDITISMAKKVHESLQAIKLWKSKHIELKMNRRPENTIATSGKGMIGGI
                     SLPRMDLGQKLSKDEPRKASCRLGTASGHAKGGNAAIFSEAVASHNTGRHNIDTQLST
                     KAIGEPKGRVMRNALQCAHCSSTKTPEWRKGPCGRRSLCNACGLFYKKLVRKFGDGQA
                     SMIMKHRKSISSKNRKVPHVFDVPHSFVQI"
     gene            <555685..>558462
                     /locus_tag="KLTH0H06336g"
                     /db_xref="GeneID:8294470"
     mRNA            <555685..>558462
                     /locus_tag="KLTH0H06336g"
                     /product="KLTH0H06336p"
                     /transcript_id="XM_002556109.1"
                     /db_xref="GeneID:8294470"
     CDS             555685..558462
                     /locus_tag="KLTH0H06336g"
                     /note="similar to uniprot|P38138 Saccharomyces cerevisiae
                     YBR229C ROT2 Glucosidase II catalytic subunit required for
                     normal cell wall synthesis mutations in rot2 suppress tor2
                     mutations and are synthetically lethal with rot1
                     mutations"
                     /codon_start=1
                     /product="KLTH0H06336p"
                     /protein_id="XP_002556155.1"
                     /db_xref="GeneID:8294470"
                     /db_xref="GOA:C5E2N2"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:C5E2N2"
                     /translation="MPRVCRKLQLALILVSIGQVLGFTDYLLKSCSQSGFCQRNRHYA
                     SEIERAQESPYSLDPASIQISNSNHTFQATIQKSIPDLLSFNETLIVELPVFVDVLDG
                     GKVRFRIDERRETNNTYVPEILNPKRYDEASLWAFQKDAKTQPVEVGIEKSLWSRKTS
                     VTFIAPDSQVKIRVFLKQFRIEFYFEENLVLVVNDRLLLNVEHLRTPEENTLQKLPEE
                     LTFNDFEDDFEYSKKDTLPFGPESVALDFTFVGVTDVFGIPEHADSLKLKDTRDGEPY
                     RLFNADVFEYSLGARTPMYGAIPFMIGSTPDFSAGIFWVNAADTWVDINYSESSTGTH
                     WMSEAGTIDVIIFLAKTPQEVTSAYTEITGRPQLPLSSSIGYHQCRWNYNDERDVLTV
                     DSQMDKAGIPYDYIWLDLEYTDDKKFFTWKPDAFPDPRRMLKKLHTLGRNLVTLIDPH
                     LKVDYSASNTVEKSGASVRNSLGASYHGHCWPGESIWIDTIGKNARKVWGKLMSNFLQ
                     DYNNLHIWNDMNEPSVFSGPETTAPKDLIHDGGFEERSIHNLYGLTVHEATYNAMREN
                     YGEKNRRPFILSRSFFAGSQRTAATWTGDNVANWEYLKISIPMCLSNNVAGFPFIGAD
                     IAGFSGNPTTELLARWYQAGMWYPFFRGHAHIDAARREPYLFEEPLKSIVKDAILLRY
                     SLMPTFYTAFYESSTKGSPIMNPVFFVHPELHECYGIDDQFYIGSSGLLVKPVTEQGA
                     TEVQVFFPAGQFYEFDSLKAFSVQEPSYLTIDAPIDKQPISIEGGHILFKKERYRRSS
                     KLMEHDPYTLVIAPDVNGKAEGTLYIDDGETFAFQDGEYMKVAVKLENDVLESTVTHM
                     PTKFPNLSTHVERIIVGGGQYSSGPNRVTLKKDKTEWILETKISKNGHHAIIENPHLD
                     LSKPWSLEVHR"
     gene            complement(<558459..>559403)
                     /locus_tag="KLTH0H06358g"
                     /db_xref="GeneID:8294471"
     mRNA            complement(<558459..>559403)
                     /locus_tag="KLTH0H06358g"
                     /product="KLTH0H06358p"
                     /transcript_id="XM_002556110.1"
                     /db_xref="GeneID:8294471"
     CDS             complement(558459..559403)
                     /locus_tag="KLTH0H06358g"
                     /note="similar to uniprot|P38324 Saccharomyces cerevisiae
                     YBR228W SLX1 Subunit of a complex with Slx4p that
                     hydrolyzes 5' branches from duplex DNA in response to
                     stalled or converging replication forks function overlaps
                     with that of Sgs1p-Top3p"
                     /codon_start=1
                     /product="KLTH0H06358p"
                     /protein_id="XP_002556156.1"
                     /db_xref="GeneID:8294471"
                     /db_xref="GOA:C5E2N3"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR027520"
                     /db_xref="UniProtKB/TrEMBL:C5E2N3"
                     /translation="MKSRSKTKQHAIPDFYCCYLLRSVPKKQSFYIGSTPNPVRRLRQ
                     HNGTLANGSAYRTKKTGFRPWRMIACVYGFTSKIAALQFEHAWQHSNLTHFIDDDQRI
                     VTKKAGGRTIHHKLGNIRLLIKNEFFSYMNLKVHLFCAEAVDAWSQNKFLIDCDIPNV
                     TESLEPPASKEELQKRGANEFASENLVLVEKLYKSVLRADDERVRVYQEALYHGCITC
                     PICHKDFNYMSDEDSPKPLVAFCPTDNCQFLSHLSCLHRIFVDDEQALTGVRKLLPHS
                     GSCPSCDKKIFWTKVVKYSTRLRETSGPQQDSVPSSQC"
     gene            <559500..>561026
                     /locus_tag="KLTH0H06380g"
                     /db_xref="GeneID:8294472"
     mRNA            <559500..>561026
                     /locus_tag="KLTH0H06380g"
                     /product="KLTH0H06380p"
                     /transcript_id="XM_002556111.1"
                     /db_xref="GeneID:8294472"
     CDS             559500..561026
                     /locus_tag="KLTH0H06380g"
                     /note="similar to uniprot|P38323 Saccharomyces cerevisiae
                     YBR227C MCX1"
                     /codon_start=1
                     /product="KLTH0H06380p"
                     /protein_id="XP_002556157.1"
                     /db_xref="GeneID:8294472"
                     /db_xref="GOA:C5E2N4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004487"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2N4"
                     /translation="MIKTGLKSFQSFHRLSSLAGKVQENQLRNLPSPKELRKFLDNYV
                     VGQTTGKKVLSVAVYNHYLRVNDKQKRIDAKLQRELLEKQQQEDDKDEPIYTGSNEAK
                     VGFQNLQTQLARGMDPKDDDLELSKSNVLVVGPSGSGKTLLASTLARVLDVPIAITDC
                     TQLTQAGYIGEDVEVCIERLLINADYDVAKAERGIIVLDELDKLAKPAASIGTKDVSG
                     EGVQQALLKILEGHSIEVTVKRPINKKKDGQNNNQVSAKKDETFVVDTSNILFMLMGA
                     FVGLDKHVVKRINRLKAISNGETIEDKSEDSKRLRFSNTIEKVELSNGKKVSALNLAT
                     PTDLVAYGLIPELIGRVPIITALEPLERTDLYHILREPKNALLNQYEYIFKQFGVKLC
                     VTEKALMKVAHFALDEGTGARGLRGIMERLLLNVNYECPGSGISYVLVNEDTVKSLQL
                     SEHSLSTHVNAKYYSRGERDKFIEDVHKEDSKQGRELDRLYGRTATLVREGNVDQCPE
                     "
     gene            complement(<561071..>563329)
                     /locus_tag="KLTH0H06402g"
                     /db_xref="GeneID:8294473"
     mRNA            complement(<561071..>563329)
                     /locus_tag="KLTH0H06402g"
                     /product="KLTH0H06402p"
                     /transcript_id="XM_002556112.1"
                     /db_xref="GeneID:8294473"
     CDS             complement(561071..563329)
                     /locus_tag="KLTH0H06402g"
                     /note="weakly similar to uniprot|P38321 Saccharomyces
                     cerevisiae YBR225W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H06402p"
                     /protein_id="XP_002556158.1"
                     /db_xref="GeneID:8294473"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E2N5"
                     /translation="MEGKKKQHSKGELECTDGSRRNSGFVPGVGKALGVSDSSKNTKS
                     PSWTSSISTITEELPAPKVSEAMTRVPSAASAVSYPYCSSVPEEPGAKPCPTRARWWN
                     TLPKIGETVHSHKHSLNAVVLNVNGTPREIIYDPRYNPLFSKLEIFYMFNAQTPLSDC
                     YTYAKTRLASFVKFLEVYHSSRQYASACLPFNVSVAANATAGGYPSYTAGVDYHEIGE
                     IVQLWYLQSLEFMIDNNSFLFSNEIVDYLVNYEPQKNASIKRELSCSGPPPSALQETI
                     IRADILLIRCTFEEELGWQLALDEPNWNIVDLFVDLSFLGRLTTEDEGEDSSGNATST
                     TADVDGDTTLSPPSSASSSPATSATTSSSDVSYGKVSESVMREPVRSGNDIFVDPQTD
                     VPETSSARACHVIVQDCVGRDLDKLAAEMRAKGINETCRPSISQNSSQESFSSQKQGQ
                     SGKKDQSTKSAKSSTGLGISNFFRRKNSHASGDKGDNPLSSKRAPQSDSVKMNLTIQN
                     SYLDDYYASTLANFRKLVLPSHCMFTRREAPKPFKRENGASKKQEANSYQKEFLQIKI
                     PLKDESFPVIICPDVWFSLEFKKWKGLINELFRCIRPGGFLETSACNLTNVNDGYDIE
                     KSSKEFPTLLEMKALNDVISMEAVKAGLQVFPMRHLVGALKAAGFVNIKHSVFSLKRG
                     DLRHNMGFLFEFLAIRNYDYQLRNDLLSSEVKPPGTNPASFPLRYVEEHMGKADEDAG
                     VVRLVLITAQKP"
     repeat_region   complement(565752..566169)
                     /rpt_type=long_terminal_repeat
     gene            complement(<567521..>569320)
                     /locus_tag="KLTH0H06446g"
                     /db_xref="GeneID:8294475"
     mRNA            complement(<567521..>569320)
                     /locus_tag="KLTH0H06446g"
                     /product="KLTH0H06446p"
                     /transcript_id="XM_002556113.1"
                     /db_xref="GeneID:8294475"
     CDS             complement(567521..569320)
                     /locus_tag="KLTH0H06446g"
                     /note="highly similar to uniprot|P53128 Saccharomyces
                     cerevisiae YGL125W MET13 Isozyme of
                     methylenetetrahydrofolate reductase catalyzes the
                     reduction of 5 10-methylenetetrahydrofolate to
                     5-methyltetrahydrofolate in the methionine biosynthesis
                     pathway"
                     /codon_start=1
                     /product="KLTH0H06446p"
                     /protein_id="XP_002556159.1"
                     /db_xref="GeneID:8294475"
                     /db_xref="GOA:C5E2N6"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:C5E2N6"
                     /translation="MRVSEKLQKNREANGTSKATFSFEFFVPKTSQGVQNLYDRMDRM
                     YQTHPQFIDITWNAGGRLSQLSTELVSTSQSVLGLETCMHLTCTNMPRQLIDDALQKA
                     YESGCQNILALRGDAPITSSEWKPCEGGFTYAKDLVRYIREKYGDHFDIGVAGYPEGH
                     PEEEASPKLVQYLKEKVDAGADFIITQMFYDADNFIEWCRQVRAAGIEVPIIPGIMPI
                     TTYAAFLRRSSWCQINVPEAFMAKLDPVKDDDQAVREVGTELVAQMCQKLLDSGYVTH
                     LHMYTMNLEKACIMVLDRLGLLSEDEDIFRDEVVPMPWRKSLHPQRRNESVRPIFWQK
                     RPYSYVARTSQWTADEFPNGRFGDSSSPAFGDLDLLGSTSIRQSPQRALELWSTPTKF
                     SDIAALVIDYLHGKLKCLPWCDVALNHEVDTTMPQLLDLNKHMILTLNSQPRVNGASS
                     ADKIVGWGPNNGYVYQKQYLEFLLPKSKLSQLRDFVNDMPSLTYFAVDSADELHSNHP
                     DDTAANAVTWGIFPGREVLQPTIVEKVSFLAWKEEFFDILDEWKRIMGENNHSESVAL
                     LESVISDYLLVNIVDNDYVSDGDRIYDMLQRLY"
     gene            <570533..>572245
                     /locus_tag="KLTH0H06468g"
                     /db_xref="GeneID:8294476"
     mRNA            <570533..>572245
                     /locus_tag="KLTH0H06468g"
                     /product="KLTH0H06468p"
                     /transcript_id="XM_002556114.1"
                     /db_xref="GeneID:8294476"
     CDS             570533..572245
                     /locus_tag="KLTH0H06468g"
                     /note="similar to uniprot|P38319 Saccharomyces cerevisiae
                     YBR223C TDP1 Tyrosine-DNA Phosphodiesterase"
                     /codon_start=1
                     /product="KLTH0H06468p"
                     /protein_id="XP_002556160.1"
                     /db_xref="GeneID:8294476"
                     /db_xref="GOA:C5E2N7"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:C5E2N7"
                     /translation="MSGTEAESAARKRVRERWCQVEYNTKREEQADEVVPKRAKIGGT
                     PEVIDLTSDQEDTTSWEASETDIPVLGEAPTNGESSSGATREHGRVNYPFKLVRSEFY
                     DEGHVSEHFITLQEIFSESKLTRAWLFSFQYELDFILPMFNESTQITIIAQKGTILPP
                     TRISSKTSKILSKMKTIELQMPPFACHHSKMIVNEYRDGSCCIYIPSNNFTHAETNLP
                     QQIVWCSPRLRRCSEAVKESEFRKSLVKYLNAYPVSLKPLIEFLGTLDFTSLDQLGVE
                     FIFSCPKPFESILSGIPLLHKALSSRQHAAGGNTGRERHRYLSQVSTIGAPLKTGLEY
                     PGNLFSHLMIPLLSGLLVGPRDRKRAYEIPNLHKVFEDYNIEPYIVYPTPEEIRQSPM
                     GYLTGGWFHFHWLRNQATKTVYNTLKKWGVLHKQQPQDCPRRGRTPSHTKFYMKSTTL
                     LDNQAPFSEVDWFLFTTANLSLNAWGTTTRKPQNYEVGVLFKSQDRRRITVKSVSDLV
                     YSKFRSTGQILGSSKVHSNANICVMVPFDINPVPYQPGDDAFCVSRSYEAPDIHGKLH
                     QAQN"
     gene            <572398..>574017
                     /locus_tag="KLTH0H06490g"
                     /db_xref="GeneID:8294477"
     mRNA            <572398..>574017
                     /locus_tag="KLTH0H06490g"
                     /product="KLTH0H06490p"
                     /transcript_id="XM_002556115.1"
                     /db_xref="GeneID:8294477"
     CDS             572398..574017
                     /locus_tag="KLTH0H06490g"
                     /note="highly similar to uniprot|P38137 Saccharomyces
                     cerevisiae YBR222C PCS60"
                     /codon_start=1
                     /product="KLTH0H06490p"
                     /protein_id="XP_002556161.1"
                     /db_xref="GeneID:8294477"
                     /db_xref="GOA:C5E2N8"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:C5E2N8"
                     /translation="MTQDTRGVASFNESFKVTDNVALVVPETGTQVTYRDLSHMTGHF
                     QTLFQSPDSPLYKLIGRQSAIAISMANGLEFVTAFLGITTDSKIAAPLNPNYKAEELN
                     FYLNDLKTKVICVPQGTVQAGSNAEILKSASKFGCFIVELYFDKERFRVEYDVYSPQE
                     SYKRKVYSSINHAVFHNHSDKFPGFARSSDVALILHTSGTTSAPKTVPLLHLNIARSM
                     RNIAATYKLSPADRSYVVMPLFHVHGLIGVLLSTFWAQGSVVVPPRFSVKKFWNDFIT
                     WNCNWFSCVPTISMIMLNSPKPNPLPHIRFIRSCSSALAPSTFAKLESEFQAPVLEAY
                     AMTEASHQMTSNNLPPGKRKPGTVGQPQGVEVFILDDKDNVLPQGQQGEVSIRGENVT
                     LGYAHNEKANRENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELD
                     GVMLSHPKVDEAVAFGVSDEKYGQIVNAAVVLKLGQKLDYKELTDYMRSKVASFKVPT
                     KIFFVDKLPKTATGKIQRRIIAEVFAGKSKL"
     gene            <574323..>575420
                     /locus_tag="KLTH0H06512g"
                     /db_xref="GeneID:8294478"
     mRNA            <574323..>575420
                     /locus_tag="KLTH0H06512g"
                     /product="KLTH0H06512p"
                     /transcript_id="XM_002556116.1"
                     /db_xref="GeneID:8294478"
     CDS             574323..575420
                     /locus_tag="KLTH0H06512g"
                     /note="highly similar to uniprot|P32473 Saccharomyces
                     cerevisiae YBR221C PDB1 E1 beta subunit of the pyruvate
                     dehydrogenase (PDH) complex which is an
                     evolutionarily-conserved multi-protein complex found in
                     mitochondria"
                     /codon_start=1
                     /product="KLTH0H06512p"
                     /protein_id="XP_002556162.1"
                     /db_xref="GeneID:8294478"
                     /db_xref="GOA:C5E2N9"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5E2N9"
                     /translation="MAFRLSTGVFGGVRQAFLSGRAGAAAPLARRMASTKTMTVRDAL
                     NSAMAEEMDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEMGFTGLSV
                     GAALKGLKPIVEFMSFNFSMQAIDQVVNSAAKTYYMSGGTQKCQIVFRGPNGAAVGVG
                     AQHSQDFSAWYGSIPGMKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGESFEVS
                     EEALSTDFTLPYTAKVEREGTDISIITYTRNVQFSLQAAEILDKQYGVSAEVINLRAI
                     RPMDVNAIIKTVKKTNHLITVESTFPNFGVGSEIVAQIMESEAFDYLDAPVKRVTGAD
                     VPTPYAKELEDFAFPDPDVIVNAVKSVLSIE"
     gene            <576000..>577634
                     /locus_tag="KLTH0H06534g"
                     /db_xref="GeneID:8294479"
     mRNA            <576000..>577634
                     /locus_tag="KLTH0H06534g"
                     /product="KLTH0H06534p"
                     /transcript_id="XM_002556117.1"
                     /db_xref="GeneID:8294479"
     CDS             576000..577634
                     /locus_tag="KLTH0H06534g"
                     /note="similar to uniprot|P38318 Saccharomyces cerevisiae
                     YBR220C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H06534p"
                     /protein_id="XP_002556163.1"
                     /db_xref="GeneID:8294479"
                     /db_xref="GOA:C5E2P0"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024371"
                     /db_xref="UniProtKB/TrEMBL:C5E2P0"
                     /translation="MSGVPHQLARHDYKAFFLLVVLYFLQGIPVGLAFGTVPFLLKSG
                     ARETTFTQLGVFALATYPYSLKIIWSPIVDSIYSKKTGRRRSWIIPVQLASGIILWAI
                     GFCVSNNLVFAGIDDSYSTGNAPVKQGVRPTDITTLTICFLLLVFLCATQDIAVDGWA
                     LEILSKQSLSYASTAQTVGLNTGYFLSFTIFLTFNSSDFMNRYIRSEPLEYGLISFGG
                     YLKFAGTVYLAVTFYIMFFTNERPSNCSVLPSTAKKSDEKQVIDYNVETGASSISLKN
                     VYLLFFKVLKLPSVRSLMLIHLVSKFAFQCNEGATNLKLLERGFKREDLAVTVLVDFP
                     FEIIFGYYVAKWSSSATFGPRKFERSNFFARMLVGEAGILTPWLWGFLGRLLSAFLAG
                     ILVAKFPSDGIVTRSYFLMVIFQHLLGSFMTTVQFVAICAFHTRIADSAIGGTYMTLL
                     NTFSNLGGTWPRLLVMTMIDRLTKHECVGTGAQPLDATDEGLCKAAGGTWMIVRDGYF
                     VSNFCCITVGIVLYFTFIRKRAQRLQLLPESAWHCS"
     gene            complement(<577648..>578739)
                     /locus_tag="KLTH0H06556g"
                     /db_xref="GeneID:8294480"
     mRNA            complement(<577648..>578739)
                     /locus_tag="KLTH0H06556g"
                     /product="KLTH0H06556p"
                     /transcript_id="XM_002556118.1"
                     /db_xref="GeneID:8294480"
     CDS             complement(577648..578739)
                     /locus_tag="KLTH0H06556g"
                     /note="weakly similar to uniprot|P53012 Saccharomyces
                     cerevisiae YGL126W SCS3 Protein required for inositol
                     prototrophy"
                     /codon_start=1
                     /product="KLTH0H06556p"
                     /protein_id="XP_002556164.1"
                     /db_xref="GeneID:8294480"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:C5E2P1"
                     /translation="MELSLYKIFLFSLCPLTLLVGQLVSFRVHLEVDKDGWLNTYFVK
                     QGWFWTSLVGWWCMIRYGGFGPRGTWKRTLLRYAILTVWWFVFTQSLWSEAAPLMDLV
                     FTATGGRCSFEVFDLSDSPTWGINEKFHDTFSRRQSSLQKLYNALKKGAQNPPSLLQN
                     AVSEIEYWISEGKGHLRGEDVTPSQLNSLIDSALHSWKKINSSNLCRSMGGYWIGGHD
                     PSGHIFLITLMCMFLLGELQAIGKRALRVLKTHNKYWQQLREHGTSVLTLGGLWNLVA
                     HPPATKKQLFKQLGLIPLDISQHLTQLFGATAKFIVWENPVVLLVLFTFLWWWSLLIT
                     TIAFHTLWEQLSGLLCAYIVAGFVYWKLV"
     gene            <579003..>579392
                     /locus_tag="KLTH0H06578g"
                     /db_xref="GeneID:8294481"
     mRNA            <579003..>579392
                     /locus_tag="KLTH0H06578g"
                     /product="KLTH0H06578p"
                     /transcript_id="XM_002556119.1"
                     /db_xref="GeneID:8294481"
     CDS             579003..579392
                     /locus_tag="KLTH0H06578g"
                     /note="similar to uniprot|P38633 Saccharomyces cerevisiae
                     YGL127C SOH1 Subunit of the RNA polymerase II mediator
                     complex"
                     /codon_start=1
                     /product="KLTH0H06578p"
                     /protein_id="XP_002556165.1"
                     /db_xref="GeneID:8294481"
                     /db_xref="GOA:C5E2P2"
                     /db_xref="InterPro:IPR008831"
                     /db_xref="UniProtKB/TrEMBL:C5E2P2"
                     /translation="MEDGGIPENNGVEQPVPEDIPPTRFEVELEFVQCLANVPYVIFL
                     LSQQHIWRDPKFRAYLKYLEYWCKPPYAQCIVYPNCLFMLKLLNGFMEAAEVNEDGLL
                     EGLEDLPKVLQSQGAQWMNEMVERWSS"
     gene            <580087..>583611
                     /locus_tag="KLTH0H06600g"
                     /db_xref="GeneID:8294482"
     mRNA            <580087..>583611
                     /locus_tag="KLTH0H06600g"
                     /product="KLTH0H06600p"
                     /transcript_id="XM_002556120.1"
                     /db_xref="GeneID:8294482"
     CDS             580087..583611
                     /locus_tag="KLTH0H06600g"
                     /note="highly similar to uniprot|P11154 Saccharomyces
                     cerevisiae YGL062W PYC1 and to YBR218C uniprot|P32327
                     Saccharomyces cerevisiae YBR218C PYC2 converts pyruvate to
                     oxaloacetate pyruvate carboxylase"
                     /codon_start=1
                     /product="KLTH0H06600p"
                     /protein_id="XP_002556166.1"
                     /db_xref="GeneID:8294482"
                     /db_xref="GOA:C5E2P3"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:C5E2P3"
                     /translation="MSKLAGLRDSSNLLGEKNKLLVANRGEIPIRIFRSAHELSMKTV
                     AIYSHEDRLSMHRLKADEAYMIGKEGKYTPVGAYLAIDEILKIAKEHNVDFIHPGYGF
                     LSENSEFAQKVEAAGITWIGPSAEVIESVGDKVSARNLAAKADVPVVPGTPGPIDSVE
                     EAQAFVEEYGYPVIIKAAYGGGGRGMRVVREGDDIADAFQRATSEAKTAFGNGTCFIE
                     RFLNKPKHIEVQLLADGYGNVVHLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTD
                     AVKLAKVAGYKNAGTAEFLVDDQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIA
                     AGASLQELGLLQDKIITRGFAIQCRITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGG
                     NAYAGSIISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTN
                     PVFIDGSYWTTFIDDTPELFKMVSSQNRAQKLLHYLADLAVNGSSIKGQMGLPKLHTQ
                     PSVPTLHDSNGEVIDVLTTPPPSGWRQVLLEQGPAQFAKAVRHYKGTLLMDTTWRDAH
                     QSLLATRVRTYDLAAIAPTTAHALSGAFALECWGGATFDVAMRFLHEDPWERLRILRK
                     LVPNIPFQMLLRGANGVAYSSLPDNAIDHFVEQAKENGVDIFRVFDALNDLEQLKVGV
                     DAVKKANGVVEATICYSGDMLQPGKKYNLDYYLEITDKIVQMGTHILGIKDMAGTLKP
                     SAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFAGADVVDVATNSMSGMTSQ
                     PSINALLASLDGEIDTGVNVNMVRELDAYWAQMRLLYSCFEADLKGPDPEVYEHEIPG
                     GQLTNLLFQAQQLGLGEKWAETKRAYRDANYLLGDLVKVTPTSKVVGDLAQFMVSNKL
                     TPDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKRRKLTCRPGLELA
                     PFDLAGIKEDLQDRFGDIDECDVASYNMYPKVYEDFRKMRETYGDLSVLPTKNFLSPP
                     TVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVSVIDKSQKVDTL
                     SKPKADAHDPFQIGAPMAGVIIEVKVHKGSLVKKGQPIAVLSAMKMEMVISSPTDGQV
                     KDVLVKDGENVDASDLLVFLEESVPPKE"
     gene            complement(<583819..>584490)
                     /locus_tag="KLTH0H06622g"
                     /db_xref="GeneID:8294483"
     mRNA            complement(<583819..>584490)
                     /locus_tag="KLTH0H06622g"
                     /product="KLTH0H06622p"
                     /transcript_id="XM_002556121.1"
                     /db_xref="GeneID:8294483"
     CDS             complement(583819..584490)
                     /locus_tag="KLTH0H06622g"
                     /note="similar to uniprot|P53168 Saccharomyces cerevisiae
                     YGL061C DUO1 Essential mitotic spindle protein required to
                     maintain spindle integrity and kinetochore function part
                     of the multisubunit DASH complex which binds microtubules
                     and is transferred to the kinetochore prior to mitosis"
                     /codon_start=1
                     /product="KLTH0H06622p"
                     /protein_id="XP_002556167.1"
                     /db_xref="GeneID:8294483"
                     /db_xref="GOA:C5E2P4"
                     /db_xref="InterPro:IPR013960"
                     /db_xref="UniProtKB/TrEMBL:C5E2P4"
                     /translation="MSEHAEEDSNINKLIPEIFDQMRSNLSLAPLAGGIKPFVSSKSS
                     SNLTTQSLLEENKCLDKIIPVIQKLNSSLSSSGPQHLKRIKETCESSNKILDAWIKIQ
                     SQAGYVHELMSDHSYLEYVSATQENEALTAEAFVQRKEAQVASLKRTLEEKQQLRESV
                     KKEQEVRSSSDVPSLPRGRRAINPRREVRGGMKKPTGIPRSSTRVSKPPLSRPPHSSV
                     KKPSR"
     gene            complement(<584893..>585477)
                     /locus_tag="KLTH0H06644g"
                     /db_xref="GeneID:8294484"
     mRNA            complement(<584893..>585477)
                     /locus_tag="KLTH0H06644g"
                     /product="KLTH0H06644p"
                     /transcript_id="XM_002556122.1"
                     /db_xref="GeneID:8294484"
     CDS             complement(584893..585477)
                     /locus_tag="KLTH0H06644g"
                     /note="similar to uniprot|P38316 Saccharomyces cerevisiae
                     YBR217W ATG12 Protein that becomes conjugated to Atg5p by
                     the E1 enzyme Atg7p a step that is essential for
                     autophagy"
                     /codon_start=1
                     /product="KLTH0H06644p"
                     /protein_id="XP_002556168.1"
                     /db_xref="GeneID:8294484"
                     /db_xref="GOA:C5E2P5"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5E2P5"
                     /translation="MSQLLESESDAASTSSTGESSRFGKASYSVQDGLEQYSKRLSFL
                     GLGSSDDVPALEDNSSGADASSGNIKAEPAPKRSAPVSTSAVLTHLTPAGDQAIKRFT
                     EKEGILPEKVQIKFQPIGSVSQVLPQSARISASQPFSVLVTFLRKKLKMNSVYCYVNN
                     SFSPAPQQSVGDLWRHFRVNDELVVSYCGGVAFG"
     gene            <586283..>588313
                     /locus_tag="KLTH0H06666g"
                     /db_xref="GeneID:8294485"
     mRNA            <586283..>588313
                     /locus_tag="KLTH0H06666g"
                     /product="KLTH0H06666p"
                     /transcript_id="XM_002556123.1"
                     /db_xref="GeneID:8294485"
     CDS             586283..588313
                     /locus_tag="KLTH0H06666g"
                     /note="similar to uniprot|P38315 Saccharomyces cerevisiae
                     YBR216C YBP1 and to uniprot|P53169 Saccharomyces
                     cerevisiae YGL060W YBP2"
                     /codon_start=1
                     /product="KLTH0H06666p"
                     /protein_id="XP_002556169.1"
                     /db_xref="GeneID:8294485"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:C5E2P6"
                     /translation="MEETPLFQEKLEQAFEDCKDDSISLATIMDLYAMQVSKEGAYEE
                     QAKFLEAVLTNIQKDKHLIDQIGWDLPKILMRFITIQNIDLRVPLLQNRIIATTLKCF
                     NEIALFGNSKECFLTGCELLGSLKMNPDEQTEEEEVGEKSDVEKTGDEASAPEISLKK
                     QEAQIAPEVLAENIHNHNRSPEEVSLEVKFHALLELVGTTLRRIDTCYPSKFLAMAVS
                     AIFNFVRLNASFVDDCVFVLRRIYAFARNYMPPQPSSEALKGMSTEELVKNLDDENAL
                     QRKLLRCLLTFSLGQMTRLKIMSSAIEYFLKLKGDFSNNLDYEQRIFMKNVISRFYQL
                     ALSFDIDLKESFLDLCVKESKAIYKSLPSDSEIVNEAARNGITQLVYRLAYSYELQKK
                     INEKNLSLDPSGILVLASYHYQETGKVLCPELKIDGAIYMFLRFITPEMCGLSPKSLY
                     IADCCNFWLWSAVTNSSCKESRMTLQKMPSYLNMTFLQILLLRSFREPQEQLRMVSFT
                     LLTRLLCLMPENTSFEFAKDTLLSCPFNDLKCCILGILKDLMLNNSSGDDITAKLSKL
                     KVSNAPEDKSVPPLPARSFVQINDDRMATIHSLAMMSFEDSKETTDKSCLRLLLTYLN
                     FFTGLRFKWDRYLLKDFSKQVSEFLGSVKLEDQPEYGFIEIANQNLASFLSQ"
     gene            complement(<588350..>589987)
                     /locus_tag="KLTH0H06688g"
                     /db_xref="GeneID:8294486"
     mRNA            complement(<588350..>589987)
                     /locus_tag="KLTH0H06688g"
                     /product="KLTH0H06688p"
                     /transcript_id="XM_002556124.1"
                     /db_xref="GeneID:8294486"
     CDS             complement(588350..589987)
                     /locus_tag="KLTH0H06688g"
                     /note="some similarities with uniprot|Q01448 Saccharomyces
                     cerevisiae YBR215W HPC2 Highly charged basic protein
                     required for normal cell-cycle regulation of histone gene
                     transcription mutants display strong synthetic defects
                     with subunits of FACT a complex that allows RNA Pol II to
                     elongate through nucleosomes"
                     /codon_start=1
                     /product="KLTH0H06688p"
                     /protein_id="XP_002556170.1"
                     /db_xref="GeneID:8294486"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:C5E2P7"
                     /translation="MELAKNRTSVRNHSPSPHGGSSIPLLSLLSGDSAIVKSDPETCQ
                     AALLNSARVRVSSLLSSDNSIEQERITAPKIILPTQKVATNTTTEPDTPGFLFARTSS
                     PVTGLLKLSNSSLNRSQSTLGPSTPPKPAPVAVKTTSLPVANSKSTTKKPASKRNTES
                     TKKAKTDADNKKNTPSSDAKLQKAAPARRSNKAKESKTKANEKEAKPNNIIIEDMQKL
                     NTTPEASKDNKSPEQENTAKAGSTQKEEKPLEPKKETKPNESKKDVKSAGPKKALKSN
                     EPKKEPKVSEVKKEVDAKGPPKDTKSKDSKSNAKDETKKEAKPSKRSSTATKKKDPTP
                     QPQKKSNDAKASQNTPKVLLPPPPLKSPSVLDPLDKGKNPDNQEEPVILIDVPLYSVE
                     SNSYMDENGQVVFNFCKLVHDEFGQSSKAKRNLASELQGGEEEDEDAIEVEDDDGVEE
                     DDDDEMDLDDKAPPSAASVASPKKKSHPMKGRSLIGKYDIEDPFIDDSELLWEEQRVA
                     TKDGFFVYFGPLIEKGQYASFERVNGTMKRGGIKYSK"
     gene            <590346..>591830
                     /locus_tag="KLTH0H06710g"
                     /db_xref="GeneID:8294487"
     mRNA            <590346..>591830
                     /locus_tag="KLTH0H06710g"
                     /product="KLTH0H06710p"
                     /transcript_id="XM_002556125.1"
                     /db_xref="GeneID:8294487"
     CDS             590346..591830
                     /locus_tag="KLTH0H06710g"
                     /note="similar to uniprot|P53170 Saccharomyces cerevisiae
                     YGL059W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H06710p"
                     /protein_id="XP_002556171.1"
                     /db_xref="GeneID:8294487"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:C5E2P8"
                     /translation="MYKVKSKSTSGLKVKLAHRWKSQSQTQSSHISQIPEFSKYSPTK
                     SISELAPYVSPTLCAYPLRSKYVNQQHYYQNQNILEKHYLTKKPHPVSLMQLAQYFDD
                     STALTKQKIVNSGNFVKQELVTRIAHKIHMLQMLPFDVVNNFHFCQVYESYYNIFERF
                     RRYPAIKTIEDNEKFAEFLHTILSDFNSLNLPHLIMGALECRILDLYPPEKMDEVISS
                     LLRARISRRLIVEEHLSITSNYHSGKKENTLVLGDIFQECSAKEFLLGAKSMCERFIQ
                     DMYFKGIKLPAFNIDGNTELKFLFLPLHLKYLLGEVLRNSYEATMLEYIRLGLQEPEP
                     ITVTIVSNESSFIFRISDRAGGIPHDEKTIWSFGKSKELARQSLSNFHKLPGLQTISL
                     YDSVNGKGLTRSVDHPYKYTSLEPINASNLPSGLHKFEKPLLGLLERSSRYKLGIGLA
                     MCKVYAEYWNGTLTVHSIPGYGTDTILKLGNLMYHTGKLQLDKV"
     gene            <592074..>592641
                     /locus_tag="KLTH0H06732g"
                     /db_xref="GeneID:8294488"
     mRNA            join(<592074..592115,592201..>592641)
                     /locus_tag="KLTH0H06732g"
                     /product="KLTH0H06732p"
                     /transcript_id="XM_002556126.1"
                     /db_xref="GeneID:8294488"
     CDS             join(592074..592115,592201..592641)
                     /locus_tag="KLTH0H06732g"
                     /note="highly similar to uniprot|P06104 Saccharomyces
                     cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme (E2)
                     involved in postreplication repair (with Rad18p)
                     sporulation telomere silencing and ubiquitin-mediated
                     N-end rule protein degradation (with Ubr1p)"
                     /codon_start=1
                     /product="KLTH0H06732p"
                     /protein_id="XP_002556172.1"
                     /db_xref="GeneID:8294488"
                     /db_xref="GOA:C5E2P9"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5E2P9"
                     /translation="MSTPARRRLMRDFKDAPPGVSASPLPDNVMVWNAMIIGPAETPY
                     EDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASIL
                     TSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSWEDDLEDMDDEDEDDE
                     "
     gene            complement(<592757..>593665)
                     /locus_tag="KLTH0H06754g"
                     /db_xref="GeneID:8294489"
     mRNA            complement(<592757..>593665)
                     /locus_tag="KLTH0H06754g"
                     /product="KLTH0H06754p"
                     /transcript_id="XM_002556127.1"
                     /db_xref="GeneID:8294489"
     CDS             complement(592757..593665)
                     /locus_tag="KLTH0H06754g"
                     /note="some similarities with uniprot|P53171 Saccharomyces
                     cerevisiae YGL057C Hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H06754p"
                     /protein_id="XP_002556173.1"
                     /db_xref="GeneID:8294489"
                     /db_xref="GOA:C5E2Q0"
                     /translation="MLSQYLRKHHLLSRRHQFMRCASQSRSPPRSLLQRQAKRRGEAE
                     AVAPSQLIVTSLKDIFSTFQPSGFTQEDDELEAVKQREDAMQRLENGELRELLLHKFG
                     ARRIPSTTETGNSVGDLRIPPRNINQAFHNLTTQERELIEVFQSLGTPSMNWRDVPLV
                     SKQLQFYISFGSYGPREGITFLGSKPEDFIWSKTSRRLLPGQTVRKLPKDATTNTWTC
                     IPSRKANFERMKKGLDPGTRIIAWLGILIVMIASVRDYKQRRDSEATVKVSEFTEQET
                     SEPQAAQQDTAPISKTPKSWYQFWKS"
     gene            complement(<594214..>595629)
                     /locus_tag="KLTH0H06776g"
                     /db_xref="GeneID:8294490"
     mRNA            complement(<594214..>595629)
                     /locus_tag="KLTH0H06776g"
                     /product="KLTH0H06776p"
                     /transcript_id="XM_002556128.1"
                     /db_xref="GeneID:8294490"
     CDS             complement(594214..595629)
                     /locus_tag="KLTH0H06776g"
                     /note="similar to uniprot|P53172 Saccharomyces cerevisiae
                     YGL056C SDS23 Spindle pole body protein and similar to
                     YBR214W uniprot|P38314 Saccharomyces cerevisiae YBR214W
                     SDS24 Nuclear protein with similarity to S. pombe Sds23,
                     suppresses dis2 mutations"
                     /codon_start=1
                     /product="KLTH0H06776p"
                     /protein_id="XP_002556174.1"
                     /db_xref="GeneID:8294490"
                     /db_xref="GOA:C5E2Q1"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR016711"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q1"
                     /translation="MKDISSQPPSNSNNSRHASIVEMLSTPPAIPQQPPSNVELEAIS
                     LSRTGSSASLDSQMSATTSCLTKVHTQKWQHIPLSQLIEQNKLIFVDAAISVEEAFNT
                     LVRHNLTSVPVEQFPGDMNCFTFDYNDLNSYLLLVLNKIQVNDPQVARDCQMGKPVPV
                     GKIVKLTPKNQFHKLREVDNLTTAMSLLGSGVHRVAITDPASTQIRGVLSQRRLTKYL
                     WDNARQFSNLQPLLNSSLKELGIGVLNSHTAPTSRQSRVISIQGEEQLIMALFKMHTE
                     RISSIAVVDHQGNLLGNISVTDVKHVTRTSQYPLLHNTCRHFISVILNSRGLEMGKDS
                     FPIFHVYPSSSLARTLAKLVATKAHRLWIVQPENSGSSASSSSLAAPSPQSIPISTQA
                     SSSSDHENSGRSGSPISVKSLEESSPTTSTPLFEKEYRTGKLIGVVSLTDILGLLARR
                     QTEHTQVDPQAARRQRGSVGV"
     gene            <596966..>598432
                     /locus_tag="KLTH0H06798g"
                     /db_xref="GeneID:8294491"
     mRNA            <596966..>598432
                     /locus_tag="KLTH0H06798g"
                     /product="KLTH0H06798p"
                     /transcript_id="XM_002556129.1"
                     /db_xref="GeneID:8294491"
     CDS             596966..598432
                     /locus_tag="KLTH0H06798g"
                     /note="uniprot|P79047 Delta 9-fatty acid desaturase"
                     /codon_start=1
                     /product="KLTH0H06798p"
                     /protein_id="XP_002556175.1"
                     /db_xref="GeneID:8294491"
                     /db_xref="GOA:C5E2Q2"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q2"
                     /translation="MADTKADKMEQVDLVKANILAAGANKESVRVVNGLGSLMGSKNM
                     VNVDFDKDSNMDYLLRKDQEEKDRYKNSKHISEQPWTIHNWHQHLNWLNMVLVVGIPL
                     AGWYFALSGKVPLHMNVLLFSIAYYVLGGVSITAGYHRLWSHRAYSARWPLRLFFAIF
                     GAASVEGSIKWWGHSHRIHHRYTDTVRDPYDARRGLWYSHMGWMLLQPNPKYRARADI
                     ADLTDDWIVRFQHRHYIPIMAFSAFILPALLCKYLFNDFIGGLVYGGVLRVFAIQQAT
                     FCINSLAHYLGDQPFDDRRTPRDNWITALVTFGEGYHNFHHEFPTDYRNAIKWYQYDP
                     TKVFIFLSSLVGLSFNLKKFSQNAIQQGLVQQQQKKIDRQRSHLNWGTPLTQLPVWDK
                     QQFMENIKTNPGLVIISGIVHDVSNYITEHPGGETLIQAALGKDATKAFNGGVYLHSN
                     AAHNVLATMRVAVVKEGVDAAAKFAARRGESLEGKKLI"
     gene            complement(<598604..>599494)
                     /locus_tag="KLTH0H06820g"
                     /db_xref="GeneID:8294492"
     mRNA            complement(<598604..>599494)
                     /locus_tag="KLTH0H06820g"
                     /product="KLTH0H06820p"
                     /transcript_id="XM_002556130.1"
                     /db_xref="GeneID:8294492"
     CDS             complement(598604..599494)
                     /locus_tag="KLTH0H06820g"
                     /note="similar to uniprot|P15807 Saccharomyces cerevisiae
                     YBR213W MET8 Bifunctional dehydrogenase and ferrochelatase
                     involved in the biosynthesis of siroheme also involved in
                     the expression of PAPS reductase and sulfite reductase"
                     /codon_start=1
                     /product="KLTH0H06820p"
                     /protein_id="XP_002556176.1"
                     /db_xref="GeneID:8294492"
                     /db_xref="GOA:C5E2Q3"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q3"
                     /translation="MLSLQLAHQLSGKHILLVGAGEVAMTRIPKLLPTGCKLTVIAPE
                     IHGDMWKHFDVPEDNDTVEHTDEHWSPEKNKIFQIFRRGFRNTDIVLHGNGLTDNADA
                     QSFLNGELDPIESYDHNKASGWHMIMTCIPDPVLSEKIYRGAKLVLGQHVLCNVADNP
                     PLCDFYFGSNVTLGKGGKPIQIMLSSNGNSPRFTALLKNEIERQFGDLPIGESVAKLG
                     QLRARIRKISEERCPASLSKPELIKYRMEWIRNCTDAFGVSHCHEINVDKTVTLFEDM
                     FASMSLEQPDNEKYMKEYLE"
     gene            complement(<600623..>602266)
                     /locus_tag="KLTH0H06842g"
                     /db_xref="GeneID:8294493"
     mRNA            complement(<600623..>602266)
                     /locus_tag="KLTH0H06842g"
                     /product="KLTH0H06842p"
                     /transcript_id="XM_002556131.1"
                     /db_xref="GeneID:8294493"
     CDS             complement(600623..602266)
                     /locus_tag="KLTH0H06842g"
                     /note="some similarities with uniprot|P32831 Saccharomyces
                     cerevisiae YBR212W NGR1 negative growth regulatory
                     protein"
                     /codon_start=1
                     /product="KLTH0H06842p"
                     /protein_id="XP_002556177.1"
                     /db_xref="GeneID:8294493"
                     /db_xref="GOA:C5E2Q4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q4"
                     /translation="MGDLDPSFDEATIQRIWAHLGKRVSVKLIRAKKNLLIPCSTSST
                     FSDTQPQAPAPEGSGALRAPDADGAGRKIHINGVSFIDPNTTQLHHAGYCFVEFESLA
                     DAQWALTLNSTPLPDITCPGPAAADMASPAGSPAAGPDASSPLRTNPTGLRNFRLNWA
                     SGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRC
                     FGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPRNNVMWQLTQPQHQQRQPQHHQ
                     HQHQHQQQQQQQQQQQQQLHHQQHQQHQQHHHIQNHLSQYHQHYQSMSQNNFQLASPE
                     YTQAPLLMRTASSLVGNNLINFPATDFVSGSDAPYMGVPSMPPSLAHASAAASGAASA
                     PAPGRSPFTNPNNTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAY
                     RIDAEAAIQGMQGFIVGGNPIRLSWGRTSTDTSRHPAMQDMPSSLRNVASQRGPQVWN
                     SATAPTPTTAVSMFASPHIQRQDSVTQAGSVPPVHPSLL"
     gene            <604465..>605523
                     /locus_tag="KLTH0H06864g"
                     /db_xref="GeneID:8294494"
     mRNA            <604465..>605523
                     /locus_tag="KLTH0H06864g"
                     /product="KLTH0H06864p"
                     /transcript_id="XM_002556132.1"
                     /db_xref="GeneID:8294494"
     CDS             604465..605523
                     /locus_tag="KLTH0H06864g"
                     /note="some similarities with uniprot|P38313 Saccharomyces
                     cerevisiae YBR211C AME1 associated with microtubules and
                     essential regulator of microtubule stability"
                     /codon_start=1
                     /product="KLTH0H06864p"
                     /protein_id="XP_002556178.1"
                     /db_xref="GeneID:8294494"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q5"
                     /translation="MSTKRISPFHKRARSGAMLMDRDVKLLYRQRGSALRRTGQSIVI
                     SQAKRPKHSGRAVRERERDVAAAPGPAVGEQPSSPPPLISDGFLGSPAHELTREPTQL
                     PHSPPAPLSPSPLVPLPALDADLDADLGAGLDEDLNADLGASPGVAGHAEAAPLLPAP
                     QFSFSDVPLSRLHSNTVSLSSIEVVASLINSLFEEQLVPQCFAEFDTAATPEDRLMHK
                     LDIKLYSTFVQAVLADLRDLLDINVSNNELLTQLKQTIKRKSALTQTLLDVRHETADW
                     EANAGADEQLEELRQKSAVNAKLQALAQDVRTASADASAPPDADHALDDLTAVLDPYN
                     GVLAQLQTFNQSLEKLLE"
     gene            complement(<605628..>606035)
                     /locus_tag="KLTH0H06886g"
                     /db_xref="GeneID:8294495"
     mRNA            complement(<605628..>606035)
                     /locus_tag="KLTH0H06886g"
                     /product="KLTH0H06886p"
                     /transcript_id="XM_002556133.1"
                     /db_xref="GeneID:8294495"
     CDS             complement(605628..606035)
                     /locus_tag="KLTH0H06886g"
                     /note="similar to uniprot|P53173 Saccharomyces cerevisiae
                     YGL054C ERV14 Protein localized to COPII-coated vesicles
                     involved in vesicle formation and incorporation of
                     specific secretory cargo required for the delivery of bud-
                     site selection protein Axl2p to cell surface related to
                     Drosophila cornichon"
                     /codon_start=1
                     /product="KLTH0H06886p"
                     /protein_id="XP_002556179.1"
                     /db_xref="GeneID:8294495"
                     /db_xref="GOA:C5E2Q6"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q6"
                     /translation="MAVWLFVLALVLNCINLFAQVHFTILYADLEADYINPIELCSKV
                     NKLITPEAALHAFISISCLLTGHWFVFLINLPLLAFNANKHYKKMQLLDATEIFRTLG
                     KHKKESFLKLGFYLLMFFFYLYRMIMALIAEAD"
     gene            complement(606394..606465)
                     /locus_tag="KLTH0H06908r"
                     /db_xref="GeneID:8294496"
     tRNA            complement(606394..606465)
                     /locus_tag="KLTH0H06908r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=62.09"
                     /db_xref="GeneID:8294496"
     gene            complement(<608218..>609003)
                     /locus_tag="KLTH0H06930g"
                     /db_xref="GeneID:8294497"
     mRNA            complement(<608218..>609003)
                     /locus_tag="KLTH0H06930g"
                     /product="KLTH0H06930p"
                     /transcript_id="XM_002556134.1"
                     /db_xref="GeneID:8294497"
     CDS             complement(608218..609003)
                     /locus_tag="KLTH0H06930g"
                     /note="similar to uniprot|Q05905 Saccharomyces cerevisiae
                     YLR301W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H06930p"
                     /protein_id="XP_002556180.1"
                     /db_xref="GeneID:8294497"
                     /db_xref="GOA:C5E2Q7"
                     /translation="MCSEHPLAVKWQSKIIAMVSLNKRCTFQVGENPADERTLTLSSA
                     SNGGYYISLRPFVEPKGSESELPYEWAFAGSPKSLEAKKVDELRDDINFNFDFDTNVH
                     LNAENTHRGVVETHWKKWESGLVEERGQVFPFGPDKQAVSFFELWQPIDATRDEFVHI
                     SEKSVDQSAARSVVLALDDDNYRGLVITVGKWTQGILFKKAEHTAKGINFLRACESAD
                     GKITTLLKYGVDFDRFPSTFVGQKDAELQGAAGAFWKVVESNL"
     gene            complement(<609143..>613222)
                     /locus_tag="KLTH0H06952g"
                     /db_xref="GeneID:8294498"
     mRNA            complement(<609143..>613222)
                     /locus_tag="KLTH0H06952g"
                     /product="KLTH0H06952p"
                     /transcript_id="XM_002556135.1"
                     /db_xref="GeneID:8294498"
     CDS             complement(609143..613222)
                     /locus_tag="KLTH0H06952g"
                     /note="weakly similar to uniprot|Q08562 Saccharomyces
                     cerevisiae YOR191W RIS1 Member of the SWI/SNF family of
                     DNA-dependent ATPases plays a role in antagonizing
                     silencing during mating-type switching contains an
                     N-terminal domain that interacts with Sir4p and a
                     C-terminal SNF2 domain"
                     /codon_start=1
                     /product="KLTH0H06952p"
                     /protein_id="XP_002556181.1"
                     /db_xref="GeneID:8294498"
                     /db_xref="GOA:C5E2Q8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q8"
                     /translation="MEDQHAEVQTSVRPVPSIDLTQDDSNPNEATLENIENHESQASP
                     RAAVQRSIRLQSLDSSPLKFTGQNFTTQPTTGKQGFFVPLNKTGNSNGTHSDPLNVDH
                     KKPSRFTSASREASLQSPAFESGGDSVIPEKGSLSGAGNLLSEHSFKKRKIEEDEGRP
                     DTSLQNIRDFIDPSKSRYFPGKALNEGGSLASPENTPGDQHNSQGPEIYNGPPTFKQP
                     SSDFSHDEDAFFSFDDKSNADQKPATPPSLTHNSDLKDNKPMDGALSPPLGQNHEINH
                     NQNAPIIILSDEEEDAISHKSTELVSTKAESSRKVSNEDVKHFRSLHERNMKEQAETE
                     KHMLSLRNTCRDTKVILKRKLQKRDALINEVQSKLDILSRTSSVSGEEDVALLQEELS
                     SLKERRSQTMVKLRKVENKESLIVDQHAKFVARLEPKLRESYTNLQNAINNYRQTRMV
                     EKRAVLMSEKSQLDSLFSNGNIDPSEYQQRLRFLNNALNDLHSTQSAPNTEPHVSDIF
                     FKSIGVARDLILKNTVRSDQNKMLMNKYLDVVENFKRSCDKGVRYNLHTKMQVEKAIT
                     DLFRHGVKMPAVSKSLKSMGFIVNPEDYDAVRSSAHQRSNDDFMEVSHGKGEDDDILE
                     IVRSQEEQSLAHSNPLHLSNIYNMHDNDSLHDLLEGLKTAETEIEGEELTPPELTVNL
                     MKHQRQGLHWLLSVEKSQKKGGLLADDMGLGKTVQAIALMLANKSNTDKCKTNLVVAP
                     VAVLRVWQAEVRTKVKKTCGLKVLIYGGSNGAKVENYRSLLRHDVVLVSYQTLASELK
                     KHWPAKLEQDAEGGNIADIPDIKAMNSLKERKEYWSPFFCDESVFYRIILDEAQNIKN
                     KKTQSAKACCALNSTYRWALSGTPMQNNIMELYSLLRFLKISPYNREQKFKLDIGNPL
                     GRSSNDYDSHDRKQAIKKVQVLLRAIMLRRTKDSKIDGKPILELPDKIIKPMEETLQG
                     LELTFYTELEAKNQKKAEKLMKNRSKGSYSNILTLLLRLRQACCHPELVILGEHKSES
                     SKVANGKNFQNDWLRLFELARNMPAAGKETVAEGLENMICPYCMEQMELESSVVITPC
                     GHMLCEGCSQQYFEDARGQQNARKVVNSGYLVPCLVCERYVNDSEIITYKLYDQAVNQ
                     NLTAEGLKREFRSEMEAQKDRLKNGYKINFETLEPSQKIKQCLDIVRNVFANSRDEKI
                     IIFSQFTTFFDLLQHFIRKELGVQYLRYDGSMDAQSRAATIEGFYRNNERRLLLISMK
                     AGNAGLTLTCANHVILVDPFWNPFVEEQAMDRCYRISQTREVQVHRLLIKDSVEDRIL
                     ELQKKKRELVESAMDPNKIQEVNRLGRQELGFLFGLNSL"
     gene            complement(<613530..>614858)
                     /locus_tag="KLTH0H06974g"
                     /db_xref="GeneID:8294499"
     mRNA            complement(<613530..>614858)
                     /locus_tag="KLTH0H06974g"
                     /product="KLTH0H06974p"
                     /transcript_id="XM_002556136.1"
                     /db_xref="GeneID:8294499"
     CDS             complement(613530..614858)
                     /locus_tag="KLTH0H06974g"
                     /note="highly similar to uniprot|P23776 YLR300W
                     Saccharomyces cerevisiae EXG1 Major exo-1 3-beta-glucanase
                     of the cell wall"
                     /codon_start=1
                     /product="KLTH0H06974p"
                     /protein_id="XP_002556182.1"
                     /db_xref="GeneID:8294499"
                     /db_xref="GOA:C5E2Q9"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:C5E2Q9"
                     /translation="MLALTWVYTLSVAVCAALAQPVPAKGPHSVQFMHEQNKKRFYDY
                     SSATIRGVNIGGWFVLEPFITPSLFEVFRTIDNNDEGIPADEYHYCQALGQEVAASRL
                     EQHWSSWFTEKDFANIADSGLNFVRIPIGYWAFKTLESDPYVTGKQEYYLDQAIGWAR
                     NNGLKVWVDLHGAAGSQNGFDNSGLRDSYAFLEDSNLALTKEVLQYLLEKYSRDEYLD
                     TVIGVELINEPLGPVLDMDKLKEYYQFGYDYLRNELGRDQIVIIHDAFEPYNYWDDTL
                     VYNQGAWGVVVDHHHYQVFSNKELLRSIDEHVSVACEWGSGTLSEAHWTVCGEWSAAL
                     TDCAKWLNGVGYGHRYDGTFHKGDDTSSYIGSCENNEDINSWSDERKADTRKYVEAQL
                     DAFELRGGWVIWTYKTETSLEWDLQRLMFNGLFPQPVTDRQYPNQCGFSN"
     gene            complement(<616972..>617355)
                     /locus_tag="KLTH0H06996g"
                     /db_xref="GeneID:8294500"
     mRNA            complement(<616972..>617355)
                     /locus_tag="KLTH0H06996g"
                     /product="KLTH0H06996p"
                     /transcript_id="XM_002556137.1"
                     /db_xref="GeneID:8294500"
     CDS             complement(616972..617355)
                     /locus_tag="KLTH0H06996g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H06996p"
                     /protein_id="XP_002556183.1"
                     /db_xref="GeneID:8294500"
                     /db_xref="UniProtKB/TrEMBL:C5E2R0"
                     /translation="MSQETQESKLDSKQLPKEEPEPEVPVNYPALQWQKVESSIPVHT
                     FTNYKLKLNGYVRKDKMRVEEPEDEPTSTTNNAEGHDVEHTSEHESESEAKNDDVRDH
                     NTEERAGSADGEPETKSEEAQKESA"
     gene            complement(<618189..>621167)
                     /locus_tag="KLTH0H07018g"
                     /db_xref="GeneID:8294501"
     mRNA            complement(<618189..>621167)
                     /locus_tag="KLTH0H07018g"
                     /product="KLTH0H07018p"
                     /transcript_id="XM_002556138.1"
                     /db_xref="GeneID:8294501"
     CDS             complement(618189..621167)
                     /locus_tag="KLTH0H07018g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H07018p"
                     /protein_id="XP_002556184.1"
                     /db_xref="GeneID:8294501"
                     /db_xref="UniProtKB/TrEMBL:C5E2R1"
                     /translation="MQHETLESGSPPISYLKDLKNGNEVLIVEGDIVHLYRTKDSSFD
                     TSRVTELKNSALHLSFRLVNPKSDFFLVLAFDLSITVFDIPGFKKVAKKRLKINEQDV
                     DPRKTLRFLDSDSEQLYFSLSEKQLVSINKSDLLSESPFAKFISVHDTPYRIENAFCL
                     NPNKGFFCLAKRDLIQNVLAFEVIHANTFRHRNNHSRYDRLLQEYTAAMDCGSSGELG
                     TLVEMITLEVPKTVVFLFSRGVIIFNNKVCVFENKYDENTRESLCLDGLIPGASLYQG
                     EEGLRLSILSTKGETISTTIDLRKPKSLQWNSVTLNSFLKKPLDSMLCYKCLGHGQIL
                     LISKREGMVFADYQKERILYISRYKRPTYLDALPLDFGFAQVTTVVACGGYNSTLGFV
                     SFFQKSVSANTFKVIEFKHFGTTRAIRDFWFTTKGIVSASSIRGSDKFLLHVSFHNKT
                     LTRPSTRCALQLKNVGDEYIILDNELDLYLVKGKTTFKLASMAKFSSWNVCYMSAFQG
                     SGSSSSLFIAISDGKDVYMLENGVIVAEYSFEDANINDICLKDCSSSKGTVLIVTNRA
                     GCVTILNFSFETHSLSISLQVCLGENRAFRLCDIKMVESGTTEHQDSAFFVYSSSKVF
                     VFNLSRRCFYKWIPKFDIKLIKYQGNSKYVVLTMDDSFVTLTYSGALSAEWTTEELVS
                     KDWVYTKMVQLRNPRYILLASQTTNFKSKVSIFDTESLNTIDEYILPDQGVIKGVITL
                     EKPYAQEILISFAGCSPESDCLLVLSALRNKLFKSGTYKTRGASAALTQRGETIACLG
                     TTVLLFKLQRCLKKRVWDFKLLMRPFEGSGPWSVDCAFVSEEILCVLDRAKGICFFDL
                     ATKTPSLKCSIQSLAPDFANDRGHFDLLFSTLIEDTKQSEFYKINGPRTAKIRPLLDP
                     IEKTARQLSIVVACGSQLLVYPCHPRYFKNSQNHSKCKLPCASGRIPFEDVVMSTRRT
                     DANQFLVCTTGRLLITSLNT"
     gene            complement(<621645..>625103)
                     /locus_tag="KLTH0H07040g"
                     /db_xref="GeneID:8294502"
     mRNA            complement(<621645..>625103)
                     /locus_tag="KLTH0H07040g"
                     /product="KLTH0H07040p"
                     /transcript_id="XM_002556139.1"
                     /db_xref="GeneID:8294502"
     CDS             complement(621645..625103)
                     /locus_tag="KLTH0H07040g"
                     /note="similar to uniprot|P21339 Saccharomyces cerevisiae
                     YOR188W MSB1 Protein involved in positive regulation of
                     both 1 3-beta-glucan synthesis and the Pkc1p- MAPK pathway
                     potential Cdc28p substrate multicopy suppressor of
                     temperature-sensitive mutations in CDC24 and CDC42 and of
                     mutations in BEM4"
                     /codon_start=1
                     /product="KLTH0H07040p"
                     /protein_id="XP_002556185.1"
                     /db_xref="GeneID:8294502"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:C5E2R2"
                     /translation="MESLKPLPSPPSNPKAAEPTGRKGRLHSAADEDEEFEFFHEFSR
                     DKVKGLIHLITQELKTNAIGIEFLFLPFRPEQSNEKLLRFLNQVFPLGNGVPVNETKQ
                     SRIISKTEPWTLFQALKYVWCRLPEGQVITWKAYEAFRVREQSDGYRSRSFLELMPKC
                     LSSPDHASIVYDFFDLIVTASSNSKHNKMSARKISKMFGIWAFRSKVENSPYDFGEPT
                     PEIEKKNSFSEGIEQWIPASDAMFHLLLAFIRSFISNDLKDANIPTSLKTILFNSTYP
                     PKGSTAYDSETILTVPIVSLKTTEFSKKPWQLIERCNELFDFSNYDAFEAREDYALLK
                     SLFKRKKNIDGISHKMSKESRRIMKEISTKHSTFQAGWASQKCVPSDDGMKRLETHLE
                     MGRVDIDDYFIWAWLSTLSHEQTSDKKKLFGRSLILEFEFDGFKKWVIIEECDLSLEL
                     KKHEKVDSLEYLKPRDNRDQVHEHQNRSITPAYEKFQHNVENESIPQNKDPLVPFLQS
                     DKLKAEEGISPPHVQDRRHQRSVPKWNPLKSIRKKSSGSSSSNSPLPQAASEQNKASK
                     GYKNKELPPSPPHEQASTRGSRNDSRVLSQFSMLNPENYKLPAIEHDDFKIEIPDIEE
                     DSIALDPEDEAHHTAPIQKDNISLPSTNNGIEDLNEMVDELSKQVRNLRTKGNQSPKS
                     LATNAETFETLTMFERYRDLPKNSTDTLAGSTNSSTVPPLQLDSPRTEKLPGTFPTES
                     PIRRSPQQSFDSHKELKSYQLNQASQVTQADEPNQANQVHQVSPIVFPIDYSQVARAE
                     VSPIRSRGNSPVRKAPYPQQEFGVNNAKFEKPIPETRSPTPPPSQSYIHYEKHMPTNE
                     SRGEVNRDFAHRAANRIENKDNIKYSSHEASSYPAPTQVQTPEGAQVAFSGHNAHGYH
                     SQPFAHYPDQSAVPIEGYTNLPVSRPEHSNNQAKALNGGPPLSSNGNRYSYYQAPYGY
                     PQVAHHSGTTASYEIQESSHPPHYPYNPANVAGSQPHRLVTQRPSHPAQQTFSKAYNN
                     QHQSPSSNIHPRFPPQHARQHPHTRVIPQAGASPQPPQVMRSYASPQMAYAPTAQGPA
                     PTSFVASPGTNPAYYGPVHSPPGPQSAPFIPGVPVGGKLHGAYAKKREDRKKLHDTIK
                     NGTFGI"
     gene            complement(<625250..>627079)
                     /locus_tag="KLTH0H07062g"
                     /db_xref="GeneID:8294503"
     mRNA            complement(<625250..>627079)
                     /locus_tag="KLTH0H07062g"
                     /product="KLTH0H07062p"
                     /transcript_id="XM_002556140.1"
                     /db_xref="GeneID:8294503"
     CDS             complement(625250..627079)
                     /locus_tag="KLTH0H07062g"
                     /note="similar to uniprot|Q05902 Saccharomyces cerevisiae
                     YLR299W ECM38 Gamma-glutamyltranspeptidase major
                     glutathione-degrading enzyme expression induced mainly by
                     nitrogen starvation"
                     /codon_start=1
                     /product="KLTH0H07062p"
                     /protein_id="XP_002556186.1"
                     /db_xref="GeneID:8294503"
                     /db_xref="GOA:C5E2R3"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5E2R3"
                     /translation="MRLAAVLTLLLETAVCMQHFFVESPDHNIDIKPLPRHPTLSPNS
                     SQVLRTGRYGAASSDSEHCNKIAVEQVLKKFDGANAADAAVSVALCLGMKNFFSSGIG
                     GGGYAVFVGKDQMSGETDSLFIDFREQAPALAHKNMFSQSPNASQIGGLAIAVPGELR
                     GIYELFVKKGSGKVEWRDLLQPIIELGSNGWEVDEITAACLKIYEPYFVQHKKDWAFV
                     LNEGQSRVLKTGESIKRPALSDTLKELASNGTVAPFYDPNHRIGRSMLRKIKESGGII
                     TGNDLKSYYVNTSKPLYTKIRSGWQYFPNNDLEVFTSGGSSSGAALLSALKILDEFPA
                     KKGGDFQPEQVYVLVECMKWMSSARSRLGGFSDPHELPQRILEVLDSNWTQNSVRLIN
                     DHLPGLKTLSNWTEYNPAYALTDPHGTTHFGVVDKFGNAVSFTSTVNLLCGSLVHDIE
                     TGVIFNNQMDDFSQPGRSNAFELAPSIYNFIEPGKRPLSSASPVVILDELGKPDLVIG
                     ASGGSRITPSIFQVITRLYWYEMPLLEAIAYPRVHHQLLPDVLEVESFPMLGKDTLEA
                     LKSMGHNLLEQAPKSVVNGIKRHRGEWHAVSDYWRKRGLSVAY"
     gene            complement(<627335..>628615)
                     /locus_tag="KLTH0H07084g"
                     /db_xref="GeneID:8294504"
     mRNA            complement(<627335..>628615)
                     /locus_tag="KLTH0H07084g"
                     /product="KLTH0H07084p"
                     /transcript_id="XM_002556141.1"
                     /db_xref="GeneID:8294504"
     CDS             complement(627335..628615)
                     /locus_tag="KLTH0H07084g"
                     /note="highly similar to uniprot|P02992 Saccharomyces
                     cerevisiae YOR187W TUF1 Mitochondrial translation
                     elongation factor Tu comprises both GTPase and guanine
                     nucleotide exchange factor activities while these
                     activities are found in separate proteins in S. pombe and
                     humans"
                     /codon_start=1
                     /product="KLTH0H07084p"
                     /protein_id="XP_002556187.1"
                     /db_xref="GeneID:8294504"
                     /db_xref="GOA:C5E2R4"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2R4"
                     /translation="MFLVPRAFSLIARPATRSFASTALRSYAAAFDRTKPHLNIGTIG
                     HVDHGKTTLTAAITKTLAVKGGADFLDYAAIDKAPEERARGITISTAHVEYETDKRHY
                     SHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQDIVVFV
                     NKVDTVDDEEMLELVEMEMRELLTQYGFDGDNTPVVMGSALCALEGKRPEIGEQAIMK
                     LLDAVDEHIPTPQRDLEKPFLMPVEDIFSISGRGTVVTGRVERGNFKKGEEVEIVGHN
                     AQPLKTTVTGIEMFRKELDKAMAGDNAGILLRGVRRDQLKRGMVLAKPGTVKAHTKFL
                     ASLYILSKEEGGRHSGFGENYRPQMFVRTADVTVVLKFPEAVEDHSMQVMPGDNVEME
                     CELVHPTPLEAGQRFNIREGGKTVGTGLVTRIIE"
     gene            <628865..>629506
                     /locus_tag="KLTH0H07106g"
                     /db_xref="GeneID:8294505"
     mRNA            <628865..>629506
                     /locus_tag="KLTH0H07106g"
                     /product="KLTH0H07106p"
                     /transcript_id="XM_002556142.1"
                     /db_xref="GeneID:8294505"
     CDS             628865..629506
                     /locus_tag="KLTH0H07106g"
                     /note="some similarities with uniprot|Q05900 Saccharomyces
                     cerevisiae YLR298C YHC1 U1 snRNP protein required for
                     pre-mRNA splicing"
                     /codon_start=1
                     /product="KLTH0H07106p"
                     /protein_id="XP_002556188.1"
                     /db_xref="GeneID:8294505"
                     /db_xref="GOA:C5E2R5"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="UniProtKB/TrEMBL:C5E2R5"
                     /translation="MPRFCDYCHSYLTHDTPSVRKSHLLGKNHVKLAADYYCNKARQT
                     EKPIFEKSRSAKKNRKRARSPRGQEPERRWTLHCDTNRQKRQSHRAALAQQDLAPISV
                     LEKLYRHSPAYAKVFVSECRLDTGQSVRLERLPQRANKRPQRTAAADPQKPTRDTLYK
                     PDYSDAGKIPSAVLLPPPPSLARWPACPPLQLASDRAATATVQHVTRKLEARR"
     gene            complement(<630668..>632062)
                     /locus_tag="KLTH0H07128g"
                     /db_xref="GeneID:8294506"
     mRNA            complement(<630668..>632062)
                     /locus_tag="KLTH0H07128g"
                     /product="KLTH0H07128p"
                     /transcript_id="XM_002556143.1"
                     /db_xref="GeneID:8294506"
     CDS             complement(630668..632062)
                     /locus_tag="KLTH0H07128g"
                     /note="some similarities with uniprot|P38960 Saccharomyces
                     cerevisiae YDR082W STN1 Protein involved in telomere
                     length regulation functions in telomere metabolism during
                     late S phase"
                     /codon_start=1
                     /product="KLTH0H07128p"
                     /protein_id="XP_002556189.1"
                     /db_xref="GeneID:8294506"
                     /db_xref="InterPro:IPR018856"
                     /db_xref="InterPro:IPR024263"
                     /db_xref="UniProtKB/TrEMBL:C5E2R6"
                     /translation="MANWDHVVYRNKDVDYYVPSLFHLSPTFQTTVPCLVCDLSYHFK
                     RSKIITQKYYAGEPDAWLYGNYPIGSVEVLGCVAGWKWKLIGECDNAMFKLDDSTREP
                     RGPPTLLSVKCSKGVVLRSGLPLGDLSGWTLKLAGQMNRFGELDVQSVRICSELQDEI
                     EFWKRAMKWRRELSVPWTVEKAVLDRVCAPAGNAPPSSYNFIQWLEQQHYQREMKIAD
                     DYSEGPREIVLPFKHVSQDMVLGDQEAESEPHTGRHEQTQARSPEMHERSRAPELVET
                     IDQAAGPRASVHDYVRHVLDHLLTQNRVEVSTLNTFRSPGPLRVLRRVAAQRARRQAR
                     PVDEVASSLFADVLQRLARAGLISVFAQGRILNLRVLKNCDDYVTQRIAALVELRSYT
                     GKIDFRRACDLLGLARSAPLERLLVDLHKRALRRLAAASDTPLQSWWIELAGPAAAFV
                     HFEYHHDPSSLAPG"
     gene            <632257..>632700
                     /locus_tag="KLTH0H07150g"
                     /db_xref="GeneID:8294507"
     mRNA            <632257..>632700
                     /locus_tag="KLTH0H07150g"
                     /product="KLTH0H07150p"
                     /transcript_id="XM_002556144.1"
                     /db_xref="GeneID:8294507"
     CDS             632257..632700
                     /locus_tag="KLTH0H07150g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H07150p"
                     /protein_id="XP_002556190.1"
                     /db_xref="GeneID:8294507"
                     /db_xref="GOA:C5E2R7"
                     /db_xref="InterPro:IPR014306"
                     /db_xref="InterPro:IPR023416"
                     /db_xref="UniProtKB/TrEMBL:C5E2R7"
                     /translation="MSNSKPPVTCHILDTTSGKPAQDVTCSIYFVRTTAESFGFEVSE
                     TQPFAAARTNEDGRIGAWIFAPEPSKRPFLKELGIYEENSTLVWKSLVPGTYKIRFQT
                     SRYFERQKKTCFFPFVEIFFEVSDSRHYHIPLLLSNYAYSTYRGS"
     gene            <633266..>635656
                     /locus_tag="KLTH0H07172g"
                     /db_xref="GeneID:8294508"
     mRNA            <633266..>635656
                     /locus_tag="KLTH0H07172g"
                     /product="KLTH0H07172p"
                     /transcript_id="XM_002556145.1"
                     /db_xref="GeneID:8294508"
     CDS             633266..635656
                     /locus_tag="KLTH0H07172g"
                     /note="some similarities with uniprot|P32896 Saccharomyces
                     cerevisiae YDR081C PDC2 Transcription factor required for
                     the synthesis of the glycolytic enzyme pyruvate
                     decarboxylase required for high level expression of both
                     the THI and the PDC genes"
                     /codon_start=1
                     /product="KLTH0H07172p"
                     /protein_id="XP_002556191.1"
                     /db_xref="GeneID:8294508"
                     /db_xref="GOA:C5E2R8"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5E2R8"
                     /translation="MGLLSVEQKYNIILMAERHPKWTQLELARWAYEAYQLSSCPSQG
                     TISRLLARKSVFMNSKEHEKDANRLRKPNNILVRRILQEWVSQSIWNGIPISPPIIQD
                     TAQSVWHRIPAEHREGNGSFSYKWITHFLSKMDVNVSSLDEEPPKPPKVWTFEERGTL
                     KEFLCKIPARNLFTLDETFLAYNLPLDYAQYETNQVQRRIEVVTVMLCANLDGSEKMN
                     PLVIGKYENYRSFRNHFSSEPPEGASQLSLGNKMAKKFSLTYYNNRKSWLTSNLFHDW
                     LVWWDKRLVVDNRKIYIVLDDSCSHRIINLRLKNIKLIYTSANSRFLPFNWGVLDEFK
                     THYRVQQYEALTELQEKIEKKTGQKKILTYDQSLLKMSNAFKLIKVAWDAIPADTIKA
                     NWKSSGILPQHMIQLDESVSMAFKKNEALEKKLYEVSERFHCMKQWDYDMLLDLNIEN
                     KNTNFLSSEELVQSAIVDEWEPEEKQVSLEDDYGTNGFSLEAFAQVGEVGNDTFGHVE
                     HLSHNPTETLEKNLLVSDVIDRPSEFFPSSVLPINDDQHIENVTGPPRSNSTQIYPAV
                     SAPPAATGYLDDVFSTLPHEPSSANPATSINTHVSSTLPATDSPSPNGIPAADILGIE
                     TPALNLGNEFDLDSVNDYLGQSSSNPHEPTFGNQRLVILTTLQTNIDIAKSMGNILKH
                     AEFREVGLSDRSLNELRFSYNNCLKKIRKAKQALSGADKRLRQQRLERQIINQEQSIV
                     STAASPSSKIHRPVGISPSLEIENSNFFTNFPSNASLDIPPHIQSGTENSSTRRSS"
     gene            complement(<635744..>638542)
                     /locus_tag="KLTH0H07194g"
                     /db_xref="GeneID:8294509"
     mRNA            complement(<635744..>638542)
                     /locus_tag="KLTH0H07194g"
                     /product="KLTH0H07194p"
                     /transcript_id="XM_002556146.1"
                     /db_xref="GeneID:8294509"
     CDS             complement(635744..638542)
                     /locus_tag="KLTH0H07194g"
                     /note="similar to uniprot|P38959 Saccharomyces cerevisiae
                     YDR080W VPS41 vacuolar protein sorting component of
                     vacuolar membrane protein complex"
                     /codon_start=1
                     /product="KLTH0H07194p"
                     /protein_id="XP_002556192.1"
                     /db_xref="GeneID:8294509"
                     /db_xref="GOA:C5E2R9"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016902"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2R9"
                     /translation="MMTQSDAKLSLIQESSEEHNPVGLGGQAEKGPLSQDNKKDDLDV
                     SSNSKEGNMDETKSIDRTEIRDGFASRLEGAEVSGNKDKNNAESEAVSGSDVESEDQS
                     EEEEEDEEEEEEEEDEEPPLLNYTRITKLPKNFFTRDSISACQFHEKVFAFATHAGFL
                     HFTETDFTTIRTFRCHRASITSIFTDGDIFATSSIDGSVVIGSVRDSAGMLACDFKRP
                     VHAVVLDDKYKTSKTFVSGGMAGEVILSQRNWLGNRLDIILDRDNGPVVGIYTVDDVL
                     FWMNDSGITFYSISSKTKLLQVPFPRDEQGTRPDLYWPSVHFPETDRIIVVWANHIWT
                     FKISLTKLPQHGNHLGSILSSAASSLRAAPDKKIDQEHYLYVNTVLAGVVSFKNDQLL
                     CLEVPPSKTVKNKSELPRFKVIDMFSGLEIHSDEVVSKSYQNLTVKDYHLGKHIGKGA
                     TEYYMISAKDAVAAHELSLKERFDWFSNTGHDYEAWKIGLYAVDKSARLEAGKRHINK
                     TVSQENWKEAAKSITEVFSEAHDDRKDDYFEAHVIKDWGNYILLLLEREQANVIVDLI
                     PTEPPLDNQVYDATLNYYLKANQISNFSKYLRLWPKKLFSLGAFCEKLEEVIEQDPEN
                     SADYRKDLVFLLIENGNDVKAIPHLIKLKDQRALDIIRRRKLLSMFSNQLVEILLLPF
                     NGSAKELSSLDLRDAVKVFQKPVELLVEGAHMIGVNSIIPKLSSPRELRLLLFLFFRK
                     ASSVNSLMIAPYEDDMLELYYEYDKTHLLDFLRSKNDYNIDKAIDLCASDENCFNELI
                     YLWGKVGETRKALSLIIDKKNDPQLAIEFVKGSGDSELWEYLVTYSMNKPSFIEKLLD
                     PRADIGTAYPEVVKRVPEKMDITGLKVSLENVTKENFLSLNVGTGVFKIIDDETNQLA
                     HEFLNLRDMGKPFEVNNA"
     gene            complement(<638924..>641187)
                     /locus_tag="KLTH0H07216g"
                     /db_xref="GeneID:8294510"
     mRNA            complement(join(<638924..641053,641119..>641187))
                     /locus_tag="KLTH0H07216g"
                     /product="KLTH0H07216p"
                     /transcript_id="XM_002556147.1"
                     /db_xref="GeneID:8294510"
     CDS             complement(join(638924..641053,641119..641187))
                     /locus_tag="KLTH0H07216g"
                     /note="similar to uniprot|P40094 Saccharomyces cerevisiae
                     YER157W COG3 Essential component of the conserved
                     oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
                     tethering complex that functions in protein trafficking to
                     mediate fusion of transport vesicles to Golgi
                     compartments"
                     /codon_start=1
                     /product="KLTH0H07216p"
                     /protein_id="XP_002556193.1"
                     /db_xref="GeneID:8294510"
                     /db_xref="GOA:C5E2S0"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:C5E2S0"
                     /translation="MTRSRGNSLVQSIATHAPSGKYLSPSLQDDELLGKLRRIGTSYK
                     QIEVRAQPEARCKENKYSKYDQYVTGVDVKVSEYQTVIDQAEKINKQLALTVDKFCAI
                     SSETRDFTESTYELFEKFRNLDDLHKSIREYLSYFEALDPIVRGLHHFSSPNIVRKNS
                     FKSKLSKIDESLQFLCEHKEFKDAEAYRIKFKQCMVRCCSLMATYLSNCLRSMFEEVV
                     KSLEGISQSATRDALLYNKFSSIAADFYSVSRELSSRYSSKHHQTYHEELNSILQDCY
                     NEYFRIRIKLLGPLISSQLENKEAQQKNFSLVKDIQDNLLFFTQLCEDEYSLIVQFFP
                     EKEGKKSFNEWLFHLCEPLHDHVREKVLRESDVASLCDAVTLLNKYYQFEENSEEYDA
                     QFRSVQLDKIFEPLLQDVQYRLIFRAQIYVETSIIAYRPTRDAFSINHRKGGLSKIEK
                     GDGIVKSFLDSISESKDEVEEMHSCYPPVTRAIALLSKIYQMVNSSIFDTLAHHIVHD
                     CVESLRAALRLVRESEDNLDVNLSYLKNLLMLRKQVQNFDIQYVCNETYVDFSGLRDF
                     LRSLAHGGLSAASNSVFSLAREGAPKVVKNMVDARSELSVELRNAIKELTETAAHEIV
                     GGCLNCSGVLISDNTQLRKNVEVILPRIYNQMCIFIKDHEVRIHLIDAIQDLVIRAYA
                     DYYEDVTQQAENGKIAKEDVSEIMYVDVFADLFNNVASQLEKGGASNSIV"
     gene            complement(<641736..>642056)
                     /locus_tag="KLTH0H07238g"
                     /db_xref="GeneID:8294511"
     mRNA            complement(<641736..>642056)
                     /locus_tag="KLTH0H07238g"
                     /product="KLTH0H07238p"
                     /transcript_id="XM_002556148.1"
                     /db_xref="GeneID:8294511"
     CDS             complement(641736..642056)
                     /locus_tag="KLTH0H07238g"
                     /note="similar to uniprot|P38958 Saccharomyces cerevisiae
                     YDR079W PET100 Chaperone that specifically facilitates the
                     assembly of cytochrome c oxidase located in the
                     mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0H07238p"
                     /protein_id="XP_002556194.1"
                     /db_xref="GeneID:8294511"
                     /db_xref="UniProtKB/TrEMBL:C5E2S1"
                     /translation="MKLPFRYTRSQLEVFRFAFCLLSPVAIMYWIGIDTDKKLNVPGF
                     WPDPETLNKIPKEPYEIKAELARMKKERLEKRLRLEKKIAEEYGIDIEAEKARIKEEM
                     NSGR"
     gene            <642294..>643298
                     /locus_tag="KLTH0H07260g"
                     /db_xref="GeneID:8294512"
     mRNA            <642294..>643298
                     /locus_tag="KLTH0H07260g"
                     /product="KLTH0H07260p"
                     /transcript_id="XM_002556149.1"
                     /db_xref="GeneID:8294512"
     CDS             642294..643298
                     /locus_tag="KLTH0H07260g"
                     /note="highly similar to uniprot|P40093 Saccharomyces
                     cerevisiae YER156C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H07260p"
                     /protein_id="XP_002556195.1"
                     /db_xref="GeneID:8294512"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:C5E2S2"
                     /translation="MSVHKRAKVNMTKQICTHSGSFHADEALAVYMLRVLPEFKDAKV
                     VRSRDPAKWEESDIVVDVSGKYDVEKRLFDHHQREFFETFSEKYKTKLSSAGLVYKHF
                     GQDIIKTLQPQLDESDVEFLYEKVYKDFVESLDANDNGISNFDAEDLGVKPKFSDKNI
                     TIPGIISGMNPNWNGDCSDASFDKCFFKASDFIGEVFVNLVKGYGESWMPAKALVRDA
                     VQNRLQEDPSGKIIVLKQFCPWKEHLYNIEKELGIVGEILFVLFEDSSSKWRVSTVPV
                     SATSFKFREGLPEPLRGLRDNELSEKSGLPGCIFIHAAGFIGGADSKDTVLKLAQMSL
                     "
     gene            <644732..>650635
                     /locus_tag="KLTH0H07282g"
                     /db_xref="GeneID:8294513"
     mRNA            <644732..>650635
                     /locus_tag="KLTH0H07282g"
                     /product="KLTH0H07282p"
                     /transcript_id="XM_002556150.1"
                     /db_xref="GeneID:8294513"
     CDS             644732..650635
                     /locus_tag="KLTH0H07282g"
                     /note="similar to uniprot|P39960 Saccharomyces cerevisiae
                     YER155C BEM2 Rho GTPase activating protein (RhoGAP)
                     involved in the control of cytoskeleton organization and
                     cellular morphogenesis required for bud emergence"
                     /codon_start=1
                     /product="KLTH0H07282p"
                     /protein_id="XP_002556196.1"
                     /db_xref="GeneID:8294513"
                     /db_xref="GOA:C5E2S3"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5E2S3"
                     /translation="MKSLRWSGRGKKSSSSSSSDDRHSEHSSQGQASPAQHWNKPEGS
                     SHSTNSQALQKKPTVFGKHMTSSPSIYLSETSNRSNRSLSSSRASITGEDLKHEDTHT
                     NSTVADDRTTMVTSFSAETNGTSRQQVPLPSLNNDNYDNTTFKVGWVNKAAPFQAANN
                     RDSRVYGNSSASLDPQSGSKRGSNFRLHRAALRGCVLSLYKSGIGNVKYFDPNLPPPA
                     HLMEQQYHETFSPAQPAQKAEEPLAVVEKQQNDLSYLSEEYPHPELKLDKDGRLLSGS
                     NESICHMILFCPYNNDENTRKIIDVLLILPLIDKFGVFLNIFQLFGVTFTRHRVKLVN
                     SARQHHQISAKADTLMTERLALVVKAILDVFSGFLLDDKLFSQIVDLVDIISLHDDEI
                     STNLKVSIVERQNRLSTLCSFTKQRSSPEEIGMLVDVEQFMKLDLDDVARSVHQINHK
                     FIREWSPQIDYSLLYESKFNEKHIYMNPMVFRNSENVHFLGRLLTTHLFVSNGAFTPH
                     QRATVLSTWVQLGCKFEKLGDMVSWLAIATIICSVPVLRLASTWQFVPEQTLRVIFKD
                     WVPTIVQLDRRQISSKSTNSVFILAPPNLNDSRIRESVIPFFGDLAINANDLPPDTKF
                     KYLEKKIHRTKNAFYKWHQRIEQAKKFDNETERSALAIPVDDGKITNTIFRYWKYHLD
                     QEQMNIDAIMDLSLALEPPKICQKQYSATSTRRSALLTGSYLPMLFNDMFPNYSIFPR
                     DSLIGAAGVSGNETKRRPVSTQKVGAPQKLIQDYDQGSITGVERIDEPVAKEISSKVS
                     NKQKLLKLIRDAFNIDMDMFHISDDIIFKAADDVDGRSRPASVVIETPKRMSQHSSIT
                     AARDSQDINRLSSAMESLDFFSNIGKSTGSINESFIQVVLKCATLDKLFDVLVLTTSV
                     FSKVVDTEDLEKYFYHERKRQNGRAQSSDSASVGPLDYAFVRLLMDNDIFTETFFNTY
                     RSFTTTTIVLENLAKRFIGAVSGAVSISRVVNSGKQRYSGSVNSSRFSGFVDATSSNS
                     RFPAWDIKVTEEDEVNLTYMAKIQIGAMEALLHLVNLHYSDFTDCLVNNTTFLDILKI
                     MDQEVNEEWKKRVELFSKSKLEQPEFREEVAELEQLQTTLKLLFKKLKSCYQKQLYRP
                     LGVSKTQRLTQSYLKDFTTIPLRDLSIHMNDPVLEDKFVASFNRLSFDDYSELPKWVY
                     GLNELVCDKLALVSNQDWVDVSQILELFSNESLVSLYQYPLHTISHSIIQSAGSQLDD
                     LEILNVFTWLTTLSVGENEMLFDKLAPSVQMIIKLHISITQFFILQIAHPDHTIETRA
                     NICTIILQLLNFTRWKNSSMDLFHDGKQDKCTTAISPHVPSFLETCLTNAIVAPESRY
                     YEMLWKNAHKKLAGPNAAEVKDVSNILDGIDAQIRFFVEYDESQISKPKSLSPCPGWL
                     ITRLLEISQFVPNMSIENSRMINFDKRRFVNNIIINFREMVPYVGGHSEDGSSTNFDS
                     DLKNSILFHEIVDIGKAFRKLAKEKAAEEARKSKYQASGLFNSIIVAEVDKIKRDQKK
                     KMELTIQDNDSKRKNMLEHAVKHKNRLSSSPSLLSLGQSPARGPPVDPEFPGAGKRSS
                     LATTGTRSSIISNSSTHSNGSMGKKLGGFFKRPFSIGGFSSSSSTHGLNAILLSGVQP
                     NGSISPFELPDITSSVFKDTKPVYSIRTFEIKSCIPVSGINKLPQTDHSFKIVMENGV
                     EHIVQGTSYIDMMEWIRLINISRRYSFHSQKYKGKTSNKIFGVPIEDVCERECSIIPN
                     IVVKLLEEIELRGLDEMGLYRVPGSVGSINALKNAFDEEGAVSNSFTLEDDRWFEINT
                     IAGCFKLYLRELPDSLFTKEKLPLFVSLALSYKSNEIDYEQFQAGMKDALKSLPLYNF
                     HMMKRTFEHLHRVDEHVENNRMDATNLAIVFSMSFIDQDDLASSMGPTLGALQTILQS
                     FIRNPADFF"
     gene            complement(<650870..>652111)
                     /locus_tag="KLTH0H07304g"
                     /db_xref="GeneID:8294514"
     mRNA            complement(join(<650870..651985,652076..>652111))
                     /locus_tag="KLTH0H07304g"
                     /product="KLTH0H07304p"
                     /transcript_id="XM_002556151.1"
                     /db_xref="GeneID:8294514"
     CDS             complement(join(650870..651985,652076..652111))
                     /locus_tag="KLTH0H07304g"
                     /note="similar to uniprot|P39952 Saccharomyces cerevisiae
                     YER154W OXA1 Translocase of the mitochondrial inner
                     membrane mediates the insertion of both mitochondrial- and
                     nuclear-encoded proteins from the matrix into the inner
                     membrane interacts with mitochondrial ribosomes null is
                     respiratory deficient"
                     /codon_start=1
                     /product="KLTH0H07304p"
                     /protein_id="XP_002556197.1"
                     /db_xref="GeneID:8294514"
                     /db_xref="GOA:C5E2S4"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:C5E2S4"
                     /translation="MFRNCVTRSARLAARSSSITWQPRLSGPSFIRFKSSVPQPGLNT
                     EIQTQLPSLDEISGATDAAASLADQASQVVGEASNHIGYLSSIGLAKSWWWPPDLIQN
                     IMEQIHVYTGLPWWGTIVTTTVIVRLLMFPLYVKSSDTIARNSKIKPELDAINSELMG
                     TTDMVEAQRVALRRKKLMAENGIKNRYLAAPMLQVPVALGFFSGIRQMANYPVDGFTN
                     QGLAWFQDLSLADPYLGLQVITASVFISFTRLGGETGAQQFSPAMKNFFTVMPLLSIP
                     ATMNLASGVVLYFAVNGACSVLQTLVLRNKWIRKKLDIADVVKRPASTTGPAKGIIET
                     FKENMNKAREQAERRQLMQDNEKKLQEAAKEQKSNSAIKIVRKSDLKRK"
     gene            <652347..>653213
                     /locus_tag="KLTH0H07326g"
                     /db_xref="GeneID:8294515"
     mRNA            <652347..>653213
                     /locus_tag="KLTH0H07326g"
                     /product="KLTH0H07326p"
                     /transcript_id="XM_002556152.1"
                     /db_xref="GeneID:8294515"
     CDS             652347..653213
                     /locus_tag="KLTH0H07326g"
                     /note="weakly similar to uniprot|P10355 Saccharomyces
                     cerevisiae YER153C PET122 Specific translational activator
                     for the COX3 mRNA that acts together with Pet54p and
                     Pet494p located in the mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0H07326p"
                     /protein_id="XP_002556198.1"
                     /db_xref="GeneID:8294515"
                     /db_xref="GOA:C5E2S5"
                     /db_xref="InterPro:IPR008732"
                     /db_xref="UniProtKB/TrEMBL:C5E2S5"
                     /translation="MKKSLVLYGPSKELLSADIRRGLFARCLNLEFDSLLNDVRKLPL
                     DRLEESFLHLFLAKSVQHAHVPSVDYLWYRFVMGRKVLMVKPRLLCGIGAVALHGSKP
                     FIPRQLCMHFEKFYGESDGLAQYHEELLRIKVESFAKSAGSSISFREKWKVFLEDIDR
                     NVDETCVFRVRDFPYLAESAANADRDLLAQLLFEENKIAIKNRWTLPLLLNLALLQPR
                     LDADFKIRIFSTFYETHKSLDYTDSVCILFQTLRDDVYRSTKLMQFLTERRISLPPLA
                     AKYFMSGSSKHS"
     gene            <654884..>655633
                     /locus_tag="KLTH0H07348g"
                     /db_xref="GeneID:8294516"
     mRNA            <654884..>655633
                     /locus_tag="KLTH0H07348g"
                     /product="KLTH0H07348p"
                     /transcript_id="XM_002556153.1"
                     /db_xref="GeneID:8294516"
     CDS             654884..655633
                     /locus_tag="KLTH0H07348g"
                     /note="similar to uniprot|P38957 Saccharomyces cerevisiae
                     YDR078C SHU2 Suppressor of hydroxy-urea sensitivity"
                     /codon_start=1
                     /product="KLTH0H07348p"
                     /protein_id="XP_002556199.1"
                     /db_xref="GeneID:8294516"
                     /db_xref="GOA:C5E2S6"
                     /translation="MVDEHYIDYSQLLAQLLDKDGELNETTVSFLYHLFPSDFFVRAM
                     SLIDSNNMFIYVFERDETSAALTTSVGTEPDEVETTTETLRTSPSPPVASEQELGNAV
                     QSSALINTLYEKPQSVLHRLIVKQEGPQSPPVCVDLRHWFCSCDEYNTLFEERMLTDE
                     EPSLYSKATTELRAGASITDSFASMPPKGASRRYFRHDIIMCPHLLAFAILLQTTPEL
                     LTYFTHKAATVYLITIQNLDEWLKLHLNVVI"
     gene            <655985..>658330
                     /locus_tag="KLTH0H07370g"
                     /db_xref="GeneID:8294517"
     mRNA            <655985..>658330
                     /locus_tag="KLTH0H07370g"
                     /product="KLTH0H07370p"
                     /transcript_id="XM_002556154.1"
                     /db_xref="GeneID:8294517"
     CDS             655985..658330
                     /locus_tag="KLTH0H07370g"
                     /note="some similarities with uniprot|Q01477 Saccharomyces
                     cerevisiae YER151C UBP3 Ubiquitin-specific protease that
                     interacts with Bre5p to co-regulate anterograde and
                     retrograde transport between endoplasmic reticulum and
                     Golgi compartments inhibitor of gene silencing cleaves
                     ubiquitin fusions but not polyubiquitin"
                     /codon_start=1
                     /product="KLTH0H07370p"
                     /protein_id="XP_002556200.1"
                     /db_xref="GeneID:8294517"
                     /db_xref="GOA:C5E2S7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5E2S7"
                     /translation="MSSAASKDGQEGSYSMYPPTSPAGPPASMQYGMGVYGNPNTFAQ
                     YGYGYPMPMDMYAGQGAPFLGYGINPNMMYYGGGSVPPPSGQKKKYYNKVENNGKTEA
                     GNHHNNHHNGVHFYANGKSGPTSNGTAIPAASPSGASKSVPITIKNQYKFELGNANSV
                     STTDLKLEYPFFANTDESEFSKAQEKRRELTLRAFGEIYCGNFGENSQTQDPEVEASA
                     LESVETPVETPQASSSEELNAAEKTEKSEQSTEQEKKETESRKSSVTSQAAPTKVIKS
                     WSAVASSAVPKASPSSASDQKKDKKYVPPTVKSLEPLGVVALRVCFDPQYVKYTADQY
                     KGAGMALQSVIPRGIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFL
                     LLDACLELYRKFDKQAFEREKASRSSSGVNISSALADAIKPDDFYKTLSKLPKFKDLR
                     WGHQEDAEEFLTHLLDQLHEEFVNSIDSLSDSEVISLINSINDEDTKTVFIRNLAKYK
                     DAKFIKDSSNEIKSMLEKYDADVDDADDTSGNGWQEVSSTSKKGKKTKTAAKRTVVVE
                     PSPISVIFGGQFRSVLDVPQNKEPQSITLDPFQTIQLDISDPDVNDLDSAFLKFSEME
                     HLPFKTSSGNNVEAKKQTFIDKLPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKI
                     RKKIHYGHELAIPDATISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQET
                     LNKWYRIDDTNVQEIEKDEVLKGGEEGNDSRTAYILIYQKL"
     gene            complement(658464..658537)
                     /locus_tag="KLTH0H07392r"
                     /db_xref="GeneID:8294518"
     tRNA            complement(658464..658537)
                     /locus_tag="KLTH0H07392r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=68.42"
                     /db_xref="GeneID:8294518"
     gene            complement(<658932..>660140)
                     /locus_tag="KLTH0H07414g"
                     /db_xref="GeneID:8294519"
     mRNA            complement(<658932..>660140)
                     /locus_tag="KLTH0H07414g"
                     /product="KLTH0H07414p"
                     /transcript_id="XM_002556155.1"
                     /db_xref="GeneID:8294519"
     CDS             complement(658932..660140)
                     /locus_tag="KLTH0H07414g"
                     /note="some similarities with uniprot|Q01589 Saccharomyces
                     cerevisiae YDR077W SED1 Isolated as a suppressor of an
                     erd2 deletion mutant (ERD2 is the HDEL receptor that sorts
                     ER proteins) SED1 encodes a cell wall protein."
                     /codon_start=1
                     /product="KLTH0H07414p"
                     /protein_id="XP_002556201.1"
                     /db_xref="GeneID:8294519"
                     /db_xref="UniProtKB/TrEMBL:C5E2S8"
                     /translation="MQFSTVALISSLGSAALAQQFLNTTTPLSSARSSSTASLVPSNA
                     GETTTYTDYEVVTAFTTYCPEPTTIITNDETYTVTSATTLTITNCPCTIPKSTTKTAT
                     KEEPVTVTEEEVVTAFTTYCPEPTTFSTNGETYTVTSATTLTITNCPCTLTRTTTKSS
                     SEAPAATSTETTSSKASSEAPVATSTARTITVTEEEVVTAFTTYCPEPTTFSTNGETY
                     TVTSPTTLTITDCPCTLTRTSTTTKTEATSTVEGTTVTGTTVPGTTVTGTTAPGTTVT
                     GTTVTGTTGQETTVPGTTVEGTTVPGTTVEGTTVPGTTVTGTTAPGTTVEGTTVTPSS
                     AKGTTAATPSVSSSAATLSSVTISTEQGTHAATSATSSHSIAVQSEAGANKIAVGGVA
                     GLAAAAALLI"
     gene            complement(<660969..>662171)
                     /locus_tag="KLTH0H07436g"
                     /db_xref="GeneID:8294520"
     mRNA            complement(<660969..>662171)
                     /locus_tag="KLTH0H07436g"
                     /product="KLTH0H07436p"
                     /transcript_id="XM_002556156.1"
                     /db_xref="GeneID:8294520"
     CDS             complement(660969..662171)
                     /locus_tag="KLTH0H07436g"
                     /note="weakly similar to uniprot|P38953 Saccharomyces
                     cerevisiae YDR076W RAD55 Protein that stimulates strand
                     exchange by stabilizing the binding of Rad51p to
                     single-stranded DNA involved in the recombinational repair
                     of double-strand breaks in DNA during vegetative growth
                     and meiosis forms heterodimer with Rad57p"
                     /codon_start=1
                     /product="KLTH0H07436p"
                     /protein_id="XP_002556202.1"
                     /db_xref="GeneID:8294520"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2S9"
                     /translation="MAIGISLSQLIDDSPPPLRSGVAALDDALGGWHSRCIYELFGPP
                     GTSKTRIAQSLVQSEMARDGTCLWVDAHVHTPLETLASPSQSARPAEADAQSRASDAE
                     GDERASSESPSRGLHRTRLTSFAQYVFFFQNLRERYELVVLQGFSQVLTDYIHARAAM
                     PLPRADSAHAIKVKSLITLFTLITKYAHAYNATIVLVSDAMNTSYMGGVHHVPQEHVT
                     FADDSRFLMRALKRRPVQVLRSALVANLGIGPHDHLWEVFVRRRVALMWDWDWRTPFR
                     RVPRRMEVALVYDPARSAAALARVELQDGSALARERGREREQNDQEGAADHVILSSFS
                     SNMSPPQLSPGTEPPRKRAKPAAWQGPSEDRCRASQALPLTPRFQELRARNTDPRASA
                     DVLYDSEG"
     gene            complement(<662465..>663388)
                     /locus_tag="KLTH0H07458g"
                     /db_xref="GeneID:8294521"
     mRNA            complement(<662465..>663388)
                     /locus_tag="KLTH0H07458g"
                     /product="KLTH0H07458p"
                     /transcript_id="XM_002556157.1"
                     /db_xref="GeneID:8294521"
     CDS             complement(662465..663388)
                     /locus_tag="KLTH0H07458g"
                     /note="highly similar to uniprot|P32345 Saccharomyces
                     cerevisiae YDR075W PPH3 Catalytic subunit of protein
                     phosphatase involved in activation of Gln3p which is a
                     transcription factor with a role in nitrogen utilization"
                     /codon_start=1
                     /product="KLTH0H07458p"
                     /protein_id="XP_002556203.1"
                     /db_xref="GeneID:8294521"
                     /db_xref="GOA:C5E2T0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5E2T0"
                     /translation="MKVDETIALLRQGKQVSEETVYTLCLRSQELLMSEANVTRVDTP
                     VTICGDIHGQLHDLLTLFDKSGGVENNKYVFLGDFVDRGFYSLESFLLLLCYKLRYPD
                     RITMIRGNHETRQITKVYGFYDEIVRKYGNSNVWRYCCEVFDYLSLGAVVDGQVFCVH
                     GGLSPNVTTVNQIRAIERKQEVPHEGAMCDLLWSDPDEVSTWSLSPRGAGFLFGRNEV
                     DQFLHCNGLELIARAHQLVMEGYKEMFGGGLVTVWSAPNYCYRCGNVAAVLRIEDGLS
                     REYMIFEAVQAQDDVGNAIIPTKKPQMDYFL"
     gene            <663740..>664927
                     /locus_tag="KLTH0H07480g"
                     /db_xref="GeneID:8294522"
     mRNA            <663740..>664927
                     /locus_tag="KLTH0H07480g"
                     /product="KLTH0H07480p"
                     /transcript_id="XM_002556158.1"
                     /db_xref="GeneID:8294522"
     CDS             663740..664927
                     /locus_tag="KLTH0H07480g"
                     /note="weakly similar to uniprot|Q70DD8 Saccharomyces
                     cerevisiae YER149C PEA2 Coiled-coil polarisome protein
                     required for polarized morphogenesis cell fusion"
                     /codon_start=1
                     /product="KLTH0H07480p"
                     /protein_id="XP_002556204.1"
                     /db_xref="GeneID:8294522"
                     /db_xref="UniProtKB/TrEMBL:C5E2T1"
                     /translation="MGGLKLLRAANPKLFSDPECDKYPTSYDELSVFLKREQVYSGAE
                     LATELDYLDSVLYGDRERGIDLDRKLRVEYAMFKATTMQNERAGPGPSLDELVVLNEQ
                     IQNAHKQRTSEITQKQNAFYAALMALLQSVSLDQAALQSILTAAEGGRDCDDLEKSSS
                     GMSRSIQPSPLDEVTSYLISGALQHGVELKPSTLEPESPRDDITFFKECIDSLLRNVG
                     LTQPPAENQDRDNDRKDETGDSDVAVALKDLQLAHSFLTKKFEGDRNEYLHSIDKLTR
                     TNKELSHELLTYHSELTTVKENCDALTKEREELKSQLEYHTSLNTPTLVASSPVSNAS
                     ASSAASGSKSYSIGVMRSEFKKVLTDTQNRYEKELQEERELRKQLEQELSSFRTRRSG
                     HNL"
     gene            complement(<665022..>665714)
                     /locus_tag="KLTH0H07502g"
                     /db_xref="GeneID:8294523"
     mRNA            complement(<665022..>665714)
                     /locus_tag="KLTH0H07502g"
                     /product="KLTH0H07502p"
                     /transcript_id="XM_002556159.1"
                     /db_xref="GeneID:8294523"
     CDS             complement(665022..665714)
                     /locus_tag="KLTH0H07502g"
                     /note="highly similar to uniprot|P13393 Saccharomyces
                     cerevisiae YER148W SPT15 TATA-binding protein general
                     transcription factor that interacts with other factors to
                     form the preinitiation complex at promoters essential for
                     viability"
                     /codon_start=1
                     /product="KLTH0H07502p"
                     /protein_id="XP_002556205.1"
                     /db_xref="GeneID:8294523"
                     /db_xref="GOA:C5E2T2"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="UniProtKB/TrEMBL:C5E2T2"
                     /translation="MSEESRLKDFQEANKIVFDPSTRSVWETQEKGPNAGLSKTEDED
                     SQNATTSGIVPTLQNIVATVNLDCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTT
                     ALIFASGKMVVIGAKSEDDSKLASRKYARIIQKIGFSAKFTDFKIQNIVGSCDVKFPI
                     RLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFE
                     AIYPVLSEFRKL"
     gene            <666040..>667884
                     /locus_tag="KLTH0H07524g"
                     /db_xref="GeneID:8294524"
     mRNA            <666040..>667884
                     /locus_tag="KLTH0H07524g"
                     /product="KLTH0H07524p"
                     /transcript_id="XM_002556160.1"
                     /db_xref="GeneID:8294524"
     CDS             666040..667884
                     /locus_tag="KLTH0H07524g"
                     /note="similar to uniprot|P40090 Saccharomyces cerevisiae
                     YER147C SCC4"
                     /codon_start=1
                     /product="KLTH0H07524p"
                     /protein_id="XP_002556206.1"
                     /db_xref="GeneID:8294524"
                     /db_xref="InterPro:IPR019440"
                     /db_xref="UniProtKB/TrEMBL:C5E2T3"
                     /translation="MNEKLSASEFYRLSHEYSEHAHQLLRDVSTEQQMQQYQTLIYHA
                     IHALICTKEQFQLSAEQDVTVTLELCNLLVQETVEFDLAETYLSSVKERLHATDLLHE
                     KMLVEEALVRVAKMRGSSQHLKDSLRNVNATLSDLDGSNSAWHLYFSFLRIELISMIS
                     PSDQRILRLFEELIQSSRDAPPFHLFIMCSYLGYCLDQHLSVPMHYLQELATLSDSEA
                     PPPLKLWKHLIELLVLMQIDSNITGKLSEFKEFVTIHKKVLTSPSFNLRLDNKVEITL
                     NSLVFRYKDFKNIILLFQSISYLTNCYDKKANFSTRFLPKVKKAATELLDSAEDANIL
                     AINNMRSFYKRMLDLCHYYTCFEGLILEGVCEEVTDETEYAALINAMKLQLAKNSEGA
                     LQAYSKIIDSKFSTEFRLIGMLNCFVIKVATMSKHGGTVAFDDYQKVNEIWASITHLV
                     DSHEFRMNQTWQCTLVVIWIATHFHPFTNAQLSRENDADYLEKLKWFHSANSYCKVAS
                     SSSHGSVNNEEKPKAPALKKALLLLFLLNYIAGATVVHDLGEKCQISNACFYLGQQQQ
                     MPLMRYLAGLSHLLNCGLAMKSKDVAITRSKLKELVENLLKSGFELAQ"
     gene            complement(<668029..>670734)
                     /locus_tag="KLTH0H07546g"
                     /db_xref="GeneID:8294525"
     mRNA            complement(<668029..>670734)
                     /locus_tag="KLTH0H07546g"
                     /product="KLTH0H07546p"
                     /transcript_id="XM_002556161.1"
                     /db_xref="GeneID:8294525"
     CDS             complement(668029..670734)
                     /locus_tag="KLTH0H07546g"
                     /note="similar to uniprot|P31688 Saccharomyces cerevisiae
                     YDR074W TPS2 Trehalose-6-phosphate phosphatase"
                     /codon_start=1
                     /product="KLTH0H07546p"
                     /protein_id="XP_002556207.1"
                     /db_xref="GeneID:8294525"
                     /db_xref="GOA:C5E2T4"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5E2T4"
                     /translation="MSSDKPGTAEKPVSGRIINCVPQLPYKVSRNDLYTPGENQDPGD
                     EWKLTPISGNSALYSSLYLLRDSPDWEEHVVGWTGEIDPGNKFAYVAPPNQRGTQAAN
                     DNARYNSQESNEDPLYLSQEQKRVIAEKLQDKEDSNNKMTVHPVWLLRRDQLRWREYS
                     DKIVWPALHYILNPPSDGQKENTWWYDYVKFNEAYALKVAQIYQPGDIIWVHDYYLML
                     LPQLLRMRFGDAIIAYFHHTPWPSSEYFRCLSKRKQLLDGILGSNRVCFQNDGFSRHF
                     VSACKRLLDSTSTKKKSKGKGRDEWVISVYGGDVVVDSLPIGVNTEEILRKAFTEDID
                     EKVKVIKEAYANKKIIFGRDRLDTVRGVVQKLQAFEAFLAMYPEYRDKVVLIQVSRPT
                     ATDQGLKLEQQVNDLVNSINAQYGTLNSSPVHHYHVRIPEDAYHSLLRAADLCLITSA
                     RDGMNTTALEYVTVKSRSSIDGCYANPLVLSEFSGTSTVLKDALIVNPWDAVAVARTI
                     KKALCLTAQERVSLEMKLWSKVPTIQDWNNSFLQRMVEIAKHESQDNKITPALNRPLL
                     LQAYRAAKRRLFLFDYDGTLTPIVQDPAAAIPSARLFRILSKLAADPHNLIWIISGRD
                     QQFLSKWLGSRMPQLGLSAEHGCFMKDVSSEEWVNLTTKYDMTWQEKVNEAMEQITVQ
                     TPGSFIEKKKVAVTWHYRRADPEQGEFLAGKLKASLEKFSKDLGLEVMEGKANLEVRP
                     KFVNKGEIVKRLVWHPYGEKQLNEDEFKQDDTVPKSQLPDFVLCLGDDFTDEDMFNQL
                     NDIESVWDKKFPDDKNEAGHYGIYPVTVGSASKKTVAKAHLTDPQQVLDTLGLLVGDV
                     SLFQSPGTVELDDRGHVKDSESSVKSEQAGAAYNMKRSASLKDNA"
     gene            complement(<670978..>671445)
                     /locus_tag="KLTH0H07568g"
                     /db_xref="GeneID:8294526"
     mRNA            complement(<670978..>671445)
                     /locus_tag="KLTH0H07568g"
                     /product="KLTH0H07568p"
                     /transcript_id="XM_002556162.1"
                     /db_xref="GeneID:8294526"
     CDS             complement(670978..671445)
                     /locus_tag="KLTH0H07568g"
                     /note="some similarities with uniprot|P38956 Saccharomyces
                     cerevisiae YDR073W SNF11 component of SWI/SNF global
                     transcription activator complex"
                     /codon_start=1
                     /product="KLTH0H07568p"
                     /protein_id="XP_002556208.1"
                     /db_xref="GeneID:8294526"
                     /db_xref="UniProtKB/TrEMBL:C5E2T5"
                     /translation="MWWLSRACFVCDDYYVTPSPRTVPLPQLLSWPTSSHQPPLTVIH
                     TSEPPPPMDPQEPRHAQYKVQLLLHINSVLLARVNQLSYNTAHFSPEQQQNIVSQYLK
                     RVHANLQCISQLNQGHAGCKPAILEPPQLPSQQPSQDILAKLYLLTSRVFEVW"
     gene            <671945..>673438
                     /locus_tag="KLTH0H07590g"
                     /db_xref="GeneID:8294527"
     mRNA            <671945..>673438
                     /locus_tag="KLTH0H07590g"
                     /product="KLTH0H07590p"
                     /transcript_id="XM_002556163.1"
                     /db_xref="GeneID:8294527"
     CDS             671945..673438
                     /locus_tag="KLTH0H07590g"
                     /note="similar to uniprot|P38954 Saccharomyces cerevisiae
                     YDR072C IPT1 Inositolphosphotransferase 1 involved in
                     synthesis of mannose-(inositol-P)2-ceramide (M(IP)2C)
                     which is the most abundant sphingolipid in cells mutation
                     confers resistance to the antifungals syringomycin E and
                     DmAMP1 in some growth media"
                     /codon_start=1
                     /product="KLTH0H07590p"
                     /protein_id="XP_002556209.1"
                     /db_xref="GeneID:8294527"
                     /db_xref="GOA:C5E2T6"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5E2T6"
                     /translation="MPAVLVSYSSFKSLASLPWQFVVRVYRGGLNRRNIPTLAFNFAL
                     NFFPVFLWLTIFKNAGVIPTRLRPRIHSQLAFLADVFMFGDSAGELVSQYGADARFAA
                     AMTWLTSTVFALAVLVAAPVSVWYYLYYKRRLNYNVIDPYAALFHRNQPFSPTAPRAI
                     LPFLFLIYTFVGLNTVHLLTSQNEDNFTKNKDLLAWTSYVLLHLLAPIFTAVYLYVFH
                     PPGTLKAFSLAMGLQNICGVFSHLLVPMAPPWFVHMYGIKDTEHVSYEQEGFAAGLTR
                     VDSHLGTHLNSKGFHKSPIVFGAVPSLHSAIAVQCFLFLITRATSTKANFGSASQGQN
                     RDCVQLQEPPTIAASQLSAPKEPESFELDSVTDVSLTPSGGSVTPPPNMVYATPIPEA
                     ALNSRWLRIFHIAFLPRFLGTTFPLLQWWSTMYLDHHFRFDLFVGMCYAVTSFLIVNH
                     YYLQPRVLKRWCNLRMGVEPDIRKEAKTMGMRVFENTNVEWFFDPFA"
     gene            complement(<673556..>673801)
                     /locus_tag="KLTH0H07612g"
                     /db_xref="GeneID:8294528"
     mRNA            complement(<673556..>673801)
                     /locus_tag="KLTH0H07612g"
                     /product="KLTH0H07612p"
                     /transcript_id="XM_002556164.1"
                     /db_xref="GeneID:8294528"
     CDS             complement(673556..673801)
                     /locus_tag="KLTH0H07612g"
                     /note="similar to uniprot|P40089 Saccharomyces cerevisiae
                     YER146W LSM5 Component of small nuclear ribonucleoprotein
                     complexes involved in RNA processing splicing and decay"
                     /codon_start=1
                     /product="KLTH0H07612p"
                     /protein_id="XP_002556210.1"
                     /db_xref="GeneID:8294528"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5E2T7"
                     /translation="MSIAEVLPLEIIDKTVGQPVWVMLTSHREFAGTLVGYDDFVNVV
                     LEDVIEYDHDQEIKRHAGKMLLSGNNISMLVPGGKRL"
     gene            <674553..>675140
                     /locus_tag="KLTH0H07634g"
                     /db_xref="GeneID:8294529"
     mRNA            <674553..>675140
                     /locus_tag="KLTH0H07634g"
                     /product="KLTH0H07634p"
                     /transcript_id="XM_002556165.1"
                     /db_xref="GeneID:8294529"
     CDS             674553..675140
                     /locus_tag="KLTH0H07634g"
                     /note="highly similar to uniprot|Q12447 Saccharomyces
                     cerevisiae YDR071C PAA1 Polyamine acetyltransferase
                     acetylates polyamines such as putrescine spermidine and
                     spermine may be involved in transcription initiation"
                     /codon_start=1
                     /product="KLTH0H07634p"
                     /protein_id="XP_002556211.1"
                     /db_xref="GeneID:8294529"
                     /db_xref="GOA:C5E2T8"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5E2T8"
                     /translation="MSSTLPLHMYIRPLMVEDTQDVCDLESRGFPPEERASPETAEFR
                     LTACPELCSGLFIRDVEGSEVKGEKLIGHILGTKIPCSADGTQNALITLESMGKVHDE
                     SSTTVGIHSVVIAPEHQKKNLATLLLTDYIQKLSNQEVGQRIAIIAHEPLVPFYERIG
                     FQLLGENKTVKADPAFSKSKWCDMVRELVKEEYEN"
     gene            <675767..>676057
                     /locus_tag="KLTH0H07656g"
                     /db_xref="GeneID:8294530"
     mRNA            <675767..>676057
                     /locus_tag="KLTH0H07656g"
                     /product="KLTH0H07656p"
                     /transcript_id="XM_002556166.1"
                     /db_xref="GeneID:8294530"
     CDS             675767..676057
                     /locus_tag="KLTH0H07656g"
                     /note="similar to uniprot|Q12497 Saccharomyces cerevisiae
                     YDR070C FMP16 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0H07656p"
                     /protein_id="XP_002556212.1"
                     /db_xref="GeneID:8294530"
                     /db_xref="UniProtKB/TrEMBL:C5E2T9"
                     /translation="MLQQTTRGTRMLAGVAVRAATPRASQRFLSRSCALQMPAGKSDM
                     TQKDMDANKKKLDELEKKSHNGGAYKRPSTDELKKKGEDAQVEQHRPDDGVY"
     gene            <677217..>679802
                     /locus_tag="KLTH0H07678g"
                     /db_xref="GeneID:8294531"
     mRNA            <677217..>679802
                     /locus_tag="KLTH0H07678g"
                     /product="KLTH0H07678p"
                     /transcript_id="XM_002556167.1"
                     /db_xref="GeneID:8294531"
     CDS             677217..679802
                     /locus_tag="KLTH0H07678g"
                     /note="similar to uniprot|P32571 Saccharomyces cerevisiae
                     YDR069C DOA4 Ubiquitin hydrolase required for recycling
                     ubiquitin from proteasome-bound ubiquitinated
                     intermediates acts at the late endosome/prevacuolar
                     compartment to recover ubiquitin from ubiquitinated
                     membrane proteins en route to the vacuole"
                     /codon_start=1
                     /product="KLTH0H07678p"
                     /protein_id="XP_002556213.1"
                     /db_xref="GeneID:8294531"
                     /db_xref="GOA:C5E2U0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5E2U0"
                     /translation="MPHSEETRMFCKSLTQLSRIADQFVKQDGENLDMETLLQECIDT
                     LVNYQDECKKVRKLGPGPDTRDPAVFEAYESAYVYYKIVSQIVLNKIPDLPQFVQAKD
                     SAKSQKERGLLEVYNMLLKTLLTDEKIGELRKFLKDHSRPEPRQHKKGAGDVSKTWAN
                     GQAISPSELQSLLGAQNALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSDTEITR
                     RSLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQR
                     TIILTLQGGFENWCRNRGPCDKSESSEETNFASEYGVPPLIPKILPALRPIPPSAQDP
                     LSVKGGMTLNTSLTHDKPLNTQPFPEQQQPRLKRTSSFKDKFSSLTPSRSRAGSPSLQ
                     SPTILHTDSTTYPDAPQLAPSSVQLNALSQLQPIHSRAVTPQSKSLSPPRYNVNGSGQ
                     LTSDLMGHSPSPPKPVIFPVSSQSSVANYQNGSKPLTRRNTNFTVGLTNLGNSCYMNC
                     IIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTMQQQAASASTKQ
                     NSGDKTAVQPLHFKVACGSINSLFRSSSQQDCQEFCQFLLDGLHEDLNQCGGNPALKE
                     LSEEAEGIREKLCMRIASSIEWERYLTTDFSVIVDLFQGQYASQLTCKVCGRTSTTYQ
                     PFSVLSVPVPSGSKCDIIDCFKEFTKVETLEKDEQWSCPRCKCKQPSTKKITITRLPR
                     NLVIHLKRFDNLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAELPTRGQVPPFNY
                     NLYAVACHFGTLYGGHYTSYVDKGDKAGWCYFDDTSWRKAKSQGECITLSAYVLFYHR
                     KYNVS"
     gene            complement(<679846..>680736)
                     /locus_tag="KLTH0H07700g"
                     /db_xref="GeneID:8294532"
     mRNA            complement(<679846..>680736)
                     /locus_tag="KLTH0H07700g"
                     /product="KLTH0H07700p"
                     /transcript_id="XM_002556168.1"
                     /db_xref="GeneID:8294532"
     CDS             complement(679846..680736)
                     /locus_tag="KLTH0H07700g"
                     /note="weakly similar to uniprot|P54858 Saccharomyces
                     cerevisiae YDR068W DOS2 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm"
                     /codon_start=1
                     /product="KLTH0H07700p"
                     /protein_id="XP_002556214.1"
                     /db_xref="GeneID:8294532"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:C5E2U1"
                     /translation="MEFFYEEQATRNGEQLVEGDLKSDKDTEKAFQELEGTIDEQYQR
                     TARALKKFVNDERDVELNIPLDTRISEKAQGALDSLDTQLQNVEHLAQDYWKKVSTKS
                     FWSSVTNTLGSKLDEVVKVNDQKSSTVCSQTPDAKATTPVAGNRTEAELRMLSSNDKI
                     YLENEDELPDDFKVDEYTAEVSQLLTENKNLELLMNALVPEKLSYQDFWNIFFLKRNR
                     IFEMERKRKELLKKEGEEDKEIDWDDEEEEPELGKASDSENKKEPNKSDIDVQHDEVN
                     DAGAQEKGGDDNDDEDDDWE"
     gene            <680854..>681510
                     /locus_tag="KLTH0H07722g"
                     /db_xref="GeneID:8294533"
     mRNA            <680854..>681510
                     /locus_tag="KLTH0H07722g"
                     /product="KLTH0H07722p"
                     /transcript_id="XM_002556169.1"
                     /db_xref="GeneID:8294533"
     CDS             680854..681510
                     /locus_tag="KLTH0H07722g"
                     /note="similar to uniprot|Q6Q559 Saccharomyces cerevisiae
                     YDR067C which is a model system for studying replication
                     of positive-strand RNA viruses in their natural hosts"
                     /codon_start=1
                     /product="KLTH0H07722p"
                     /protein_id="XP_002556215.1"
                     /db_xref="GeneID:8294533"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5E2U2"
                     /translation="MSLVTPLYFSAVQPNFYRGSCPRETNIPFLNTLGLKYILSLTPE
                     PLTNDAVMSKFCAEKGIQAIHIECNNEKSQKDKSKTKVKRKKKPVPIEYDVVVRCVQF
                     LIDRRHYPCYIHCTNGELVTSLVVACLRKLSYWSTVSIFNEYLTYTSSINIHERGFIE
                     NFNLEIEINDLEMKDKVPWITVRASDVADPHGGNTADKNIRRIQSFPGMLPRLKFHSV
                     "
     gene            complement(<681534..>682742)
                     /locus_tag="KLTH0H07744g"
                     /db_xref="GeneID:8294534"
     mRNA            complement(<681534..>682742)
                     /locus_tag="KLTH0H07744g"
                     /product="KLTH0H07744p"
                     /transcript_id="XM_002556170.1"
                     /db_xref="GeneID:8294534"
     CDS             complement(681534..682742)
                     /locus_tag="KLTH0H07744g"
                     /note="similar to uniprot|P40087 Saccharomyces cerevisiae
                     YER143W DDI1 DNA damage-inducible v-SNARE binding protein
                     contains a ubiquitin-associated (UBA) domain may act as a
                     negative regulator of constitutive exocytosis may play a
                     role in S-phase checkpoint control"
                     /codon_start=1
                     /product="KLTH0H07744p"
                     /protein_id="XP_002556216.1"
                     /db_xref="GeneID:8294534"
                     /db_xref="GOA:C5E2U3"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5E2U3"
                     /translation="MRLTINSEITDEIFGPLDVTAEMSLQDLIALLEFECGFDATKHN
                     LLHKATALNSSESKTLQELQFENDELLVIKAKINNVHENSQSGASMEDMLVEQARQQI
                     LQNPALRAQIVSSNPGFESIINDATAFRQQAGPHLLQSMQGGSRQNPFGIAQTEYDEL
                     MRNPDDPANQKRIGELISQQEIDEQMRNALEFTPEAFTTVHMLYVNLEINGYPVKAFV
                     DSGAQSTIISTKLAEKAGLSRLIDKRFSGEAHGVGVQKIIGKIHIAQVKIETQHVPCS
                     FTVLDTHVDMLLGLDMLKRHQACIDLKDNVLRIAGVQTRFLSEAEIPESLEAKISEST
                     SQGLNIPAPSAQLEPPKKAQTSQPHPERAFPESVVQQLMDLGFSRSEVLRSLEQANGN
                     PDVAAALLFQ"
     gene            <683735..>684559
                     /locus_tag="KLTH0H07766g"
                     /db_xref="GeneID:8294535"
     mRNA            <683735..>684559
                     /locus_tag="KLTH0H07766g"
                     /product="KLTH0H07766p"
                     /transcript_id="XM_002556171.1"
                     /db_xref="GeneID:8294535"
     CDS             683735..684559
                     /locus_tag="KLTH0H07766g"
                     /note="similar to uniprot|P22134 Saccharomyces cerevisiae
                     YER142C MAG1 3-methyl-adenine DNA glycosylase involved in
                     protecting DNA against alkylating agents initiates base
                     excision repair by removing damaged bases to create abasic
                     sites that are subsequently repaired"
                     /codon_start=1
                     /product="KLTH0H07766p"
                     /protein_id="XP_002556217.1"
                     /db_xref="GeneID:8294535"
                     /db_xref="GOA:C5E2U4"
                     /db_xref="InterPro:IPR000035"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:C5E2U4"
                     /translation="MKRSREETVELPQDFAEKHIDTFVKGCHHILGVDPSLYDALLSK
                     DFQLFLKREQPPMDLNHHFIKLASSILAQQISGAAANSVKNKLMAYYGGHFPTYQEVV
                     ETFHKKDVQELRDCGLSARKVQYLESLANYFNDNEKAIEALFEQDNEEIASQLVANIK
                     GIGPWSAKMFLVTSLERMDVFAADDLGIARGCSKYLDCRPEILKELMSKRVQGKTKRS
                     KIVHKKKNWKIYDEDIVEKCGEMFAPYRSIFMFILWRLSSTNIDALAKREKDFVAK"
     gene            complement(<684628..>686067)
                     /locus_tag="KLTH0H07788g"
                     /db_xref="GeneID:8294536"
     mRNA            complement(<684628..>686067)
                     /locus_tag="KLTH0H07788g"
                     /product="KLTH0H07788p"
                     /transcript_id="XM_002556172.1"
                     /db_xref="GeneID:8294536"
     CDS             complement(684628..686067)
                     /locus_tag="KLTH0H07788g"
                     /note="similar to uniprot|P40086 Saccharomyces cerevisiae
                     YER141W COX15 Protein required for the hydroxylation of
                     heme O to form heme A which is an essential prosthetic
                     group for cytochrome c oxidase"
                     /codon_start=1
                     /product="KLTH0H07788p"
                     /protein_id="XP_002556218.1"
                     /db_xref="GeneID:8294536"
                     /db_xref="GOA:C5E2U5"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:C5E2U5"
                     /translation="MFGSLLRNSGPRLSLGSALASRILTRTSIARPSLFSRWSSPARA
                     KNVQVSRGLFTGTTLRQAAATIKKQPAKNLLNSSKSVGYWLVGTSGLVFGIVVLGGLT
                     RLTESGLSITEWKPVTGTLPPMNEQEWLEEFAKYRESPEFQQLNSHIDLDEFKFIFFM
                     EWVHRLWGRAIGLVFVLPAVYFAAARKTSPRVNRRIFSLSLLLGLQGFIGWWMVKSGL
                     DKEQLKERNSKPTVSQYRLTTHLGTAFLLYMGMLWTGIEILKEAKWIKNPAKALGVFA
                     KLDNPAVTPLRRSALGLLALTFVTAMTGGLVAGLDAGLIYNTFPHMGDDWIPSKRELL
                     DPNFARKDDDSDLLWRNMLENPTTVQLNHRIFATITFFSVFGMHMWCNRMKHVLPKNA
                     IKSMHSMMGVATLQVALGIFTLLYLVPVSLGSLHQAGAIALLTNALVFASQLRKPRVP
                     MRILVGGLSTKANSNAGSKILTEASRLAK"
     gene            complement(<687664..>689160)
                     /locus_tag="KLTH0H07810g"
                     /db_xref="GeneID:8294537"
     mRNA            complement(<687664..>689160)
                     /locus_tag="KLTH0H07810g"
                     /product="KLTH0H07810p"
                     /transcript_id="XM_002556173.1"
                     /db_xref="GeneID:8294537"
     CDS             complement(687664..689160)
                     /locus_tag="KLTH0H07810g"
                     /note="similar to uniprot|P40085 Saccharomyces cerevisiae
                     YER140W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H07810p"
                     /protein_id="XP_002556219.1"
                     /db_xref="GeneID:8294537"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:C5E2U6"
                     /translation="MTKRISKPKKPKRSVHWKYIKEILLAEFEVKDAKRKDQSAEDDQ
                     REAEEAEHEMEQILNMLRLFLHMEKLMLFSLLACLNAFLYYFTTFPARLLYNFVGRKK
                     LRQADREFNLLALIALASLVLFRVDTSRVYHRIKGQSAIKLYMMFGVLEMCDKMLSSV
                     GQSLMVIVQTKRTRQTKLQKALLNMCALGYLSCHGYILMYETIALNVAVNSYSNSLLT
                     LLLSMQFAEIKASVFKRFDKEGLFQITISDIIERFQMVILLTIIALRNLVATSTSFST
                     LIPDSWSWNSTSSIVVGILCGPVLTVVGSEILVDWIKHAYITKFNRIRPQMYDTYLRI
                     ISHDHMCNLQKLQIRLGLPVPALVVLFIVMIRPSLKIGLFEVSTSVAGSVAMVLMAFV
                     CLFLTKFVLYLVLARWSQAMQANGLTGSTDTKVTEEMYVPGTPSSGMGKIDEQLRAQL
                     HATDAQQIDTKQKQASVPPSSNEIRAQRDSKRNLKNVTRYKMVSKRIW"
     gene            <689313..>689987
                     /locus_tag="KLTH0H07832g"
                     /db_xref="GeneID:8294538"
     mRNA            <689313..>689987
                     /locus_tag="KLTH0H07832g"
                     /product="KLTH0H07832p"
                     /transcript_id="XM_002556174.1"
                     /db_xref="GeneID:8294538"
     CDS             689313..689987
                     /locus_tag="KLTH0H07832g"
                     /note="similar to uniprot|P40084 Saccharomyces cerevisiae
                     YER139C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H07832p"
                     /protein_id="XP_002556220.1"
                     /db_xref="GeneID:8294538"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:C5E2U7"
                     /translation="MSGVNDIKELVLKPYQSHRQLSIKEADTISLELLDLFSQSNCKD
                     KETLKYIANFLTVETYHDLIDERNLNKRCGYPVCNRSQNRVRDPYGGNMMAKKFLQQN
                     NPYAYLSSYCSKFHYRCSQFYEIQLTDEALFVRIGIHLDNQEQNGSQKHEITLLEDLM
                     QSEQPDQQDLMSIVNGIGQLNIEQSQPSSREELEKDLSDWLSQIKIVENESPSIMGDI
                     LKEEPR"
     gene            complement(<690041..>691123)
                     /locus_tag="KLTH0H07854g"
                     /db_xref="GeneID:8294539"
     mRNA            complement(<690041..>691123)
                     /locus_tag="KLTH0H07854g"
                     /product="KLTH0H07854p"
                     /transcript_id="XM_002556175.1"
                     /db_xref="GeneID:8294539"
     CDS             complement(690041..691123)
                     /locus_tag="KLTH0H07854g"
                     /note="similar to uniprot|Q6Q5U4 Saccharomyces cerevisiae
                     YDR065W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H07854p"
                     /protein_id="XP_002556221.1"
                     /db_xref="GeneID:8294539"
                     /db_xref="GOA:C5E2U8"
                     /translation="MVLHFSNLARHKTFVLHWYRYTLRNVARQTFSWHLKARVKDITR
                     TTIVKHKSDKSSWSIYILLRDLKALNGFLRNKKTAAAWRLLTLYSKKPLRSGASSPSV
                     ALEHSPPLQDPETVRNSHIIHSYIVERQQKNLLPLEIPAEYKTLLLLPLALHDHALKR
                     LHLIESKLVRGPPKVSVNYTSAGKARIWFLRTAVNKNQRQSKALGQIIRREKRKNQKN
                     IDYWEKCRVNGIWAWHEAAWEHLMETNTMLTESPAKYFDNERSRKRAASDGTSVKAVA
                     EWLDPVFSSLDMLQAQSAEQAAYFEQYKHNTVLQGLQQFFARKSDKMYQNRKKRFESL
                     LENDLPFVTPYFSQQNLATVMKSHKF"
     gene            complement(<691624..>692438)
                     /locus_tag="KLTH0H07876g"
                     /db_xref="GeneID:8294540"
     mRNA            complement(join(<691624..692058,692418..>692438))
                     /locus_tag="KLTH0H07876g"
                     /product="40S ribosomal protein S13"
                     /transcript_id="XM_002556176.1"
                     /db_xref="GeneID:8294540"
     CDS             complement(join(691624..692058,692418..692438))
                     /locus_tag="KLTH0H07876g"
                     /note="highly similar to uniprot|P05756 Saccharomyces
                     cerevisiae YDR064W RPS13 Protein component of the small
                     (40S) ribosomal subunit; has similarity to E. coli S15 and
                     rat S13 ribosomal proteins"
                     /codon_start=1
                     /product="40S ribosomal protein S13"
                     /protein_id="XP_002556222.1"
                     /db_xref="GeneID:8294540"
                     /db_xref="GOA:C5E2U9"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:C5E2U9"
                     /translation="MGRMHSSGKGISSSAIPYSRNAPAWFKTSPEAIVEQIIKYARKG
                     LTPSQIGVLLRDAHGVTQTRFITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHL
                     ERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN"
     gene            complement(<693115..>693555)
                     /locus_tag="KLTH0H07898g"
                     /db_xref="GeneID:8294541"
     mRNA            complement(<693115..>693555)
                     /locus_tag="KLTH0H07898g"
                     /product="KLTH0H07898p"
                     /transcript_id="XM_002556177.1"
                     /db_xref="GeneID:8294541"
     CDS             complement(693115..693555)
                     /locus_tag="KLTH0H07898g"
                     /note="similar to uniprot|Q12156 Saccharomyces cerevisiae
                     YDR063W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H07898p"
                     /protein_id="XP_002556223.1"
                     /db_xref="GeneID:8294541"
                     /db_xref="GOA:C5E2V0"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR011171"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5E2V0"
                     /translation="MSSLYHISTETKNTIRKYRTATARSESLQALVIKIEPKPSCEII
                     IDDDEELREASSLEELGEELPDNAPRYVLLCYPMTTADGRKQTPLVLLYWKPATVVSQ
                     EWKMLYAGALEMVRSECGVSKVIEVATGLEDEDEIEELKEQIQG"
     gene            complement(<693778..>695466)
                     /locus_tag="KLTH0H07920g"
                     /db_xref="GeneID:8294542"
     mRNA            complement(<693778..>695466)
                     /locus_tag="KLTH0H07920g"
                     /product="KLTH0H07920p"
                     /transcript_id="XM_002556178.1"
                     /db_xref="GeneID:8294542"
     CDS             complement(693778..695466)
                     /locus_tag="KLTH0H07920g"
                     /note="highly similar to uniprot|P40970 Saccharomyces
                     cerevisiae YDR062W LCB2 Component of serine
                     palmitoyltransferase responsible along with Lcb1p for the
                     first committed step in sphingolipid synthesis which is
                     the condensation of serine with palmitoyl-CoA to form
                     3-ketosphinganine"
                     /codon_start=1
                     /product="KLTH0H07920p"
                     /protein_id="XP_002556224.1"
                     /db_xref="GeneID:8294542"
                     /db_xref="GOA:C5E2V1"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5E2V1"
                     /translation="MSSISNTKVPLFGPAKQSVEHKKNNEFGPLTSDEYLYQVHSRNG
                     EPLRDPVLDAPPYYVVVITYLNYLILIILGHIHDYLGMTFQKEKHRELLEKDGLAPWF
                     SKFESFYVRRLKLRIDDCFSRPTTGVPGRFITCIDRISHDLNSYYTHPGTTTMCLNLS
                     SYNYLGFAQSEGKCTDNAIASVDKYGLTAGGPRAQAGTSDLHLETEKLVARFVGKEDA
                     MVFSMGYSTNANFFNSILDSKCLVISDELNHTSIRTGVRLSGTAVKAFKHNDMEALEK
                     LIKEQIVQGQPKTHRPWKKILICVEGLFSMEGTMCNLPKLIELKNKYKCYLFVDEAHS
                     IGAIGPQGRGVCDYFGINPSEVDIMMGTFTKSFGAAGGYIAADKKVIDKLRCDLTIPN
                     YGESVPAPILAQTSASLRIITGELNPGEGLERLQRIAFNSRYLRLALQRLGFIVYGIA
                     DSPVVPMLLYAPSKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCVSAALTKEDID
                     YLLRHVNEVGEKLFLKVSTGKAGGSLDGKPPRWDIEEVIRRTPSDCKDDKYFLI"
     gene            complement(<696683..>698269)
                     /locus_tag="KLTH0H07942g"
                     /db_xref="GeneID:8294543"
     mRNA            complement(<696683..>698269)
                     /locus_tag="KLTH0H07942g"
                     /product="KLTH0H07942p"
                     /transcript_id="XM_002556179.1"
                     /db_xref="GeneID:8294543"
     CDS             complement(696683..698269)
                     /locus_tag="KLTH0H07942g"
                     /note="similar to uniprot|Q12298 Saccharomyces cerevisiae
                     YDR061W Mitochondrial protein member of the ATP- binding
                     cassette (ABC) transporter family transcriptionally
                     activated by Yrm1p along with genes involved in multidrug
                     resistance"
                     /codon_start=1
                     /product="KLTH0H07942p"
                     /protein_id="XP_002556225.1"
                     /db_xref="GeneID:8294543"
                     /db_xref="GOA:C5E2V2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2V2"
                     /translation="MANFIVRINSGLFKSSLQRSAPTLYSKPIKHFEIKPREKWVIWG
                     AEKAKFLDVIGNKFLPDPPLSLEYGLKKGSFPRVEFVKFSGVIPTAHLSARYEYFKDD
                     FDQTCEKFIKDNTAGSLAVDYEVSKTNRNIDLSLYSELLKDLKLKALEHRWTMGLSNG
                     QMRRARLARSLLKEPDLTLIEDPFLGLDPSATDTISNFIGNYSRSCIVIGLRYQDTIP
                     KWCTHVCCVDENGIAFQGQKSEVKDLMAETRKQYTSNVPGARQPKYQIKDLVSRHPLA
                     QVPKHEIINMPSALELKGLDVSYKGEPVLKDLHWKVAPQSKWHVKGDNGTGKSTLLSL
                     LTADHPQSWNSKVVENGRPRKTGSTDYFTINRNIAMSSPELHAIFVKNSRNGLITREA
                     LASGFQENSSNNFLPYYNVLSKEQKETLAIFADYFGINDLLSRRFEELSVSDQKLVLF
                     VRCLLKMPKILILDEAFSAMETEPMQTCHEFLEYWPGTVFVVSHVPEETPRCDHYLRL
                     ISPGHYEIGDSTPFSRQAPR"
     gene            complement(<698453..>700618)
                     /locus_tag="KLTH0H07964g"
                     /db_xref="GeneID:8294544"
     mRNA            complement(<698453..>700618)
                     /locus_tag="KLTH0H07964g"
                     /product="KLTH0H07964p"
                     /transcript_id="XM_002556180.1"
                     /db_xref="GeneID:8294544"
     CDS             complement(698453..700618)
                     /locus_tag="KLTH0H07964g"
                     /note="weakly similar to uniprot|P39106 Saccharomyces
                     cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
                     integral membrane glycoprotein of the Golgi complex
                     required for addition of alpha1 3-mannose linkages to
                     N-linked and O-linked oligosaccharides one of five S.
                     cerevisiae proteins of the MNN1 family"
                     /codon_start=1
                     /product="KLTH0H07964p"
                     /protein_id="XP_002556226.1"
                     /db_xref="GeneID:8294544"
                     /db_xref="GOA:C5E2V3"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E2V3"
                     /translation="MLRRFLHSLRGVKLPPSRMIVKLAMLLVVVAAAVVLYVQSAKLG
                     HYSKVSKYSPDLEEMDAVRGGNNKHPYNFVDGTSLLQPIKGNKFSPLELIPGYDAEMK
                     EKRKASWDFLARKHRFKTFTELTPKTQCYFFFQKMYQLNNAWSNNYNRWGFIINDEEE
                     EQLSTVDDATKEAIHDKKRAVDIALGMERMRMYDTCFVLDESINVSELFKTLQQSDPN
                     LSGFDQWDFERRMWPMLKPFDKSTFVDIMPNLISPSGVTIEKGYLPPLDSTPDYINNA
                     VKYEYNEKLSFLANWNKMSSIVSRRGLVLGFGDQQLEMASKFIAQLRFIGNTLPIQVV
                     HKGDLSRESIDALLKIAQSDKLTFPKTEYPNAQNVKQELWFVDMGPVLDPDVLNSFSR
                     FKNKWLAQSFNLFEEYVFMDIDAISYVDLNYYFETHEYRQTGTLFFRDRYRGEPISEK
                     CPAMAETLFPSFLENFYWHHYAAVDLDYVEDQCDKYLRPHEKVVKNYFIDNNQHQMES
                     GLVVVHKTSHCVALMLSLMLHMTPALGGCSYGDKEFFWLGFYAAGHDFAFHGGRAGTA
                     GTRKEDEKVNKYFQQKKYEICSVTIAHMSEHEGELLWVNGGAQSCKFDDAEKDWKNEK
                     LGMSTKFSSLEELQRAYREPIDIQHGIIPAEKFDGWGQPDGRCQGYMHCARYEKHMKP
                     YSFSKLHEKGTLIEFQPNKKARYNAINVVWVADYLRQDL"
     gene            <701923..>703266
                     /locus_tag="KLTH0H07986g"
                     /db_xref="GeneID:8294545"
     mRNA            <701923..>703266
                     /locus_tag="KLTH0H07986g"
                     /product="KLTH0H07986p"
                     /transcript_id="XM_002556181.1"
                     /db_xref="GeneID:8294545"
     CDS             701923..703266
                     /locus_tag="KLTH0H07986g"
                     /note="highly similar to uniprot|P39958 Saccharomyces
                     cerevisiae YER136W GDI1 GDP dissociation inhibitor
                     regulates vesicle traffic in secretory pathways by
                     regulating the dissociation of GDP from the Sec4/Ypt/rab
                     family of GTP binding proteins"
                     /codon_start=1
                     /product="KLTH0H07986p"
                     /protein_id="XP_002556227.1"
                     /db_xref="GeneID:8294545"
                     /db_xref="GOA:C5E2V4"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:C5E2V4"
                     /translation="MDESYDVIVLGTGLTECILSGLLSVDGKKVLHIDKQDHYGGESA
                     SVALSQLYQKFKQNPIPKDQMEAKFGRDRDWSVDLIPKFLMADGGLTKILVHTDVTRY
                     IDFKQVAGSYVYNKGKIYKVPSNEMEAISSPLMGIFEKRRMKRFMEWISEYQEDDVKT
                     HQGLDLDKNTMDEVYYKFGLGTSTKDFIGHSMALWTNDDYLQEPARPTFERILLYVQS
                     VARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNTPVEKVLYDDDGKFQGVVTKE
                     GTAKAPLVIADPTYFPEKCKSTGQKVIRAICILNHPVPNTSNADSLQIIIPQSQVGRK
                     NDIYVAVMSDSHNVASKGFYLAIVSTIIETDTPHVELEPAFKLLGPIEERFMGIAEIF
                     EPKESGSTDNVFLSRSYDSSSHFESMTDDVKDIYFRVTGHPLVLKKRPQEEEEEE"
     gene            <703423..>703786
                     /locus_tag="KLTH0H08008g"
                     /db_xref="GeneID:8294546"
     mRNA            join(<703423..703476,703553..>703786)
                     /locus_tag="KLTH0H08008g"
                     /product="KLTH0H08008p"
                     /transcript_id="XM_002556182.1"
                     /db_xref="GeneID:8294546"
     CDS             join(703423..703476,703553..703786)
                     /locus_tag="KLTH0H08008g"
                     /note="highly similar to uniprot|P38203 Saccharomyces
                     cerevisiae YBL026W LSM2 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing
                     splicing and decay"
                     /codon_start=1
                     /product="KLTH0H08008p"
                     /protein_id="XP_002556228.1"
                     /db_xref="GeneID:8294546"
                     /db_xref="GOA:C5E2V5"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:C5E2V5"
                     /translation="MLFFSFFKTLVDQEVTVELKNDIELKGTLKSVDQFLNLKLDNIS
                     CSNESKYPHLSSVRNIFIRGSTVRYVYLNKNMVDTNLLQDAARREAMSARK"
     gene            complement(<703865..>704317)
                     /locus_tag="KLTH0H08030g"
                     /db_xref="GeneID:8294547"
     mRNA            complement(<703865..>704317)
                     /locus_tag="KLTH0H08030g"
                     /product="KLTH0H08030p"
                     /transcript_id="XM_002556183.1"
                     /db_xref="GeneID:8294547"
     CDS             complement(703865..704317)
                     /locus_tag="KLTH0H08030g"
                     /note="weakly similar to uniprot|P40083 Saccharomyces
                     cerevisiae YER137C"
                     /codon_start=1
                     /product="KLTH0H08030p"
                     /protein_id="XP_002556229.1"
                     /db_xref="GeneID:8294547"
                     /db_xref="GOA:C5E2V6"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C5E2V6"
                     /translation="MGSQAQDPEQVSRAMDALARSILAKRVQDHKRKPERLRQLELLK
                     QQFDALVLARQAQKEPAPRAPLLDAAQLDRELEQGLGFVERNGRNYVLLPLVGNPNPA
                     PAAAPGATPAAPKHAKKKKNKIPCSYCHEAGHTRARCEKRLLGESGGL"
     gene            704755..705186
                     /gene="SNR20"
                     /locus_tag="KLTH0H08052r"
                     /db_xref="GeneID:8294548"
     ncRNA           704755..705186
                     /ncRNA_class="SRP_RNA"
                     /gene="SNR20"
                     /locus_tag="KLTH0H08052r"
                     /product="SRP RNA"
                     /note="SCR1 (SRP RNA)"
                     /transcript_id="XR_002432222.1"
                     /db_xref="GeneID:8294548"
     gene            <705605..>706018
                     /locus_tag="KLTH0H08074g"
                     /db_xref="GeneID:8294941"
     mRNA            <705605..>706018
                     /locus_tag="KLTH0H08074g"
                     /product="KLTH0H08074p"
                     /transcript_id="XM_002556184.1"
                     /db_xref="GeneID:8294941"
     CDS             705605..706018
                     /locus_tag="KLTH0H08074g"
                     /note="similar to uniprot|P38204 Saccharomyces cerevisiae
                     YBL025W RRN10 subunit of UAF (upstream activation factor)
                     involved in promoting high level transcription of rDNA
                     Upstream activation factor subunit"
                     /codon_start=1
                     /product="KLTH0H08074p"
                     /protein_id="XP_002556230.1"
                     /db_xref="GeneID:8294941"
                     /db_xref="InterPro:IPR022793"
                     /db_xref="UniProtKB/TrEMBL:C5E2V7"
                     /translation="MDRSVYEACSDLVEQFGHKVSADEILAQKVSNLVPIPFKSREDL
                     ELAALGDKKEGIYSGELAPRIDLKVLHYYATQLIVQKYPHLINCFDETALLTLGLLVE
                     KWVEDYLRAQSDELRTNPARLIAKKTDYRKSPSDI"
     gene            <706261..>708327
                     /locus_tag="KLTH0H08096g"
                     /db_xref="GeneID:8294549"
     mRNA            <706261..>708327
                     /locus_tag="KLTH0H08096g"
                     /product="KLTH0H08096p"
                     /transcript_id="XM_002556185.1"
                     /db_xref="GeneID:8294549"
     CDS             706261..708327
                     /locus_tag="KLTH0H08096g"
                     /note="similar to uniprot|P38205 Saccharomyces cerevisiae
                     YBL024W"
                     /codon_start=1
                     /product="KLTH0H08096p"
                     /protein_id="XP_002556231.1"
                     /db_xref="GeneID:8294549"
                     /db_xref="GOA:C5E2V8"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E2V8"
                     /translation="MARRRNFKKGNRKTFGARDDSNAQKNWTELEKENPKWEKYYKDL
                     GVIPENEWDDFKKTCQAQLPLTFRITGSRKHAHEVLALFEEKHLPGLTNVEFEGEQIQ
                     PPKRLPWYPENLAWQLDVSKQVIRKNEQFSKVQRFLVVENAVGNISRQEAVSMIPPIV
                     LEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVVANDADARRSHMLVHQLKRL
                     NSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTMRKNVNVWKDWGTA
                     SGLGLHTVQLNILKRGLNLLKKGGRLVYSTCSMNPIENEAVVAAALRQWGDKIKLVDC
                     SDKLPGLVRSKGISNWPVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYP
                     HQQNTGGFFITVIEKVGSDSVETAKRATTEEVADEAAVDKKQKTEDGASAAPSAPVKK
                     EKLPRDANEEPFVFLDPKHPELEKCWSFYGIDEKFDKSTCLVRNAAGEPTRVIYYTSS
                     SLKNIIEANEDRLKLVYSGVKLFVAQRSDIECSWRIQNEALQIMKHHMNRNRVVEANV
                     ECFKMLLIESFPRFEDMEKSHIDDNFVEKMKELSAGCAFIHVDRGEDKESMFLPVWNG
                     TKCVNLMVCKESTQELLHRLFGIEVTSKKPAAEPKKEEGDASVEQEGKSEEIAGDDAE
                     KSADTA"
     gene            complement(<708435..>711005)
                     /locus_tag="KLTH0H08118g"
                     /db_xref="GeneID:8294550"
     mRNA            complement(<708435..>711005)
                     /locus_tag="KLTH0H08118g"
                     /product="KLTH0H08118p"
                     /transcript_id="XM_002556186.1"
                     /db_xref="GeneID:8294550"
     CDS             complement(708435..711005)
                     /locus_tag="KLTH0H08118g"
                     /note="similar to uniprot|P29469 Saccharomyces cerevisiae
                     YBL023C MCM2 Protein involved in DNA replication component
                     of the Mcm2-7 hexameric complex that binds chromatin as a
                     part of the pre-replicative complex"
                     /codon_start=1
                     /product="KLTH0H08118p"
                     /protein_id="XP_002556232.1"
                     /db_xref="GeneID:8294550"
                     /db_xref="GOA:C5E2V9"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5E2V9"
                     /translation="MDRRRGREDDDSGDERVVPPSSPQGPSIERSSPLGSPEEIDFEN
                     PDGEVPDQVEDLDDMEEGLDEVDLMGDDMYRDYGSDALRDTYETTGVDDRNQRELSLA
                     ERRRIDSQLNERDRLLRSEAYMDDDEDLDKAHVDEMGLPVQRRRRRRQYEDDDDLLSD
                     IDMDPLAEELTLESLSDVKASSYTEWITQPNVACTIARELKSFLLEYTDEWGRSVYGA
                     RIRTLGELNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDVVAMDATQLHYPDYA
                     RIHSEIHVRISDFPTVLNLRELRESNLNSLVRVTGVVTRRTGVFPQLKYVKFNCLKCG
                     AVLGPYFQDSNEEIKISFCTNCRSKGPFRTNAEKTLYRNYQRLTLQEAPGTVPAGRLP
                     RHREVILLWDLVDIAKPGEEIEVTGVYKNNYDGNLNARNGFPVFATIIEANSIRRREG
                     GRRSGEDEEGLDVFGWTEEEEREFRKISRDRGIIDKVISSIAPSIYGHKDIKTAVACA
                     LFGGVPKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGL
                     TASVRKDPITREWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQNISISKA
                     GIVTSLQARCSIIAAANPNGGRYNSALPLAQNVDLTEPILSRFDILCVVRDLVDEVKD
                     ERLARFVVDSHLRSHPLHDKVGGNGSADEDANDADAAVDEEPMSSRQRRLQRDREREE
                     EISPIPQDTLMKYIQYARTKIYPKLHQMDMDKVSRVYADLRRESITTGSFPITVRHLE
                     SILRIAESFAKMRLSEFVSSWDLDRAIKVIVDSFVGAQKISVRRQLQRSFSIYTLGQN
                     "
     gene            <713577..>714680
                     /locus_tag="KLTH0H08140g"
                     /db_xref="GeneID:8294551"
     mRNA            <713577..>714680
                     /locus_tag="KLTH0H08140g"
                     /product="KLTH0H08140p"
                     /transcript_id="XM_002556187.1"
                     /db_xref="GeneID:8294551"
     CDS             713577..714680
                     /locus_tag="KLTH0H08140g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H08140p"
                     /protein_id="XP_002556233.1"
                     /db_xref="GeneID:8294551"
                     /db_xref="GOA:C5E2W0"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:C5E2W0"
                     /translation="MSDISASEYISQQNALEDEARGLMPWNPSHCTYADGSLRQPIFA
                     CLDCGEIGVCYSCSIQCHADCHLEELFTKRGFTCDCGTERQESKKGEFWCHLRQNLDR
                     DVPSLSNRYSQNFKGLFCDCHNKYKADIDSTMIQCVLGLECNEEWYHCCCILKKHDHA
                     RHCLQSAIQNNQVPSEFPAIDYFEGFICWKCVSRYFTVFQALMSHHRSSDVIAHKVAH
                     LTTFEPLGSEDEAPSLSKKRKRDSNTEQLFSIMLKSGYDKVLLEIKEDLEKTDKLYVF
                     LQDIAPFLINDDPVYEFPEDSDNDISTYELGTKALNTSLDRDTAVAGIQAMDDIKKKL
                     SDFLRPFAEAGEVVKEEDIRNFFELQKGKPKNK"
     gene            complement(<714771..>716291)
                     /locus_tag="KLTH0H08162g"
                     /db_xref="GeneID:8294552"
     mRNA            complement(<714771..>716291)
                     /locus_tag="KLTH0H08162g"
                     /product="KLTH0H08162p"
                     /transcript_id="XM_002556188.1"
                     /db_xref="GeneID:8294552"
     CDS             complement(714771..716291)
                     /locus_tag="KLTH0H08162g"
                     /note="similar to uniprot|P38067 Saccharomyces cerevisiae
                     YBR006w UGA2 succinate semialdehyde dehydrogenase involved
                     in the utilization of gamma- aminobutyrate (GABA) as a
                     nitrogen source"
                     /codon_start=1
                     /product="KLTH0H08162p"
                     /protein_id="XP_002556234.1"
                     /db_xref="GeneID:8294552"
                     /db_xref="GOA:C5E2W1"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5E2W1"
                     /translation="MLRFKQSLIRPKTLFKRFASTSFEDPELFRTKALVNGKWLSGDD
                     QFPVINPSTSEEISTITNCGVADYNEAIGHAHRAFKKFKETSPRERSQVLYNIYDLMS
                     EHKNDLARLITMENGKTFKDSLTEIDYSASYFRWFAEEAPRIYGHVIPSSSSLRKQII
                     TLRQPLGVVGIMAPWNFPSAMIARKLAPVIATGNACVIKPPHESPMSALALGWLAEQA
                     GLSDGVCNVLPTTHTAAIGEYICSHDQVRKITFTGSTKVGKLLMKQCANGNIIKKVSM
                     ELGGNAPFIVFDDADIDKAVNGLISCKFRQLGQTCICANRVFVHESIYGDFATRLVAA
                     IESGFHLGDGFSPKVTHGPLINEGAVQKVSELVEDAKNKGANVLTGGVRASSLGPRFY
                     HPTVLSGVDETMSIFHTEVFGPVASLIGFKTTEEVIERANKTNVGLAGYFYSSNIQTV
                     LDVASELEVGMVGVNSSAISDAAMPFGGIKNSGLGREGSSWGVDDYTDLKSIVLEA"
     gene            complement(<716467..>719784)
                     /locus_tag="KLTH0H08184g"
                     /db_xref="GeneID:8294553"
     mRNA            complement(<716467..>719784)
                     /locus_tag="KLTH0H08184g"
                     /product="KLTH0H08184p"
                     /transcript_id="XM_002556189.1"
                     /db_xref="GeneID:8294553"
     CDS             complement(716467..719784)
                     /locus_tag="KLTH0H08184g"
                     /note="similar to uniprot|P36775 Saccharomyces cerevisiae
                     YBL022C PIM1 Mitochondrial ATP-dependent protease involved
                     in intramitochondrial proteolysis involved in degradation
                     of misfolded proteins in mitochondria required for
                     bigenesis and maintenance of mitochondria"
                     /codon_start=1
                     /product="KLTH0H08184p"
                     /protein_id="XP_002556235.1"
                     /db_xref="GeneID:8294553"
                     /db_xref="GOA:C5E2W2"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="UniProtKB/TrEMBL:C5E2W2"
                     /translation="MLSKGSLSAFRQAYRRPQLLQVRLASSIARASCGISKVIAPLEQ
                     QHWSAYQQQMRSAVLSSELKTLESQWLRSMQLKSEKNNEDESTESKTPGKNTEEDNGD
                     EDPSRPVREEADDESRLDGKYSHTSSAAADGAGTSAPSGGDGSGSGSSGNGDDGDDSK
                     SSPKKQKLPEVYPQMLALPIARRPLFPGFYKAVVISDDRVMKAIKEMLERQQPYIGAF
                     LLKNSDTDTDVIHSPDEVHDVGVFAQITSAFPSKDEKTGAETMTALLYPHRRIKIDEL
                     LPPMENKESERGSAGALGEEELKSSSKQASKSEKKSLQTKKRSDVVDENVDEANPTEF
                     LKNYQISLVNVSNLEDKQFDRKSPVINALTSEILKVFKEISQLNTMFREQIATFSASI
                     QSATTNIFEEPARLADFAAAVSAGEEEELQEILESLDIEQRLERSLVVLKKELMNAEL
                     QNKISKDVETKIQKRQREYYLMEQLKGIKRELGIDDGRDKLIETFKSRVEKLQLPENV
                     QKVFDDEVNKLATLETSMSEFGVIRNYLDWITSLPWGVTSKEQYSIPLAKKILDEDHY
                     GLKDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSIARSLNRQFFRFSVG
                     GMTDVAEIKGHRRTYIGALPGRVIQALKKCETQNPLILIDEIDKIGHGGIHGDPAAAL
                     LELLDPEQNNSFLDNYLDIPIDLSKVLFVCTANSLETIPRPLLDRMEIIELTGYVAEE
                     KIKIAEQYLSPSAKRDAGLENAHVDISESAIVALMKYYCRESGVRNLKKHIEKVYRKA
                     ALNVVKQLKIDDNPVNTVDESGKKTRASAGQSPKGEIVGSTESLAEKDGKLQVEKTHD
                     NKEALVVPGDIEVNVNAENLKDYVGPPIYTSDRLYETTPPGVVMGLAWTSMGGCSMYV
                     ESVLEQPITDKSIPSLERTGQLGDVMKESSRLAYSFARMFLTKKFPENRFFEKAAIHV
                     HCPEGATPKDGPSAGVTMASSFLSLALNKPLEPTVAMTGELTLTGKVLRIGGLREKAV
                     AARRSGAKTIIFPKDNMNDWADLPDHVKEGLEPLAADWYDQIFDKLFSDVSKESGDSV
                     WKAEFDKIDAKEAKNKS"
     gene            complement(<719957..>720508)
                     /locus_tag="KLTH0H08206g"
                     /db_xref="GeneID:8294554"
     mRNA            complement(<719957..>720508)
                     /locus_tag="KLTH0H08206g"
                     /product="KLTH0H08206p"
                     /transcript_id="XM_002556190.1"
                     /db_xref="GeneID:8294554"
     CDS             complement(719957..720508)
                     /locus_tag="KLTH0H08206g"
                     /note="similar to uniprot|P13434 Saccharomyces cerevisiae
                     YBL021C HAP3 Subunit of the heme-activated
                     glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex a
                     transcriptional activator and global regulator of
                     respiratory gene expression contains sequences
                     contributing to both complex assembly and DNA binding"
                     /codon_start=1
                     /product="KLTH0H08206p"
                     /protein_id="XP_002556236.1"
                     /db_xref="GeneID:8294554"
                     /db_xref="GOA:C5E2W3"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5E2W3"
                     /translation="MDKEQEKRDLHNQFVAELREQDRWLPINNVGRLMKNTLPASAKV
                     SKDAKECMQECVSEFISFVTSEANDRCTTDKRKTINGEDILISLNALGFENYAEVLKI
                     YLAKYRQQQALKNQMTYMRRDGESEDLESGSQDEDPASNTAGLEASKEGQVMASDPSN
                     DKEPNKGASKDASHFDQDSQLYL"
     gene            <720642..>722345
                     /locus_tag="KLTH0H08228g"
                     /db_xref="GeneID:8294555"
     mRNA            <720642..>722345
                     /locus_tag="KLTH0H08228g"
                     /product="KLTH0H08228p"
                     /transcript_id="XM_002556191.1"
                     /db_xref="GeneID:8294555"
     CDS             720642..722345
                     /locus_tag="KLTH0H08228g"
                     /note="similar to uniprot|P38206 Saccharomyces cerevisiae
                     YBL020W RFT1 Flippase essential integral membrane protein
                     that is required for translocation of Man5GlcNac2-PP-Dol
                     from the cytoplasmic side to the lumenal side of the ER
                     membrane mutation is suppressed by expression human p53
                     protein"
                     /codon_start=1
                     /product="KLTH0H08228p"
                     /protein_id="XP_002556237.1"
                     /db_xref="GeneID:8294555"
                     /db_xref="GOA:C5E2W4"
                     /db_xref="InterPro:IPR007594"
                     /db_xref="UniProtKB/TrEMBL:C5E2W4"
                     /translation="MEKRGQVSQHESMLKRSAKGVTFLMFSQLFSKIVTFILNTLLVR
                     YLSPRVFGINAFLEFLLSTVLFFSREAIRMSTLRIKSPVAASSATEDDPETDDAGPGV
                     LQTAINFAYIPLCIGVPLSLVLIGWQYSNLNEYFLSLPYFKLSIAMIWLSIIFELLNE
                     PFFVVNQLMLNYKVRSQLESIAVVVSCIANFSIVYVYENKFNGSGIALHDATKQEGIA
                     ILAFAVSKLVHSTALLCCYYYDYLTRLAPAKKFNISPSKVQLSAGTQPYYLQSEVLQH
                     FKKVYLQLCFKHLLTEGDKLIINSMCSVEEQGIYSLLSNYGSLLTRLLFAPIEESLRL
                     FLARLLSVTSTKNTKLSMDVLVNLTKFYLYLSLLILVFGPTNSPFLLQFLIGSKWSST
                     SVLDTIQVYCLYLPFLSINGIFEAFFQSVASGEDILRQSYFMIASSGVFLLSCWLLIS
                     QYKMSLEGLIFSNIINMLLRIGFCGRFINAFYKRVYSDPASHDSTFLLNFSNLKAVSL
                     VALVIALSNYFLFGVVKTFGQLSINAIMAFGLLSLILYKEKDIIRSYLKQSKRDEVKD
                     A"
     gene            <722463..>724001
                     /locus_tag="KLTH0H08250g"
                     /db_xref="GeneID:8294556"
     mRNA            <722463..>724001
                     /locus_tag="KLTH0H08250g"
                     /product="KLTH0H08250p"
                     /transcript_id="XM_002556192.1"
                     /db_xref="GeneID:8294556"
     CDS             722463..724001
                     /locus_tag="KLTH0H08250g"
                     /note="similar to uniprot|P38207 Saccharomyces cerevisiae
                     YBL019W APN2 Class II abasic (AP) endonuclease involved in
                     repair of DNA damage homolog of human HAP1 and E. coli
                     exoIII"
                     /codon_start=1
                     /product="KLTH0H08250p"
                     /protein_id="XP_002556238.1"
                     /db_xref="GeneID:8294556"
                     /db_xref="GOA:C5E2W5"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="UniProtKB/TrEMBL:C5E2W5"
                     /translation="MSEIPNKEGHDVRFLTFNVNGIRTLFHYHPFSSMNSSLSRVFEY
                     FQSDIITFQELKTDTLSLSKWGKVDGFHSFISLPLKRKGYAGVGCWVRIPKPGDSMFS
                     ALQVTKAEEGITGYLQVRVGKTATKYRDNQAVGIGGYEALGIEDEADALSIDSEGRCV
                     MVELKCNMVVISTYCPANSSLTDEGEEMRIRFLKVLFRRIRNLQALGKRVVLMGDINV
                     CRDLIDHAEALKETHIFVTDLTKGTQVEQTYSAFVKDFIFAPSRPARRLLNEMLADSV
                     LKPFAESGSLIDTTRYIQGRDRMKMYTVWNTLRNSRPVNYGSRIDYILATAGLKNDLK
                     KADIWPKIMGSDHCPVFADIQLHYEAEGGPGDPCLAPPFEAKHRHNLNHRDILSMFSR
                     PTKSNLKDSNNFGPGPYRVQKNTSATAQARLLSTSSIHRSIISNESRTKNAGSSSIKK
                     PEPFFQMLNGMLGKPPLCKHNENAILRTSKTKNNPGKKFWACARPTGDENNKEASCSF
                     FQWK"
     gene            complement(<724024..>724338)
                     /locus_tag="KLTH0H08272g"
                     /db_xref="GeneID:8294557"
     mRNA            complement(<724024..>724338)
                     /locus_tag="KLTH0H08272g"
                     /product="KLTH0H08272p"
                     /transcript_id="XM_002556193.1"
                     /db_xref="GeneID:8294557"
     CDS             complement(724024..724338)
                     /locus_tag="KLTH0H08272g"
                     /note="similar to uniprot|P38208 Saccharomyces cerevisiae
                     YBL018C POP8 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="KLTH0H08272p"
                     /protein_id="XP_002556239.1"
                     /db_xref="GeneID:8294557"
                     /db_xref="InterPro:IPR020347"
                     /db_xref="UniProtKB/TrEMBL:C5E2W6"
                     /translation="MTWRQFINNALKKSHGLFGEGCEFYFINQQNTTAYIKVFHKDAD
                     KFSSAVSTFISDEELVGLPLVVHMIQATKALGNLQVEDSDLIWLKNAVREESEDADYI
                     SS"
     gene            complement(<724705..>729315)
                     /locus_tag="KLTH0H08294g"
                     /db_xref="GeneID:8294558"
     mRNA            complement(<724705..>729315)
                     /locus_tag="KLTH0H08294g"
                     /product="KLTH0H08294p"
                     /transcript_id="XM_002556194.1"
                     /db_xref="GeneID:8294558"
     CDS             complement(724705..729315)
                     /locus_tag="KLTH0H08294g"
                     /note="similar to uniprot|P32319 Saccharomyces cerevisiae
                     YBL017C PEP1 Type I transmembrane sorting receptor for
                     multiple vacuolar hydrolases cycles between the late-Golgi
                     and prevacuolar endosome-like compartments"
                     /codon_start=1
                     /product="KLTH0H08294p"
                     /protein_id="XP_002556240.1"
                     /db_xref="GeneID:8294558"
                     /db_xref="GOA:C5E2W7"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="UniProtKB/TrEMBL:C5E2W7"
                     /translation="MIAFKLLLLVWASIALAKWEPRVTSTKSSLSFTLQVFDDSTTLM
                     TIDHGKLKISHDNGLNWDVLDQLGRRVSRVEVDRNYPKSRAFAVDAEGKVVYKTDDKG
                     QHWEKLNFDSPIVGDENDAPLSMTAYFETNPLSDGDILVHVAGCDIVDGNFLHCSSSK
                     RVFVSSNGKDFSLVESLKAESEEKDGEEVFSVFCRFDGFKPEDSEAGDAHGIVCEVDS
                     METKDSETVRSSKVFQSSDYGKTLQIPHGFEDLNIVSLIHVGDYNVITTVEDKYNPDS
                     ASQLWISRDGLNYEKAVIPTRTGRYTFVLKFGSSSKELALQNNAFTDSGEKTPSVLIS
                     TSNGTKFTPLTEAAAVGYYSLSGVGNQEGVVAYTVSTPNYSDESKESPDKAKISFDNG
                     KTWSNLRIDDPDHEFDCDTSDPENCYLRPLWFLEDWRNSHVTTTPGISACVAEVIGDS
                     GKPSSFENVKTFITGNGGYSWHKILDFPASVVFGDYGNIILAVPFSPDNDGDPAAEFY
                     YSLDQGNTWSEYQFKEPLYFINFVPTALDGSGATFILQAATPTGRDDGRFLTVDFSDA
                     FDGNKCTDSDMGEWYTNGGGCVSGSKHKFRRRKEDAKCLVKELFKDLEPTEETCDCTK
                     SDYECSPEFSLNKDGECVLDRNLLEISGTCGGENKDRKIKLLPMVLERGNKCRAPLKI
                     DTIEIDCGAYFEGGEPSPIKIEEHTLDFGLKSYQYFDTIADETLLLGSDNHEVYISYD
                     SGQTTQKLDFQDKIIEVVFNQYFNTSAYLFGSSNKLYVTHDRARSFKEYKLPDAKQLG
                     FPLTFHAKDVDTFIFYGAKDCDSLFSPNCHAVAYITKDGGKRFRELTQGALRCEFIGS
                     INDDSADPDMIMCLVKDKGANERHVVTSSNFFENQKTVFENAIGFISAGEYTIIAVPH
                     DNDELRAYVTVDGREFAEASLPAELNIDKQQAYTVLGSQEGAIFFHLTTEMKQGSEYG
                     ALMKSNSNGTSFVVLERAVNRGSSGFVDFEKALGLEGIIMINTVSNAEEVSSGSGVQK
                     KLKSKISFNDGADWIYLSPPERDSEGKKYQCDSKSLSSCSLNLHGYTERKDERDTYSS
                     GSALGYMIGVGNVGEYLLPKEECSTFITTDGGFTWKEIKKGSYQWEFGDRGSVIVLVK
                     DQQKTDLITYSVDSGKTWNDYKFAGEELYVEDIITTPQDSAMRFLLIGKSSSISGKDT
                     KTFTVDFTQSFDRQCQLDRDYQYRVFGDCLFGHQAEYLQKVNDNCYNGAAPLEGMKKI
                     VKNCSCTRSDFECDYNYYKANDGTCKLVKGLEPADPSQICKKDSDLIEYFEITGYRKI
                     PLSTCEGGLRLDVASKSHACPGKEKEFKNKYGVSGRHILYIMIAPVLIFIGAAWFVYE
                     RGIKRNGGLSRFGEIRLGDDDLVEENFTDRVVNSVVRVGVFGFSALAASKQLVQRNAV
                     NAWQRLKLRIQGGRGGPSYSSLTHEQLLDEADELLAGHDEDANDLASFIDSEGDYDIG
                     AEELPQTHSPAPYTDHEPSDHETSSHETADHNNENGGNSNEV"
     gene            <730027..>731094
                     /locus_tag="KLTH0H08316g"
                     /db_xref="GeneID:8294559"
     mRNA            <730027..>731094
                     /locus_tag="KLTH0H08316g"
                     /product="KLTH0H08316p"
                     /transcript_id="XM_002556195.1"
                     /db_xref="GeneID:8294559"
     CDS             730027..731094
                     /locus_tag="KLTH0H08316g"
                     /note="similar to uniprot|P16892 Saccharomyces cerevisiae
                     YBL016W FUS3 Mitogen-activated protein kinase involved in
                     mating pheromone response activated by phoshporylation by
                     Ste7p provides specificity during the mating vs.
                     filamentous growth response by phosphorylating
                     transcriptional and cytoplasmic targets"
                     /codon_start=1
                     /product="KLTH0H08316p"
                     /protein_id="XP_002556241.1"
                     /db_xref="GeneID:8294559"
                     /db_xref="GOA:C5E2W8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E2W8"
                     /translation="MGKKIVFNISSEFQLQQMLGEGAYGVVCSARHLPTGQMVAIKKI
                     EPFDRPLFCLRTLREIKLLRCFQHENIISIFDIQRPASFETFSEVYIIQELMDTDLHR
                     VITTQTLSDDHVQYFVYQILRALKCLHGAEVIHRDLKPSNLLVNANCDLKLCDFGLAR
                     CAGGGTKPGDAGHMTEYVATRWYRAPEVMLTAAEYTFAMDVWSCGCILAELLMRRPLF
                     PGKDYHHQLLLIFQVIGSPTAGDLGCVRSKRARQYLNTLPRYAGDGNLRSLVPDASAE
                     ALDLLEQMLVFDPRRRITASQALKHPYLQAYHDPQDEPATAKVDPALFHFDERKDKLG
                     AGDLKRLLWDEIFGKRERTDS"
     gene            <732210..>733784
                     /locus_tag="KLTH0H08338g"
                     /db_xref="GeneID:8294560"
     mRNA            <732210..>733784
                     /locus_tag="KLTH0H08338g"
                     /product="KLTH0H08338p"
                     /transcript_id="XM_002556196.1"
                     /db_xref="GeneID:8294560"
     CDS             732210..733784
                     /locus_tag="KLTH0H08338g"
                     /note="highly similar to uniprot|P32316 Saccharomyces
                     cerevisiae YBL015W ACH1 Acetyl-coA hydrolase primarily
                     localized to mitochondria required for acetate utilization
                     and for diploid pseudohyphal growth"
                     /codon_start=1
                     /product="KLTH0H08338p"
                     /protein_id="XP_002556242.1"
                     /db_xref="GeneID:8294560"
                     /db_xref="GOA:C5E2W9"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /db_xref="UniProtKB/TrEMBL:C5E2W9"
                     /translation="MTISSVLKKRVRYAPYLERLVQPQELVPLFRTGQNLGWSGFTGV
                     GAPKIVPQVLADHVATNSLQGQLRFNLFVGASAGPEESRWAELDMISRRSPHQVGKPI
                     SRAINDGRIQFFDKHLSMFPQDLTYGFYTRERPAGAPILDYAIIEATAIKEDGSIVPG
                     PSVGASPEFVAVADKVILEVNTATPSFEGMHDIDMPVNPPHRPPYPYMSVDQRNGLDS
                     IPIDPAKVVAIVESNQRDIVPPNTEADDASRAIASHLIGFLEHEVTCGRLPANLHPLQ
                     SGIGNIANAVIEGLSSASFKNLTVWTEVLQDSFLDLFENGSLDFATATSIRLTEPGFR
                     RFFDNWDEFSKKLCLRSQVVSNNPELIRRLGVIAMNTPVEVDIYAHANSTNVSGSRML
                     NGLGGSADFLRNAKLSIMHTPAARPSKTDPTGISTIVPMASHVDQTEHDLDIVVTDQG
                     LADLRGLSPTERAREIINHCAHPDYKPILTDYLDRAEFYARKHKCLHEPHILKNAHKF
                     HINLAEKGTMKVDSWD"
     gene            complement(734055..734128)
                     /locus_tag="KLTH0H08360r"
                     /db_xref="GeneID:8294561"
     tRNA            complement(734055..734128)
                     /locus_tag="KLTH0H08360r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.40"
                     /db_xref="GeneID:8294561"
     gene            <734831..>735364
                     /locus_tag="KLTH0H08382g"
                     /db_xref="GeneID:8294562"
     mRNA            <734831..>735364
                     /locus_tag="KLTH0H08382g"
                     /product="KLTH0H08382p"
                     /transcript_id="XM_002556197.1"
                     /db_xref="GeneID:8294562"
     CDS             734831..735364
                     /locus_tag="KLTH0H08382g"
                     /note="similar to uniprot|P40081 Saccharomyces cerevisiae
                     YER134C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H08382p"
                     /protein_id="XP_002556243.1"
                     /db_xref="GeneID:8294562"
                     /db_xref="GOA:C5E2X0"
                     /db_xref="InterPro:IPR010033"
                     /db_xref="InterPro:IPR010036"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR024734"
                     /db_xref="UniProtKB/TrEMBL:C5E2X0"
                     /translation="MPYPEVAAFDLDYTVWPCFCDTHLNPPFKPVTGKNGEVHTLIDS
                     YGYEVAFYKDVPRILADLKSHGVKIVSASRTWAPDIARDLLRGFKVEYEGEIVPLITL
                     FDSLQWGERSKVNHISLGIKDIFGKKADIKDYKCCLFDDESRNRDVERYGVKYVYVRD
                     PEKGTTWDLYQRYLSGN"
     gene            735510..735582
                     /locus_tag="KLTH0H08404r"
                     /db_xref="GeneID:8294563"
     tRNA            735510..735582
                     /locus_tag="KLTH0H08404r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8294563"
     gene            736141..736248
                     /locus_tag="KLTH0H08426r"
                     /db_xref="GeneID:8294564"
     tRNA            join(736141..736176,736213..736248)
                     /locus_tag="KLTH0H08426r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove"
                     /db_xref="GeneID:8294564"
     gene            complement(<736894..>738819)
                     /locus_tag="KLTH0H08448g"
                     /db_xref="GeneID:8294565"
     mRNA            complement(<736894..>738819)
                     /locus_tag="KLTH0H08448g"
                     /product="KLTH0H08448p"
                     /transcript_id="XM_002556198.1"
                     /db_xref="GeneID:8294565"
     CDS             complement(736894..738819)
                     /locus_tag="KLTH0H08448g"
                     /note="highly similar to uniprot|P10592 Saccharomyces
                     cerevisiae YLL024C SSA2 member of 70 kDa heat shock
                     protein family"
                     /codon_start=1
                     /product="KLTH0H08448p"
                     /protein_id="XP_002556244.1"
                     /db_xref="GeneID:8294565"
                     /db_xref="GOA:C5E2X1"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5E2X1"
                     /translation="MSKAVGIDLGTTYSCVAHFSNDRVEILANDQGNRTTPSFVAFTD
                     TERLIGDAAKNQAAMNPANTVFDAKRLIGRNFTDAEVQGDVKHFPFKVVDVGGKPQIQ
                     VEFKGETKVFTPEEISSMILTKMKETSENYLGCKVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKSEGEKNVLIFDLGGGTFDVSLLSIEDGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLTSNQRALRRLRTACERAKRTLSSSA
                     QTSIEIDSLFEGIDLYTSITRARFEELCADLFRSTIDPVEKVLRDAKLDKSQVHEIVL
                     VGGSTRIPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSKTQDLLLL
                     DVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERARTKD
                     NNLLGKFDLSGIPPAPRGVPQIEVTFDVDANGILNVSAVEKGTGKSEKITITNDKGRL
                     SKEDIERMVSEAEKFKEEDEKEAARIGAKNQLESMAFSLKNTISEAGDKLEAADKETL
                     TKKCDEVVSWLDSNTTATTEEYNDQLKELQEVSNPIMSKLYQQGGAAPGGAAPGGFPG
                     GSAPAPEAEGPTVEEVD"
     gene            complement(<739626..>740438)
                     /locus_tag="KLTH0H08470g"
                     /db_xref="GeneID:8294566"
     mRNA            complement(<739626..>740438)
                     /locus_tag="KLTH0H08470g"
                     /product="KLTH0H08470p"
                     /transcript_id="XM_002556199.1"
                     /db_xref="GeneID:8294566"
     CDS             complement(739626..740438)
                     /locus_tag="KLTH0H08470g"
                     /note="similar to uniprot|Q12164 Saccharomyces cerevisiae
                     YLL023C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H08470p"
                     /protein_id="XP_002556245.1"
                     /db_xref="GeneID:8294566"
                     /db_xref="GOA:C5E2X2"
                     /db_xref="InterPro:IPR005344"
                     /db_xref="UniProtKB/TrEMBL:C5E2X2"
                     /translation="MPPSQGVPRHFQVSRFLELLKTSQFAWFAGHLVALASAFLYLVT
                     FRGGSSGAHNTFYRVLYLGVIESFGIIIYQQHFKRGTPAAGASSAGPRPPVLQLILRD
                     DNALYVALAFMWLLTPRLSLTMFPYVVFSFFHFLTYLKSVILPQVFEIGAKSRLVMAI
                     DKFVRENSDRSMVWSSFSELVCLALVLMRALLWYPKSWITAIVYCLFIKIRYETSPYM
                     KSGVKKWEVRLDGLVSHPQVPAALKNGYVLFKNNIRELRKYNLSGTAPPKSM"
     gene            complement(<740579..>741580)
                     /locus_tag="KLTH0H08492g"
                     /db_xref="GeneID:8294567"
     mRNA            complement(<740579..>741580)
                     /locus_tag="KLTH0H08492g"
                     /product="KLTH0H08492p"
                     /transcript_id="XM_002556200.1"
                     /db_xref="GeneID:8294567"
     CDS             complement(740579..741580)
                     /locus_tag="KLTH0H08492g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H08492p"
                     /protein_id="XP_002556246.1"
                     /db_xref="GeneID:8294567"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019544"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5E2X3"
                     /translation="MGGREEIKHLLAEAAKFYAARDYEKSTNLYSEVNALHDTLTGTS
                     SADYLFLYGKSLFQLALSQSEVFGKDEETAGGESDSDEEESSKKHELYQFSETLAEGD
                     EIEKGDDAEQDDEEVEGEHPGENEHEGAGDEGQEEEPSDFENAWEILELARSVYEKQP
                     QEPETLRKLSETYDILGEISLETENFPQAKQDFEKCLELRQAVYGTVDATHRLIIESY
                     YKLSLVLEFDPNDAKDCQENLSKAVELLEKRIKEKGAEGGDDGLLEELKLKLKELKTT
                     EASLNAIKHQSMAQIKEALGLPSDSKSAPAAVNDLTSMVKKRKSKPEKDTASKKQKN"
     gene            <741823..>743307
                     /locus_tag="KLTH0H08514g"
                     /db_xref="GeneID:8294568"
     mRNA            <741823..>743307
                     /locus_tag="KLTH0H08514g"
                     /product="KLTH0H08514p"
                     /transcript_id="XM_002556201.1"
                     /db_xref="GeneID:8294568"
     CDS             741823..743307
                     /locus_tag="KLTH0H08514g"
                     /note="similar to uniprot|P32457 Saccharomyces cerevisiae
                     YLR314C CDC3 Component of the septin ring of the
                     mother-bud neck that is required for cytokinesis septins
                     recruit proteins to the neck and can act as a barrier to
                     diffusion at the membrane and they comprise the 10nm
                     filaments seen with EM"
                     /codon_start=1
                     /product="KLTH0H08514p"
                     /protein_id="XP_002556247.1"
                     /db_xref="GeneID:8294568"
                     /db_xref="GOA:C5E2X4"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2X4"
                     /translation="MQAGEPIEELKSAASTENEFGSVSADVKEENMPDAIEPASSVNG
                     HGSDVASEGEVQQKGQVLPKQPELRVLHHKISGYVGFANLPKQWHRKSIRRGFSLNLL
                     CVGQGGLGKSTLINTLFNKQLYDLEGKPTEDLAALKLEDSENLSESLERPQGEEQPSV
                     KIETISTDIEENGVKLALTVVDAPGFGDAIDNTDSWVPIVREIDSRFDQYLDAENRID
                     RDVIQDHRIHACLYFIEPTGHCLAPLDLEFCKAVHQKCNLIPVIAKSDILTDEEIEQF
                     KHTIKTQLDNAGVELFEPPQYSLDDKDTVARCAALCTRMPFAVVGSTSEVSTPDGRRV
                     RGRSYPWGVIEVDNESHSDFVHLRDLLIRLYLMELREKTENVLFERYRSEKLMSLGIK
                     QDNSVFKEYDPELKQKEEKQLHEAKLAKLEAEMKAVFQQKVNEKEKKLQKSEAELFAR
                     HKEMKDKLLKQLKALEDKKHQLEMSYANQSANSPAQTKKKGFLR"
     repeat_region   743818..744059
                     /rpt_type=long_terminal_repeat
     gene            744117..744208
                     /locus_tag="KLTH0H08558r"
                     /db_xref="GeneID:8294570"
     tRNA            join(744117..744153,744173..744208)
                     /locus_tag="KLTH0H08558r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8294570"
     gene            744429..744500
                     /locus_tag="KLTH0H08580r"
                     /db_xref="GeneID:8294571"
     tRNA            744429..744500
                     /locus_tag="KLTH0H08580r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (AGG) cove score=66.45"
                     /db_xref="GeneID:8294571"
     gene            <744917..>749275
                     /locus_tag="KLTH0H08602g"
                     /db_xref="GeneID:8294572"
     mRNA            <744917..>749275
                     /locus_tag="KLTH0H08602g"
                     /product="KLTH0H08602p"
                     /transcript_id="XM_002556202.1"
                     /db_xref="GeneID:8294572"
     CDS             744917..749275
                     /locus_tag="KLTH0H08602g"
                     /note="weakly similar to uniprot|P23201 Saccharomyces
                     cerevisiae YLL021W SPA2 Component of the polarisome which
                     functions in actin cytoskeletal organization during
                     polarized growth acts as a scaffold for Mkk1p and Mpk1p
                     cell wall integrity signaling components potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="KLTH0H08602p"
                     /protein_id="XP_002556248.1"
                     /db_xref="GeneID:8294572"
                     /db_xref="InterPro:IPR013724"
                     /db_xref="UniProtKB/TrEMBL:C5E2X5"
                     /translation="MVTSKADLTAEQRGQLYGYFCELRDFFQVTGTKHDRSNSARAQK
                     ARSKLLKLYPSQFFELSTDVHDELQRRIDENQAQPDHLLPKDTFHVKRNQARQKLANL
                     SQSRFNDLVDDILYEIKRRNYHEKPEHKGTDISEKYSGGTPTSSSHFEGVFSGDEAGN
                     HTKDTGETSDASQADIHNQKNGYTIAPEMVLSDTNESPSKITPNASVQASQVIPKKAS
                     IEWSSDEEDEDDSHKPKQVSDKEQDSPVSNSQTGETTIQSPLFSSKDADRLHFSENEN
                     GFNKHASPSREENYTFSEEFSSQSPLFSSSKKTKRFSELEDDLNHSRKSISGNENGLL
                     GQSPPQSPLFSLQHRETDGNPELLSASELKDDRKEVEAAHSWGNYSEGHASGKALQGA
                     LADDLLPVSRGLPEDRRAAPNTSSTNDDNVGNTSRTSHPGRTSNESGTSINAYTGNRG
                     SIKRASLEHENSKREIEVLMAEGTKMDMRITELENSNSILSSAKNELDRRIQDHQSEI
                     LELKSRLEKSSKEAEDAKAEVLRLTEQEVKEGDSLGKSIDQSHQEEFARLTKQVNSLS
                     IENEELKQKNAELEFKMKLLNSSNRKDEKSISPSTRQKAVGSDRLKEKELLSDPEALK
                     RYSSEDGLLPLDLILSFNKQIETIFYHLHDKQHLPAFGDQLFEDISRISELIHKTIKL
                     VDVSDHQDQVILLKASLSHAITSVRYFASYHDILPPITVESAISDISFAVCGLLDVVK
                     IIDAPQAVISKQHLSEPSPQTPIMKNMKSSSSLAGEEANSGLKDPRGINKHAIEESNN
                     SMSPVKPLKITQKVVQNSPPTKPTISARKPSSTLFTSMLSPSLSNNSSPRNSQFSNLR
                     FASGAKSEEDVRIDKGSESKSHSQTDKEDSARSPEGGISVKEKMDNSLQEASKNGNNS
                     GLSAQERLFLNGKENHNLSKGEESRKIEKRVDSIIPTSETKSSVPEKFNRGPDFSLCA
                     ASGGDTTDDQYNHKSDASNTTSDEDLTYQALKQSMKKNHEIAGEKKIESSMPSKKPEG
                     KINVPKLRSSLDSSPKRGGGDSDGVSALKTIQGAVHAKESPAEPPRIIKQVITTQMEG
                     PPDETDADIETSPFRFDDAMALERSVNHKSPTKNLELSPLKNSEVKVKDRAVATTENR
                     AFDVENSAIEINDTNSRAPSGAVNGFSKQKENLSLDENSKKKQIKPFLEGVKKGTDAN
                     AQKTSPNPSTTQSSSTSQPIIKVSNFGSEGSPAARTVVKEEEIEDVRNVPAINRAKST
                     SSNNQKSSARLSNTSLAEKEYEDEGDFDIDAFDIENPDNTLSELLLYLEHQTIEVIST
                     IQSLLTSIKQPQASTGELRKGSGAITRVIAQMIEATSVSMAQSRNAPLKEHGNWVVQS
                     LEDCQRRMTTLCRLKRDGTVEVNEGDSDYADKHFKQRLAGIAFDVAKCTKELVKTVEE
                     ASLKEEIEFLNSKISS"
     gene            complement(<749443..>750159)
                     /locus_tag="KLTH0H08624g"
                     /db_xref="GeneID:8294573"
     mRNA            complement(<749443..>750159)
                     /locus_tag="KLTH0H08624g"
                     /product="mitochondrial 54S ribosomal protein YmL15"
                     /transcript_id="XM_002556203.1"
                     /db_xref="GeneID:8294573"
     CDS             complement(749443..750159)
                     /locus_tag="KLTH0H08624g"
                     /note="similar to uniprot|P36523 Saccharomyces cerevisiae
                     YLR312W-A MRPL15 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL15"
                     /protein_id="XP_002556249.1"
                     /db_xref="GeneID:8294573"
                     /db_xref="GOA:C5E2X6"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:C5E2X6"
                     /translation="MLQVTKRQTGVLTGIIKANFGARNITYLHSGSRVRGLKRDPSEY
                     LRLQNGLMYNEVKPENYQENVRKQLNLAKHNISLSDDIILQCLTHKSFAHGSKPYNEK
                     LAALGMQFLKYHTSVHSLRSAKPLSPVAEGKNQKSINGLNFTNLGTQLSKLLIAKKTT
                     AQVIRSRHLDSLIFWKKRDPLKNESFNGETTVYSGVLSALVGGILVTNGPQKTSQFIE
                     KELLDPKKEASLVQIAKTMA"
     gene            <750413..>752113
                     /locus_tag="KLTH0H08646g"
                     /db_xref="GeneID:8294574"
     mRNA            <750413..>752113
                     /locus_tag="KLTH0H08646g"
                     /product="KLTH0H08646p"
                     /transcript_id="XM_002556204.1"
                     /db_xref="GeneID:8294574"
     CDS             750413..752113
                     /locus_tag="KLTH0H08646g"
                     /note="highly similar to uniprot|P45818 Saccharomyces
                     cerevisiae YGL171W ROK1 ATP-dependent RNA helicase of the
                     DEAD box family required for 18S rRNA synthesis"
                     /codon_start=1
                     /product="KLTH0H08646p"
                     /protein_id="XP_002556250.1"
                     /db_xref="GeneID:8294574"
                     /db_xref="GOA:C5E2X7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2X7"
                     /translation="MDIFQVLTRGANVKKNGKLGASGDFSKSNGSQRKQIQAGSTRKE
                     DDNKQLTKELDFFRNKKVVSKTENAQAGKHDPAEDIAAEVSTLGDEMPPPKISSAHDA
                     VLLRKSYKGNVTGQDLPLPIGSFEDLITRFQFDKRLLSNLIESHFTEPTPIQCEAIPL
                     ALEGRDVLACAPTGSGKTVAFILPLLQQIISLGDKEGLKGLIISPTKELANQIFVECS
                     KLSHKIYLARKRPLNIALLSKSLSAKLRNKVISDKKYDLIISTPLRLIDVVKNEALDL
                     SDVKHLIFDEADKLFDSTFVEQADSILASCQDSQLRKSMFSATVPSSLEEVVNSIMLD
                     PVRIIIGHKEAANVNIEQKLVYCGNEEGKLVAIRQMIQEGGFKPPVIIFLESITRAKA
                     LFHELLYDNLNVDVIHAERTQVQRNTIIERFRTGELWCLICTDVLARGVDFKGVNLVI
                     NYDVPRSAQAYVHRIGRTGRGGREGKAVTFYTKQDDMAIKPIINVMRQSGFEIAEWME
                     KFAKMTKREKEALKKGKSRPERKQISTVPNVVKKKRRQREQMVEASKKRKEQDDEERS
                     "
     gene            complement(<752358..>752717)
                     /locus_tag="KLTH0H08668g"
                     /db_xref="GeneID:8294575"
     mRNA            complement(<752358..>752717)
                     /locus_tag="KLTH0H08668g"
                     /product="KLTH0H08668p"
                     /transcript_id="XM_002556205.1"
                     /db_xref="GeneID:8294575"
     CDS             complement(752358..752717)
                     /locus_tag="KLTH0H08668g"
                     /note="highly similar to uniprot|Q12233 Saccharomyces
                     cerevisiae YPR020W ATP20 Subunit g of the mitochondrial
                     F1F0 ATP synthase which is a large enzyme complex required
                     for ATP synthesis associated only with the dimeric form of
                     ATP synthase"
                     /codon_start=1
                     /product="KLTH0H08668p"
                     /protein_id="XP_002556251.1"
                     /db_xref="GeneID:8294575"
                     /db_xref="GOA:C5E2X8"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="UniProtKB/TrEMBL:C5E2X8"
                     /translation="MLARIQSFATGIASKAQTYTTKTFYYSKVVGELSKQVYLKEGLQ
                     PPAISDFQSVYTKLYKQALDLALKPRQSLSLFKNIQKDSVLKYGAYGVQLAGLYSLGE
                     VIGRRKVVGYTNYAAHH"
     gene            complement(<753192..>755921)
                     /locus_tag="KLTH0H08690g"
                     /db_xref="GeneID:8294576"
     mRNA            complement(<753192..>755921)
                     /locus_tag="KLTH0H08690g"
                     /product="KLTH0H08690p"
                     /transcript_id="XM_002556206.1"
                     /db_xref="GeneID:8294576"
     CDS             complement(753192..755921)
                     /locus_tag="KLTH0H08690g"
                     /note="highly similar to uniprot|P30665 Saccharomyces
                     cerevisiae YPR019W CDC54 Essential helicase component of
                     heterohexameric MCM2-7 complexes which bind
                     pre-replication complexes on DNA and melt the DNA prior to
                     replication accumulates in the nucleus in G1 homolog of S.
                     pombe Cdc21p"
                     /codon_start=1
                     /product="KLTH0H08690p"
                     /protein_id="XP_002556252.1"
                     /db_xref="GeneID:8294576"
                     /db_xref="GOA:C5E2X9"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5E2X9"
                     /translation="MSDNRSSPAHDGGSSPMAAPPSSLGGSSPPLFYNPSSSSQPDTY
                     ESQQRQHAVGSSPFRYPSSSQGHPHATSDTFASQRRSQRSSGFGRFTDQSSEPDLLSS
                     SLSGHASQRSSQRRSDLHASDLSSPRRIVDLDSQPAPSSSSDPVSEAAEPLRIIWGTN
                     VSIQECATNFRNFLMSFKYKYRKVLDQNEDLINDTEDQELYYVKRLNQMMEMGSLNLN
                     LDARNLLSFKPTEKLYYQLMSYPQEIISIMDQTVKDCMVSLVVDSNAESTLDDVESKF
                     YKIRPYNIETKKGMRELNPNDIDKLISVKGLVLRSTPIIPDMKVAFFKCNICDHTTVV
                     EIDRGVIQEPARCPRVACNQQNSMTLVHNRCSFADKQVIKLQETPDTVPDGQTPHSVS
                     LCVYDELVDSCRAGDRIEITGIFRSIPVRASSTQRALRSLYKTYLDVVHVKKVAHDRL
                     GADTSTVEQELMQNELIHADVQEVPKVSDDQIRKIHAVAARDDVYEVLARSIAPSIFE
                     LDDIKKGILLQLFGGTNKTFTKGGRYRGDINILLCGDPSTAKSQILQYVHKIAPRGVY
                     ASGKGSSAVGLTAYVTRDIDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEV
                     MEQQTISIAKAGIITTLNARTSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVY
                     LVLDKVDEATDRDLAKHLTNLYLEDAPANETEGDVLPVELLTTYINYAKQQYAPVITE
                     QAKTELVRAYVTMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSQLVELQDV
                     QEAVRLIKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREMVNILRERPNNT
                     ISYNELVRSINEQSQDKVDVTDISEALSRLQQEDKVVVLGEGVRRSIRLNGRI"
     gene            complement(<756097..>757845)
                     /locus_tag="KLTH0H08712g"
                     /db_xref="GeneID:8294577"
     mRNA            complement(<756097..>757845)
                     /locus_tag="KLTH0H08712g"
                     /product="KLTH0H08712p"
                     /transcript_id="XM_002556207.1"
                     /db_xref="GeneID:8294577"
     CDS             complement(756097..757845)
                     /locus_tag="KLTH0H08712g"
                     /note="some similarities with uniprot|Q12495 Saccharomyces
                     cerevisiae YPR018W RLF2 Chromatin Assembly Complex subunit
                     1: largest (p90) subunit of three-subunit protein complex
                     (yeast CAF-I) involved in DNA-replication- linked
                     nucleosome assembly. Homol. to p150 subunit human
                     Chromatin Assembly Factor-I (CAF-I) p90 subunit of yeast
                     Chromatin Assembly Factor-I (CAF-I)"
                     /codon_start=1
                     /product="KLTH0H08712p"
                     /protein_id="XP_002556253.1"
                     /db_xref="GeneID:8294577"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y0"
                     /translation="MASILSDSSLSDVGSPEVPTVAEQITSSDLLGNLKDEQESREGP
                     QSSQSLTDESESPQRSKDADQLRSLEGVESTNSEIEKAAATKVRKEEAKKLREQLKQE
                     QKLQKELKKEQERKDKELKKEQERREKEQRKLEEKKRKEEEKKERERRREEEKRSREL
                     KREQEKREREVRREEEKRRKLVEKLKIEEEKRKKEEAIEKSQTRIGSFFKKSSTHKNV
                     VSTKTDFEKSFLPFYIKDGTIMGENFKSSPKDLERSKAEIDAQMKLSSNEDDTIKWLE
                     SCRVSRGHPVMKSAVELIQMMTSKNKTNKELEQHLQQIPHKFIKFYENVRPPYIGTYS
                     KFVDMPRDNPFTIELTGFDYDYDSDWDWVDEEEEEGGGVDDLEDGDEEEDDDDEPEEG
                     TDGEFEGFLDREDSQGPRDGKKFLGPLIPTIKLRSQISELDEDDQLYFQMVAVEYLIK
                     EQPFPVDPAHYPVASSKRSLVEASLPTKGSKDSPTDDGTSDARSKKPKTLVTEPVDLL
                     RLFNEVHESTFSLGTITEILQKNLPHYSKETIRNTIKEHTTRPATKAGGSRKWVLKNL
                     DHWEALKRSHGSFSAN"
     gene            complement(<758082..>759479)
                     /locus_tag="KLTH0H08734g"
                     /db_xref="GeneID:8294578"
     mRNA            complement(<758082..>759479)
                     /locus_tag="KLTH0H08734g"
                     /product="KLTH0H08734p"
                     /transcript_id="XM_002556208.1"
                     /db_xref="GeneID:8294578"
     CDS             complement(758082..759479)
                     /locus_tag="KLTH0H08734g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H08734p"
                     /protein_id="XP_002556254.1"
                     /db_xref="GeneID:8294578"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y1"
                     /translation="MSEGDSDCDLSELSHGLTQLSLRPANRSAASPARGARAPAKSAL
                     PKADSSSRVHLASVRNENYHLKLELTQKSQELEALRRQMQSLEKRKQMLGSTDGLLSL
                     RNMKVHTWEPAGSPTRPHQSTLSECEIVTHFSGSPYKGERLGSQQDTASRASTSNSRV
                     RRNHNFFRNFVVPFLQRNIDAFRHSDMFCDEAANLGQKLEEFKIHGSKNKELKVQLMM
                     DILDGLNHLQQQCVAVLNRELQAKKVSSQLEFLFTVFLDPEQYGLVRQAHVEKLRQEL
                     YDVMLQLWDYDGRRPLSQEGSPSRKPTISGLPAKQMPRSGKIPKLQPQGFGKMARTLR
                     KTPCDLPVAPSGVLENPRSTEFSPSNKPRAANRLDPLNNAYASERSRLKQNRDALEFI
                     PIGYNEVMLSKKTPDRRPKSRSKLQESIHMTPLTRCANNEEEMETDSLQVFITEFFKD
                     TQSQDDSTTTVASNF"
     gene            <759812..>760219
                     /locus_tag="KLTH0H08756g"
                     /db_xref="GeneID:8294579"
     mRNA            <759812..>760219
                     /locus_tag="KLTH0H08756g"
                     /product="KLTH0H08756p"
                     /transcript_id="XM_002556209.1"
                     /db_xref="GeneID:8294579"
     CDS             759812..760219
                     /locus_tag="KLTH0H08756g"
                     /note="similar to uniprot|P32601 Saccharomyces cerevisiae
                     YPR017C DSS4 Nucleotide release factor functioning in the
                     post-Golgi secretory pathway required for ER-to-Golgi
                     transport binds zinc found both on membranes and in the
                     cytosol guanine nucleotide dissociation stimulator"
                     /codon_start=1
                     /product="KLTH0H08756p"
                     /protein_id="XP_002556255.1"
                     /db_xref="GeneID:8294579"
                     /db_xref="GOA:C5E2Y2"
                     /db_xref="InterPro:IPR007515"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y2"
                     /translation="MTKLRCPFAGCDSCIVSAEEGRKVVLPAEVYDKLRLALPSNQAP
                     RSGEFSVFEDIWDFDNIGVSRQVPTEIEAAAENAQELRFTWKERPYTLGKLQKYLICA
                     DCDRGPLGIVCEILDAEGARETVNLLSLASVLA"
     gene            <760522..>761259
                     /locus_tag="KLTH0H08778g"
                     /db_xref="GeneID:8294580"
     mRNA            <760522..>761259
                     /locus_tag="KLTH0H08778g"
                     /product="KLTH0H08778p"
                     /transcript_id="XM_002556210.1"
                     /db_xref="GeneID:8294580"
     CDS             760522..761259
                     /locus_tag="KLTH0H08778g"
                     /note="highly similar to uniprot|Q12522 Saccharomyces
                     cerevisiae YPR016c TIF6 translation initiation factor 6
                     (eIF6) singleton"
                     /codon_start=1
                     /product="KLTH0H08778p"
                     /protein_id="XP_002556256.1"
                     /db_xref="GeneID:8294580"
                     /db_xref="GOA:C5E2Y3"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y3"
                     /translation="MASRTQFENSNEVGVFSKLTNSYCLVTVGGSENFYSAFEAELGD
                     AIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELHHLRNSLPDSVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELIADVLGVEVFRQTISGNVLVGSYCALSNQGGL
                     VHPQTSIQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDAQPDSISGNLRDTLIETYS"
     gene            <762417..>762923
                     /locus_tag="KLTH0H08800g"
                     /db_xref="GeneID:8294581"
     mRNA            <762417..>762923
                     /locus_tag="KLTH0H08800g"
                     /product="KLTH0H08800p"
                     /transcript_id="XM_002556211.1"
                     /db_xref="GeneID:8294581"
     CDS             762417..762923
                     /locus_tag="KLTH0H08800g"
                     /note="some similarities with uniprot|Q6Q5F4 Saccharomyces
                     cerevisiae YPR015C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H08800p"
                     /protein_id="XP_002556257.1"
                     /db_xref="GeneID:8294581"
                     /db_xref="GOA:C5E2Y4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y4"
                     /translation="MGLIEERGRDASQERGRGESQERGGRSLSEILREVKKPEIRSRA
                     RRGEGDAARDPHVPPPLTPTPPLVHTPPMVHTPPLPQSALPFAHMAPLAHPAALAVPA
                     RAPPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHK
                     KIHDKPRD"
     gene            764077..764176
                     /locus_tag="KLTH0H08822r"
                     /db_xref="GeneID:8294582"
     tRNA            join(764077..764113,764133..764176)
                     /locus_tag="KLTH0H08822r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAG) cove"
                     /db_xref="GeneID:8294582"
     gene            <764341..>765294
                     /locus_tag="KLTH0H08844g"
                     /db_xref="GeneID:8294583"
     mRNA            <764341..>765294
                     /locus_tag="KLTH0H08844g"
                     /product="KLTH0H08844p"
                     /transcript_id="XM_002556212.1"
                     /db_xref="GeneID:8294583"
     CDS             764341..765294
                     /locus_tag="KLTH0H08844g"
                     /note="similar to uniprot|Q12251 Saccharomyces cerevisiae
                     YPR011C"
                     /codon_start=1
                     /product="KLTH0H08844p"
                     /protein_id="XP_002556258.1"
                     /db_xref="GeneID:8294583"
                     /db_xref="GOA:C5E2Y5"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y5"
                     /translation="MAQENGWTRALRSDASVAFIAGGVAGAVSRTVVSPFERVKILLQ
                     VQSSTHAYNQGIFGAVRQVYAEEGVPGLLRGNGLNCVRIFPYSAVQFVVYEFCKKQWF
                     ERGAADGRAPQQMQNWQRLLSGALCGGCSVLATYPLDLVRTRLSIQTANLASLQRAKA
                     ANVAKPPGVWELLENTYKNEGGVVGLYRGVWPTSIGVVPYVALNFAVYEQLREFIPPS
                     VDPGWASVFKLTIGALSGGVAQTITYPFDLLRRRFQVLAMGQNELGFRYKSVTDALVT
                     IGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYEAVRDLMQA"
     gene            <765552..>766033
                     /locus_tag="KLTH0H08866g"
                     /db_xref="GeneID:8294584"
     mRNA            join(<765552..765584,765830..>766033)
                     /locus_tag="KLTH0H08866g"
                     /product="KLTH0H08866p"
                     /transcript_id="XM_002556213.1"
                     /db_xref="GeneID:8294584"
     CDS             join(765552..765584,765830..766033)
                     /locus_tag="KLTH0H08866g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H08866p"
                     /protein_id="XP_002556259.1"
                     /db_xref="GeneID:8294584"
                     /db_xref="InterPro:IPR010530"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y6"
                     /translation="MRPTSLLLNAAKKQKSGFDIPVELTPLFVAMGVAVSSACWFTYK
                     KFRWDESLRVGRKNPDRSGLKTILEEPEKFEKKE"
     gene            complement(<766403..>768265)
                     /locus_tag="KLTH0H08888g"
                     /db_xref="GeneID:8294585"
     mRNA            complement(<766403..>768265)
                     /locus_tag="KLTH0H08888g"
                     /product="KLTH0H08888p"
                     /transcript_id="XM_002556214.1"
                     /db_xref="GeneID:8294585"
     CDS             complement(766403..768265)
                     /locus_tag="KLTH0H08888g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H08888p"
                     /protein_id="XP_002556260.1"
                     /db_xref="GeneID:8294585"
                     /db_xref="GOA:C5E2Y7"
                     /db_xref="InterPro:IPR006042"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y7"
                     /translation="MEFEESSQEASAVRVGSRVRSTWQKILHKFTTREGLLGDYDYAF
                     LFTPSYPFKDWVNRKRGIEPMHRDQPFFSVHSEMPILLGLLLGLQHSLAMLAGVITPP
                     IIISSVANFPMEVQQYLVSASLIVSAIMSSIQITRFHIPYTPYYIGSGLLSVVGTSFA
                     TITIVEKAIPVMYTSGFCPMEADGTKGACYAGYGALLGTAACCALLEVAMSFTPPKVL
                     QKVFPKIVTGPVVLCIAVSLIQSGFNDWVGGSGCVGAICPSEGAPMAGEWGSARFIGL
                     GFLVFTTIVTCEKWGSPIMKSCAVIVGLIVGCIVAAACGYFDHSSIDSAPAATFLWVH
                     TFPLKVYGPIVLPMLVMYIVLAQECIGDVTATCDVSRMEVEGEIYETRIQGAVLSDGL
                     SGILSALFTLPPMSTFAQNNGVISLTKCANRQVGYWCCFFLLLMGIFAKFGAALVSIP
                     KPVLGGMTTFLFTSVAVSGLKIISTIPFTRRDRFVLTGTLLFGFGAILVPNWFETFFH
                     YSGSNQSLQGFLDAIILIMETGFAIAGVIGIILNLMIPQELDEDLMDDIEIQQGNLTA
                     LEGQRSALAEGGPVLTGKAKEAMSKDNGVSNPQNSFEGKDDRIFVSAGETSPST"
     gene            complement(<768960..>769820)
                     /locus_tag="KLTH0H08910g"
                     /db_xref="GeneID:8294586"
     mRNA            complement(<768960..>769820)
                     /locus_tag="KLTH0H08910g"
                     /product="KLTH0H08910p"
                     /transcript_id="XM_002556215.1"
                     /db_xref="GeneID:8294586"
     CDS             complement(768960..769820)
                     /locus_tag="KLTH0H08910g"
                     /note="similar to uniprot|P53212 Saccharomyces cerevisiae
                     YGR021W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H08910p"
                     /protein_id="XP_002556261.1"
                     /db_xref="GeneID:8294586"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="InterPro:IPR017856"
                     /db_xref="InterPro:IPR026563"
                     /db_xref="InterPro:IPR026564"
                     /db_xref="InterPro:IPR029072"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y8"
                     /translation="MLRLLKPGRCPSALRLFSTCSARLSGHNKWSTIKHDKAKNDAEK
                     NKLFNKFANQIALAVKLGGGSTDPALNIRLAAAIESANKNNVTKRVVENAIKKGSGAG
                     GKDGSKSGSCVYEGMGPGGVAFVVEALTDNKNRTIGLVRSTFSKVNGSMTPTLYFFDR
                     KGYIIVQPPQELDDFDQVFEKVLEHEGVEDLEQVDPENDALAAEDLAPGFASSVYELS
                     TEPAATNQVASSLKQHGFHIKEVGIGYVPKSDMLVDVQNEDTMKSVEKFMGQLDEIDD
                     VTDFYCNLRK"
     gene            <770159..>770515
                     /locus_tag="KLTH0H08932g"
                     /db_xref="GeneID:8294587"
     mRNA            <770159..>770515
                     /locus_tag="KLTH0H08932g"
                     /product="KLTH0H08932p"
                     /transcript_id="XM_002556216.1"
                     /db_xref="GeneID:8294587"
     CDS             770159..770515
                     /locus_tag="KLTH0H08932g"
                     /note="highly similar to uniprot|P39111 Saccharomyces
                     cerevisiae YGR020C VMA7 Vacuolar H ATPase subunit F of the
                     catalytic (V1) sector"
                     /codon_start=1
                     /product="KLTH0H08932p"
                     /protein_id="XP_002556262.1"
                     /db_xref="GeneID:8294587"
                     /db_xref="GOA:C5E2Y9"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:C5E2Y9"
                     /translation="MSENRSLIAIIGDEDTCTGLLLAGVGQISPSSQEKNFFMYQEGK
                     TTREEILGAFDKFTQERDDIAILLINQHVAEKIRGQVDSYTAAFPAVLEIPSKEHPYD
                     PEKDSVLKRVRRLFGE"
     gene            complement(<770614..>772521)
                     /locus_tag="KLTH0H08954g"
                     /db_xref="GeneID:8294588"
     mRNA            complement(<770614..>772521)
                     /locus_tag="KLTH0H08954g"
                     /product="KLTH0H08954p"
                     /transcript_id="XM_002556217.1"
                     /db_xref="GeneID:8294588"
     CDS             complement(770614..772521)
                     /locus_tag="KLTH0H08954g"
                     /note="some similarities with uniprot|Q12114 Saccharomyces
                     cerevisiae YLR330W CHS5 Protein of unknown function
                     involved in chitin biosynthesis by regulating Chs3p
                     localization also involved in cell fusion during mating"
                     /codon_start=1
                     /product="KLTH0H08954p"
                     /protein_id="XP_002556263.1"
                     /db_xref="GeneID:8294588"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z0"
                     /translation="MASVEVSLTVGRLDASLALLTTKNHHVIEFPTMLLPDNIKAGSI
                     VKIQVAEDADLERQELEQFQTLQDEILEKYGTHSPQSPVLKVVNVTQTSGVLGWEPIE
                     LGSAQLKSLLLYKDGVRSLMIPNPFKTTATKISGLSVDSEYTFQLKLCTTSGDLWSEK
                     ITLHTHKMTDMSGITACLGALDGIEGITREHIENSLKEIGAKPLQSHVTIDTTHFISN
                     DKDSDDDEFHKAQQSNVPIVRPEWVRACELERRIVGVRGFYLDADPNNLASYKFLKLP
                     PKEGQQPVSNAAEDGNVMATDSKSLKEPVEEGEDAVNGDISESATPIQAEKGSREDTV
                     INDSAELKTEDEGTQASQVKLDEAVTNPEYDDGMPEADVAEPAAEFAAEPAAEPVAEP
                     AAESVAESITETAAEPIAESTEEPAEEPAEEPAEEPAEEPAEEPAEEPADEPAEEPAD
                     EPEVPVKAEAEIESINNEDINTSRVNTELDESQDAQAVAENAGFHDQPPANTETTVTG
                     EKDLQEAADENAGDFASRQEAEIQEASSTIEPNGMSEVGAVAPTSSQELRHGNAEEDE
                     ARAAGTQLDQVEVVGEDNSQLNQKEESTDVSAAEESAEPNASLPKPEANGTQTSSKKK
                     KNKKNKKKGKK"
     gene            complement(<772894..>774309)
                     /locus_tag="KLTH0H08976g"
                     /db_xref="GeneID:8294589"
     mRNA            complement(<772894..>774309)
                     /locus_tag="KLTH0H08976g"
                     /product="KLTH0H08976p"
                     /transcript_id="XM_002556218.1"
                     /db_xref="GeneID:8294589"
     CDS             complement(772894..774309)
                     /locus_tag="KLTH0H08976g"
                     /note="highly similar to uniprot|P17649 Saccharomyces
                     cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
                     transaminase (4-aminobutyrate aminotransferase) involved
                     in the 4-aminobutyrate and glutamate degradation pathways
                     required for normal oxidative stress tolerance and
                     nitrogen utilization"
                     /codon_start=1
                     /product="KLTH0H08976p"
                     /protein_id="XP_002556264.1"
                     /db_xref="GeneID:8294589"
                     /db_xref="GOA:C5E2Z1"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z1"
                     /translation="MSVAAKYYPSEPASPSVVTTSIPGPKSQEELAKLGKVFDARPAY
                     FMTDYEKSVGNYIVDADGNTYLDLYAQIASIALGYNNPALIKAAQSPEMVRALVDRPA
                     LGNFPSKDLAPILEKILKFAPKGQDHVWSGLSGADANELAFKAAFIYYRSKQRGYDTE
                     FSTEENQSVMKNAEPGSPHLAVLSFKKAFHGRLFASGSVTCSKPIHKLDFPAFQWPHA
                     EYPSYKFPLTENEEANRAEDDRCLKIVEDLITSWSIPVAALIIEPIQSEGGDNHASKY
                     FLQSLRDLTLKHGVVYIVDEVQTGVGATGKFWCHEWADIQPPVDLVTFSKKFQSAGYF
                     FHDPKFIPNKPYRQFNTWCGEPARMIIAGAIGQEIVDNKLLEQCSRVGDYLFSKLEAL
                     QSKYPEKFQRLRGQNRGTFIAWDLPSAAERDALLKSLKLHGCNVGGCAELSVRLRPSL
                     TFEEKHADIFVDALSKAVSEL"
     gene            complement(<774665..>775600)
                     /locus_tag="KLTH0H08998g"
                     /db_xref="GeneID:8294590"
     mRNA            complement(<774665..>775600)
                     /locus_tag="KLTH0H08998g"
                     /product="KLTH0H08998p"
                     /transcript_id="XM_002556219.1"
                     /db_xref="GeneID:8294590"
     CDS             complement(774665..775600)
                     /locus_tag="KLTH0H08998g"
                     /note="similar to uniprot|P53210 Saccharomyces cerevisiae
                     YGR017W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H08998p"
                     /protein_id="XP_002556265.1"
                     /db_xref="GeneID:8294590"
                     /db_xref="GOA:C5E2Z2"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR024624"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z2"
                     /translation="MIHQMAPWVPQFIQSWKNHSQPFAPFTFATLDMQSNRPKCRTVI
                     FRDFLFHDKRSNVLTFTTDMRGDKVKEILGSGAETAPFEACFYFPSSWEQYRFSGKCF
                     VVSRQSKPLITHTFNGAESGAIEYPILSPSIYGDAHVLYQHEHVDESEDEHVQNDEEH
                     NGTSADNETEPDVASVRPELSRTSTRSSGPAAHHAVLTPAEYAPPTPKEWDLELARQW
                     ADLSRSTKAQFRKPHPGTPVTSETSKQLDKIQRGVDGAKENTGFDNFGVVCLCIDEVD
                     FLNLKDGRGGERWKFRRHVEEDSHLESWIEEEVCP"
     gene            complement(<775981..>776598)
                     /locus_tag="KLTH0H09020g"
                     /db_xref="GeneID:8294591"
     mRNA            complement(<775981..>776598)
                     /locus_tag="KLTH0H09020g"
                     /product="KLTH0H09020p"
                     /transcript_id="XM_002556220.1"
                     /db_xref="GeneID:8294591"
     CDS             complement(775981..776598)
                     /locus_tag="KLTH0H09020g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H09020p"
                     /protein_id="XP_002556266.1"
                     /db_xref="GeneID:8294591"
                     /db_xref="GOA:C5E2Z3"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z3"
                     /translation="MVRLTIALGSKCATRHYTVAARPQTGFSLLNLRIGFASQVGAHP
                     NSDKMFVSQIKVSNGGADAFKQVCSGLRGFVTREDLEGSLLVLVDNMKKCKLRGEVSE
                     AMILCGDDSVSGIVQPCKPANFDLTLVGQPVVLEGTPAGAQPTSRRIKNNEWLEVSSR
                     LYVDNKARVVYKDPETQTETPLCVYNEEKAIPILVGSVSPGSPVR"
     gene            <776732..>777460
                     /locus_tag="KLTH0H09042g"
                     /db_xref="GeneID:8294592"
     mRNA            <776732..>777460
                     /locus_tag="KLTH0H09042g"
                     /product="KLTH0H09042p"
                     /transcript_id="XM_002556221.1"
                     /db_xref="GeneID:8294592"
     CDS             776732..777460
                     /locus_tag="KLTH0H09042g"
                     /note="similar to uniprot|P13856 Saccharomyces cerevisiae
                     YGR152C RSR1 GTP-binding protein of the ras superfamily
                     required for bud site selection, morphological changes in
                     response to mating pheromone, and efficient cell fusion;
                     localized to the plasma membrane; significantly similar to
                     mammalian Rap GTPases"
                     /codon_start=1
                     /product="KLTH0H09042p"
                     /protein_id="XP_002556267.1"
                     /db_xref="GeneID:8294592"
                     /db_xref="GOA:C5E2Z4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z4"
                     /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTM
                     EIDNKVFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELIELREQVLR
                     IKDSTRVPMVLVGNKADLQDERVISVEEGIEMSSNWGKVPFYETSALLRSNVDEVFVD
                     AVRQIIRNEIEAQNSSTAALGHMSRKNTGLGAASANAADPSAAQDTPKKQVTLNRPAT
                     AKQAPGKPSTKRKTKKTKTSCVIL"
     gene            complement(<777657..>779027)
                     /locus_tag="KLTH0H09064g"
                     /db_xref="GeneID:8294593"
     mRNA            complement(<777657..>779027)
                     /locus_tag="KLTH0H09064g"
                     /product="KLTH0H09064p"
                     /transcript_id="XM_002556222.1"
                     /db_xref="GeneID:8294593"
     CDS             complement(777657..779027)
                     /locus_tag="KLTH0H09064g"
                     /note="similar to uniprot|P31755 Saccharomyces cerevisiae
                     YGL038C OCH1 Mannosyltransferase of the cis- Golgi
                     apparatus initiates the polymannose outer chain elongation
                     of N-linked oligosaccharides of glycoproteins"
                     /codon_start=1
                     /product="KLTH0H09064p"
                     /protein_id="XP_002556268.1"
                     /db_xref="GeneID:8294593"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z5"
                     /translation="MLKFNKKERTILTSVVFLYVIASFQLSSWKLEKQFFRGFKTLIP
                     TATEGQTINLKTFKPANMKGAPIAELRSQLTQQFPYDPSQPIPRRIWQTWKTPFNSPK
                     MSQGFKDFSGRWASAASEAPLYDYTLVPDDHIMPLLHNLYGAVPQIIQAFDSMPLNIL
                     KADFFRYLVLYARGGIYSDMDTFPLKALDEWPSIKTSRLPKPEVPIKYKGLDSASSPP
                     TQEPGFIAGIEADPDRDDWNDWYARRVQFCQWTIQSKPGHPLLRELIINITATTLAST
                     NVKTNIKAPDFIIDEGHKDDYFVNARGKKRLDSKFPPTQKKTAKNTDGTDTMNWTGPG
                     VFSDAIFNYLNNIIQTNPDIMIINNNLKANNMEDGSGTRKFYRKITEGLMSSATFVTE
                     FFSLIEEPVIVDDVMILPITSFSPGVNHMGSKPEDDDMAFVKHMFKGTWKNDPKPSSK
                     GQRQQE"
     gene            complement(<779286..>779927)
                     /locus_tag="KLTH0H09086g"
                     /db_xref="GeneID:8294594"
     mRNA            complement(<779286..>779927)
                     /locus_tag="KLTH0H09086g"
                     /product="KLTH0H09086p"
                     /transcript_id="XM_002556223.1"
                     /db_xref="GeneID:8294594"
     CDS             complement(779286..779927)
                     /locus_tag="KLTH0H09086g"
                     /note="similar to uniprot|P53184 Saccharomyces cerevisiae
                     YGL037C PNC1 NAD() salvage pathway gene pyrazinamidase and
                     nicotinamidase"
                     /codon_start=1
                     /product="KLTH0H09086p"
                     /protein_id="XP_002556269.1"
                     /db_xref="GeneID:8294594"
                     /db_xref="GOA:C5E2Z6"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z6"
                     /translation="MGKALIVVDVQLDFLPPDGSLAVAAGDEIVDRIAELVKDPRWCV
                     VVATQDWHPVDHISFAKNHGLPEFSSYQYVSPVDRHETQQATLWPVHCVQGTPGAELA
                     PALSESLQSLECDHHTVKKGYISDREYYSAFNDIWNDHRTELDGLLRKHGVNDVFVVG
                     LALDYCVKNTALSAAALGYRTTILQDYTRAIASDSKSMCNLKQELVQNDITLK"
     gene            <780617..>783001
                     /locus_tag="KLTH0H09108g"
                     /db_xref="GeneID:8294595"
     mRNA            <780617..>783001
                     /locus_tag="KLTH0H09108g"
                     /product="KLTH0H09108p"
                     /transcript_id="XM_002556224.1"
                     /db_xref="GeneID:8294595"
     CDS             780617..783001
                     /locus_tag="KLTH0H09108g"
                     /note="weakly similar to uniprot|P53185 Saccharomyces
                     cerevisiae YGL036W Mtf1 Two Hybrid Clone 2"
                     /codon_start=1
                     /product="KLTH0H09108p"
                     /protein_id="XP_002556270.1"
                     /db_xref="GeneID:8294595"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z7"
                     /translation="MVAAEMDALSRKRSESTDDPMAADMMLTVESSARILHSYPPSAA
                     EALSAAYEFANAIRQLKPHQEPQVADLDVFTPLVQLCVSERDSKDILLDLLATTFAYC
                     SVHRTLAKLVRVFVSRSLHNQPVASQLRELCGSFATDYKPGFYSVISKLECYDRLDAS
                     VFRELQLNLGPTMRMTWIPLWTQETGIDLYSAVLSHNLLVSTSAEPKLDFLIASWAHA
                     TTEWVGLKDRSNEALKSFIYQTARRTILFAKWIPGGFFKFCQQAIAEWIESDCLLKTE
                     TDVSFSLSVVMEVLDHPDLNFLEEPHLALLLKVALRRIWHMCSEGQVQTLHFELGKMG
                     ATQSLPGLLNITQYLTARFLLRVGSLAMSARNYNSNKEWMLQETSYQLPSFFDDIVPT
                     IPPIPRSTFSFVNNTIESELLANRHLETVSSLLDSLKCVLSINKMVLRHYNASEIQVL
                     ALKSSNPQKDTTIDNRSSLEVLQLYFISMTSALLLSRQLTEEQYLMVAEGQYEYTIQG
                     RLIRREALACFETLIGTFKGISLFQLVKFSARVSMAELSLQKVSMQTLNFVFFEASFS
                     VTQVPSLTNKLTVQSLYEYINLWNDGSPIFRPFYTEMFRVPQPLVKCVQVELERFLCL
                     LTFEVKKDSSAPTPTTSRGTESKNNGYVPKYNAHASSFIPASKAGSKPSMDIEKSFGT
                     QASNQLIPLSADFPRQLSICHERTEDAGSAFAAQRYSGSADSTTPGSAQAPSPFSARR
                     WDSNCFSQGLNNSPETSSAVVSTGKDYILGGHNKATNNSRAQSVHVDRFDYVRQ"
     gene            <783260..>785347
                     /locus_tag="KLTH0H09130g"
                     /db_xref="GeneID:8294596"
     mRNA            <783260..>785347
                     /locus_tag="KLTH0H09130g"
                     /product="KLTH0H09130p"
                     /transcript_id="XM_002556225.1"
                     /db_xref="GeneID:8294596"
     CDS             783260..785347
                     /locus_tag="KLTH0H09130g"
                     /note="similar to uniprot|P48234 Saccharomyces cerevisiae
                     YGR145W ENP2 Essential nucleolar protein of unknown
                     function contains WD repeats interacts with Mpp10p and
                     Bfr2p and has homology to Spb1p"
                     /codon_start=1
                     /product="KLTH0H09130p"
                     /protein_id="XP_002556271.1"
                     /db_xref="GeneID:8294596"
                     /db_xref="GOA:C5E2Z8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z8"
                     /translation="MVLKSTSASDNSVYQVSGTNVSRSLPDWIAKKRKRSLKHDLEYQ
                     NRVELIQDFEFSEASNKVKCTPDGQFAMATGTYKPQIHLYDFANLSLKFERHTDAENV
                     DFLILSDDWTKSVHLQNDRSIQFQNKGGLYYTTRIPKFGRSIAYNKANCGLYVGASGD
                     ELYRLNLEQGRFLNPFKLDSEGVNHVSVNDVNGLVAVGMEDNVVEFWDSRARARAAKL
                     LLENSYDSSPFQVTATSFRNDGLNFACGTSTGYSYLYDLRASQPMIVKDQGYGFDIKK
                     IIWLDNTGAENGNNNILTCDKRIAKIWDRNSGKPFASMEPSVDINDIEHVPGTGMFFT
                     ANEGIPLHTYYIPNLGPAPKWCSFLDSITEELEEKPSDTVYSNYRFITREDVKKLGLN
                     HLIGSKVMRAYMHGYFINSELYDKVSLIANPNSYRDEREREVRRRIEKERESRIRTSG
                     AVKKPAVKINKVLVDKLSQKRGDKIADNVLADDRFKEMFEDEDFQVDEDDYDYKQLNP
                     VKSARETEEGAEKRIRALTAAEESDEERIAIKEGRGHYSDSESEESESDEEKGSEEMT
                     EKEKKALAKQIAVTQRRKREKEKADKFMNQMSVGADDRLSQEAQDLTFDRKVAQLRRE
                     EQREKRQEPAVRRNHQGEAEFSFVPSKKKPAGKKKVTFDSDGDEAENKKDSGRSKPRF
                     QGRRASKNVFRGM"
     gene            <785536..>787242
                     /locus_tag="KLTH0H09152g"
                     /db_xref="GeneID:8294597"
     mRNA            <785536..>787242
                     /locus_tag="KLTH0H09152g"
                     /product="KLTH0H09152p"
                     /transcript_id="XM_002556226.1"
                     /db_xref="GeneID:8294597"
     CDS             785536..787242
                     /locus_tag="KLTH0H09152g"
                     /note="similar to uniprot|P40357 Saccharomyces cerevisiae
                     YGR009C SEC9 t-SNARE protein important for fusion of
                     secretory vesicles with the plasma membrane"
                     /codon_start=1
                     /product="KLTH0H09152p"
                     /protein_id="XP_002556272.1"
                     /db_xref="GeneID:8294597"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5E2Z9"
                     /translation="MGIKRFFKIKPPEEDTPEVNRDNLIEQGIPTKNVNRTKKEKFAA
                     YGKFAKDKAEDKFYAPPGYENFGKSNPPVLDDLNKSEVDSDAGNAYMREPSKNDFDPY
                     ARNNFTNSSAAADPYGKQPYDPYGKQPSDPYGKQSSDPYSSYSSNAYGNQPSGRSSGS
                     ATPYADPYTQGRGPSAPALNAGNPYGQRPGNPYAGHSSFSSSTAGSAQPSQNPYSMMK
                     SDPYSAGASSTNVPAPQKPNPYVSREASRSSRPSAAPEDDQFDFETSAAAPKIRNPDL
                     NDDEIDLNATLQDEGDDLNGSIHENYAGELGQTQLQQPDDTRGYQTFEDVQRQNQELQ
                     QQQEDEEVDEIKQQIRFTKQSSVASTRNTLKMAQEAEMAGTNTLGMLGHQSEKLNNVE
                     RNLDLMKMQNRVADDRVAELKKLNRNILAVHVSNPFTSKRRLREAEERIRNQRIEDKL
                     MQKQTNGRLHQSTNRIEGALNGASQDHDTIRQRYQNQAILEKAKRYQFENDEEDDEME
                     LEIDKNLDKVGQISGRLKRLAIAAGDEIDAQQNRVQNIEEDTDNMDIKIHLNTTRLTQ
                     IR"
     gene            complement(<787674..>788042)
                     /locus_tag="KLTH0H09174g"
                     /db_xref="GeneID:8294598"
     mRNA            complement(<787674..>788042)
                     /locus_tag="KLTH0H09174g"
                     /product="KLTH0H09174p"
                     /transcript_id="XM_002556227.1"
                     /db_xref="GeneID:8294598"
     CDS             complement(787674..788042)
                     /locus_tag="KLTH0H09174g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H09174p"
                     /protein_id="XP_002556273.1"
                     /db_xref="GeneID:8294598"
                     /db_xref="InterPro:IPR024368"
                     /db_xref="UniProtKB/TrEMBL:C5E300"
                     /translation="MSAFNDFCIVCERLIDGSSRLYCSQACCERDTSAGRRKSVVESL
                     VATPQLCPLDMDAEDSDGDEDFFELDYTSTVPTTLSSPRAFAKEQQGGYFSLARDVVF
                     DHTAENNYKLWLNAHGAHAG"
     gene            complement(<789919..>791301)
                     /locus_tag="KLTH0H09196g"
                     /db_xref="GeneID:8294599"
     mRNA            complement(<789919..>791301)
                     /locus_tag="KLTH0H09196g"
                     /product="KLTH0H09196p"
                     /transcript_id="XM_002556228.1"
                     /db_xref="GeneID:8294599"
     CDS             complement(789919..791301)
                     /locus_tag="KLTH0H09196g"
                     /note="some similarities with uniprot|P27705 Saccharomyces
                     cerevisiae YGL035C"
                     /codon_start=1
                     /product="KLTH0H09196p"
                     /protein_id="XP_002556274.1"
                     /db_xref="GeneID:8294599"
                     /db_xref="GOA:C5E301"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E301"
                     /translation="MSSTDDTKGNKKRRSPNSGPDSPRPYICPICSRAFHRLEHQTRH
                     IRTHTGEKPHACDFPGCTKKFSRSDELTRHKRIHTNPHPKGKRGRKKKTETQSSGADT
                     AVQQGNLPRERATRPAPTFQLGGEDDDASDVNNPASSPEDQSMGILANAALKFQARST
                     DTPLHSVRSLPSLKTLEANGMRVASPPGLAGAALPPHNSSTGNLQSVGSLLPARSTPS
                     RLKLNVLSSLQRMTPLAPVQAGNPGTAQYSSQTASASNSGTTTPYQSPEHPEYLGSCP
                     PRHKTYSSSASLTSISNLITTDDEDREFDEEEMGRARKKSRTTTPTISRSHSQTNLSS
                     RTGTFTNLASLNGVGQPPGITGILSSRPSSSDFSSELNQRLQSVQRSRSSQFLDRYAS
                     TPSVALSGAPSAKFTPLGTPPQLASPPNARAVPTDLQGHSQSSHCIKTESEESMLPPI
                     RSLDLQFPTG"
     gene            <793572..>795695
                     /locus_tag="KLTH0H09218g"
                     /db_xref="GeneID:8294600"
     mRNA            <793572..>795695
                     /locus_tag="KLTH0H09218g"
                     /product="KLTH0H09218p"
                     /transcript_id="XM_002556229.1"
                     /db_xref="GeneID:8294600"
     CDS             793572..795695
                     /locus_tag="KLTH0H09218g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H09218p"
                     /protein_id="XP_002556275.1"
                     /db_xref="GeneID:8294600"
                     /db_xref="UniProtKB/TrEMBL:C5E302"
                     /translation="MPVSSVVTAAPGAAATSTAVSSAPEGQPSAVSPVEPSVASSTVT
                     TPGTEATPSSVSSSASAFSPSSSSSLPPLSSASPSFASPSSSSTSPSSPNPPADTTSS
                     SSLSPSSSPVSSLLSSASPSSSSSSSLTLVQESAYTTVTVTLTTTEFFTNHEAVSTYY
                     SEEQVSVPTTVLLSYSPVYTTQYVEGTTISVPVTTISSEYVVTPTTILYSTVETSSPT
                     TFTEESVLYSTISSPTATVYDAQETVIEYITETSVFTTTFSTIITTLGPVAVTSHYTE
                     SGTTEIVSPSVYTSFVTYTTTAEHTSIGLATSTAVSTRTYTTTITAAVTSAPGPAATG
                     SVPTVTSTSTAYTTYVITEPDSTYVITRDIDMETTFETVAPATITSEYLTTLLDVPLS
                     TSIIKPSVLYSNKTETDTVIVYEAISLVSLARTVLTTEVTVLTTSTIESQTLETITAP
                     GQLVTRVVPVSPEIITLRKRCEACEELPQTTFQSVLSEEVQSNYVYTTTIVADEPTVV
                     VNCNLETSYSTITTDYVVAHASVYSTFGTYTTEVATTSVGTTVYSYPVTKTLSASSSD
                     ILYNVEVVPVATSTLVLTSYLPLEQEVAYTTVTGAPVTASETASYGASIIPGSSTVYI
                     ISSTPIYSTSYFVTTEEEPVSTAFSDEVVTETITSTSVSVATLPGAVIVPANAGNSIG
                     VPAVTLGWQCIATVASIVLLSAIVV"
     gene            <796183..>796934
                     /locus_tag="KLTH0H09240g"
                     /db_xref="GeneID:8294601"
     mRNA            join(<796183..796234,796342..>796934)
                     /locus_tag="KLTH0H09240g"
                     /product="KLTH0H09240p"
                     /transcript_id="XM_002556230.1"
                     /db_xref="GeneID:8294601"
     CDS             join(796183..796234,796342..796934)
                     /locus_tag="KLTH0H09240g"
                     /note="similar to uniprot|P53187 Saccharomyces cerevisiae
                     YGL033W HOP2 Meiosis-specific protein that localizes to
                     chromosomes"
                     /codon_start=1
                     /product="KLTH0H09240p"
                     /protein_id="XP_002556276.1"
                     /db_xref="GeneID:8294601"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:C5E303"
                     /translation="MSSKKKAEKAPQAKGAEAESIIESYLIEQYRPFAVNDIIQNLHN
                     KVSRTNTIKALESLTKQQRITCKTFGKIAIYVCNEQELTSTNIGTGTDVSIETVTQLR
                     EELLETEKDRSEYSAQLQGVMRHPPNEELLAIVEAKKAEVLEVNNMLQNLLSDWKPEN
                     EELIQTVRAYEQKIGKELSARKKILNSAIALMKEALSLKNIDEFLVRVMPGTFI"
     gene            <797482..>798405
                     /locus_tag="KLTH0H09262g"
                     /db_xref="GeneID:8294602"
     mRNA            <797482..>798405
                     /locus_tag="KLTH0H09262g"
                     /product="KLTH0H09262p"
                     /transcript_id="XM_002556231.1"
                     /db_xref="GeneID:8294602"
     CDS             797482..798405
                     /locus_tag="KLTH0H09262g"
                     /note="highly similar to uniprot|P78609 Pichia jadinii
                     Uricase"
                     /codon_start=1
                     /product="KLTH0H09262p"
                     /protein_id="XP_002556277.1"
                     /db_xref="GeneID:8294602"
                     /db_xref="GOA:C5E304"
                     /db_xref="InterPro:IPR002042"
                     /db_xref="InterPro:IPR019842"
                     /db_xref="UniProtKB/TrEMBL:C5E304"
                     /translation="MPYSYLESSTYGKDNVKFLKVKKDKTNPKVHEIMEATVCVLLKG
                     DFEISYTEADNAPIVPTDTVKNTILILAKKYDTFPIEKFAAKLALHFTSKYSHVSGLT
                     VKITQDRWVKFDVDGKESQHSFVHQGPEKKITFLDYDKKNGPSNYSLSSSIKDLTVLK
                     STNSMFYGYNVCDYTTLKPTTDRILSTDIFATMDWCPKKLGCLESIASGSKDEIFTNA
                     YNSARDITLDIFAKENSPSVQATMYNMATAILKIAPQVAYVSYELPNKHYFLFDLKWF
                     QGLENDNELFYPSPHPNGLIKCKVGRNGSKL"
     gene            complement(<798515..>799306)
                     /locus_tag="KLTH0H09284g"
                     /db_xref="GeneID:8294603"
     mRNA            complement(<798515..>799306)
                     /locus_tag="KLTH0H09284g"
                     /product="KLTH0H09284p"
                     /transcript_id="XM_002556232.1"
                     /db_xref="GeneID:8294603"
     CDS             complement(798515..799306)
                     /locus_tag="KLTH0H09284g"
                     /note="weakly similar to uniprot|P37293 Saccharomyces
                     cerevisiae YGR147C NAT2 N alpha-acetyl-transferase
                     transfers acetyl group from acetyl coenzyme A to the
                     N-terminal methionine residues of proteins"
                     /codon_start=1
                     /product="KLTH0H09284p"
                     /protein_id="XP_002556278.1"
                     /db_xref="GeneID:8294603"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="UniProtKB/TrEMBL:C5E305"
                     /translation="MLTFRNNKRSIYEIRSLLTKDQIENLSQFITHKQPPNHMSLFTR
                     FSRLACSKAIRSPALRWPSNIASSRFASTATKSEKPSLKNLMKTYGSSALVVYFGLSA
                     IDLPICFFAVHSLGEETIRVYINRAKQIFGYGRDEQELIKDVRAQIEEKEQRKLSGEE
                     QHNTSLWERLKESTILTEFLIAYGIHKSLIILRLPVTAAITPATVKLLQKWGFNIGKF
                     NKSFQTAGDVAKFKNKTGRPEDFVKGNPIPKQTQTKGRKWFNGLM"
     gene            complement(<799475..>799753)
                     /locus_tag="KLTH0H09306g"
                     /db_xref="GeneID:8294604"
     mRNA            complement(<799475..>799753)
                     /locus_tag="KLTH0H09306g"
                     /product="KLTH0H09306p"
                     /transcript_id="XM_002556233.1"
                     /db_xref="GeneID:8294604"
     CDS             complement(799475..799753)
                     /locus_tag="KLTH0H09306g"
                     /note="similar to uniprot|P32781 Saccharomyces cerevisiae
                     YGL032C AGA2 Adhesion subunit of a-agglutinin of a-cells
                     C-terminal sequence acts as a ligand for alpha- agglutinin
                     (Sag1p) during agglutination modified with O- linked
                     oligomannosyl chains linked to anchorage subunit Aga1p via
                     two disulfide bonds"
                     /codon_start=1
                     /product="KLTH0H09306p"
                     /protein_id="XP_002556279.1"
                     /db_xref="GeneID:8294604"
                     /db_xref="InterPro:IPR014404"
                     /db_xref="UniProtKB/TrEMBL:C5E306"
                     /translation="MKFSSVVTAYLAIFPSMCAAATVSWASVSCESISTGGTLETTPY
                     SSSTATILKNGKEMVGVYEFFQSVTYISDCNPSTRKTSAEPNPTITIY"
     gene            complement(<800260..>800727)
                     /locus_tag="KLTH0H09328g"
                     /db_xref="GeneID:8294605"
     mRNA            complement(<800260..>800727)
                     /locus_tag="KLTH0H09328g"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_002556234.1"
                     /db_xref="GeneID:8294605"
     CDS             complement(800260..800727)
                     /locus_tag="KLTH0H09328g"
                     /note="similar to uniprot|P04449 Saccharomyces cerevisiae
                     YGL031C RPL24A and to uniprot|P24000 Saccharomyces
                     cerevisiae YGR148C RPL24B"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_002556280.1"
                     /db_xref="GeneID:8294605"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="UniProtKB/TrEMBL:C5E307"
                     /translation="MKVEIDSFSGGKIYPGRGTLFVRGDSKIFRFQSSKSSSLFKQRK
                     NPRRIAWTVLYRRHHKKGITEEVAKKRSRKTVKAQRAIVGASLEFIKERRSLKTEVRK
                     AQREDKKKADKEKKKADKEKRKAEKAKLAGTQGSKVSKQQAKGAFQKVAATSR"
     gene            <801551..>801925
                     /locus_tag="KLTH0H09350g"
                     /db_xref="GeneID:8294606"
     mRNA            join(<801551..801553,801611..>801925)
                     /locus_tag="KLTH0H09350g"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_002556235.1"
                     /db_xref="GeneID:8294606"
     CDS             join(801551..801553,801611..801925)
                     /locus_tag="KLTH0H09350g"
                     /note="highly similar to uniprot|P14120 Saccharomyces
                     cerevisiae YGL030W RPL30 Protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_002556281.1"
                     /db_xref="GeneID:8294606"
                     /db_xref="GOA:C5E308"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5E308"
                     /translation="MAPVKSQESINQKLALVIKSGKYTLGYKSTVKALRQGKSKLVII
                     AANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVTILDAGDSDILT
                     TLA"
     gene            complement(<802071..>802334)
                     /locus_tag="KLTH0H09372g"
                     /db_xref="GeneID:8294607"
     mRNA            complement(<802071..>802334)
                     /locus_tag="KLTH0H09372g"
                     /product="KLTH0H09372p"
                     /transcript_id="XM_002556236.1"
                     /db_xref="GeneID:8294607"
     CDS             complement(802071..802334)
                     /locus_tag="KLTH0H09372g"
                     /note="highly similar to uniprot|Q3E731 Saccharomyces
                     cerevisiae YLL018C-A COX19 Cytochrome c oxidase assembly
                     protein"
                     /codon_start=1
                     /product="KLTH0H09372p"
                     /protein_id="XP_002556282.1"
                     /db_xref="GeneID:8294607"
                     /db_xref="UniProtKB/TrEMBL:C5E309"
                     /translation="MSGNPGNALKALSPTPPERGSFPLDHDGDCTKQMQEYLECIKLV
                     KGENAPNCRLLAKEYLNCRMDHRLMDRDEWKNLGLPDDAPDKK"
     gene            complement(<802549..>804354)
                     /locus_tag="KLTH0H09394g"
                     /db_xref="GeneID:8294608"
     mRNA            complement(<802549..>804354)
                     /locus_tag="KLTH0H09394g"
                     /product="KLTH0H09394p"
                     /transcript_id="XM_002556237.1"
                     /db_xref="GeneID:8294608"
     CDS             complement(802549..804354)
                     /locus_tag="KLTH0H09394g"
                     /note="similar to uniprot|P04802 Saccharomyces cerevisiae
                     YLL018C DPS1 Cytoplasmic aspartyl-tRNA synthetase
                     homodimeric enzyme that catalyzes the specific
                     aspartylation of tRNA(Asp) class II aminoacyl tRNA
                     synthetase binding to its own mRNA may confer
                     autoregulation"
                     /codon_start=1
                     /product="KLTH0H09394p"
                     /protein_id="XP_002556283.1"
                     /db_xref="GeneID:8294608"
                     /db_xref="GOA:C5E310"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5E310"
                     /translation="MIYLIKFCSHFTKDEKGRPALKPQKSSLLSLAMSEAVAKAAEAV
                     KESVEKVTEQVKDLTTQEPSEPVILGEDGQPLSKKALKKLQKEQEKQRKKEEKARQLA
                     EEKAQREREAAANDTAKENYGKLPLIQSASKTGVPRTKLEDLSEADDGKEVLIRARVH
                     NSRQQGATLVFLTLRQQAQLIQALAKSNAEGTISKQMVKWIGSVNPESIVLVKGVVKK
                     VEEPIKSATVQNLEIHITQIHTISEAPQQLPILIEDASRSDAEAETAGLPVVNLDTRL
                     DARVIDLRTATNQAIFRIQSGVCELFREFLAKRKFVEIHTPKLLGAPSEGGANVFEVT
                     YFKGKSYLAQSPQFYKQELIAADFERVFEVAPVFRAENSNTHRHMTEFIGLDLEMAFE
                     EHYDEVIDVLSELFVFIFSELKTRYAKEIALVRKQYPVEEFKLPKDGKMVRLAYKDGI
                     AMLKAAGKEVGELEDLSTENEKFLGALVREKYDTDFYILDKFPLEVRPFYTMPDPVDP
                     RYSNSYDFFMRGEEILSGAQRIHDANFLKERMSHHGLSPEDPGLKDYVDSFTYGCPPH
                     AGGGIGLERVVMFFLDLKNIRRASLFPRDPKRLRP"
     gene            <806836..>811422
                     /locus_tag="KLTH0H09416g"
                     /db_xref="GeneID:8294609"
     mRNA            <806836..>811422
                     /locus_tag="KLTH0H09416g"
                     /product="KLTH0H09416p"
                     /transcript_id="XM_002556238.1"
                     /db_xref="GeneID:8294609"
     CDS             806836..811422
                     /locus_tag="KLTH0H09416g"
                     /note="similar to uniprot|P04821 Saccharomyces cerevisiae
                     YLR310C CDC25 Membrane bound guanine nucleotide exchange
                     factor (GEF or GDP-release factor) indirectly regulates
                     adenylate cyclase through activation of Ras1p and Ras2p by
                     stimulating the exchange of GDP for GTP required for
                     progression through G1"
                     /codon_start=1
                     /product="KLTH0H09416p"
                     /protein_id="XP_002556284.1"
                     /db_xref="GeneID:8294609"
                     /db_xref="GOA:C5E311"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5E311"
                     /translation="MSLSRVSSHDEQTPAARAGSTRPVDVVVATCDFTPTKKAQLRLS
                     AGDVVYVLGKNESGWWDGVTVCGRSPQRVARGWFPHNFTRSYREHKRGGLAAKCGAAS
                     SVAGTRSNRSGGSSRRSSLAAPPMPGHMDFGSSMRLGTVSEPNLSPTDSHAPHLKQDY
                     RFDMRSNLAGQAGSRRPSMASGWSAGANSLSKSPSHSSNEQQSHGSQSQPQQVDPLQK
                     STADERRRRSHVAETDKMNVLGTDEVQMIFSNIHDNSPPIWTPVPTTEGKILYYNRDY
                     DIYCSGLPLLQSPELNIKSVFSDHDWFVDIQERALTHNKKVLDKKEEPAGANGAATGP
                     MSANTQSTSQNTRNHSGSRRPSVDEKSKNYLAATIISDSAGTGSRNTKINALKSDNLS
                     PKRVAGDDTNTNTNSDSKAGIKTATENENDTEVAASDPGWWQKNPKHTLLAKEELFYH
                     HRMDLRSWTEMRDTTLYFARKAYASFFQNDYHQFNRNFEVTAKFSIYYHNACRLLKGE
                     LIKNNVKREVRRILRQMTDAVSAISINGNLFFSSPQRFDISFSPSVQQQQLQQRHKSS
                     VGSTGTAIQDPLRVSISTLNPLQPGDLQKLSISSNDILINEESQSLETKSKNDRDDRF
                     GSVLSSYTIQAHSTAFDENSKISIQALFQTIDAQFSRFMICVRNLDALMKTKCSGGDI
                     LPQLFPRFFRDGFSGGAWTSTFQDQVISLTPRASLASLGSPLTGEAYQAVNNVFGSIS
                     SKAGTVESSILSKSTADNDRTSAIKGSPKAKNQKSLKFPLNEDTLALLKKRIDYFSTP
                     TYASYGTLIDQPRTNKRNLEISANCHRELSHSVVIIEMLENLDLRFFLNMRNLAYNHA
                     LDEDSEELRQHTMTSSATLLMEFFDIKQALYDVTIKKVMDIQNLTLDDPFVFCSMAGD
                     LSFGGEREEGSREEHVLKQERLAEAYRKRLVAEDVEVNDMTYFNPDTEVKATQISFLA
                     VIDSTYQVVEQLIQARENVLNYAARMMKNDLISELTRGEQEKIFEDDKIDAKTSDAEI
                     EHIGPKDFGDSSFTSDVPWYLDSEHEYSLIYDNQGRIKGGTKVALLEHLTSHRAIDAS
                     FNIAMLLSFRSIFTTSEFLHALVERYHLYPPEGLSFEEYSAWIEKKSTPVKTRVVNIL
                     KTLFSNYWTPAYYEPGIDDLVSFAQLATAQSISGAPALLVELKNRLSLKGNLKNFVPE
                     TIRFDESGHNYSGNALNPRVSTGGPAEFGAGYGFRMRKLKLLDIDPQTFAKQLTTKEH
                     YLYSKITPFECLDRIWSKKYCYFGGSEDISKFISSANALTSYVSFAIVKQTNTKKRAK
                     VLQHFISVAEYCYELNNFSSMTAIVSALYSSPIFRLKKSWSAVPEDSKKVLENLNTLM
                     DPAKNFITYRNWLKTVHDVACVPFFGVYLSDLTFIAEGNPNCLHRSPEIINFSKRLRI
                     VDILKEISSYQIIRYKFKRYDDIQSFIEESMKNIPNIEKQYEQSLRLEPRTEVSAGLS
                     SGGTGMSKTDLGKKLEKKSRFMKNKKRPTKLVSL"
     gene            <811653..>814436
                     /locus_tag="KLTH0H09438g"
                     /db_xref="GeneID:8294610"
     mRNA            <811653..>814436
                     /locus_tag="KLTH0H09438g"
                     /product="KLTH0H09438p"
                     /transcript_id="XM_002556239.1"
                     /db_xref="GeneID:8294610"
     CDS             811653..814436
                     /locus_tag="KLTH0H09438g"
                     /note="similar to uniprot|Q06704 Saccharomyces cerevisiae
                     YLR309C IMH1 Protein involved in vesicular transport
                     mediates transport between an endosomal compartment and
                     the Golgi contains a Golgi-localization (GRIP) domain that
                     interacts with activated Arl1p-GTP to localize Imh1p to
                     the Golgi"
                     /codon_start=1
                     /product="KLTH0H09438p"
                     /protein_id="XP_002556285.1"
                     /db_xref="GeneID:8294610"
                     /db_xref="GOA:C5E312"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR029687"
                     /db_xref="UniProtKB/TrEMBL:C5E312"
                     /translation="MFKQLSQLGKNLTDELAKGLTDELNEGQFDKNSDIPVEVQAKLR
                     KFEKYEQKYPLLLNAYKSEKAKSEKLAAVQKILSENTPISSIDDYDSLTSFFKNTNLK
                     TDMLNDEIKRLTSEKNEHLREIQDLRAQKDVAADKAFSEGHSEKSEGLEQVKQLEQKI
                     SEYLKDIESLKHELAAREEEKYAFVKQQTEMKNQIESLKGESTDFATASKNLAATEKL
                     VDEFKKKLDSERQEHTKLNSELTKLEDEAARKSERIVSLEKLIKSEEEDEALSKQDPV
                     SSGTSQTSTFKSKKKKKKGKSQNTSSNAKVLPSPPLPGSSADQKSDLDNRLHETLKDL
                     QETQEKLKVIQSKYDDLVAASGNSESLQLELEKTRGEIEKLEVDNERLLRELQESKKE
                     LKFKSEEVENVKDLLKTVGNELVEAKDTIKNSNGASETEMKHLKSQLESLRSQNSENI
                     KSYETTQSELKQKVASLQKEKSETEKELDDLRTTLNKHMQEKSKLLTDLKQSHEKMSI
                     LNNENITLSDQVKNLNALKRSESSLKSSLSQKEKTIVYLEQQVKEYSSKEEASSRALR
                     EAKMENGRLSNKISLVSKECESLKNELEKSKTSLEKFIKENGGLSERLEILNEKYETL
                     QDMKTNSHEQVELIRRQCDELNVKIKELNKKNLSLEDELNESVSALQERTQEASSMRR
                     LLAERQSDKDFQVQKLEQSFAAASEEKNRLESELALHDAKTKRTINELKEVNDDLRVQ
                     VQTLIAKEKDYEQEVARLTSLNKEMQTTRNESSQSSNELKEALANVKAALMTSEKKLR
                     EMESSSENIKELNDDLTKKLERISKNYKLVSGQLAAIKERNVPSRGPSRSNSVLSISD
                     RASNEPPSRRGSFNGETVIESQSEINDKIAYIKNVLLGFLEHKDQRNQLLPVVSTLLQ
                     LDSNDEKRLMAIR"
     gene            <814825..>815742
                     /locus_tag="KLTH0H09460g"
                     /db_xref="GeneID:8294611"
     mRNA            <814825..>815742
                     /locus_tag="KLTH0H09460g"
                     /product="KLTH0H09460p"
                     /transcript_id="XM_002556240.1"
                     /db_xref="GeneID:8294611"
     CDS             814825..815742
                     /locus_tag="KLTH0H09460g"
                     /note="similar to uniprot|P38892 Saccharomyces cerevisiae
                     YHR209W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0H09460p"
                     /protein_id="XP_002556286.1"
                     /db_xref="GeneID:8294611"
                     /db_xref="GOA:C5E313"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E313"
                     /translation="MDHQRSRPKYIQLTREMSTYSENSFNSDFYQEKRPRYPESLYQE
                     ILSYHSGDLKLAIDVGCGTGISTLPLLKSFERVVGCDPSSTMLESAKKFKDKITVKDI
                     NRIEYSVCGAEDLTSLFASDSIDLVTGAESIHWVDEERFFKQAFQVLKPNGTLAYWFY
                     VEPIFIEHPQANEIYEEFVYEDPAYMGPQWKPGKEKLRVYGEQIRIPEDKFTDIERHV
                     YRPLVSKEKTAYFYGRDSMTVDDLRQYLRSWSAYHTWQQKFGEKGCDVAELLLDELKS
                     KCGWDEANTRLKVEWGTAYYLARKKATTK"
     gene            complement(<815929..>816885)
                     /locus_tag="KLTH0H09482g"
                     /db_xref="GeneID:8294612"
     mRNA            complement(<815929..>816885)
                     /locus_tag="KLTH0H09482g"
                     /product="KLTH0H09482p"
                     /transcript_id="XM_002556241.1"
                     /db_xref="GeneID:8294612"
     CDS             complement(815929..816885)
                     /locus_tag="KLTH0H09482g"
                     /note="highly similar to uniprot|Q06703 Saccharomyces
                     cerevisiae YLR308W CDA2 Chitin deacetylase together with
                     Cda1p involved in the biosynthesis ascospore wall
                     component chitosan required for proper rigidity of the
                     ascospore wall"
                     /codon_start=1
                     /product="KLTH0H09482p"
                     /protein_id="XP_002556287.1"
                     /db_xref="GeneID:8294612"
                     /db_xref="GOA:C5E314"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:C5E314"
                     /translation="MKFPISVLDHLSCKQVALLTAVVASVSAASNDSGVGQPVGGLIS
                     VRVGHSQTPFPEWLTEFTGLKEWPGIDPPYIPMDFIDFDQIPDYRSYEQGVCGANPRE
                     SCSFDCDHCVAPDDVFTCSKLSQTFDDGPSLATERLLDNLDHKTTFFNLGINIVNYPD
                     VYKKILDGGHLVGTHTWSHPFLPSLSNEKIIAQLQWSIWAMNATGHHLPKWFRPPYGA
                     IDNRVRAISRMFGLQAVLWDHDTFDWQLLVEDQSLRTEESIYRDIQDWKQSGTGLILE
                     HDGAFKTVQVGINVGRILGNDQMTVAECVGGSDYIKSFQQEG"
     gene            complement(<817855..>818465)
                     /locus_tag="KLTH0H09504g"
                     /db_xref="GeneID:8294613"
     mRNA            complement(join(<817855..818406,818463..>818465))
                     /locus_tag="KLTH0H09504g"
                     /product="KLTH0H09504p"
                     /transcript_id="XM_002556242.1"
                     /db_xref="GeneID:8294613"
     CDS             complement(join(817855..818406,818463..818465))
                     /locus_tag="KLTH0H09504g"
                     /note="similar to uniprot|P52491 Saccharomyces cerevisiae
                     YLR306W UBC12 Enzyme that mediates the conjugation of
                     Rub1p a ubiquitin-like protein to other proteins related
                     to E2 ubiquitin-conjugating enzymes"
                     /codon_start=1
                     /product="KLTH0H09504p"
                     /protein_id="XP_002556288.1"
                     /db_xref="GeneID:8294613"
                     /db_xref="GOA:C5E315"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5E315"
                     /translation="MLKLRQLQKQKQEQARQNGTIPAPGNAPVSACQLRLRKDLASLD
                     IPPCVSIDVSECESNSRLYINITPDEGYYKCGHFKFCATFKDTYPIEPPKVTLLSKIF
                     HPNIDLQGNVCLNILREDWSPVLDVQSILIGLLMLFLEPNATDPLNKVAADVLAANPH
                     QFRRDVATSLRGGQVNGQWYDRVI"
     gene            <819533..>820510
                     /locus_tag="KLTH0H09526g"
                     /db_xref="GeneID:8294614"
     mRNA            <819533..>820510
                     /locus_tag="KLTH0H09526g"
                     /product="KLTH0H09526p"
                     /transcript_id="XM_002556243.1"
                     /db_xref="GeneID:8294614"
     CDS             819533..820510
                     /locus_tag="KLTH0H09526g"
                     /note="similar to uniprot|P05150 YJL088W Saccharomyces
                     cerevisiae ARG3 Ornithine carbamoyltransferase"
                     /codon_start=1
                     /product="KLTH0H09526p"
                     /protein_id="XP_002556289.1"
                     /db_xref="GeneID:8294614"
                     /db_xref="GOA:C5E316"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="UniProtKB/TrEMBL:C5E316"
                     /translation="MRHLVSIKDLTDKEFQVLVDRAEYYKKTFKCGDLSAAQKNHVKL
                     LGKTAALIFSKRSTRTRVSTEGALSFFGAQPMFLGKDDIQLGVNESFYDTTRVVSSMV
                     SCIFARVNKHSEIQELTKHSSVPIINSLCDMFHPLQAICDILTIKEHLDYTKNKLKVA
                     WIGDANNVINDMAIACLKVGIDVSISTPSGIEMDPEIIKAGQEVAKANGSKLIVTHSS
                     TEAATGANVLVTDTFISMGEEYARVAKLKQFQGFQINSELCSYADPNYKFMHCLPRHH
                     EEVTDDIFYSDHSIVFDEAENRLYAAMAAVDVFVINKGNFSAGPDDILN"
     gene            complement(<820616..>823087)
                     /locus_tag="KLTH0H09548g"
                     /db_xref="GeneID:8294615"
     mRNA            complement(<820616..>823087)
                     /locus_tag="KLTH0H09548g"
                     /product="KLTH0H09548p"
                     /transcript_id="XM_002556244.1"
                     /db_xref="GeneID:8294615"
     CDS             complement(820616..823087)
                     /locus_tag="KLTH0H09548g"
                     /note="similar to uniprot|P09880 YJL087C Saccharomyces
                     cerevisiae TRL1 tRNA ligase"
                     /codon_start=1
                     /product="KLTH0H09548p"
                     /protein_id="XP_002556290.1"
                     /db_xref="GeneID:8294615"
                     /db_xref="GOA:C5E317"
                     /db_xref="InterPro:IPR012387"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR015966"
                     /db_xref="InterPro:IPR019039"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E317"
                     /translation="MVFETAEDSKKLVKELEAATLLPKRGRSYKHKCQIKNTNKEVFS
                     WKFNEWDYGKNNIKLPLNARGLFTLDDPENPRIVARGYDKFFNINEVSTTKWDWLAAN
                     TLGPYEVTVKENGCIIFVSGLEDGSLVVCSKHSTGERDDTDRNHSMAGENFLKRQLES
                     YGLEPRELGLALFNMNATAVAEYCDDSFEEHILEYTKDAAGLYLHGININKRVFQTLP
                     MNEVHDFALAYGFKTIEYFTKHDITTLRQFLEECASVGSYRNKEIEGFVVRCKLRDGS
                     AFFFKFKFEEPYLMYRQWREATKKYITTKSRVFSFKKHRFITNKYLDFVIPILDADPK
                     ICEEYMRDSGIIKLRKVFLEDYGLTGMEILNSEVIQQLELQNAIDYNKVDENTKFLLF
                     PVATIGCGKTTTALTIRNLFPETWSHVQNDDITGKDKSLLMKRSLELLAKDNIKAVVT
                     DRNNHQFRERKQLFEWFEELKEKYLPYDCNVKIVALSFLPYEDIDATSRLTIKRVMAR
                     GDRHQSIKVDSDGEKKVLGIMRGFLKRYQPVAPDRDPDNMFDLVINLQVRDTDSSLIN
                     AKEILRELNHHYPVLVPSIPPAEDIKAAFDKSLLYTPTTTKKIGKSSSSEGKAFKLKP
                     SYFSANIEGPQSFIKAICDLVSRVETSTDVSSVIKAFEENKAQPEFHITLCHVATGKR
                     GTQKQKDIWCEFNKRYNHLLVKGEGNQTFQNTLIKTNDKVEFKVKSVVWDSSIVTLVA
                     ELPENCVLDRTTGKAAPRLSCANEVAHITIALLQPGVKPFYSNTLCQKMQQEHGFEEG
                     NFDDGTNCVVIHESPVFEATVSINP"
     gene            <823303..>825168
                     /locus_tag="KLTH0H09570g"
                     /db_xref="GeneID:8294616"
     mRNA            <823303..>825168
                     /locus_tag="KLTH0H09570g"
                     /product="KLTH0H09570p"
                     /transcript_id="XM_002556245.1"
                     /db_xref="GeneID:8294616"
     CDS             823303..825168
                     /locus_tag="KLTH0H09570g"
                     /note="similar to uniprot|P19658 YJL085W Saccharomyces
                     cerevisiae EXO70 Essential 70kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p)"
                     /codon_start=1
                     /product="KLTH0H09570p"
                     /protein_id="XP_002556291.1"
                     /db_xref="GeneID:8294616"
                     /db_xref="GOA:C5E318"
                     /db_xref="InterPro:IPR004140"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:C5E318"
                     /translation="MDEYDVDGADILVLREKLNRVSRLSLNINKSLKKIGKATIQSSE
                     LFTPIIQSNTALGVLQRNIEGSLDAVSSIKDLANDASKHELVLTQGIEAVGLKPYIKA
                     IRKLQGIQESMDYQNQVSPESSEFQGIRTHLSQIVQSSEEALRTHFTIILRKIEPFDP
                     QINLNKKVPFPYYEDSDLSQLTDIINFFGGSSSSPLVAILANNRSQLILTSLAFLEPF
                     AKQITTNENVPYRKGSSGFLNYTEALLGFIANEYMFTEDILAKKPSFRDQVFANIVTP
                     VLNNYVKLVKLNISLIKKNVLNVGLFTFELSDCVGNALKFLRNKPLENYTPLVSSLDE
                     STSILQSLFRDLIVYIESKASQLSQLPSDNGVIESTIDVMSRLRKFSEYKQGCLNCIV
                     GMRREEWLPKDYNEKEYTLQERKQINSNTALLSCFFSDCIDCLIVSLERRAQRILMPN
                     QEPDIANPTSPRNTFKQRIGFFLITNITLIEQIVSRSELNSILGERGNARLEKLKKRY
                     VNYFVSDWRALTSNLLDAVFVDSSGKVSAKDKDQIKEKFKKFNDGFEELASNFKHFRI
                     SDPAMKKLLKSEINSLVLPLYERFHGRYKDSFKNPRKHIKYTPNELSTVLNSLDR"
     gene            complement(<825306..>828095)
                     /locus_tag="KLTH0H09592g"
                     /db_xref="GeneID:8294617"
     mRNA            complement(<825306..>828095)
                     /locus_tag="KLTH0H09592g"
                     /product="KLTH0H09592p"
                     /transcript_id="XM_002556246.1"
                     /db_xref="GeneID:8294617"
     CDS             complement(825306..828095)
                     /locus_tag="KLTH0H09592g"
                     /note="similar to uniprot|P47029 Saccharomyces cerevisiae
                     YJL084C Cytoplasmic protein of unknown function that
                     interacts with Pcl7p phosphorylated in vitro potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0H09592p"
                     /protein_id="XP_002556292.1"
                     /db_xref="GeneID:8294617"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5E319"
                     /translation="MSSSVDAGNSPMFPVDKDLQIADSAQPLTQTTSIQIFIQLAEPV
                     LFLQGFEQHQWEERPPGLLRGTLIIRVLKPSKIKSIDLTFKGTSRTEWPEGIPPRRQE
                     FLETIDIVNHTWPFFQLEHNNVHSSGSTDADDLLKGSCASLYRPLKNKRGSVSYINLN
                     AATPASPPKNQGTNFLPIGNILRKATSPDSQKRERSRSISDLLAGTLSNNSDNASLFS
                     KSSSSGGEPFIFQPGDYIYGFEQTIPLSCPESVQAAFGSVEYTLSANVERSGAFKSNL
                     HARLPLEVIRTPSDSSVEETEPIAISRDWEDQLHYDIVIASKDIVLDAFLPIAFKITP
                     MDKVNLHRIRIYLTETMEYYCKNKKVHRLEPAKKFLLAEHKAPVLENLPSNANASKAK
                     NLGNLLIDESNGDLVSKEFGYQVFIPERLNLQQRIHPDTSYQNIKANHWIKICLRLSR
                     NLDGKKKHYEVSIDSPIHVLNKLCSHANTLLPSYDTHTFIPGTDCSEFGDLNVNLYHV
                     SNLYFPKEVIGSPALSPEVMPLEERGTFSPRSLSPIRNGGSSISLHSRRADGQPKMLD
                     DFILRSPELKSNVYQPDNIKPELTSPQAIPLSPISSPRARPINMIRTPSFEPPPFDAN
                     EPPSRTLFKAMTDPMSRAPRDPPTYQEVMAADGVAPVLRPPKFKITSSNEYDDDGVDP
                     KNTQKKNLEEESGDIASSFSFNGTRLDSPDLPSSILKSSPKLRPLNFAHGPSRRGSIQ
                     DNLPSTVKNSSENYSDLNDILNSPDISTDRNIVPSRSSSAAASPRSSIETAASFITQR
                     EDTMNMEPLLSPKANQTLDTLLQSKESLDDYADDATEASVDITALYDRNSNSWHPLQN
                     NVPTHPIISRQYSSGVADGNNVFEDFKKAFKIPAGTEYTRASTKQELTTSSATAGSES
                     SPENITFSDSPQTNQ"
     gene            complement(<828395..>828796)
                     /locus_tag="KLTH0H09614g"
                     /db_xref="GeneID:8294618"
     mRNA            complement(<828395..>828796)
                     /locus_tag="KLTH0H09614g"
                     /product="KLTH0H09614p"
                     /transcript_id="XM_002556247.1"
                     /db_xref="GeneID:8294618"
     CDS             complement(828395..828796)
                     /locus_tag="KLTH0H09614g"
                     /note="some similarities with uniprot|P36116 Saccharomyces
                     cerevisiae YKR020W VPS51 whiskey (whi) mutant forms a
                     tetramer with VPS52 VPS53 and VPS54"
                     /codon_start=1
                     /product="KLTH0H09614p"
                     /protein_id="XP_002556293.1"
                     /db_xref="GeneID:8294618"
                     /db_xref="UniProtKB/TrEMBL:C5E320"
                     /translation="MAEQITHKRPIRIKIDKDKRKQLQDFYKLREEQSPVSDNINENH
                     ESVDQDVASASEDCVEPPTLKISESTLSELVSAHNTLLGKETEVNNTIKNTIYENYYD
                     LIKVNELLKSVGNDSSDRLAQLSDILKLLEK"
     gene            <829108..>831087
                     /locus_tag="KLTH0H09636g"
                     /db_xref="GeneID:8294619"
     mRNA            <829108..>831087
                     /locus_tag="KLTH0H09636g"
                     /product="KLTH0H09636p"
                     /transcript_id="XM_002556248.1"
                     /db_xref="GeneID:8294619"
     CDS             829108..831087
                     /locus_tag="KLTH0H09636g"
                     /note="weakly similar to uniprot|P47030 Saccharomyces
                     cerevisiae YJL083W TAX4 and to uniprot|P36115
                     Saccharomyces cerevisiae YKR019C IRS4"
                     /codon_start=1
                     /product="KLTH0H09636p"
                     /protein_id="XP_002556294.1"
                     /db_xref="GeneID:8294619"
                     /db_xref="GOA:C5E321"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:C5E321"
                     /translation="MRLNWPKRQSAVISRDPHSGNEDLLSSDASLKAAQAIFKKHSFS
                     SEDGRPDGLAAPSVQPRHKTGNTTRPHPSKALKKRPRAAPKPSMASQTAAPSKQVAQV
                     ANSAAACAAAATAQKTTWTIEPQGKPKNKVAQYFTPNQLKPPVTYSASRSNSRSGSIR
                     SRSSSKSDDFADIVAQLQGNHDAAQSQRSARVGSVSPRANASSDSIASSHMSSDEMAQ
                     AHAINGSNGPPLLSSISPRHSVAGKGYSDFHSSEVENNSIKPSETPTFLNARGVSTRT
                     LPDRRSPPRVYLKDTDAENASTSSLQSSAFSGLPNGGAEVLSEPEYAEYGVSPNTNTN
                     PYRHDYPRSSIDQSSGTMDLNSDRLSYETLSKMPVQVKYHGTLPDLIPNHKREKKRGR
                     LSSLFGRKHKIEEADGSQTDLIQQNDVAVVKATQPTRLKTTMRAQSEDQAVSSANESS
                     DEYESGSEDEFGTADKKKKPRRRRVHIRRQIKKASGHHNSSDKSFNEDKPWKSHIDIG
                     FVTQAERKRYEGMWVTNRNCYLELLPWWQTSGEQQVYVPDEGLILNLVVLDIWSRSNL
                     PQDKLASIYDMVDFRKDGTLERKSFIVGMWLVDQSLYGRKLPAKIEPRVWESVDKYVV
                     NVPSEAQVGFSHKDKQRQIKQEIKSLKKDLKRVQL"
     gene            <831223..>833400
                     /locus_tag="KLTH0H09658g"
                     /db_xref="GeneID:8294620"
     mRNA            <831223..>833400
                     /locus_tag="KLTH0H09658g"
                     /product="KLTH0H09658p"
                     /transcript_id="XM_002556249.1"
                     /db_xref="GeneID:8294620"
     CDS             831223..833400
                     /locus_tag="KLTH0H09658g"
                     /note="similar to uniprot|P36114 Saccharomyces cerevisiae
                     YKR018C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H09658p"
                     /protein_id="XP_002556295.1"
                     /db_xref="GeneID:8294620"
                     /db_xref="InterPro:IPR019412"
                     /db_xref="UniProtKB/TrEMBL:C5E322"
                     /translation="MFRVLGALTGTGGPAKLDQEEQSEKILSQAHDFEVALQAMDYVL
                     DDHPGKGLQLLEGSGAKPKNEEDQCVRVLARGVIEFLEATLGFEASVMKKAAATLSEA
                     QQLSAKRRQQFQKMGLKTSSLYPPGTEYAVTFAEACLLHALLMLFSESMVESAKALFK
                     LRKAYHMLREILNDINAAKKKKGSAMYAQGNNESFASFVSADSSTFKSVDIPYSLSTE
                     EQQNKELMELAENVYNMRKKRLEGAHIGNSPAIERLRTDLGIQALKDLPKKKEAKKPV
                     TLSKAEIDKDQATIDEFIHSGVNLCFGILQVVLSLIPPAIGAVLSVVGFHGSREEGLR
                     LVWRSTKDRNIHGGIGLLGLLFYYDGPFQFTDVDFDVPATSDGLKKTSSNDLDNSTLL
                     HPGKMLEDALLQARALFPNSALWLLQEARMLSSRGRLQEAVDLMDSIDVSGIEMKQVR
                     ALMIFDRAMTLVHLHEFERAAEDLLSLLDINEWSHALYTYFAGCCYLENYRMCQMGLM
                     EYSRIDFFKERATTLIFDAPNMLSRKKFMSKNLPLDRFMLRKVEQFKKFQSQLQLQDP
                     LDAIGVSPVHELTYFYNGYNRMTEDCLKLSHKLLTEYHNPTIDAKEPNQELVKNLLTS
                     LTSRRLGKVQEGCDMLDKNVLPQIITLQPDGKVKYIKKTEDPWAYPTALYERALFTWK
                     LKGLDGLEECKMWLTRAQDYADDYELSARIGMKIKAAIDRLEG"
     gene            <833533..>835155
                     /locus_tag="KLTH0H09680g"
                     /db_xref="GeneID:8294621"
     mRNA            <833533..>835155
                     /locus_tag="KLTH0H09680g"
                     /product="KLTH0H09680p"
                     /transcript_id="XM_002556250.1"
                     /db_xref="GeneID:8294621"
     CDS             833533..835155
                     /locus_tag="KLTH0H09680g"
                     /note="similar to uniprot|P36113 Saccharomyces cerevisiae
                     YKR017C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H09680p"
                     /protein_id="XP_002556296.1"
                     /db_xref="GeneID:8294621"
                     /db_xref="GOA:C5E323"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:C5E323"
                     /translation="MKEGSVYDEGFNDDDDDDSILLEFESGSDIEYDDTGLLRRDPGL
                     ASLSDEESGKGGNNGYYLDGATISSRNVVIPKDELYENDGVPKLSYRCLTTDQIYELM
                     LERLERIQPIFDISYEDIIVLLQQYAWSEERLLEDWTENRDNVIVSCGLKLGHEPVAS
                     RGIRKHANFLCHICCEANKMKTFTLECGHEYCLECYQHYIKDKLLEGKIITCMSCPLA
                     LKNKDIDAIMGDNSSQKLMRSSIKGFIQKHSNHYKWCPFVDCNCIIQVGNISTLSEFP
                     RFHLSPYVVCDNQHRFCFKCGLESHSPGDCHVAELWVKMAQLESANLNWVLTNTKECP
                     KCGVNIEKNGGCNHMTCKSCAYEFCWICEGCWAEHGGGYYECTRFKKEDKNGAVESKN
                     AIRKYTFYYKLFSEHENSAKLDWSLGLTVEQKVKALQENIGISWIETQFLPESIRALI
                     EGRTTLKWSFPVAFYSDPSHNLTKIFVDNQSLLVSAVEDLSQLLQVKEPQKIIDRKLE
                     FFNKARFVRSRDKALVECGRDLLCKGICIPHQ"
     gene            complement(<835255..>836700)
                     /locus_tag="KLTH0H09702g"
                     /db_xref="GeneID:8294622"
     mRNA            complement(<835255..>836700)
                     /locus_tag="KLTH0H09702g"
                     /product="KLTH0H09702p"
                     /transcript_id="XM_002556251.1"
                     /db_xref="GeneID:8294622"
     CDS             complement(835255..836700)
                     /locus_tag="KLTH0H09702g"
                     /note="similar to uniprot|P80428 Saccharomyces cerevisiae
                     YJL081C ARP4 Nuclear actin-related protein involved in
                     chromatin remodeling component of chromatin-remodeling
                     enzyme complexes"
                     /codon_start=1
                     /product="KLTH0H09702p"
                     /protein_id="XP_002556297.1"
                     /db_xref="GeneID:8294622"
                     /db_xref="GOA:C5E324"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027667"
                     /db_xref="UniProtKB/TrEMBL:C5E324"
                     /translation="MSNPALQIYGGDEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCY
                     GQYTAGGKEGQKSFNDQFMIMPRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFE
                     SFKGTPAFLTEAIWNPEENRKKSLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLD
                     IGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRELVPLYKVERKRPEFV
                     PKKFEFTVSKSVDEFANSRGFLQECKETMLHVAAVELPKFQSELETTSKRSIEAPWGE
                     NIIFDSNARYSFAEQLFKPTKEMLPSDWPVTKDGVVETWHNDYVPMKRAKPGLGNKDK
                     EGTTESTPAPEEANGETPSATTNENGKRPIEESSKTSDAIAGLADLVNTAITATDVDL
                     RATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSGHLRERQSRAWLGGSI
                     LSSLGTFHQLWVGRQEYEEVGAERLLKDRFR"
     gene            complement(<836980..>838563)
                     /locus_tag="KLTH0H09724g"
                     /db_xref="GeneID:8294623"
     mRNA            complement(<836980..>838563)
                     /locus_tag="KLTH0H09724g"
                     /product="KLTH0H09724p"
                     /transcript_id="XM_002556252.1"
                     /db_xref="GeneID:8294623"
     CDS             complement(836980..838563)
                     /locus_tag="KLTH0H09724g"
                     /note="weakly similar to uniprot|P36112 Saccharomyces
                     cerevisiae YKR016W FMP13 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0H09724p"
                     /protein_id="XP_002556298.1"
                     /db_xref="GeneID:8294623"
                     /db_xref="GOA:C5E325"
                     /db_xref="InterPro:IPR019133"
                     /translation="MLRSRATINCVKSGRAGRALSRGMATFEGQPAARPNRLSKLLVR
                     VGLATVGFYVGGVTLSLNNDQFGELFCDNVPLAESLVEMYEEFRDEKMQASRMSLDEL
                     KQKFGELGTKVDRIPNRGADPALTSQAVAALPASKEVRLEDESLVKLRLPEVEQLGSC
                     KRATPLVESVNAAVAAVNEQSLLLPEDTYNAVHDAFTKLKSALQAINEDIRTNVAESV
                     AVQYGQASKDLHESFEIRAKSREVELTQQFLNEFNAFKAQLEKHSSEELASALKANEQ
                     ALLAKQSNEVALLSMKQVEEFTKILSEKLDQERQGRLSKLEALNGSVQELAEAVDQVD
                     TLVMKSEVLSQLSLLTTLLKNKLHAGDESSVKIDSELARLKTLCDILPGRPSKCCSKN
                     PQLLDVVVSQLDSLASQQLILSNEQLYNRWTLLQKDLSTSSLLPPNAGILGHISAKIF
                     GFFLFNKNGAPVDNDIDSVIARVGQNLRLSKLDKAVEEVVALKGWPRVLCDEWVQEAR
                     KKLEIETLIDALDCEIRSS"
     gene            <839114..>840394
                     /locus_tag="KLTH0H09746g"
                     /db_xref="GeneID:8294624"
     mRNA            <839114..>840394
                     /locus_tag="KLTH0H09746g"
                     /product="KLTH0H09746p"
                     /transcript_id="XM_002556253.1"
                     /db_xref="GeneID:8294624"
     CDS             839114..840394
                     /locus_tag="KLTH0H09746g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H09746p"
                     /protein_id="XP_002556299.1"
                     /db_xref="GeneID:8294624"
                     /db_xref="UniProtKB/TrEMBL:C5E326"
                     /translation="MDTLLANIDSGPELLEHSSELQDCSRNLGLEEFASFSKMCRLYH
                     ELRETAYGEEMNKLAVAFANVLLKQQGFRAQALAQNAELAEDVQMRLERDSVSSEGFK
                     VEWEVPLWRVLFLLAHGHADGSRSFEVFSRDLVPNKFQHLAEKLAENEQQSSKLPLVF
                     EELGKYWYALCYNYGSFVVTHGAHFWSSLESFTASLRANDGRLLGDYASALLQLCSPL
                     LLFPENNLLATFDMVLNLTLILKHGIIAWSGKVSEELYSSPQDYKIPQILHVIFVFVA
                     KSPHAVRKRIQPCFSGEEGCGVNLRKQVLDLQCSKITCSETRETLDRILSALGLTVSA
                     NDDGELEVIHVVQSQPPSARDSTETVYDQRYSQSSSRLSDLSSSGTTLHNSLDGDYDD
                     LWSEEDKIAEADRIMAVIRRLDELGIIKPKFPGQ"
     gene            <840625..>841314
                     /locus_tag="KLTH0H09768g"
                     /db_xref="GeneID:8294625"
     mRNA            <840625..>841314
                     /locus_tag="KLTH0H09768g"
                     /product="KLTH0H09768p"
                     /transcript_id="XM_002556254.1"
                     /db_xref="GeneID:8294625"
     CDS             840625..841314
                     /locus_tag="KLTH0H09768g"
                     /note="similar to uniprot|P36018 Saccharomyces cerevisiae
                     YKR014C YPT52 rab5-like GTPase involved in vacuolar
                     protein sorting and endocytosis probable purine
                     nucleotide- binding protein"
                     /codon_start=1
                     /product="KLTH0H09768p"
                     /protein_id="XP_002556300.1"
                     /db_xref="GeneID:8294625"
                     /db_xref="GOA:C5E327"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E327"
                     /translation="MGWVKSPIHKRAHQNKRYNTATMLQFKLVLLGDSSVGKSSIVHR
                     FVKDSFDEFRESTIGAAFLSQTIKLEKHPDVTIKFEIWDTAGQERYKSLAPMYYRNAN
                     AALIVYDVTQPGSLVKAQSWVEELKNKVGDQDLVICLAGNKVDICDEDATAREVQRED
                     AQLYAQEQGLLFYETSAKTGAGVSAIFQEIGERVYQKKGMEVPSSTQARKPLNVELQR
                     PSTNDSTSCCS"
     gene            complement(<841554..>845168)
                     /locus_tag="KLTH0H09790g"
                     /db_xref="GeneID:8294626"
     mRNA            complement(<841554..>845168)
                     /locus_tag="KLTH0H09790g"
                     /product="KLTH0H09790p"
                     /transcript_id="XM_002556255.1"
                     /db_xref="GeneID:8294626"
     CDS             complement(841554..845168)
                     /locus_tag="KLTH0H09790g"
                     /note="similar to uniprot|P06105 Saccharomyces cerevisiae
                     YJL080C SCP160 May be required during cell division for
                     faithful partitioning of the ER-nuclear envelope membranes
                     involved in control of mitotic chromosome transmission"
                     /codon_start=1
                     /product="KLTH0H09790p"
                     /protein_id="XP_002556301.1"
                     /db_xref="GeneID:8294626"
                     /db_xref="GOA:C5E328"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5E328"
                     /translation="MSFPETEISAPAVEQDAAIETPPTSVDASSEGAAPAPEAAPAKK
                     PLPTKKDFPTLGSGAFLAAANKVSWGPNMKPAAATASGTSSGSSSATQSRSATPAPSA
                     KPARSKTIQEAFSLDLQSQIAVSKPDFSRIVQGVKTAHSVSVESTLSKTSRMFLIAGK
                     PESVRAAKREIVKKLTKPVTTTLQVPSKCRSAIIGAGGRKIREISEPLEVRIDVGKEI
                     VEGSYDEDLDDSMVDITIHGDLESVRIAQEKILAIVKEDTKNASIKVNVENKDLVPFV
                     DLEALNLKVEAHFNASAGQFQISGLRDDVQAAKAAVNKYLSELGSQIKTLKVKIPSKF
                     QFLIDTADIKKRFNVIVNMPAPGEEEVAFIGPADKLDEAVTYARENSKKFIVESLEIS
                     KAHGKNVAHAKNIAIYFSKYNSLEEIKKSYPNVRFAIPTAQELQGTDAVAIRVTTTSE
                     NAGELKAVRKDIINLVNELPTSQVLIVDDLDYELFHKDIKHLLQQQEQKAGFVQLGDL
                     YPGDDRVLIVAKLSDEDFRPSDEELKEILAEVNSALEPLRAKQSNLSHKTFEVPAADQ
                     DNYFSSSALIRKLIEQDIAAEGGHVQFKLHHPSAKQLTIRGDTKAAKVATAAVESIIG
                     SPDEKFETKFAVSSNSVPRLIGSKGANLNAIREKYQCNIDVAQESNGTTTDVTISGLQ
                     FCVEHAKAYMISESKKWADIITKELNVLPKYRGKLIGSQGSYRNRLQNKYSVHIHFPS
                     EGENEGVTIRGPSRGVAKAYDELKALLDFEIENGHTSTITVPAEHVPRIIGKNGDTIN
                     DIRADCGVEMDFLQKTTDAKAVETGKVELKITGSRQAIKEATQKVEAIIKEASDVETE
                     SFEVKPEYIRDIVGAGGRVLKSLISKAGGDEIRNKSVDIPDASSKDKKITVQGPQAFV
                     KSIVKEIKAIIEERENSIEKELDVPADRVGALIGPGGVTRRQLEADFHVRLSLPDIGD
                     KDSKVKVSGLAENIAACEKQIFTQIIRDSCDLEIQVPASFHEFVSEKGALIQRLRSDF
                     FVNVKFGNANGRANKLARANLNIPVEKASGSDEESIKLTTEEVPLNVDESQAPIPWRL
                     SYEPVDLSDILTEEERANDKQVSKDEVLEKVQKIIQQKIDLAPQASTVGYLWSRKPQD
                     FRKVVGSLGSNIKRIREATNTVLNVPKKNEKVNDIIYIRGTKEGVEKASELIKNKLKN
                     "
     gene            complement(<845566..>846210)
                     /locus_tag="KLTH0H09812g"
                     /db_xref="GeneID:8294627"
     mRNA            complement(<845566..>846210)
                     /locus_tag="KLTH0H09812g"
                     /product="KLTH0H09812p"
                     /transcript_id="XM_002556256.1"
                     /db_xref="GeneID:8294627"
     CDS             complement(845566..846210)
                     /locus_tag="KLTH0H09812g"
                     /note="some similarities with uniprot|P47032 Saccharomyces
                     cerevisiae YJL079C PRY1 Protein of unknown function, has
                     similarity to Pry2p and Pry3p and to the plant PR-1 class
                     of pathogen related proteins"
                     /codon_start=1
                     /product="KLTH0H09812p"
                     /protein_id="XP_002556302.1"
                     /db_xref="GeneID:8294627"
                     /db_xref="GOA:C5E329"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:C5E329"
                     /translation="MNPLSVLGALLLLTSRALAATIALASEPAPAWITTRTTVFRTVR
                     LSSTSAPRASSPLSVTTATTASATATLPSTTSSSFQTQILLEHNSYRALHHAPALTWS
                     TQLASYAQNYANSYNCNGTLVHSGGSYGENLALGYNSSAAVAAWYNEVRLYNFKNPGF
                     AEDTGHFSQLVWVSSKRLGCARVDCGDYYGQYTICSYDPPGNVAGQYKANVLKT"
     gene            complement(<846452..>847540)
                     /locus_tag="KLTH0H09834g"
                     /db_xref="GeneID:8294628"
     mRNA            complement(<846452..>847540)
                     /locus_tag="KLTH0H09834g"
                     /product="KLTH0H09834p"
                     /transcript_id="XM_002556257.1"
                     /db_xref="GeneID:8294628"
     CDS             complement(846452..847540)
                     /locus_tag="KLTH0H09834g"
                     /note="some similarities with uniprot|P47032 Saccharomyces
                     cerevisiae YJL079C PRY1 Protein of unknown function, has
                     similarity to Pry2p and Pry3p and to the plant PR-1 class
                     of pathogen related proteins"
                     /codon_start=1
                     /product="KLTH0H09834p"
                     /protein_id="XP_002556303.1"
                     /db_xref="GeneID:8294628"
                     /db_xref="GOA:C5E330"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:C5E330"
                     /translation="MKLSQIALVSATAVGAALAAPAAQTTVTEHVHQEHTATVRAAVY
                     VDNGSTYTSLTTEQPSDAVATATASASEATGSVVVVVTTLYGSGAASSAPVSSAESTS
                     SAPLVTAVAQKAAAVSETASESSEAATSSAASSADAGTSAAETSVAASTSSSAAPETT
                     TVAATSESSTSSTSSPAKTSTSAAETSSSAAAETSISTSSPAATSSASSTSSSAAASS
                     TSGSSSFASAILQAHNDKRSLHQDTSSLSWSDELASYAQDYADNYDCSGTLTHSGGPY
                     GENLAAGYSGTGAVDAWYSEIKSYDWSDPNYSSSTGHFTQLVWKSTSEVGCGIKSCGS
                     GTGDYVICSYKSAGNVIGSFAENVKSLN"
     gene            <848950..>850599
                     /locus_tag="KLTH0H09856g"
                     /db_xref="GeneID:8294629"
     mRNA            <848950..>850599
                     /locus_tag="KLTH0H09856g"
                     /product="KLTH0H09856p"
                     /transcript_id="XM_002556258.1"
                     /db_xref="GeneID:8294629"
     CDS             848950..850599
                     /locus_tag="KLTH0H09856g"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008C FLR1 Plasma membrane multidrug transporter member
                     of the major facilitator superfamily involved in efflux of
                     fluconazole diazaborine benomyl methotrexate and other
                     drugs"
                     /codon_start=1
                     /product="KLTH0H09856p"
                     /protein_id="XP_002556304.1"
                     /db_xref="GeneID:8294629"
                     /db_xref="GOA:C5E331"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E331"
                     /translation="MYSDNYRNTLLVDVLEYFRLVKPSHNFAPQATQASLDQESSNKS
                     TKEADIEKDLESGSGAGSAAASATGENRTDGEAAASDPFLVDWNGPSDPENPHNWSRS
                     KKGFVVVQIMILTCVTYMGASIYTPGQEYIQQEFGVGHVVGTLNLSLYVLGYGLGPMV
                     FSPLSETARFGRQHIYLVTLFLFMIFQVGAATVHNIGGLVVIRFISGVLCSPALATGA
                     GSMGDFISPELVPIFIGMWAVGAVAAPVLAPLLGAAMTVAENWRWIFWLLMWLAAATF
                     LLLAAFFPETYASNILHRRAARIRRETGDNRYYTKQERAESEIKTKDFISEILYRPFE
                     IIFKEPIVLAFDIYIALCYGAFYLFFEAFPIVFVGIYNFTLIELGLAFLGFCVGCVIA
                     YIAFLTFLAKVIMPKFKNNTFTPESFLLLAMSVCWSLPLSLFLFGWAAGVHWILPMIA
                     EIFFVLCVFNLFQATFAYLAICYPRYMASVFAGNGFCRAVFACAFPLFGRAMYENLGS
                     EKYPVGWGSSLVGFFSIALAAIPFIFNKYGSQLRGRSSYAN"
     gene            851111..851183
                     /locus_tag="KLTH0H09878r"
                     /db_xref="GeneID:8294630"
     tRNA            851111..851183
                     /locus_tag="KLTH0H09878r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8294630"
     gene            <851372..>852346
                     /locus_tag="KLTH0H09900g"
                     /db_xref="GeneID:8294631"
     mRNA            <851372..>852346
                     /locus_tag="KLTH0H09900g"
                     /product="KLTH0H09900p"
                     /transcript_id="XM_002556259.1"
                     /db_xref="GeneID:8294631"
     CDS             851372..852346
                     /locus_tag="KLTH0H09900g"
                     /note="weakly similar to uniprot|Q02209 Saccharomyces
                     cerevisiae YKR011C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H09900p"
                     /protein_id="XP_002556305.1"
                     /db_xref="GeneID:8294631"
                     /db_xref="UniProtKB/TrEMBL:C5E332"
                     /translation="MQEIYVPIGEDQRVKLTLVSTFQHIGQVRKYLHSIQDTFSVELD
                     TCDTITQNLKIQCVSHRACRSCPLYILEFDDVSDGYALWKSAGDWALGTVLSSLFAAR
                     PASKHRAARLETQLAAHATRKHDPEFLAQALQKLNVDWDAPHARFEFDFALFVRLLDE
                     AVAPEIGARTCDSYLELVSPLQYKSLTTMVVLRTKVAVSKQHVECSLKDYDARMRGLA
                     LARRAADRADSVALDRSHEASVLSDAAERSPSPPVSTSDDDAYLLSSSQQLLTNFQKH
                     FRGMAETFETFDVKRAAQSPRRLAAPSDCWKVSKPVKNGKSKPSKVHA"
     gene            complement(<852480..>854204)
                     /locus_tag="KLTH0H09922g"
                     /db_xref="GeneID:8294632"
     mRNA            complement(<852480..>854204)
                     /locus_tag="KLTH0H09922g"
                     /product="KLTH0H09922p"
                     /transcript_id="XM_002556260.1"
                     /db_xref="GeneID:8294632"
     CDS             complement(852480..854204)
                     /locus_tag="KLTH0H09922g"
                     /note="similar to uniprot|P05066 Saccharomyces cerevisiae
                     YOR386W PHR1 DNA photolyase involved in photoreactivation
                     repairs pyrimidine dimers in the presence of visible light
                     induced by DNA damage regulated by transcriptional
                     repressor Rph1p"
                     /codon_start=1
                     /product="KLTH0H09922p"
                     /protein_id="XP_002556306.1"
                     /db_xref="GeneID:8294632"
                     /db_xref="GOA:C5E333"
                     /db_xref="InterPro:IPR002081"
                     /db_xref="InterPro:IPR005101"
                     /db_xref="InterPro:IPR006050"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018394"
                     /db_xref="UniProtKB/TrEMBL:C5E333"
                     /translation="MKRSVSPPPAVSKKLKLSEGFEAYYKLDPRYYPNAITWQQANEF
                     NNGKREKPAALLDERIKKQKLPAKADISAVVHWFRTDLRVRDNAALSNAIKLLREIRG
                     QKKDAQLIALYTINEHDWRAHLDSGWKLTFALNALESLREMLKQMNVALVVRKFESKK
                     PLLSRSSEFVDWVKEQCVSLAQGNVLVTANAQYETDELYRDLKLFDKQDEQFRFQVYH
                     DQCIVQPGSLTTGKGSQYTVFTPWYKRWVEYLKSHKQGKEAIKIHAVDQESKVNESLA
                     KFESEAYELSDEFLAYLPCDKLEVPPATEADAHELLQEFISSGNAHKYNEKKDTLSLD
                     STSHLSCYITSGLISTREVVNRAFHENGDSLMRRDIKQNNSVENFIKEVAWRDFYKHV
                     MCNWPYMSMEIAIKFETMDIKWENDEEKFSKWCLGETGLPVVDAIMRKLLYTGYISNR
                     CRMIVASFLSKNLLVDWRWGERWFRKHLLDADLASNAGGWGFCSSTGIDAQPYFRIFN
                     MKLQCERYDPDGKFVKMWVPELKDADNVRIIREGRSEKDAVDGYPSPIVDLKDSRERA
                     LEAFREAL"
     gene            <855476..>859174
                     /locus_tag="KLTH0H09944g"
                     /db_xref="GeneID:8294633"
     mRNA            <855476..>859174
                     /locus_tag="KLTH0H09944g"
                     /product="KLTH0H09944p"
                     /transcript_id="XM_002556261.1"
                     /db_xref="GeneID:8294633"
     CDS             855476..859174
                     /locus_tag="KLTH0H09944g"
                     /note="some similarities with uniprot|P47035 Saccharomyces
                     cerevisiae YJL076W NET1 Core subunit of the RENT complex
                     which is a complex involved in nucleolar silencing and
                     telophase exit stimulates transcription by RNA polymerase
                     I and regulates nucleolar structure"
                     /codon_start=1
                     /product="KLTH0H09944p"
                     /protein_id="XP_002556307.1"
                     /db_xref="GeneID:8294633"
                     /db_xref="InterPro:IPR018844"
                     /db_xref="UniProtKB/TrEMBL:C5E334"
                     /translation="MYKLQVVLVPPSPGTGAFPLPMNPPTTENSQVLPSGGGVNGSAI
                     LGGGRPDLVSTTSANNLFMSSFVSSHIPQPKLRKLLHFTKPTNTLFTLAQEIVERCDK
                     LYPNLAQPVEVLTLQDSNECDLDPDYLVKDVFIVDNVVRAVLRNDIEIAEEDPQSLYS
                     VKRRRLNSSAPSSGGQSNVLHIAKKRPHMLRNSAAMRVSTPLANQIYPPAGGRQVNSD
                     YEDEDVGDRSVLPPPQPQSQPIRISSGVDSAKKINFNEDTVSRSEAVDPDKSRQQRLP
                     SGTPMRSINNKNAMTPERSNAQGQSAAAELTSKVSATPLATNNRITSGMLRIPEPKIS
                     EVENELRQGPASPSAELPARPDRIPMKKQQLPQSDDDEQSDPSAEEEPVLAELNNQHF
                     EPGLKNSASRQTSIADNNGSPIKDGNKIGNVNLAELPQVGRRATRKSSLESKVESLIK
                     SATNLSEEAREDMQRRKEDSNNARRKDTFSDEDEAEEGPLQDDPNDTVRVNHLDSANT
                     SFQKSELLSMLKGNKFNIPSDFNKRSLRSNRGFVDNVVQKPDTNPKDVINQRVQRGAA
                     RKASELLSSGQSRAQEPSSESDDESSGIETDRSDSGKITVLENEALKKLNIHPLKERV
                     IGEERKEQSKPEKEILERTSVISSVEPQPDREELPGPGVSRGVKRSAAKIPKSSQPAT
                     NEPAKAANGKGIKGKSLANKTQKPEPPSAVSSSSSQDSSPASGQTETSSEHPNTIQKS
                     PSREEVSSKLMKAISPAPGDLETKAYQSPEFIEDSDENELTSEKASASEASIPSKDQQ
                     KKLPPSILKRKEEAEKRRKEREAVRKARDEEKAKIKAEKEAKKREKEEAIAHKKAERE
                     AKRKLREEEAAKKKTERESRSGAKGPRGASKQTTKPVKESKPADENITSAKAADSGTN
                     EKPVTSNPPEIGSSKSQNHVDDKNTGSLKPQDLAQYFATSDKNKTTAAQKNTPTSSQV
                     AETTDENDTKLEKLKSQFASGKPQSAESKVKAPMEPSTHSQISPETSTSSELPDEDSS
                     SNDNESSGDDSSEDESTLNTKTRRGIVDTPKGAIISIPKRGQKDEFSGVESAPQSTQT
                     ALDNKSPEKTPAKVPVTRMMEMSSPAAASKSPSSPKVTKKPESKPSRSLSSLSDLVSR
                     GVPEVKEVSMKSATPLRSSTGKEVSSDDQSEDDSEQSDSDDSESSDGSSDGEGSNFIS
                     AKSASKALGRNKKSHSGFASLVKDSKKN"
     gene            complement(<859362..>863036)
                     /locus_tag="KLTH0H09966g"
                     /db_xref="GeneID:8294634"
     mRNA            complement(<859362..>863036)
                     /locus_tag="KLTH0H09966g"
                     /product="KLTH0H09966p"
                     /transcript_id="XM_002556262.1"
                     /db_xref="GeneID:8294634"
     CDS             complement(859362..863036)
                     /locus_tag="KLTH0H09966g"
                     /note="similar to uniprot|P47037 Saccharomyces cerevisiae
                     YJL074C SMC3 Subunit of the multiprotein cohesin complex
                     required for sister chromatid cohesion in mitotic cells
                     also required with Rec8p for cohesion and recombination
                     during meiosis phylogenetically conserved SMC chromosomal
                     ATPase family member"
                     /codon_start=1
                     /product="KLTH0H09966p"
                     /protein_id="XP_002556308.1"
                     /db_xref="GeneID:8294634"
                     /db_xref="GOA:C5E335"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:C5E335"
                     /translation="MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAA
                     VRFVLSDDYSNLKREERQGLIHQGTGSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIV
                     RVRRTIGLKKDEYSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAKDRE
                     RLALLEEVVGAKSFEIKLRESAKKMEATNRDRTRIDSELAELRTRLDELNEERQELEK
                     YQKLERDRRIFQFVLYDRELNEVTSQIESLEDEYNHVLQSSEEFLQELYKREELIENV
                     TKNISNIETELRVKESMDLQQEKSRLQEISKRKADLEVHLEEAKRQAEAHKKQTSVDQ
                     NNLKTVEEEIEKKSLQLERLIPRFEQLKSESQEFESQLSNYQRSQREIVSKRGIYAQF
                     KSKVERDEWLKNEIASLKAQHQDLAEQLAALTREKEQTGSEVEVFNEEITELNDSVRG
                     PGIQAELQDLQSHLDSLKQSYLGKIDERKELWRAEQKFLTVSDALNDGVKRSERNLSE
                     TMDRGLASGLRAVREISERLKLPADSVHGPLGELIKVNEKYKACAEAVGGNALLHVVV
                     DTDETASILMEELYNTKAGRVTFIPLNRIADSNPVTFPDNSQAECTPLIWKMKYEKRF
                     EKAVRHVFGRTIVVRDIGTGSKLAKSFNLDAVTLDGDRTDKRGLITGGYHDYHKRNRL
                     DCLKEMSAAKRQLLEATKNLDAARGQITAIDTEIDQINDEIKTQSSRKEAILSNIENM
                     RAKLNKKTAERALKKEILDSITTKHARMETSLKLNEEKTERFETDLNKPFEKGLSDEE
                     EQTLKSLADKMRAVSEPLSVTADALNELTLKIDLLKAELGVKLVPQKKEIEDRISQAS
                     GSKRLASSEELSQISTELEKLASREHELQTSLQGISDNIASLNEEKENNQQILEKANS
                     QQRALLKKLDGYQKDAEKSVIRKTTLVSRRDEVQQKISEIGLLSEESLDRHQNLDSEE
                     VLRRLNEVNDKISKTSNVNRRAIENFRKFNEKREELENRAEELARSKESIEELVDSLK
                     KQKIEAVEATFSKVANNFTHIFEKLVPAGVGKLVIHRNESTRNASGGRGPQQGSGASG
                     NEDDSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYL
                     FDEIDAALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEIS
                     AVSQQDAIRFIKGKSRMGEL"
     gene            complement(863828..863942)
                     /locus_tag="KLTH0H09988r"
                     /db_xref="GeneID:8294635"
     tRNA            complement(join(863828..863871,863905..863942))
                     /locus_tag="KLTH0H09988r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8294635"
     gene            complement(<864238..>865470)
                     /locus_tag="KLTH0H10010g"
                     /db_xref="GeneID:8294636"
     mRNA            complement(<864238..>865470)
                     /locus_tag="KLTH0H10010g"
                     /product="KLTH0H10010p"
                     /transcript_id="XM_002556263.1"
                     /db_xref="GeneID:8294636"
     CDS             complement(864238..865470)
                     /locus_tag="KLTH0H10010g"
                     /note="similar to uniprot|P38355 Saccharomyces cerevisiae
                     YBR287W ZSP1"
                     /codon_start=1
                     /product="KLTH0H10010p"
                     /protein_id="XP_002556309.1"
                     /db_xref="GeneID:8294636"
                     /db_xref="GOA:C5E336"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C5E336"
                     /translation="MDDSSGLSFGHISYVTLESVLQVVIVAFSGFWCAYTGLLPKQGQ
                     KVISRLNVDVFTPCLIFSKLARSLSLAKILEIAVIPVFYAMTTGVSFMSGKLMSRILG
                     LDKDESNFVVANSIFGNSNSLPVSLTVSLAYTLPGLLWDEIKDDNRDNVASRGILYLL
                     IFQQIGHVLRWSYGYNTLMRWSGDRGHPSIASVSEQLEVPDSEAGRSETPSGISARSY
                     SSLYKLKGKVMKMWEKIQAVMNPPLWAMVISVFVASVHPIQHEFFSKNGFINNTLSDA
                     IKELGALSIPLILVVLGSNLYPSQDTPQMTRNHKKMVLGSIVGRMILPSCFMLPVIAL
                     AVKYIKVSILDDPIFLVCGFILTISPPAIQLTQITQLNEFFEAEMASVLFWGYVVLSL
                     PISIFGVTAAMTVLKWAA"
     gene            <865827..>867650
                     /locus_tag="KLTH0H10032g"
                     /db_xref="GeneID:8294637"
     mRNA            <865827..>867650
                     /locus_tag="KLTH0H10032g"
                     /product="KLTH0H10032p"
                     /transcript_id="XM_002556264.1"
                     /db_xref="GeneID:8294637"
     CDS             865827..867650
                     /locus_tag="KLTH0H10032g"
                     /note="weakly similar to uniprot|P40358 Saccharomyces
                     cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
                     nuclear membrane fusion during mating localizes to the ER
                     membrane exhibits genetic interactions with KAR2"
                     /codon_start=1
                     /product="KLTH0H10032p"
                     /protein_id="XP_002556310.1"
                     /db_xref="GeneID:8294637"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5E337"
                     /translation="MIRWIFYVAVGIAHAAGKCDFGRLSGASHELRYDDSEIPQYQKL
                     CEQLSHCDHPEAEALRNQLLYKSGLIQVSSGQELAAAETLEQILGSSDVKFQSQASKR
                     LDEIYLQFGFWDKLKGEGGKKQEYEALRNAVVVQLSRNQAVPHESLAQLEEIAPFALE
                     TRILLNDALLRELGETLDINAAQSIIENYKIILTKHKKLVNVQDKLRIHHAVAVLQMF
                     VMATPPTNLLSCLALDMDYKPCRELSKLSSKLNRINPPLNAVTHPDQFLSLSQFDWAK
                     LVDFYLNAPSIKFTGTSSAKNNFDLLSSIQRQLLQNLLSERPLSLIKNKWKLGKRKSA
                     FTTNQNQLVCEGYDAMHKSKLAEPYCQAALGEKLPENSAKALSEFTDNFQNQQAVQDV
                     LNSLWQDSPSLAAHAVRKIVSSLAAHEKNQKSGNTAQVWFFLESFTKNHNWAQSSNSG
                     LSKIAKHISSISAKRKQQQQQQQQQQQQQHFFRQQRQQQRQPPPAPNDMSKKNYYKVL
                     EVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEGKR
                     KEYDDQRAGRGQQRQGFPFGQGANGGFPFGGGSFKMNFGGF"
     gene            complement(<867826..>869364)
                     /locus_tag="KLTH0H10054g"
                     /db_xref="GeneID:8294638"
     mRNA            complement(<867826..>869364)
                     /locus_tag="KLTH0H10054g"
                     /product="KLTH0H10054p"
                     /transcript_id="XM_002556265.1"
                     /db_xref="GeneID:8294638"
     CDS             complement(867826..869364)
                     /locus_tag="KLTH0H10054g"
                     /note="similar to uniprot|P37302 Saccharomyces cerevisiae
                     YBR286W APE3 Vacuolar aminopeptidase Y processed to mature
                     form by Prb1p"
                     /codon_start=1
                     /product="KLTH0H10054p"
                     /protein_id="XP_002556311.1"
                     /db_xref="GeneID:8294638"
                     /db_xref="GOA:C5E338"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR029514"
                     /db_xref="UniProtKB/TrEMBL:C5E338"
                     /translation="MRISTLVATSIGCAQAFVLPQAFFDAFAAPAPVADASLWPHKPY
                     FLKHNVDPDTFPDEIQLEELNATALDLYHIAESSNGTYGHPTRVIGSPGHWKTLGYIL
                     HQFDQMRDYYDVTVQSFKALNGKVSHYDLNYTNGEAVPSAQAFSLSPPVEPFVGTLVE
                     IPNLGCSDADFEALEISKDSIALIERGECPFGQKSTLAGKHGFKAVVIYDNDPKSKKG
                     ISGTLEKPTKHTVSTIGVSFAVGQKLIAGIELDPEFSLFFYMDSFVKKVKTKNIIADT
                     KHGDPDNIVALGAHTDSVAAGPGINDDGSGTISLLTVAKHLSDYKINNKVRFAFWAAE
                     EEGLVGSNYYVEKLSPEENQKIRLFMDYDMMASPNYQFQVYDANNIDNPRGSEELKNL
                     YIDYYTSHGLNYTLIPFDGRSDYVAFINHGIPGGGIAAGAEGINTDNGKVLDRCYHEL
                     CDDVNNLNWEAFLTNTQLIAYSVANYAHSLKEFPERETNTSSVLSSASAPKYPYKGGA
                     NLLL"
     gene            complement(869863..869934)
                     /locus_tag="KLTH0H10076r"
                     /db_xref="GeneID:8294639"
     tRNA            complement(869863..869934)
                     /locus_tag="KLTH0H10076r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=70.44"
                     /db_xref="GeneID:8294639"
     gene            complement(870103..870174)
                     /locus_tag="KLTH0H10098r"
                     /db_xref="GeneID:8294640"
     tRNA            complement(870103..870174)
                     /locus_tag="KLTH0H10098r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=73.79"
                     /db_xref="GeneID:8294640"
     gene            complement(871210..871281)
                     /locus_tag="KLTH0H10120r"
                     /db_xref="GeneID:8294641"
     tRNA            complement(871210..871281)
                     /locus_tag="KLTH0H10120r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=73.79"
                     /db_xref="GeneID:8294641"
     gene            complement(<871688..>872194)
                     /locus_tag="KLTH0H10142g"
                     /db_xref="GeneID:8294642"
     mRNA            complement(<871688..>872194)
                     /locus_tag="KLTH0H10142g"
                     /product="KLTH0H10142p"
                     /transcript_id="XM_002556266.1"
                     /db_xref="GeneID:8294642"
     CDS             complement(871688..872194)
                     /locus_tag="KLTH0H10142g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H10142p"
                     /protein_id="XP_002556312.1"
                     /db_xref="GeneID:8294642"
                     /db_xref="UniProtKB/TrEMBL:C5E339"
                     /translation="MSFLRRLFGRKNQEHGATSTHSVSWRDADDLDSEYVFVTGGEML
                     DSQAVLETRSEFSEDPSEVDVTAWEMARAWTHRGSAGDLRPARGSKAARLAHRLDDIR
                     KLPTVSFGTSASLPLGHQGNRASQPAWVVEYHDESMDEEAECLFDDKWNRKTKVESRR
                     DRSQKCGV"
     gene            complement(<872929..>873558)
                     /locus_tag="KLTH0H10164g"
                     /db_xref="GeneID:8294643"
     mRNA            complement(<872929..>873558)
                     /locus_tag="KLTH0H10164g"
                     /product="KLTH0H10164p"
                     /transcript_id="XM_002556267.1"
                     /db_xref="GeneID:8294643"
     CDS             complement(872929..873558)
                     /locus_tag="KLTH0H10164g"
                     /note="similar to uniprot|P40359 Saccharomyces cerevisiae
                     YJL072C PSF2 Subunit of the GINS complex (Sld5p Psf1p
                     Psf2p Psf3p) which binds to DNA replication origins and
                     facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="KLTH0H10164p"
                     /protein_id="XP_002556313.1"
                     /db_xref="GeneID:8294643"
                     /db_xref="GOA:C5E340"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR016906"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:C5E340"
                     /translation="MSLPWNIQETFSPEEIQFIVENEPIKIFPRFTTRVSLRGDRAKP
                     AHTRWKLVTADDHPLNNLVAIQTTEVALWMALLLKQQGKCSIVAPGWLRLSQLQKYID
                     YELKHAERFSELPWNWLVVAQLLFSKAADDLHDPVHLLRGKIQDLREIRLGKIGQGLK
                     HLNESHLQLDNLSLLEINELRPFVLGVMNKLKQVHSSISEERGSEDYYE"
     gene            <873771..>875396
                     /locus_tag="KLTH0H10186g"
                     /db_xref="GeneID:8294644"
     mRNA            <873771..>875396
                     /locus_tag="KLTH0H10186g"
                     /product="KLTH0H10186p"
                     /transcript_id="XM_002556268.1"
                     /db_xref="GeneID:8294644"
     CDS             873771..875396
                     /locus_tag="KLTH0H10186g"
                     /note="similar to uniprot|P40360 Saccharomyces cerevisiae
                     YJL071W ARG2 Acetylglutamate synthase (glutamate
                     N-acetyltransferase) mitochondrial enzyme that catalyzes
                     the first step in the biosynthesis of the arginine
                     precursor ornithine forms a complex with Arg5 6p"
                     /codon_start=1
                     /product="KLTH0H10186p"
                     /protein_id="XP_002556314.1"
                     /db_xref="GeneID:8294644"
                     /db_xref="GOA:C5E341"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /db_xref="UniProtKB/TrEMBL:C5E341"
                     /translation="MFRRLYQTAGYSQPNGLNKELILAVLNSTATKREAQNYLKKYGS
                     DKIQNHCLVMIRGLLKQDSKALSCFAVTIKRLKMLGVKPMFVLHPGQDVEEQAQLLDY
                     HLHKEDLRAVCLSEALVRNFNGSYQSIVQYAQLKDLIPIIKPRIFDEKTCASKPTTNV
                     PELMGQLVRQLDCHIDKVVIISDFGGISSGERQDNAHVFINLSQEFESLSDSLSKDIK
                     VLNAKVSNNEKSSVDAMQLILDMDKLKQTYTRQHAHLEDLQIMDRVLSELPISATGII
                     TALSAASNLFKNNPLLHNVLTDRSLISSSLPRFKRGNQLSHAWYELPVDNEPVVDLKD
                     AALITTVVKKGVNIKVFDYRTLNEKNSIGFPGISSLPTPSNDKVNITKLKAIIDQSFG
                     RKLDIKHYLKRINGQIAAIIVIGDYEGIAILTFEGPEGAKFPYLDKFAVMPHLKGSLG
                     ISDIMFNLMFQKFPKELVWRSRSDNVVNKWYFQRSVGVLDLSMDLGKNDAKPSIFKLF
                     FHGDNDKEDPFCDFERLQTYSKYVRDIQPSWDT"
     gene            complement(<875962..>878361)
                     /locus_tag="KLTH0H10208g"
                     /db_xref="GeneID:8294645"
     mRNA            complement(<875962..>878361)
                     /locus_tag="KLTH0H10208g"
                     /product="KLTH0H10208p"
                     /transcript_id="XM_002556269.1"
                     /db_xref="GeneID:8294645"
     CDS             complement(875962..878361)
                     /locus_tag="KLTH0H10208g"
                     /note="similar to uniprot|P40361 Saccharomyces cerevisiae
                     YJL070C and to uniprot|P38150 Saccharomyces cerevisiae
                     YBR284W Hypothetical ORFs"
                     /codon_start=1
                     /product="KLTH0H10208p"
                     /protein_id="XP_002556315.1"
                     /db_xref="GeneID:8294645"
                     /db_xref="GOA:C5E342"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:C5E342"
                     /translation="MAEIQRRPSLMLDDEEDLSHERRSRLPSQVTDAPLDDTDMIALN
                     TTYDKQIIQGQPMHLEFNGHTNPIHQEVSASQLKNHRHLDEKGCLTVFDIIGKKRAHY
                     LKSSAQDALSSPKNDTKSWFLYPRPLPKFWKFDKDRRLQDTQDRAIENNGRPDHKGYF
                     TTRASHADAYNQSSPTDKINLNYTGKFFELENYAEEFRNVVGPRNTTTLSYKEVVAKI
                     SPIEEFSKDFQWVLSYLVSEELNSLATKRIEYLLNRFDLFQQLEGRTEIRENRLVPHR
                     DFYNVRKVDQNFLLSGCVSQRQLNEFIWEKLNLEPERIVYKNSEGKEFKLRQIFCNGA
                     DAKSNEDASIGLKAVDDLFLEWYQTVYLPGSHLMGRCAPAPGKDHTFFMIAKTFLEFD
                     NCMNGEYFAELVVRYVIQSFEKSKYQLAQLSVDFQFCEDWWFKFSDWITKWKLVSYNI
                     RWNVRLGRSYTKLHASGIVESFQDYLDYIFRPLFSSKAKNDMKLQYFLSTVCCLDLSA
                     TEGDDYVWKKFMDPQSTLPIDWSATRDNPPIAYYMFYLMEYVKQFNLMRRNNLQNPVT
                     LRLYAPLLRSRVSQFKAGISITEQLESLICNVLLCHSGLLQAEPLWDASPAVLYLYYL
                     LQIPVIVSPLSSVSIAQEKPKTSRADGIRDVTVQSTRFYTGNPFLQMQKIGLRVILSS
                     NSVLFNSSYTMEPIIEEYSVAASIYLLNSADLCEFVRNSIVTSGYEGFYKAHWNGIGL
                     TKTQFLREKIGGTDSWYDQELDTSYKHNVPTTRRLYRKDCLDREWEFIRKQVPSELCF
                     S"
     gene            879442..879513
                     /locus_tag="KLTH0H10230r"
                     /db_xref="GeneID:8294646"
     tRNA            879442..879513
                     /locus_tag="KLTH0H10230r"
                     /product="tRNA-Cys"
                     /note="tRNA-Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:8294646"
     gene            <880852..>882333
                     /locus_tag="KLTH0H10252g"
                     /db_xref="GeneID:8294647"
     mRNA            <880852..>882333
                     /locus_tag="KLTH0H10252g"
                     /product="KLTH0H10252p"
                     /transcript_id="XM_002556270.1"
                     /db_xref="GeneID:8294647"
     CDS             880852..882333
                     /locus_tag="KLTH0H10252g"
                     /note="similar to uniprot|P37292 Saccharomyces cerevisiae
                     YBR263W SHM1 Serine hydroxymethyltransferase
                     mitochondrial"
                     /codon_start=1
                     /product="KLTH0H10252p"
                     /protein_id="XP_002556316.1"
                     /db_xref="GeneID:8294647"
                     /db_xref="GOA:C5E343"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:C5E343"
                     /translation="MISRIASRQLKPVLVYRRLYATAKSTANQVMVSKHVQEIDPEMH
                     EILTNERHRQKHSVTLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGNQFIDQA
                     ESLCQKRALDLYGLDPEKWGVNVQPLSGAPANLYAYSAILDVNERLMGLDLPHGGHLS
                     HGYQLPSGTKISYISKYFQTMPYHVNIQTGLIDYEMLAQTSKLFRPKVIVAGTSAYSR
                     TLDYKRFKEITDACGAYLMSDMAHISGLVAAGVLPSPFEYSDIVTTTTHKSLRGPRGA
                     MIFYRKGVRKVTKKGKEIMYDLDKRINFSVFPGHQGGPHNHTISALAVALKQAATPEF
                     KEYQTAVVANASVFGEELVKRGFQLVSGGTDTHLVLIDLSNIGIDGARLETILEKINI
                     AANKNTIPGDKSALFPSGLRVGTPAMTTRGFGPEDFAKVAEYIDKAAKLAIGLKSQES
                     SEAKDARSKLANFKQLCAESDEVAALANKVSEWVGEFPVPGEL"
     gene            complement(<882443..>883048)
                     /locus_tag="KLTH0H10274g"
                     /db_xref="GeneID:8294648"
     mRNA            complement(<882443..>883048)
                     /locus_tag="KLTH0H10274g"
                     /product="KLTH0H10274p"
                     /transcript_id="XM_002556271.1"
                     /db_xref="GeneID:8294648"
     CDS             complement(882443..883048)
                     /locus_tag="KLTH0H10274g"
                     /note="weakly similar to uniprot|P36018 Saccharomyces
                     cerevisiae YKR014C YPT52 rab5-like GTPase involved in
                     vacuolar protein sorting and endocytosis; probable purine
                     nucleotide-binding protein"
                     /codon_start=1
                     /product="KLTH0H10274p"
                     /protein_id="XP_002556317.1"
                     /db_xref="GeneID:8294648"
                     /db_xref="GOA:C5E344"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E344"
                     /translation="MDKPIHSAELKLVLLGESSVGKSALVTRFTTGAFHKNNATIGAA
                     FTTKVVSWETNEAIKQVKFEIWDTAGQERYRSLTPMYYRKTDVAFVVFDVTDDATFSK
                     AGSWIDELKGYMQSEDAHDIIIKLVGNKTDLLDHVPDTTLEWTPVSAKTGEGVANLFE
                     SVAREVPSSKFTIPNEEPRQSNVINVAPSSESPKGAKACNC"
     gene            <883534..>888540
                     /locus_tag="KLTH0H10296g"
                     /db_xref="GeneID:8294649"
     mRNA            <883534..>888540
                     /locus_tag="KLTH0H10296g"
                     /product="KLTH0H10296p"
                     /transcript_id="XM_002556272.1"
                     /db_xref="GeneID:8294649"
     CDS             883534..888540
                     /locus_tag="KLTH0H10296g"
                     /note="weakly similar to uniprot|P29539 Saccharomyces
                     cerevisiae YBR275C RIF1 Protein that binds to the Rap1p
                     C-terminus and acts synergistically with Rif2p to help
                     control telomere length and establish telomeric silencing
                     deletion results in telomere elongation"
                     /codon_start=1
                     /product="KLTH0H10296p"
                     /protein_id="XP_002556318.1"
                     /db_xref="GeneID:8294649"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:C5E345"
                     /translation="MTANSSPTKKRGKALDVLEKHISQQNKKPKNNQYGALLSMFQTI
                     TDSIKLPAPVSQPRPRMISSSPPRRVEQPFGSRQHPTSKSPEPPSQRSSPKKSVAFSD
                     QIDSSPPPASLHSSPHRSSQAVPSKPILKFTLPLARTPSPRRKNNQPGFNDKLTIDQR
                     ENDSSEDPMSLSYWVSGEVHGLGDIKSISEFKDVLTGGLYFLSSDIPEAKKRYFEIYA
                     TFNNIMPIFTSPNYSEVKDKKVQILAQNMNVILATCIPHLISIQAELLSSLKKDPFTS
                     RIYVQIVRFFNALFSNFKLVKICENNQSFQTALHKVVESFTEAIQHPNSNKVMVTAQL
                     ALLRDEQCGIKRLTPLKVQSFVKSLANMKKISSSNLTCEKLLLLKIFLAKYPEVMFET
                     IDIWLQAEVLSRLLIEEEFYSLKIANNCVSILLDLLKRCLTDRDNHQVLEVLKQTTTK
                     ELFSVNCEGNKTLAHLQTKEDNLETLLRKRVIYLIEEKDEPKLAMDLWLAMVGLLFNS
                     AGEVSSLCSDRGKLWLDLNLRYQNNSNPKAKKLALRSWRIVTYMICSKRLADIGESQK
                     LVAVLLDPFSYLSKDYYKDPDYESLIYVLNGLLYSTLCNHHKDQFTYNLEFILSPFIN
                     EILMGQKSLKIRKVALEVLLRVVNQSPGGPTPKKEFNALKVVTSSGVEAADFIPFSSP
                     LLSRNWHALMSIVQKCKQTSPPETYDLSFTLLLAVIERIPQRAIDGTTRDNCSATLLP
                     GTEDSEQKPRSRMTDALASLMRTFKDLMCEPSPIINKLCMEIATAIKNGEIDCTDMLK
                     TVLKETSNSISYLEVYSFFLRLKDTRIDDFIYNSISSKILSPKISAHAFEAFIDIVNS
                     YSSTEIIQAFLDTSEKGSFDLWKASKLDTSRWDFGCTVRYFTMRFQREDLKVDDEFVS
                     QFSSALTQHSRLAEELRKSLGVDRYAKSVVKFLKQEKRTDSYGLDSQWKLSMISCFSM
                     DDYLEMLKFAADLREDVQLLLINGAQNNDESLHLSLRFIQLLISSEKQIVDDIKNGCD
                     RALYELLEKCYQKKLLCLLNQCVLFIIENDAYYLVEKFWATCGPDFLNLLENSTLATI
                     MNQVASKNEVVINIFNFVFEQKPTDYVLGLMENVLAQDQLPTLNCCREKIINFLVREG
                     IRSNEGGRKKVLAIFERASEVLIFQHKRLLAEFMRSLISKLPAEKGEFVYDLLSFICK
                     DERFKLKGYDNLLVKINHGLPLASDTFQSEKKRETQRYKFHSAPQTPPNKTSSVSEAA
                     AYSLNQLPQKVVEMRETSPSDATFPSCRELSSNLNQQRKLKESAAASETKTLHALGTV
                     LNDQKHMDTSDEDQSCREKKRIPGPNNGDKALRSITPPEETVCSSKDDGLTPRNNEKG
                     GQDPTHKLTEISQKKQIIVSEVAQSKLQASRGAEALSEKSTTKGQIKQNVKSQGVSLN
                     DEVETVAVPSPPKKHESSTTDAAAQIACSKLHENAQKTHHGDEVHEKRSCFEETQPKA
                     ASASALHNENSQISDGEKRTSVDSKVGSLVIEQSLMNETLMNREGFSRGTDLSNAIGI
                     KSTFSNVESLAKIPIFNSRKLISKNKQPVTCENKSNEGVTANKSSKELPGKLEDFETI
                     KRKNLHGSVYSACEDKKLKVILQIMKEFGVNEFSQLSDVQKQFVKQEMIKFLSKSNAS
                     "
     STS             887223..888559
                     /standard_name="D1S3699"
                     /db_xref="UniSTS:474277"
     gene            complement(<888661..>890316)
                     /locus_tag="KLTH0H10318g"
                     /db_xref="GeneID:8294650"
     mRNA            complement(join(<888661..890128,890228..>890316))
                     /locus_tag="KLTH0H10318g"
                     /product="KLTH0H10318p"
                     /transcript_id="XM_002556273.1"
                     /db_xref="GeneID:8294650"
     CDS             complement(join(888661..890128,890228..890316))
                     /locus_tag="KLTH0H10318g"
                     /note="similar to uniprot|P38147 Saccharomyces cerevisiae
                     YBR274W CHK1 checkpoint kinase 1 homolog of the S. pombe
                     and mammalian Chk1 checkpoint kinases Protein kinase Chk1"
                     /codon_start=1
                     /product="KLTH0H10318p"
                     /protein_id="XP_002556319.1"
                     /db_xref="GeneID:8294650"
                     /db_xref="GOA:C5E346"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5E346"
                     /translation="MSINFSQRSPLPKIKNLVLGETVGQGSFAFVKAACLESNPETVV
                     AVKFVHLPTCVKHGLSEKDAIQEVVIQSKCSDHLNILKVIDCNVTKNFLWIAMEMAGG
                     GDLFDKIEPDVGVDAEVAQFYFKQLISAVTYLHEKCGIAHRDIKPENILLDSDGNLKL
                     ADFGLASQFRRKDGTKRLSSDTRGSLPYMAPEILHSRNYHADLTDIWSCGVLVFVLLT
                     GETPWEQPSRDDDQFREFSENCGNMVSGPWNKISLTQLNLVRKMLQPDPRKRVTLSEL
                     RTHVWYTSLVSFSDEGGRCNDPQLLSQKLLSKLHVSLSDDAYTQFMKDDFCLKIPTHT
                     STQPIQSEIADLRHDSFCASGRLATQHEFFGQPGSRQASNPDTEWTQQVHVDMATQQF
                     QVNSIPEGAFISTSVLTKFYSHREMSSILPMLEYALRNFSIPVKTGSYETFLELRDSH
                     KLEDVFPVTIQIKTMDRKGWFLSGNVSLSNAYGGLVLISFNRRSGDPLEWRRLFKKVS
                     LVCRELVYVP"
     gene            <890416..>891633
                     /locus_tag="KLTH0H10340g"
                     /db_xref="GeneID:8294651"
     mRNA            <890416..>891633
                     /locus_tag="KLTH0H10340g"
                     /product="KLTH0H10340p"
                     /transcript_id="XM_002556274.1"
                     /db_xref="GeneID:8294651"
     CDS             890416..891633
                     /locus_tag="KLTH0H10340g"
                     /note="similar to uniprot|P38349 Saccharomyces cerevisiae
                     YBR273C UBX7 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="KLTH0H10340p"
                     /protein_id="XP_002556320.1"
                     /db_xref="GeneID:8294651"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5E347"
                     /translation="MSRPELEFMSSVQQAVQLSLQEQKPLVVYCTEGNDNWLRSWFNR
                     ELRQQLVTTCIALKLTKGQPEYGYFEQIFPSVPVPSVCCIKEGKITGVVEATVVKTDG
                     QVHRNTLLACLGHIPRNTNSESSPKQNSTLKEQAAQRAAQLHHEEVLKQRKVEKEERE
                     RIRRLVKADREELKAKNREPVAHERRALDSLHDNIKNTDHLTAKTCTLQIRLLNGHAI
                     CHQFKSNATLNSVRRWIDENRDDGDAPYVFFRSIPRESFQESDELRSLSSLQLTPRSV
                     LILKAVENDDNNVQIIDVQGPGLLGRMFNSVTGWWNSEKANEPDSDIQQTTKPNEKSP
                     ASSKFNSPANSPYIRHQLARNPSELSLPSRPVSPNVFQFVNADDNEASDRDRKTFNGN
                     SVKLEDKKGKEGK"
     gene            complement(<891643..>892968)
                     /locus_tag="KLTH0H10362g"
                     /db_xref="GeneID:8294652"
     mRNA            complement(<891643..>892968)
                     /locus_tag="KLTH0H10362g"
                     /product="KLTH0H10362p"
                     /transcript_id="XM_002556275.1"
                     /db_xref="GeneID:8294652"
     CDS             complement(891643..892968)
                     /locus_tag="KLTH0H10362g"
                     /note="weakly similar to uniprot|P47048 Saccharomyces
                     cerevisiae YJL049W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10362p"
                     /protein_id="XP_002556321.1"
                     /db_xref="GeneID:8294652"
                     /db_xref="GOA:C5E348"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5E348"
                     /translation="MRDTTLSKSRLTSLYSDFRKLKDLNPEGYEANVRYWRHLLLDEV
                     FSDKLICQCGSELLKELSDKELGPPKCLDTALDSLISDGLLIAKERFKRNNNSKILKA
                     FSWTIGYILAGRSQATTRTSEGANYLRDADFVVLPTTKRKSLQAEQRMRSSICKKAIR
                     YSDLIFSKLEFCKIVGMEENLQGWNEFEIVLMYMETYMGVIVTDCNTVKVCTRDMAPL
                     LAKFDFNFISENDRNIASVKETYSILQFQVSMLEDRIRERKQVLAECIKSDKPKDLQR
                     LHLRAKKLLERNLTTACRNLQNIETLKSDIEMSLDNVNLRNTLLASRDVMSNVSAELG
                     DTESVEKLLDEISLERSKNEEISDILAGKLDDQNDEQLNEELEELDAEVKKEQEVTRE
                     LSKLKISSYQGFGPEEVALVAGRESPVEEESRADLGPSESKNKEPILST"
     gene            <893051..>894493
                     /locus_tag="KLTH0H10384g"
                     /db_xref="GeneID:8294653"
     mRNA            <893051..>894493
                     /locus_tag="KLTH0H10384g"
                     /product="KLTH0H10384p"
                     /transcript_id="XM_002556276.1"
                     /db_xref="GeneID:8294653"
     CDS             893051..894493
                     /locus_tag="KLTH0H10384g"
                     /note="similar to uniprot|P38348 Saccharomyces cerevisiae
                     YBR272C"
                     /codon_start=1
                     /product="KLTH0H10384p"
                     /protein_id="XP_002556322.1"
                     /db_xref="GeneID:8294653"
                     /db_xref="UniProtKB/TrEMBL:C5E349"
                     /translation="MAELTNNLSSDCLLDAITTSFNTKDYVTLNKQLNRANLQLCNAT
                     TLPGNKTEFLKSLKEIFSQAPEELDHSTTAEVFERVIGLTSFDQVLEAFTVEEMGHAL
                     SSHVINLVRLACKVLSRSQPKGLFAGTGLIDLMLEQLFDASTELDIVSEIEKCLEQLT
                     SDALIRRRILKDNLQLLLRVRSQFDPICTTRLLALMNGILPHTDRSEFQDKLFIFGET
                     EIHKALDKDIFLFINVTDYYVSILKIMGATSEQRQFSIWVLDRVLSVVIPIYGKLYKQ
                     MHEDYMIETFGRKYLFSLFKEISMLSDSHYFEELDSRYLNLTPSNLDFSEFMKFIKPS
                     YLMEVQHDYILGNLTVTPSNLMAWRNLISEKQSFDQVKDNLTSDAILSLPYSEQMVLL
                     QKLTCYEYSARYLLNDLSKVMSNTLDDKSGSITEPETSELRREVLENLLTFDSGMLNV
                     WFQPTQEAYRLLVNGGKVQDSMAHVADTYL"
     gene            complement(<894542..>897769)
                     /locus_tag="KLTH0H10406g"
                     /db_xref="GeneID:8294654"
     mRNA            complement(<894542..>897769)
                     /locus_tag="KLTH0H10406g"
                     /product="KLTH0H10406p"
                     /transcript_id="XM_002556277.1"
                     /db_xref="GeneID:8294654"
     CDS             complement(894542..897769)
                     /locus_tag="KLTH0H10406g"
                     /note="highly similar to uniprot|P47047 Saccharomyces
                     cerevisiae YJL050W MTR4 Dead-box family ATP dependent
                     helicase required for mRNA export from the nucleus"
                     /codon_start=1
                     /product="KLTH0H10406p"
                     /protein_id="XP_002556323.1"
                     /db_xref="GeneID:8294654"
                     /db_xref="GOA:C5E350"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E350"
                     /translation="MDNDDLFDVFDEKSTDLPQLEAPPKEPIETNGEAVEEVQDVKKR
                     HRASSEDEPKEDSATAHDSAKRPKNGKKILEKKKKSEVVPVLADSFEQEASREVNASM
                     GLGAANSVQVEEDGKVKLSHQVRHQVALPPHYDYKPIGEHKRQNEARTYPFTLDPFQD
                     TAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSMRNKQRVIYTSPIKALSNQKYRELL
                     ADFGDVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVVFDEVHYMRDKE
                     RGVVWEETIILLPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTDFRPTPLQHY
                     LFPAHGDGIHLVVDEKSTFREENFQKAMASISNQVGDNPGSTNSRGKKGQTYKGGASK
                     GDSKGDIYKIVRMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSEDEKEALTKIFT
                     NAIELLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATE
                     TFSIGLNMPAKTVVFTSVRKWDGKQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDE
                     KMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNATSVP
                     LMEKKLTELSAKSESMVIEDEQNIKDYYEIQKTLDGYSEDIRQIVTHPSNVLSFLQPG
                     RLIEVQVGNANYCWAAVVDCTKRTSKLSAVYSDHESWIVKVVVNTMYVDAPLNLIKPF
                     NPVFPEGIRPASVGEKSVSTIIPITLNSIKSVGNLRLHMPKDILAGSQQVAVGKSIKE
                     VRRRFSDKVPVMDPIKNMKIEDEDFQKLLQKSEVLKSRQSSNPLSGSVRLDDLYQKYN
                     EKVSINSEIRQLKKKIQEAQAVTQLDDLRRRKRVLRRLDFCTPNDIIELKGRVACEIS
                     SGDELLLTELIFNGNFNDLTPEQAAALLSCFAFQERCKEAPRLKPELAEPLKNMREVA
                     AKIAKIVKDSKIEIVEKDYVESFRHELMEVVYEWCKGATFTQICKMTDVYEGSLIRMF
                     KRLEELIKELVEVSNTIGNSMLREKMEAALNLIHRDIVSAGSLYL"
     gene            complement(<898234..>900537)
                     /locus_tag="KLTH0H10428g"
                     /db_xref="GeneID:8294655"
     mRNA            complement(<898234..>900537)
                     /locus_tag="KLTH0H10428g"
                     /product="KLTH0H10428p"
                     /transcript_id="XM_002556278.1"
                     /db_xref="GeneID:8294655"
     CDS             complement(898234..900537)
                     /locus_tag="KLTH0H10428g"
                     /note="weakly similar to uniprot|P47046 Saccharomyces
                     cerevisiae YJL051W Protein of unknown function localized
                     to the bud tip mRNA is targeted to the bud via the mRNA
                     transport system involving She2p"
                     /codon_start=1
                     /product="KLTH0H10428p"
                     /protein_id="XP_002556324.1"
                     /db_xref="GeneID:8294655"
                     /db_xref="UniProtKB/TrEMBL:C5E351"
                     /translation="MRRKKPCNLVLSLTRICAALLSLSSGAFSIAVLCVGPQESCFNE
                     AALIIILIGAIMNAMVQIALAIRDELFFKFISIFPLSMTLGSGVCYIKFLIERLPTTN
                     ISSGRAGLVTAHLSILLSTLLLSGASSSLTPQHATKESVKVHGPGGDMEPGNNEQTKV
                     ATKTVAMKNSSQTLTPEHDFQEIYSHQNWMNKYSSTYSGSESASATSVVKHSLEAQAS
                     QNSAQEQMFADPSRKISKKPKVRSFLRMRPKNKVSKDRAVLETPQMDESIQAHYVTRL
                     STIQDNSKSFLNVTHNLQHRDVSSKSARSSSLLSDHGKATVFDEDAFLMEKNAVHRIN
                     SALLPPSLRASDKDDKNYKWNSGISELHNSPPTSSVTEDGLDLLQENDLEDIPQAPDW
                     SKPLDTNADTPKLLKKVNFQDWQTHSDRLLESERILSESSPKLLPGLLFQPKDRLQPE
                     VDFSFPAQKPKLDFDDFLGHNNDDTVSELDILFRREEGGLTDKSDTADFMESILKQND
                     VSTNLKRLSKEMSFTSGNHSPTKSMTSIITNSANGSFKYPSRSPQKSPSKSPSKFGSM
                     FSNAGHSQASNHIHHSRSNSQITAFLHTVANKGNTNSSVQSSPTRGGRLRRSFSKKMS
                     LSSISFKQEEDECLHEHIRGKSIDFSYVHSLQNKHSPSKSLTLAGRRNSMFAPGDLKL
                     RTVSAIFSEDDAGHNSTVSKLKQGIGPTEDVTNQKTEDSSTRSSQSITSETHYPQAVI
                     GEYDREKWSTLLSMSLIDSPKSAAANY"
     gene            complement(<901280..>902218)
                     /locus_tag="KLTH0H10450g"
                     /db_xref="GeneID:8294656"
     mRNA            complement(<901280..>902218)
                     /locus_tag="KLTH0H10450g"
                     /product="KLTH0H10450p"
                     /transcript_id="XM_002556279.1"
                     /db_xref="GeneID:8294656"
     CDS             complement(901280..902218)
                     /locus_tag="KLTH0H10450g"
                     /note="highly similar to uniprot|P40335 Saccharomyces
                     cerevisiae YJL053W PEP8 vacuolar protein sorting protein
                     that forms part of the multimeric membrane-associated
                     retromer complex"
                     /codon_start=1
                     /product="KLTH0H10450p"
                     /protein_id="XP_002556325.1"
                     /db_xref="GeneID:8294656"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:C5E352"
                     /translation="MSLFFKSPIDIEVLLDGEESRKHVEVANASNNSTAKTLKDRFPV
                     YEDGESVSGIVTLRVKEGRKLEHLGVKVSLIGSVDISKSSSDYKKRPVDTFLSLSADL
                     CPQGELMHSQSFPFSFKDVEKRYDSYRGKNVDVSYYVKVTVLRKSTDVVKFKRFWCLL
                     YNSEPPAPALSKSSDDAKPVKLDIGIENCLHIEFEYSKSQYSLKDVIVGRIYFLLTRL
                     KVKHMELSLVTRETCGLEPNQLSDTTSIRYEIMDGSPVKGETIPIRLFLGGYDLTPNS
                     NFNHFSIRNYLSLVIIDEDGRRYFKQSEIVLYRKRN"
     gene            complement(<902520..>903968)
                     /locus_tag="KLTH0H10472g"
                     /db_xref="GeneID:8294657"
     mRNA            complement(<902520..>903968)
                     /locus_tag="KLTH0H10472g"
                     /product="KLTH0H10472p"
                     /transcript_id="XM_002556280.1"
                     /db_xref="GeneID:8294657"
     CDS             complement(902520..903968)
                     /locus_tag="KLTH0H10472g"
                     /note="similar to uniprot|P47045 Saccharomyces cerevisiae
                     YJL054W TIM54 Translocase Inner Membrane 54kD Translocase
                     for the insertion of proteins into the mitochondrial inner
                     membrane."
                     /codon_start=1
                     /product="KLTH0H10472p"
                     /protein_id="XP_002556326.1"
                     /db_xref="GeneID:8294657"
                     /db_xref="InterPro:IPR021056"
                     /db_xref="UniProtKB/TrEMBL:C5E353"
                     /translation="MSSSENPKPPQDGPKILKKPGYSNPAFKAMGIPTLRLPSRNWMI
                     FWTVLTVSVSGIVYDKQQQKKIVKKWCKTVEPLSEEKFPVNEVPRKVTVFVAPPPSDY
                     LDTSMSVWRRFVKPVLYSSGIDYEVFTEEKQGPIRAEVAERIRELRRELIKHEEDIKR
                     LNDEKKIWNRCKRALTGKLQHMRSSEGLDQEIEKAAAEKFKAEFDYKNLLGVYYKNKN
                     KSNKVVAEDALVSSPEMAGGVICIGRGAYKEYIEGVHEGILGPLEPTATTNAQTEAAS
                     EKAPALPEVLSGATQTEAKVENSNEVSENATPNTETALTNESAEAESAKDSDLDPEGS
                     AKPKPVPKPYISPKGYESAELPQELSSPNVARDLITGIPALFYQPILVIPMPNLVGFL
                     NIPERIYRYYRRRYLAEEYCKAAASCVLQKVRPFDGTTDLEIAKSEENDWPKKWVQQG
                     LEKDSPWVQELQGDRRVLEKLTVYDPSLIKEE"
     gene            complement(<904424..>905893)
                     /locus_tag="KLTH0H10494g"
                     /db_xref="GeneID:8294658"
     mRNA            complement(<904424..>905893)
                     /locus_tag="KLTH0H10494g"
                     /product="KLTH0H10494p"
                     /transcript_id="XM_002556281.1"
                     /db_xref="GeneID:8294658"
     CDS             complement(904424..905893)
                     /locus_tag="KLTH0H10494g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H10494p"
                     /protein_id="XP_002556327.1"
                     /db_xref="GeneID:8294658"
                     /db_xref="GOA:C5E354"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5E354"
                     /translation="MDKHTKKGPWTPAEDRALLSLVQELGPQNWVRIASSLQFRSPKQ
                     CRERYHQNLKPSLNKSPISDDEGAVIEDLVNKLGKKWAEIARLLNNGRSDNAIKNWWN
                     GGANKRKRARSLTSVNTASSPAHPGINGAGALSPPMAYAKSPGAYAPHSAGPQPVSVV
                     SSVSHALPSALPTPPGASLAPARQSATVGASSTPPSLSPPLRSRALPSTSLPPVTFLQ
                     QPMYMLPYANMSSGPAQPPLPPPPFHGVNQFYAPAQPLLQRPSHSQHAPQQLQSHPHS
                     LMHALPHSKSQSELPSLNSGPRPRSRRTSVSIENRGSADAKNGPSSGTSRRSSIAFLD
                     GFGSNKRPNFNQNGSPLTFSRRVSAVSLGPSASNSSSTSSILSFPVGSSGVGSAATSQ
                     ATPPGSLNVASNASPPPGATSKSTGEIFKLDFKFGDNRVQKGTPANSKPKLHTSFASE
                     KSCQQAVNPPRVPEQSRVKLHDLLNDSNDDDQPSNSTVS"
     gene            complement(<908060..>908779)
                     /locus_tag="KLTH0H10516g"
                     /db_xref="GeneID:8294659"
     mRNA            complement(<908060..>908779)
                     /locus_tag="KLTH0H10516g"
                     /product="KLTH0H10516p"
                     /transcript_id="XM_002556282.1"
                     /db_xref="GeneID:8294659"
     CDS             complement(908060..908779)
                     /locus_tag="KLTH0H10516g"
                     /note="similar to uniprot|P47044 Saccharomyces cerevisiae
                     YJL055W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10516p"
                     /protein_id="XP_002556328.1"
                     /db_xref="GeneID:8294659"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:C5E355"
                     /translation="MTEIKSQKAVCVYCGSSFGKDPKFSDEARKLGQLLHSMRWKLVY
                     GGGTTGLMGEIARATMGPDVDGFVHGIIPNALVARERTEESEAPEATGKASVSTFNEE
                     IRKSVENHKGSTPLSHEYGSTTIVPDMHTRKRMMATESDAFVAMPGGYGTLEEIMECI
                     TWSQLGIHQKPVVLFNTDGFFDSLLRFIQHSIESGFISEKNGRIIQVATTAEEVIDKI
                     QQYQVPDGRFNLNWSDEHEGN"
     gene            <910730..>912778
                     /locus_tag="KLTH0H10538g"
                     /db_xref="GeneID:8294660"
     mRNA            <910730..>912778
                     /locus_tag="KLTH0H10538g"
                     /product="KLTH0H10538p"
                     /transcript_id="XM_002556283.1"
                     /db_xref="GeneID:8294660"
     CDS             910730..912778
                     /locus_tag="KLTH0H10538g"
                     /note="weakly similar to uniprot|P47043 Saccharomyces
                     cerevisiae YJL056C ZAP1 Zinc-regulated transcription
                     factor binds to zinc-responsive promoter elements to
                     induce transcription of certain genes in the presence of
                     zinc regulates its own transcription contains seven zinc-
                     finger domains"
                     /codon_start=1
                     /product="KLTH0H10538p"
                     /protein_id="XP_002556329.1"
                     /db_xref="GeneID:8294660"
                     /db_xref="GOA:C5E356"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E356"
                     /translation="MPNSQGVVHGHIHNFNSVTYIHGHVHRKSSVSERPAGVLRDLAP
                     EGAQLQAEEALDFHNGSELAQLPQVSAPVPNAPLSPPGSNSDVMNAIATDPSLCSQFK
                     DCQHFEFMNYHNLNLFGKNKAPPASDETLVMPDKRRKLADCSCHPRVVEICCEEDHEF
                     NGQPSASPLNEDLVLFTNNVEANRPLHQTAIPIVSNLPDLIDCDLTCASSNPEDDQLF
                     EKLCEQCVDLDQSENHHSHNHTHNNRSACEPVPAAPSNPTSSHDHVINSSSDMKILED
                     LANISSMYDFPFGKHIHSHDNAINGDNINLLQTSLPGLKAENLDEQLNKAHHHHRIEV
                     HPHPAHQGSNTQDPNFSNERNSQLPDFGTFMDYGKIHHGTSQQEFPPPDMRNHTVNFN
                     WSFKDDDSKVNCGWNHCPQKYDSLIDLQSHILRDHISEGTTATKLPTPRTQFDCEWDN
                     CGFEGDDMCTLINHINGKHGIAFNMKFLDKDKLEEQSEQHHMLHCDEACDDCRPCKDH
                     NDEQDHTCRWEGCMQVFNSCEELNGHIEKVHIPRGKSSYVCGWENCGKVITQRQKLLR
                     HLRVHTRYKPCKCPHCAKTFSTQDILQQHIRTHSGEKPYKCVHCGKGFATSSSLRIHI
                     RTHTGEKPLECKVCGKRFNESSNLSKHMRTHERKYKCGKCKRSFDLQEQLEVHQSRCY
                     "
     gene            complement(<912880..>914133)
                     /locus_tag="KLTH0H10560g"
                     /db_xref="GeneID:8294661"
     mRNA            complement(<912880..>914133)
                     /locus_tag="KLTH0H10560g"
                     /product="KLTH0H10560p"
                     /transcript_id="XM_002556284.1"
                     /db_xref="GeneID:8294661"
     CDS             complement(912880..914133)
                     /locus_tag="KLTH0H10560g"
                     /note="similar to uniprot|P38347 YBR271W Saccharomyces
                     cerevisiae Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0H10560p"
                     /protein_id="XP_002556330.1"
                     /db_xref="GeneID:8294661"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E357"
                     /translation="MFDPLDFLSGSEKPSACAGNQMRSISSDTLVTVIQPQESAYNDR
                     DLEEEVDAPIGVIDLPHVAIAPPSVVLTALLLLRPSINVNFSERDDTIDRSVESVCRE
                     KDITVSQIEAFASWCSGFGMSVLDTPAKICARVPGLASTADGKDLLMYYTMVLSKYEK
                     MQTADQVNERILKEASMRISEKCGRTAQPAMNRIFKIGGLRTGVKLHEPALTSDNLGL
                     KTWGASLVLARKLCENFSKFERQRDLRILELGAGTGLVGISLVLKMLESNSGHNCSMH
                     LTDLPEIVTNLKENVKINCCNSRSDLKVYADVLDWTNPDSFEKTYGAHKFDVLLIADP
                     VYSPQHPQWIVDMISKFLSPRGVLYLEVPIRQKYHDERQHLWGLIRDASLQVIKEELD
                     EGVDDWGKVSYLYKKIVPVNANQSD"
     gene            <914695..>916440
                     /locus_tag="KLTH0H10582g"
                     /db_xref="GeneID:8294662"
     mRNA            <914695..>916440
                     /locus_tag="KLTH0H10582g"
                     /product="KLTH0H10582p"
                     /transcript_id="XM_002556285.1"
                     /db_xref="GeneID:8294662"
     CDS             914695..916440
                     /locus_tag="KLTH0H10582g"
                     /note="weakly similar to uniprot|P47042 Saccharomyces
                     cerevisiae YJL057C probable serine/threonine kinase"
                     /codon_start=1
                     /product="KLTH0H10582p"
                     /protein_id="XP_002556331.1"
                     /db_xref="GeneID:8294662"
                     /db_xref="GOA:C5E358"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E358"
                     /translation="MSLIVYGDKIDDENNESVVLQDPSSRSLVVMNQESGEISLLRQI
                     RGPQNGSRRKGGTGLISSYFCPQCGSEIGCGYNFASSPPSTKKPSGSFVHKNYFNLLE
                     HRSSQTQLPSIESPSAIPASLFTPGYYQRFFKELSLLGSGARGSVFKVEHVLMDNHLG
                     VYALKKIHIGNNLSWLERGMKEVKFLSALTHSSVNLITYNHVWLEMDNASGIVKARNG
                     EEVGPPESVPCVFILQQFCCGGNLEEVVLNKVFEKFTDHESPEARKRRFRLRRSANAH
                     GSRQLGLGTNQILSIIHDVASGLKELHDLNIIHRDLKPSNCLLLESYEAGKEGYGDKS
                     FPTVVISDFGESQLGGQPRSATGATGTLEFTAPEVVITNSENLSANLPQFSFQSDMYS
                     LGMVCYFLVFGELPFGCQQSLPELKKNIKLLSITKEGLSQKHDDMKLHPIDSAIFVLI
                     EKLLSRDALSRPTAGEVKAEIAEIMDRLDDCVSATFDEKQELLSDDESELQSIFGRQP
                     EEISAKSGPSCSAIIDLANVATVLIAICFFNEKSLIPCVCVALLALSLKVPPPARKLF
                     LITELTLLIVAHLAI"
     gene            <916591..>918201
                     /locus_tag="KLTH0H10604g"
                     /db_xref="GeneID:8294663"
     mRNA            <916591..>918201
                     /locus_tag="KLTH0H10604g"
                     /product="KLTH0H10604p"
                     /transcript_id="XM_002556286.1"
                     /db_xref="GeneID:8294663"
     CDS             916591..918201
                     /locus_tag="KLTH0H10604g"
                     /note="similar to uniprot|P38346 Saccharomyces cerevisiae
                     YBR270C BIT2 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10604p"
                     /protein_id="XP_002556332.1"
                     /db_xref="GeneID:8294663"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:C5E359"
                     /translation="MNTSKKVMDNNVKRKRSFSALPIVHKLPGKNADSGRARFYSVSS
                     QIVPQTIQVTDDLGRKAAATEPKSSSPALADLSKVGFQSIYRDPTVKKSQRSINTPEP
                     SAKLHATSSSSSIKSSTITSNRSYRSGSNTSGLSHKRSALSLSNKLSGKKSVDTFDRE
                     KRKINGVDGSSSSISSSNKERSRLFTNTLTSAARKLFHRKDGRQEKRGEQLKSPTAVT
                     SSTFGRFLHNKYSKHVGKATAHYKYSSGSFIDSAKSNANNPSTSNDVPLQLVQESNLD
                     ASDIQMLHDLIKNLKSLESNYRTFTVEELDALMSNVWGVYCSVVLTLFKNRELWELPA
                     KIEDLNKILSFYIKLKTTSKNASASSKFLSEIEEFLTTCLYTLENQIVFNYSNENTIN
                     TALKRLCVIWEVFYQQIYHSTIALFLPLSNSFLVDTRYWSETFNGFSSDGIGNKRAGS
                     LSLDFLLLKSFRDSIVSPYYQSFINSHEGASKGFHLYIMSEEEEKGVTQQDKLVLLQC
                     FGILSSIRGTDIKQRVVDELLVGIRMSI"
     gene            complement(<918216..>919424)
                     /locus_tag="KLTH0H10626g"
                     /db_xref="GeneID:8294664"
     mRNA            complement(<918216..>919424)
                     /locus_tag="KLTH0H10626g"
                     /product="KLTH0H10626p"
                     /transcript_id="XM_002556287.1"
                     /db_xref="GeneID:8294664"
     CDS             complement(918216..919424)
                     /locus_tag="KLTH0H10626g"
                     /note="similar to uniprot|P47040 Saccharomyces cerevisiae
                     YJL059W YHC3 Homolog of human CLN3 vacuolar/lysosomal
                     membrane protein"
                     /codon_start=1
                     /product="KLTH0H10626p"
                     /protein_id="XP_002556333.1"
                     /db_xref="GeneID:8294664"
                     /db_xref="GOA:C5E360"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018460"
                     /db_xref="UniProtKB/TrEMBL:C5E360"
                     /translation="MVESSTVFRYFWIFGLVNNVLYVVILSAAADIVGPNLPKSLILL
                     VDILPSFTVKLSAPFFIHKVPHNRRIALLIILSCVGMILVSGGKLSVCIGGIILASLS
                     SGLGEITFLQLTHYYQHPSLNGWSSGTGGAGLLGSGAYLLLTSILKVPVGISLLLFSV
                     LPFAFLLYFRLDTQDSYQPIEGEITESAQPSTASSDSFPDNYKATSKWMALKNHINTT
                     LTRLRSLFIPYMLPLSTVYLFEYLINQAVSPTLLFPLDGDHTHPFFFNKYRDIYVTYG
                     TLYQLGVFISRSSGSFIRIKKLFLLSVLQGLNLTVVICQSWFYIVHSVYPVMLLIFFE
                     GLLGGASYVHTFMNIIHDVNPSEREFTLGAVSMSDSFGTLLAAFIGIALEPKLCSHQV
                     DTGRDWCLKE"
     gene            complement(<919601..>920932)
                     /locus_tag="KLTH0H10648g"
                     /db_xref="GeneID:8294665"
     mRNA            complement(<919601..>920932)
                     /locus_tag="KLTH0H10648g"
                     /product="KLTH0H10648p"
                     /transcript_id="XM_002556288.1"
                     /db_xref="GeneID:8294665"
     CDS             complement(919601..920932)
                     /locus_tag="KLTH0H10648g"
                     /note="highly similar to uniprot|P47039 Saccharomyces
                     cerevisiae YJL060W BNA3 Arylformamidase involved in
                     biosynthesis of nicotinic acid from tryptophan via
                     kynurenine pathway potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0H10648p"
                     /protein_id="XP_002556334.1"
                     /db_xref="GeneID:8294665"
                     /db_xref="GOA:C5E361"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5E361"
                     /translation="MIKHLSRKLSMSVGKQRQIVPNLALTQNLTKDVWSLTNEAAAAA
                     AHNAQNKGRDLINLGQGFFSYSPPAFVVEEAQKALDDAMVNQYSPTKGRMSLINSLIK
                     QYSPLYNTQLQANNIQVTTGANEGILACLVGLLNPGDEVIVFEPFFDQYISNIQIPGG
                     KVTYVPLHPPKEMSVRPTEGTEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTREE
                     LLQIGQICVENNVVIISDEVYEHLYFTPEFTRVATLSPEIGQITLTIGSAGKSFAATG
                     WRIGWIVSLNPELLEYASMAHTRICFASPSPLQEACANALPIALDNGYFKKMREEYIH
                     KFNIFTRVFDELGLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYWLI
                     NELGVVAIPPTEFYIKEHEKVAENLLRFAVCKTDDYLEGAVERLRLLKEHL"
     gene            <921312..>921719
                     /locus_tag="KLTH0H10670g"
                     /db_xref="GeneID:8294666"
     mRNA            <921312..>921719
                     /locus_tag="KLTH0H10670g"
                     /product="KLTH0H10670p"
                     /transcript_id="XM_002556289.1"
                     /db_xref="GeneID:8294666"
     CDS             921312..921719
                     /locus_tag="KLTH0H10670g"
                     /note="similar to uniprot|P38345 Saccharomyces cerevisiae
                     YBR269C FMP21 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0H10670p"
                     /protein_id="XP_002556335.1"
                     /db_xref="GeneID:8294666"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:C5E362"
                     /translation="MSFIGSRASLTAGTLFKRSRNVIPAAFSRSFQAKRGPAPPQLPK
                     EEQEEFERLQRIAQSQEAIDEYNREIENDTTKESAKSPILKADIGGFSPEFSKTIPEF
                     AGDVNPKTGERGGPKQDPLKHGDYSFNGRVTDF"
     gene            complement(<921787..>923862)
                     /locus_tag="KLTH0H10692g"
                     /db_xref="GeneID:8294667"
     mRNA            complement(<921787..>923862)
                     /locus_tag="KLTH0H10692g"
                     /product="KLTH0H10692p"
                     /transcript_id="XM_002556290.1"
                     /db_xref="GeneID:8294667"
     CDS             complement(921787..923862)
                     /locus_tag="KLTH0H10692g"
                     /note="similar to uniprot|P40368 Saccharomyces cerevisiae
                     YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
                     forms a subcomplex with Nup159p and Nsp1p interacts with
                     Nup116p and is required for proper localization of Nup116p
                     in the NPC"
                     /codon_start=1
                     /product="KLTH0H10692p"
                     /protein_id="XP_002556336.1"
                     /db_xref="GeneID:8294667"
                     /db_xref="UniProtKB/TrEMBL:C5E363"
                     /translation="MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCL
                     MDAPNYEYMELNAISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPA
                     GVKQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKD
                     IESVCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSE
                     GDSPELKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPF
                     PEKLYLATAKQIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSL
                     ISVGSLKLPGSISLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLT
                     EEITEKKGTFQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNR
                     QRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEV
                     LSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQE
                     KNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDL
                     AEALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAEL
                     QCTTQELDS"
     gene            complement(<924077..>924397)
                     /locus_tag="KLTH0H10714g"
                     /db_xref="GeneID:8294668"
     mRNA            complement(<924077..>924397)
                     /locus_tag="KLTH0H10714g"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_002556291.1"
                     /db_xref="GeneID:8294668"
     CDS             complement(924077..924397)
                     /locus_tag="KLTH0H10714g"
                     /note="similar to uniprot|P36532 Saccharomyces cerevisiae
                     YBR268W MRPL37 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_002556337.1"
                     /db_xref="GeneID:8294668"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:C5E364"
                     /translation="MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQ
                     IKKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNF
                     LSEI"
     gene            complement(<924558..>926990)
                     /locus_tag="KLTH0H10736g"
                     /db_xref="GeneID:8294669"
     mRNA            complement(<924558..>926990)
                     /locus_tag="KLTH0H10736g"
                     /product="KLTH0H10736p"
                     /transcript_id="XM_002556292.1"
                     /db_xref="GeneID:8294669"
     CDS             complement(924558..926990)
                     /locus_tag="KLTH0H10736g"
                     /note="similar to uniprot|P40367 Saccharomyces cerevisiae
                     YJL062W LAS21 Integral plasma membrane protein involved in
                     the synthesis of the glycosylphosphatidylinositol (GPI)
                     core structure mutations affect cell wall integrity"
                     /codon_start=1
                     /product="KLTH0H10736p"
                     /protein_id="XP_002556338.1"
                     /db_xref="GeneID:8294669"
                     /db_xref="GOA:C5E365"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:C5E365"
                     /translation="MNKRLLVLLVLEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHR
                     RMAPKFEKMVLVIVDALRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPR
                     LKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFP
                     SEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGA
                     FSSFMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFI
                     SKLLEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVL
                     IPDFLKLLSPADAKTKVIDNYQQLLSISGGSTKKLGDPDAIIEEMREVQSDLAKTATN
                     YNYLLLGIGFLTLLVVSSVALFFSWTSFPSTFGLFLLLGTSLLLSLSTFGSSFIEEEH
                     QIWWWTSIALVGLSYISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQH
                     YQVEWLLITTTIFVVQFQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQVPAWLQH
                     ICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVTAAVIAVEVIRHQFKPNGPRLLEEI
                     HAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSRRQWSFPVLMTVNLVLQHLSFFQ
                     FGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSKSTQS
                     KWETFFTSRLPSFLYYCLFGCFLLGSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAII
                     AWFFEGTLVALL"
     gene            complement(<927171..>928358)
                     /locus_tag="KLTH0H10758g"
                     /db_xref="GeneID:8294670"
     mRNA            complement(<927171..>928358)
                     /locus_tag="KLTH0H10758g"
                     /product="KLTH0H10758p"
                     /transcript_id="XM_002556293.1"
                     /db_xref="GeneID:8294670"
     CDS             complement(927171..928358)
                     /locus_tag="KLTH0H10758g"
                     /note="similar to uniprot|P38344 Saccharomyces cerevisiae
                     YBR267W REI1 Protein of unknown function involved in bud
                     growth in the mitotic signaling network proposed negative
                     regulator of Swe1p and Gin4p contains dispersed C2H2 zinc
                     finger domains"
                     /codon_start=1
                     /product="KLTH0H10758p"
                     /protein_id="XP_002556339.1"
                     /db_xref="GeneID:8294670"
                     /db_xref="GOA:C5E366"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E366"
                     /translation="MSSFTCNSCGLQFSAIGGQREHMKTDWHSYNLKRRVAQLPPINE
                     ATFNAKVKAFAEQDSEPEKQKQMTKKEARRREKEALLAKKKALLEQARESILNNMQKE
                     GNEASESGPSEQAVEAPQKEGEQEASEAPDSTLTPDQLAEQLMQQKLENKVDIPLNVC
                     LFCTRKREFADLDSNLDHMFKNHGFYIPEQKYLVDKAGLVKYMSEKIGLGNVCLVCSY
                     QGRSLEAVRAHMLSKSHCRVPYELEDERLEISEFYDFSGTYGDQETPVVRAEAAGEDG
                     EWEDVDSEEDGEQASDEDLPQDYIYNDGVELHLPTGVKVGHRSLQKYYRQNLKPESVL
                     TEGQGTLIAAETRHFATVFDPKQVATQKRVWQAEVKDKKRDDKRAAKFVNNQPHYRDQ
                     LLQ"
     gene            complement(<928608..>929552)
                     /locus_tag="KLTH0H10780g"
                     /db_xref="GeneID:8294671"
     mRNA            complement(<928608..>929552)
                     /locus_tag="KLTH0H10780g"
                     /product="KLTH0H10780p"
                     /transcript_id="XM_002556294.1"
                     /db_xref="GeneID:8294671"
     CDS             complement(928608..929552)
                     /locus_tag="KLTH0H10780g"
                     /note="similar to uniprot|P38342 Saccharomyces cerevisiae
                     YBR265W TSC10 catalyzes the second step in the synthesis
                     of phytosphingosine 3-ketosphinganine reductase"
                     /codon_start=1
                     /product="KLTH0H10780p"
                     /protein_id="XP_002556340.1"
                     /db_xref="GeneID:8294671"
                     /db_xref="GOA:C5E367"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E367"
                     /translation="MAKFSLENQVALIAGGSQGLGKEFARKLYQEGTNNTVIVVSRSQ
                     DKLQRAVCSITGLETALELSEDARNLQHEQQQNRIFFASCDLAEYAQVEKLYELLAAC
                     EIVPTQVFLCAGGSTPGLFKDLSGRELDLGVRVNYMTCVNLAHIAVRKWPGSHLVFFS
                     SEVAFFPFIGYSQYAPLKQSIKSLVAILRQECAPQRISCVYPGNFDSEGYALENETKP
                     TITKEIEGPSDAISCAECCDRICKTLKAGYDDVTTDFIGWVLMSTDMGLNKQNNVSFG
                     WPLQWLLGIFANLIIVPIYMLICKFQIRQWRKSCQKKN"
     gene            complement(<929775..>930050)
                     /locus_tag="KLTH0H10802g"
                     /db_xref="GeneID:8294672"
     mRNA            complement(<929775..>930050)
                     /locus_tag="KLTH0H10802g"
                     /product="KLTH0H10802p"
                     /transcript_id="XM_002556295.1"
                     /db_xref="GeneID:8294672"
     CDS             complement(929775..930050)
                     /locus_tag="KLTH0H10802g"
                     /note="similar to uniprot|Q3E7B2 Saccharomyces cerevisiae
                     YJL062W-A Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10802p"
                     /protein_id="XP_002556341.1"
                     /db_xref="GeneID:8294672"
                     /db_xref="GOA:C5E368"
                     /translation="MAFEPSRYQDPRTWKMTPAMIRARRPFFKKNLLGLGILVSVTGG
                     IYVYTHRFLNRDNDFADVPIPPIDPKELEQLKKEYEQHKRDVAARDE"
     gene            <930412..>931143
                     /locus_tag="KLTH0H10824g"
                     /db_xref="GeneID:8294673"
     mRNA            <930412..>931143
                     /locus_tag="KLTH0H10824g"
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /transcript_id="XM_002556296.1"
                     /db_xref="GeneID:8294673"
     CDS             930412..931143
                     /locus_tag="KLTH0H10824g"
                     /note="similar to uniprot|P22353 Saccharomyces cerevisiae
                     YJL063C MRPL8 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /protein_id="XP_002556342.1"
                     /db_xref="GeneID:8294673"
                     /db_xref="GOA:C5E369"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:C5E369"
                     /translation="MTAGLMRHFSRTKAHRDSMFRNLVSQLFQHGSIVSTHEKCLEAS
                     RMADRVITMAKKLKHHPNSAMEIQSRLSLAGDNSKLLSRVVGELAPRYKQRPGGYTRV
                     LKLEPRLGDRAKQSVLELVDTPVVDAAGALQRGDIKLWLLCKTTIQNESKSVGYSQLT
                     LRNFAKMLKFRKNSHTFFTNDVLAVRKFIKQEQGLDWDEKHELKLVKQLKKQVLNEQA
                     QPAQTQTQPEAPGYTYVQERPQRQI"
     gene            <931560..>932609
                     /locus_tag="KLTH0H10846g"
                     /db_xref="GeneID:8294674"
     mRNA            <931560..>932609
                     /locus_tag="KLTH0H10846g"
                     /product="KLTH0H10846p"
                     /transcript_id="XM_002556297.1"
                     /db_xref="GeneID:8294674"
     CDS             931560..932609
                     /locus_tag="KLTH0H10846g"
                     /note="similar to uniprot|P53206 Saccharomyces cerevisiae
                     YGR012W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10846p"
                     /protein_id="XP_002556343.1"
                     /db_xref="GeneID:8294674"
                     /db_xref="GOA:C5E370"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:C5E370"
                     /translation="MTQFPVLASKGLVDAVGKTPLIKLNTLSKELGRNIFGKAEFQNP
                     GGSVKDRAALYLIEQAEKSGQIDPSRPATIVEGSAGNTAIGLAHIARSKGYKSIFYMP
                     NTQSVSKINLLKYLGAEVYPVPVCPISDPMNFNNRARDHAKRLDNAIWTDQFDNPANW
                     KSHYATTGPEILQQLQSAGLSCDAFTCSTGTGGTFTGVAKYLKEATNGQSKLVVADPP
                     GSVIYSYIKTGEMNREGSSFTEGIGQGRITKNLRESIDITDDAVFVPDEESIVMLFRL
                     LDEEGLFIGGTTALNVVAACKVAKTLPEGSNISTILCDSGHKYADRVFSKKWLREKKL
                     YDAIPDSLKRYAILD"
     gene            complement(<932678..>935029)
                     /locus_tag="KLTH0H10868g"
                     /db_xref="GeneID:8294675"
     mRNA            complement(<932678..>935029)
                     /locus_tag="KLTH0H10868g"
                     /product="KLTH0H10868p"
                     /transcript_id="XM_002556298.1"
                     /db_xref="GeneID:8294675"
     CDS             complement(932678..935029)
                     /locus_tag="KLTH0H10868g"
                     /note="similar to uniprot|P38148 Saccharomyces cerevisiae
                     YBR276C PPS1 Protein phosphatase with specificity for
                     serine threonine and tyrosine residues has a role in the
                     DNA synthesis phase of the cell cycle"
                     /codon_start=1
                     /product="KLTH0H10868p"
                     /protein_id="XP_002556344.1"
                     /db_xref="GeneID:8294675"
                     /db_xref="GOA:C5E371"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5E371"
                     /translation="MFYPAEPNGPGQPPNKRRKGHSEEQGSSFTDSASDKNHLIPGRV
                     SLISHEKMRKLVAQHISQRLPDCDEVFPWLHGYSGATNPPHSCQWLAVIRSQPLSQGL
                     IENSGLLKSSLDPHEFLMTLEPRKHHLESLLSNVGGILNLTSAEIKILTSACERHKLL
                     PFLISDAKAQSWFGVGANKHSVGKSSSKHDPPRNWKQPGMFRRFDLQVAKFVEMSRNC
                     VVYCLDQTTHYTSCPCCGLALLIHVARRIVDPKGNFRISVLDSTQIDPEWWGTPPMKV
                     NALKKVHNSQLASDFDVASFNNWDRDLFYRERLEISKMSSASCISADASVWCGNSTDF
                     EIYRLYNGDAMNAKPVNASVTSPDTVVTLPNLRSSNDDELIDTQLFNLPRPSKPWRLF
                     LHCSESSCLPELSKVTSLIEHVQRKTPLAQTLISFPNSGSIGLGNLNLDSIKVILNMC
                     LLLYSVGKHTNCGSLIYCSDGYTETSFLLVAFLIFVWDQPLDKVLVRLHGEVNRPFFL
                     FPIDLQVLGHLQILLREQSPRRTEPESSSLDVDPELFSKMFFTKVSDNLNLLQLKGPL
                     PSKILPHLYLGSLEHAQNPKLLQEIGIKNIVSVGETMPWLLAAISRKRSLTVSDINDQ
                     KTCTRPSISSASSASQIPSLQGSFLKRENGCAIIEENGFRVLHITNLDDNGEDHLLSQ
                     LDEVLSFIEECYNRQEKVLVHCMVGVSRSATVCIAECMRRLNCDVLRAYLYVRVRRLN
                     IIIQPNLMFVYELCKWQETHGRPSHVDWHIICRAISELNSVYF"
     gene            <936960..>937565
                     /locus_tag="KLTH0H10890g"
                     /db_xref="GeneID:8294676"
     mRNA            <936960..>937565
                     /locus_tag="KLTH0H10890g"
                     /product="KLTH0H10890p"
                     /transcript_id="XM_002556299.1"
                     /db_xref="GeneID:8294676"
     CDS             936960..937565
                     /locus_tag="KLTH0H10890g"
                     /note="some similarities with uniprot|P40366 Saccharomyces
                     cerevisiae YJL065C DLS1 Subunit of ISW2/yCHRAC chromatin
                     accessibility complex along with Itc1p Isw2p and Dpb4p
                     involved in inheritance of telomeric silencing"
                     /codon_start=1
                     /product="KLTH0H10890p"
                     /protein_id="XP_002556345.1"
                     /db_xref="GeneID:8294676"
                     /db_xref="GOA:C5E372"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5E372"
                     /translation="MEHSSSLEAVQKAAPRLPISKVKRIAKCDPEHMLTSQSATAAVA
                     FATELFVQVFSEEGFARSQLERPAGARLTLRYDDLSACVASSDRFAFLADVVPETQSL
                     VSLTCENRVRYTTLAPGQTVLPFRAKEEPANSDGDGEEEPDEQPEAELDAEIDEDGDN
                     HVEAEIDVYTQNDADLEPELDAEADTDIKPTADPEAGAVVI"
     gene            <938065..>938928
                     /locus_tag="KLTH0H10912g"
                     /db_xref="GeneID:8294677"
     mRNA            <938065..>938928
                     /locus_tag="KLTH0H10912g"
                     /product="KLTH0H10912p"
                     /transcript_id="XM_002556300.1"
                     /db_xref="GeneID:8294677"
     CDS             938065..938928
                     /locus_tag="KLTH0H10912g"
                     /note="weakly similar to uniprot|P40364 Saccharomyces
                     cerevisiae YJL066C MPM1 Mitochondrial membrane protein of
                     unknown function contains no hydrophobic stretches"
                     /codon_start=1
                     /product="KLTH0H10912p"
                     /protein_id="XP_002556346.1"
                     /db_xref="GeneID:8294677"
                     /db_xref="UniProtKB/TrEMBL:C5E373"
                     /translation="MGIFTGDNDKETQEYNDKLVASSLRERLCNNFNSVGDSISSLWK
                     DAVDRVDNKLPDLWVNASGSIGDVLSGLGFPGGFGHPARIRTLMDDQAAEEGTTGLYS
                     YRTPSDRQYLECQNIKGLSVWDTHGWWRCLFPESAVRSKVNAERLQEVLTREKVEKDK
                     NHSLGLFFTDYSAYLTWRANMLRLADERRRSAEESARDNSWRPTTPEDLMNSTPGKHV
                     VGTSEYVTYNTTPEGQEKVKETKTYFNDGSVRLRSEKQRQGPDGQPHIESFEKLLTED
                     DKHNEGWFWRK"
     gene            <939374..>940579
                     /locus_tag="KLTH0H10934g"
                     /db_xref="GeneID:8294678"
     mRNA            <939374..>940579
                     /locus_tag="KLTH0H10934g"
                     /product="KLTH0H10934p"
                     /transcript_id="XM_002556301.1"
                     /db_xref="GeneID:8294678"
     CDS             939374..940579
                     /locus_tag="KLTH0H10934g"
                     /note="similar to uniprot|P38351 Saccharomyces cerevisiae
                     YBR279W PAF1 RNA polymerase II-associated protein defines
                     a large complex that is biochemically and functionally
                     distinct from the Srb-Mediator form of Pol II holoenzyme
                     and is required for full expression of a subset of cell
                     cycle-regulated genes"
                     /codon_start=1
                     /product="KLTH0H10934p"
                     /protein_id="XP_002556347.1"
                     /db_xref="GeneID:8294678"
                     /db_xref="InterPro:IPR007133"
                     /db_xref="UniProtKB/TrEMBL:C5E374"
                     /translation="MSKKHEYIAKIRYRNDLPAPLLPPKLLKYQGPPNEEVDSPQLIT
                     SLYAKSNVTPLIKLNDDLSMPLDLTKIPGVLDHKDTKLLHGFENIKLHPEDRVLLRDP
                     RMDRLTKTDTSKVTFLRRTEYVSSSSAPKPSNRKRPVSEAIDPDDEILTPAQRVKRVE
                     STFDSVTDDLSKVKHPFKKNVHAVKAWELLPDTVSMDQTFFTIRLVGSAALDKAEKEQ
                     LALSTALFRPVELEEDEWVSLYTTEKNSSEEYEKNLEQQIDEITDDDRVYKFKRLRDF
                     DMKQLQPAGSGLFSELALRFNNDKKTIYYTPLRSRIELRRRRVNDVIKPLVRENNLDQ
                     INIKIKNPTTQETRIRDKIRMKFDPIDFPNIEDEIDDEAPQEEQVTKVSEAASQDAQQ
                     GSQDVDAEK"
     gene            <940867..>941763
                     /locus_tag="KLTH0H10956g"
                     /db_xref="GeneID:8294679"
     mRNA            <940867..>941763
                     /locus_tag="KLTH0H10956g"
                     /product="KLTH0H10956p"
                     /transcript_id="XM_002556302.1"
                     /db_xref="GeneID:8294679"
     CDS             940867..941763
                     /locus_tag="KLTH0H10956g"
                     /note="similar to uniprot|P40363 Saccharomyces cerevisiae
                     YJL068C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10956p"
                     /protein_id="XP_002556348.1"
                     /db_xref="GeneID:8294679"
                     /db_xref="GOA:C5E375"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="InterPro:IPR014186"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5E375"
                     /translation="MTFQIKQEIASCGGKLMKLSHPSKKTGTEMEVNVYLPKQYFHKQ
                     DQSIPVLYYLSGLTCSPQNASEKAFWQPQADKYGFALVFPDTSPRGEGVPDDPEESWD
                     FGISASFYVDATQEPYKKNYQMFSYIHDELPRELSQFFENKGNSKLDFVENVAITGHS
                     MGGFGALSAFLKLYPERKYKSCSAFAPITFPSKVQWGQKAFGGYLGQEEEKWKPYDPG
                     HLLKMTTNIGSDKILIHQGTGDPFYKNQLKPELLLEASKGTSWDGKINLNLVEGFDHS
                     YYFVSTFVPEHAEFHAKNLGLI"
     gene            complement(<941811..>943547)
                     /locus_tag="KLTH0H10978g"
                     /db_xref="GeneID:8294680"
     mRNA            complement(<941811..>943547)
                     /locus_tag="KLTH0H10978g"
                     /product="KLTH0H10978p"
                     /transcript_id="XM_002556303.1"
                     /db_xref="GeneID:8294680"
     CDS             complement(941811..943547)
                     /locus_tag="KLTH0H10978g"
                     /note="similar to uniprot|P38352 Saccharomyces cerevisiae
                     YBR280C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H10978p"
                     /protein_id="XP_002556349.1"
                     /db_xref="GeneID:8294680"
                     /db_xref="GOA:C5E376"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR027046"
                     /db_xref="UniProtKB/TrEMBL:C5E376"
                     /translation="MSHSIEHELPPDIIEAALPYLSTQDIKNLSLTNRYFHKLLDFGK
                     SNTLWHELFHKSFGSTHSDAEPLVSQQNHEYMSCSEAILRNRHPDKSWCDLYKLRSHD
                     VRFYTWGCLKHARLGFTSISHGSLPASWINNAGMRLQFGVNTPVAVPWFEDEGNEKSP
                     EADQSIACISGGGFSFQVLTRSGKLYMTGSTYSGGHKGPGPREGEHDFNSFQQIIMDT
                     ERSLTFFNGRIPHGRGALPFQGNSSATLEAPHENIYANFEDVERILDQKIPGNKHMRR
                     LFTREVIKVERGGAPVLSVDATKLDVIKFTSVSSGRSHILALSAEGNVYSWDGPDVEQ
                     GVKIAFEGLPTKETNPVIKIGCGWNFNCVSIYNLGLVVWESREPIRENETSAGAHYKV
                     IPSTGQVSGEGKIVDFACCANMSVFFISAAGDKLWRYANETVDEVKLPFHGKLVKLVG
                     SYTTLAIFTENHCYAVKVTEGHMRPETFMELELDDENEKLISLSTGDYHTVALTSSGK
                     IYTWGLESELCGCLGLGSRDEIVNERRVGRIENLRSTLVLKPSKVKIGDSDYTCVAIT
                     AGGWQTGALIVK"
     gene            complement(<943669..>946260)
                     /locus_tag="KLTH0H11000g"
                     /db_xref="GeneID:8294681"
     mRNA            complement(<943669..>946260)
                     /locus_tag="KLTH0H11000g"
                     /product="KLTH0H11000p"
                     /transcript_id="XM_002556304.1"
                     /db_xref="GeneID:8294681"
     CDS             complement(943669..946260)
                     /locus_tag="KLTH0H11000g"
                     /note="similar to uniprot|P38149 Saccharomyces cerevisiae
                     YBR281C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11000p"
                     /protein_id="XP_002556350.1"
                     /db_xref="GeneID:8294681"
                     /db_xref="GOA:C5E377"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017149"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E377"
                     /translation="MPPSIHKWNHQYAILSTVAFPHKRILFAGTHDSKILCFDLTTYN
                     LAKTICLGDTEETHTRSSVLCMTKSQDERFLFSAGADSLVRIWSVDSLTASGNITITE
                     VGTLYSLLDIGDIFSLKYLDAHQTIVFGCQNANMLYLPHVMDSVNRKTQAEDLNKLPH
                     RRFDRFFDSTGPGVRPIVANATPPPEPEELEHVIIEIPPEYIIPYAHNSFIYSTQPLK
                     GQNGNLPTHFYTDGMTKENTDFIVSGGGDGMSKIWALSQEAGGYMKPRLITEMNNEES
                     VLCQIVSFPFLYCGLSDGLIKMWDLNTKELVSTFQAPSKCDIVSISVYKDHIFATHQK
                     GVTKFYRDEVYQWNAHQGLVLSAELLRRKCTGYSHLRLATGGNDGALTLWNVNRLVGE
                     EDENEINNISSASAYVSSHIDIKSREKYNAQLVDHDNMFETLRELISFKTVSALTDTQ
                     YVIDLRRCASFLQELFTKLGAACTLLTIKNGCSPLIHAQFHGKAQKKKKILWYGHYDI
                     ISPGDPSRWKTDPFTLTCENGYLKGRGVTDNKGPLVAAMYSVGSAFLKGELLNDVVFL
                     IEGQEESSSQGFAETINKHRDLIGNDVDWVLFSNSYWVDDKVPCLNYGLRGVINARIT
                     VWNNEPDKHSGFDGGTDREPTADLISVTSKLQDDDGRVLIPGFYEPLKQLSAEEEIHF
                     KEILKRTNVCKSISLEKLRAKWTKPSLSVTNMKVSGPGNVTVIPSSASVTVSIRIVPE
                     QDVADIKNSLEQYVNECFKKLKTNNKLTLETLNTAEPWLGDPKNSAYQVLREEIQEAW
                     GADPLLVREGGSIPQIRFLERVLRAPAVQVPCGQSTDNAHLDNERLRIENWYKMRQIL
                     HKAFNRL"
     gene            <947447..>949195
                     /locus_tag="KLTH0H11022g"
                     /db_xref="GeneID:8294682"
     mRNA            <947447..>949195
                     /locus_tag="KLTH0H11022g"
                     /product="KLTH0H11022p"
                     /transcript_id="XM_002556305.1"
                     /db_xref="GeneID:8294682"
     CDS             947447..949195
                     /locus_tag="KLTH0H11022g"
                     /note="similar to uniprot|P40362 Saccharomyces cerevisiae
                     YJL069C UTP18 Possible U3 snoRNP protein involved in
                     maturation of pre-18S rRNA based on computational analysis
                     of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="KLTH0H11022p"
                     /protein_id="XP_002556351.1"
                     /db_xref="GeneID:8294682"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E378"
                     /translation="MSAPVVHSQPVPPPDDEELMLSKLVFGDTSDFNENLSQLRSLDT
                     EFGDADDVEMIEANSEEENDEDPEHNNMDAIQDDQLFFVDDGMTGEEQDKESAELGNG
                     SDSASESDTGSEYYSEDSAVWSDSEDERVEVAFTTSNRTKKLRSSYSEGRIKGRDYVS
                     RLRHQFEKIYPRPKWADSESSEEGPGSDDDSDREDREEVINGDLNALSRILQSTYNYR
                     DTSSRLLPPSSLDITRLKDANAAHPSRAAVQSLSFHPSKPLLLTGGYDRTLRVYHIDG
                     KNNHLVTSLYLTGTPIQTCSFYVSPSHQEQRIFTAGRRRYMHSWDISGTTPQQSRIEK
                     ISRMYGHEATQRSFEKFKLAHVCAQSGKAHGVILLQGNNGWVNVLHATTGVWMIGCKI
                     EGVLVDFCVDYKPISNNKFQTILIMVNTYGEIWEFDLAKQGEVLRRWKDDGSVGVTTV
                     QTGGGNNSTQLLPFKKIRHNRWLAIGSESGYVHVYDRNSSSAEPVAKLDQLTTPISSL
                     AFSPDGQILCMASRATKDALRLVHLPTGKVFSNWPTSGTPLGKVTSVAFSPRGEMLAA
                     GNEQGKVRLWRLNHYA"
     gene            <949487..>949924
                     /locus_tag="KLTH0H11044g"
                     /db_xref="GeneID:8294683"
     mRNA            <949487..>949924
                     /locus_tag="KLTH0H11044g"
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /transcript_id="XM_002556306.1"
                     /db_xref="GeneID:8294683"
     CDS             949487..949924
                     /locus_tag="KLTH0H11044g"
                     /note="similar to uniprot|P36526 Saccharomyces cerevisiae
                     YBR282W MRPL27 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL27"
                     /protein_id="XP_002556352.1"
                     /db_xref="GeneID:8294683"
                     /db_xref="InterPro:IPR019189"
                     /db_xref="UniProtKB/TrEMBL:C5E379"
                     /translation="MRPSPATLFHESPLSLLTRPWKKNRDGTLFYGVSKSGNNRTPLT
                     TKQGNKTMYKGTRSSGIGRHTRYGGYTIQWDKVRTYVTPKNFNTELKPLVSHNLPELR
                     HSFSGYQKGALDSRLYFEKLKEYVKNGKAQGEATDVKCYVERG"
     gene            complement(<950234..>951772)
                     /locus_tag="KLTH0H11066g"
                     /db_xref="GeneID:8294684"
     mRNA            complement(join(<950234..951696,951763..>951772))
                     /locus_tag="KLTH0H11066g"
                     /product="KLTH0H11066p"
                     /transcript_id="XM_002556307.1"
                     /db_xref="GeneID:8294684"
     CDS             complement(join(950234..951696,951763..951772))
                     /locus_tag="KLTH0H11066g"
                     /note="highly similar to uniprot|P38353 Saccharomyces
                     cerevisiae YBR283C SSH1 Subunit of the Ssh1 translocon
                     complex Sec61p homolog involved in co-translational
                     pathway of protein translocation not essential"
                     /codon_start=1
                     /product="KLTH0H11066p"
                     /protein_id="XP_002556353.1"
                     /db_xref="GeneID:8294684"
                     /db_xref="GOA:C5E380"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:C5E380"
                     /translation="MAGFRLIELAKPFLPLLPEVEVPYEKIGFDDKVVYTIIAALIYL
                     FGQFPLAGVSKEASGVLDPLYFLRSVFAAEPKTLLEFGVFPVVSSALIMQVLAGLKLI
                     KVNFKIRQDRELFQTCTKLFALLQYLVLANVFIFSGYYGTDLSVVQITALNVQLVVAG
                     FFVTLLVEVIDKGYGFASGAMAITTVTISTNFVADVFGVGQFPVDNEGHTEPQGAFIN
                     LIQSLRASHKTWTGAIVGAFNRDYLPNLTTAFLVLALAASICFLTNFRLELPIRSTRT
                     RGVNNVYPIRLFYVGSLSVLFAYVILFYIHVGAFVLVQLIAHNNPSSIIYKVVGGYAS
                     HNNLLYVPQFPLSLLTPPKSFVECITRQPLTPLFFTTFLVITGIWFAGLWQQISGSSA
                     RDISEQFKEQGITLTGRREQGVTKELDKIVPVAATTGAIVLGLLVACGELLGLKGKGA
                     SIIVGVSGGFALLELITAEYQQSGGQSALAQVLGAPSGGI"
     gene            <952862..>953170
                     /locus_tag="KLTH0H11088g"
                     /db_xref="GeneID:8294685"
     mRNA            <952862..>953170
                     /locus_tag="KLTH0H11088g"
                     /product="KLTH0H11088p"
                     /transcript_id="XM_002556308.1"
                     /db_xref="GeneID:8294685"
     CDS             952862..953170
                     /locus_tag="KLTH0H11088g"
                     /note="similar to uniprot|P38341 Saccharomyces cerevisiae
                     YBR262C Hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H11088p"
                     /protein_id="XP_002556354.1"
                     /db_xref="GeneID:8294685"
                     /db_xref="GOA:C5E381"
                     /translation="MSKVLKLTSVTLAASSLAAAGYFYAFDRDSYHYKNASWKRIGDH
                     VQGILDRKEDIAVQRTSSEARDVTVRPIKETMKDLWNEQVRNTAQWVYSFGSNTSTKA
                     "
     gene            <953330..>954022
                     /locus_tag="KLTH0H11110g"
                     /db_xref="GeneID:8294686"
     mRNA            <953330..>954022
                     /locus_tag="KLTH0H11110g"
                     /product="KLTH0H11110p"
                     /transcript_id="XM_002556309.1"
                     /db_xref="GeneID:8294686"
     CDS             953330..954022
                     /locus_tag="KLTH0H11110g"
                     /note="similar to uniprot|P38340 Saccharomyces cerevisiae
                     YBR261C Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0H11110p"
                     /protein_id="XP_002556355.1"
                     /db_xref="GeneID:8294686"
                     /db_xref="GOA:C5E382"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E382"
                     /translation="MSKPDSNINYGDAIDYWTAVPATVDGVLGGYGEGTTVPVMDVLG
                     SNHFLRKLKSRMIPAENCRKIGCDIGAGIGRVTRDMLHKHCDVVDLVEPVVPFVKQMD
                     VELASLKEAGRIGHIFDIGMQEWTPETGRYWLIWCQWCVGHLPDEELVAFFLRCKKGL
                     QPNGTIVVKENNTQALEDDFDEDDSSVTRSDDKFKELFQRAGLKLIATERQKGLPKEL
                     YPVRMYALKPQD"
     gene            complement(954610..954739)
                     /gene="SNR60"
                     /locus_tag="KLTH0H11132r"
                     /db_xref="GeneID:8294687"
     ncRNA           complement(954610..954739)
                     /ncRNA_class="snoRNA"
                     /gene="SNR60"
                     /locus_tag="KLTH0H11132r"
                     /product="snR60"
                     /note="C/D snoRNA monocistronic SNR60"
                     /transcript_id="XR_002432223.1"
                     /db_xref="GeneID:8294687"
     gene            <955400..>957517
                     /locus_tag="KLTH0H11154g"
                     /db_xref="GeneID:8294944"
     mRNA            <955400..>957517
                     /locus_tag="KLTH0H11154g"
                     /product="KLTH0H11154p"
                     /transcript_id="XM_002556310.1"
                     /db_xref="GeneID:8294944"
     CDS             955400..957517
                     /locus_tag="KLTH0H11154g"
                     /note="similar to uniprot|P38339 Saccharomyces cerevisiae
                     YBR260C RGD1 GTPase-activating protein (RhoGAP) for Rho3p
                     and Rho4p possibly involved in control of actin
                     cytoskeleton organization"
                     /codon_start=1
                     /product="KLTH0H11154p"
                     /protein_id="XP_002556356.1"
                     /db_xref="GeneID:8294944"
                     /db_xref="GOA:C5E383"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5E383"
                     /translation="MSVSRSSSRTDQTSEANSALQPSKSPASGSNETPSAGSTGVQPD
                     LLGKPEITRVLDSDVAINALLSRLKQSLLTCEEFTKFVRKKYLLEDVHAQELGKTYKN
                     FFPDSSASSSLQKSIHTVLEFDGKLSQVKHSYVKALHTMSDELGALLLTMTKMRKGLK
                     ENSRRLEKEVADAIHMAEKAKSRYNSLCQDWEKLRMADPTKTKLTLRGSKTTREQEED
                     LLRKIDSADLDFKQKVDHSTSLRNTFLSRERPKIVSELKDLILELDTAMAIQLQKYTI
                     WTETLILNSGVTVTPFDATKSMKSIAASTSNELDLYNFLNKYNQGSRSNNFVNKNLIP
                     VEYKQYPSMAKPVMAKNGQTRSGNHTSSSQNTFSVNTNMNSLPKRIVSTQHESPFDST
                     PTPRTGFSPVQNGSPAGSPNSHPGNASRGNLAQTTPSHQKAVSSMLDVADSQTPRSSQ
                     SGTRPDGPDSDFATLDPGNGTRSTSLTTSMITSISERPVSHIQSAATLPPGINRNFKT
                     FGVALESLLEYEQDMVPAIVRQCIYVVDKFGLDLEGIYRKPANVLDVSKLREEIDKDP
                     SNISMIVPPKNHTDSDIYLAGSLLKAFFANLPESLLPPSMTSEIKTCLTIADPVTRKN
                     YMHGLIYKLPDGQYWTLRSLVFHLKRIIEHEPTNRMNLKSVCIIWGPTLIAPNDTDIN
                     DVNYQIQAMEVLIDVADQAFEPE"
     gene            complement(<957667..>959991)
                     /locus_tag="KLTH0H11176g"
                     /db_xref="GeneID:8294688"
     mRNA            complement(<957667..>959991)
                     /locus_tag="KLTH0H11176g"
                     /product="KLTH0H11176p"
                     /transcript_id="XM_002556311.1"
                     /db_xref="GeneID:8294688"
     CDS             complement(957667..959991)
                     /locus_tag="KLTH0H11176g"
                     /note="weakly similar to uniprot|P47050 Saccharomyces
                     cerevisiae YJL047C RTT101 Cullin family member subunit of
                     a complex containing ubiquitin ligase activity binds HRT1
                     and is modified by the ubiquitin like protein RUB1
                     Regulator of Ty1 Transposition Regulator of Ty1
                     Transposition"
                     /codon_start=1
                     /product="KLTH0H11176p"
                     /protein_id="XP_002556357.1"
                     /db_xref="GeneID:8294688"
                     /db_xref="GOA:C5E384"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:C5E384"
                     /translation="MQNGEGLLTFDVVSLQFRNAVDELLRRSFDKKLRTLDGPNLLST
                     IDRIFYYELSRRLARSKIYVPTATEVSGEDTTLRKKAKAFRLLSQEEVVIKIWHLIIE
                     ELDKSVDDVVSELAEKLTLESEPKAAFVRHWPSLCLGQFEVQVSLLAEAFHLFAEDFS
                     FIFNAFTGVHTIREFAEYRLVESALSVLGNEAEGALTEALTEIRKQYHNCDEEGARKA
                     ENYNRTGTECLKKFVEVVGKCHLRFTHHRKSFRVFYLDNLEFVLSKTNMEIDKDYLKN
                     VKNLLIREDMIVNLISKSIHLETKKIILTKFLFSAGVLENLLEIYALQRGFVREFKMI
                     KLAYNSDNRCNEFYASLANVIGIRFGNSFQRQRTLDEVLSYTCSLYDLEDDKVPQLVK
                     RGLELAVDGELNLVEPLVKSLDSKVKGCYKRLKEPQSVGLQQAKKDYEIFLSLWRILE
                     SFDLLEPFFKLYMERSLFRRMIIMGTEYLAYMNHPENLEKRFFDLLEARQSHWELVTQ
                     LKALRSNLIDTQKLFQGFETQELQNVQLAPMIFERKNVPASFHDFTFPELKIPRSLDA
                     LWQKFCAFYAESDPRSTKKPLVLQNMLHHLEVQTNFKLEDGRPLMLELTLLQASILDL
                     FNESGELTVRDIESELGVAANILEPALTSFISAGLLNTDGGSFIVNEEFKPDIKKMKD
                     GRLKIFHKAAPKAALKPPEDGLEKKDTSWIKEVLRARIVRVLKTSSASFSFEQLKTAV
                     EKEKSGFSMGEFKTALAECKDFYSLNKELYQYKP"
     gene            complement(<960669..>962633)
                     /locus_tag="KLTH0H11198g"
                     /db_xref="GeneID:8294689"
     mRNA            complement(<960669..>962633)
                     /locus_tag="KLTH0H11198g"
                     /product="KLTH0H11198p"
                     /transcript_id="XM_002556312.1"
                     /db_xref="GeneID:8294689"
     CDS             complement(960669..962633)
                     /locus_tag="KLTH0H11198g"
                     /note="some similarities with uniprot|P47050 Saccharomyces
                     cerevisiae YJL047C RTT101 Cullin family member subunit of
                     a complex containing ubiquitin ligase activity binds HRT1
                     and is modified by the ubiquitin like protein RUB1
                     Regulator of Ty1 Transposition Regulator of Ty1
                     Transposition"
                     /codon_start=1
                     /product="KLTH0H11198p"
                     /protein_id="XP_002556358.1"
                     /db_xref="GeneID:8294689"
                     /db_xref="GOA:C5E385"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:C5E385"
                     /translation="MEDIKQSRSKKHGSIESPDCSDTSLFNQLEADINTLDLTESTAF
                     DVEQLVIKFAYLECSGNAQPPLQKKRKGKRLASNKFVQSLDLKFKKHASKLVRTFRKR
                     ADGDCSLLSTFLELDADYQQKFFKLSELYRLLDDRQHLEDCSRDPEINILKVKHLFLD
                     ELFSRENTNISKIICHCLHEARYDKLSIKTASAILGRLNEAALIFVDQRKDSCQPSDI
                     VVSSAISYASKLTLPLQVGFLNMAEAVISKEMKLVEGFSLEVKEKIRMSFLDALLCDS
                     NLEQLLKHHVSQYQDSKSVICNELKQLFQIAKAKERLQEFALALITGACDAFAEAINS
                     RVGFNGLLNLKAFQSEVFRCLFHGSDFGEISDKMWSYFEASDLHQTSLKLYIKVLNSF
                     FNKACSSPSKVTDISVNALIGFIEFYRFGKGFTPIYLQQCLLRRAVRKGYSFLRVFCD
                     RKKFCIERDFCETLITEGAPHSELLNNTLRCLNSSHNMCLKNRDKDCKIEPIVIGMNE
                     MKSIFKAPISGIPQLPQEMQAMWESQIVLYQEAVVESTVPKKLTLVPTLNNIELSTPF
                     VLENSCPLVLEVNLLQAVVLDAFNDGTDQTFQELKDSLKFGNDDLLSIAVGSYVKASI
                     LLQEKNTFTLNQLFKPEKSVLRGNKLRVDF"
     gene            <962932..>963324
                     /locus_tag="KLTH0H11220g"
                     /db_xref="GeneID:8294690"
     mRNA            <962932..>963324
                     /locus_tag="KLTH0H11220g"
                     /product="KLTH0H11220p"
                     /transcript_id="XM_002556313.1"
                     /db_xref="GeneID:8294690"
     CDS             962932..963324
                     /locus_tag="KLTH0H11220g"
                     /note="similar to uniprot|P38337 Saccharomyces cerevisiae
                     YBR258C SHG1 Subunit of the COMPASS complex which
                     methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="KLTH0H11220p"
                     /protein_id="XP_002556359.1"
                     /db_xref="GeneID:8294690"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:C5E386"
                     /translation="MSREELDPAVNLADEFKKRGYFDEAKNGILAGPIQESSTTTLEQ
                     FIKDRVTSVVAEMVNEDESLIFKNRGSTTALIEGQLLKDGYEKLNTESIQIDVLLRRV
                     LEDPDLKAEIKAKLKGDLEANKLQQRSQ"
     gene            complement(<963370..>964194)
                     /locus_tag="KLTH0H11242g"
                     /db_xref="GeneID:8294691"
     mRNA            complement(<963370..>964194)
                     /locus_tag="KLTH0H11242g"
                     /product="KLTH0H11242p"
                     /transcript_id="XM_002556314.1"
                     /db_xref="GeneID:8294691"
     CDS             complement(963370..964194)
                     /locus_tag="KLTH0H11242g"
                     /note="similar to uniprot|P38336 Saccharomyces cerevisiae
                     YBR257W POP4 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends binds to the RPR1 RNA subunit
                     in Rnase P"
                     /codon_start=1
                     /product="KLTH0H11242p"
                     /protein_id="XP_002556360.1"
                     /db_xref="GeneID:8294691"
                     /db_xref="GOA:C5E387"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:C5E387"
                     /translation="MNREQTFITEQILAKSLPTAEKAVDENRLQDTLLLLPTDGGLSS
                     RLKKKNGKLRLLSGEHIKNSTHSAYREINKNSKHALKSYINGARKASSTAKRIASEKN
                     LRERPELLGYLKEKHPSVFGSIPRFDQILPMHEELWVNYMREILNIPDDVPSASKLNI
                     NGTNALLKLSMADYNGCMITVTKSRNENLRGIKGIVIWDSQKDFILLCRGELVDEIKC
                     VPKMGTIFAFEIPVNKDEALQYTILGDRFKYRSSDRAGRKFKSRRCDDMLYYISGR"
     gene            <964294..>965517
                     /locus_tag="KLTH0H11264g"
                     /db_xref="GeneID:8294692"
     mRNA            <964294..>965517
                     /locus_tag="KLTH0H11264g"
                     /product="KLTH0H11264p"
                     /transcript_id="XM_002556315.1"
                     /db_xref="GeneID:8294692"
     CDS             964294..965517
                     /locus_tag="KLTH0H11264g"
                     /note="similar to uniprot|P47051 Saccharomyces cerevisiae
                     YJL046W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11264p"
                     /protein_id="XP_002556361.1"
                     /db_xref="GeneID:8294692"
                     /db_xref="GOA:C5E388"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004562"
                     /db_xref="UniProtKB/TrEMBL:C5E388"
                     /translation="MLGAIHTKALSRGAYFKSRCFRRYVSTQTPLELDSTARDENYAD
                     LNYMYTDMFAGSDVKSPVVGTGGKEGLSEIDQLNAEISETYDFTAQPLSGHELEQVVR
                     SAGRFILKSLSNNPYYNLALEDYVFLNTPVPKEGLFSSERLLFYVNDRCVVIGKNQNP
                     WRELFLDECSKKGYEFVRRKSGGGAVVHDLGNVNYSYLTSRDLFRREYFNKQIMNWLV
                     HAFPSASIGLSPRGDINLDNKKVSGSAFKVAKGKSYHHGTMLVNADLASFSGLLKPDF
                     LKGIEWSGGSVESVRSRVTNLSQMGIGNTDTFVDICTEGFKYLMNENMPVYWADESYT
                     RNAQICETISHLKSDEWLYDSGPNFTVSFNGHTINVEKGIIKDSTISEGIGSHFRDFV
                     SLLRKNKHFKTDIEI"
     gene            complement(<965578..>967500)
                     /locus_tag="KLTH0H11286g"
                     /db_xref="GeneID:8294693"
     mRNA            complement(<965578..>967500)
                     /locus_tag="KLTH0H11286g"
                     /product="KLTH0H11286p"
                     /transcript_id="XM_002556316.1"
                     /db_xref="GeneID:8294693"
     CDS             complement(965578..967500)
                     /locus_tag="KLTH0H11286g"
                     /note="similar to uniprot|P43606 Saccharomyces cerevisiae
                     YFR029W PTR3 Component of the SPS plasma membrane amino
                     acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
                     external amino acid concentration and transmits
                     intracellular signals that result in regulation of
                     expression of amino acid permease genes"
                     /codon_start=1
                     /product="KLTH0H11286p"
                     /protein_id="XP_002556362.1"
                     /db_xref="GeneID:8294693"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E389"
                     /translation="MDVNQVLSEFEQNLFLPRELISCEKEQERYRFTVKYGIVSDALV
                     LICGCIISQALYEELKRDYQNEACCPICQKLPLSSIGPVKPLRILYDQLQYFKREQAE
                     LVEAAPTQNTKSESQQQNLISLFHSVASEVGDSNEFEATEVHSLDNVSNTRTMPIQDS
                     SSTSVPIAITESPPSVQLSQLDEKKEFYFAKCFPMYRKRTQYNTHSRFLRTKSRQFIN
                     TAISPDCTKFALITEHKWEVYQISRYRKRDGQNKEKDFAKKLGKYAQNKKDRSGSSEC
                     VELLFCGKVSGEYGPSFDELSLPEDLDSLIPLSGKQRKSSQSSIDDHSNTWEHLYCKL
                     SNELLVISGSKGHFRVFDLNNGGVPLYTYASSFPIRCIEIDPKSTIIACGITGSDRAS
                     GAEQALILFHQIEKDIITQTSVNSEVARYKFSPPITTTLPYRDPINTLQFSPDSAYIS
                     CSTALESRFLVISLRRIHEPRLVMKSLRSIDTSLESEGITDTKMFPGNSNLMCVTSVA
                     FNAPPIVINTKIQTINGMQSVAQPTMLLRLDELGSKIHKCEISPRNDSIAFLDRNGTV
                     YIMYAPTLLDNEKRRIVSVEVAANAYRMREAASLRFSADGHKLFILDRKGIIYIEDFA
                     YGLPQDEEVTKCKQIN"
     gene            <968074..>968979
                     /locus_tag="KLTH0H11308g"
                     /db_xref="GeneID:8294694"
     mRNA            <968074..>968979
                     /locus_tag="KLTH0H11308g"
                     /product="KLTH0H11308p"
                     /transcript_id="XM_002556317.1"
                     /db_xref="GeneID:8294694"
     CDS             968074..968979
                     /locus_tag="KLTH0H11308g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H11308p"
                     /protein_id="XP_002556363.1"
                     /db_xref="GeneID:8294694"
                     /db_xref="GOA:C5E390"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:C5E390"
                     /translation="MVDYQKWIGEKDDDTEISKLSLPGTHNSAACHVALPSVKCQDHS
                     VSTQLRNGIRFFDFRLGKLFLKDGEDGKYNGKELQVIHGKFPVRIPIPLKFSSVLDEF
                     YSFLDQNPSETCIVSIKQEGDNFNDKSEFPRFVWDQYINQNLDKWYLNGDVPKIRDAR
                     GKIILFRRFGLTDEFQDRPYGIDAAWWPYNTINDDRGVFQVQDFCEVKHAEDIHTKAG
                     YVKDFLQTATQHNSSADAPPRLFVNFCTGANLFDMDCWPEKVADEMRKCDIGALVNKG
                     CGIVILDYAGRDNWDLVKSIVDSNF"
     gene            <969133..>971628
                     /locus_tag="KLTH0H11330g"
                     /db_xref="GeneID:8294695"
     mRNA            <969133..>971628
                     /locus_tag="KLTH0H11330g"
                     /product="KLTH0H11330p"
                     /transcript_id="XM_002556318.1"
                     /db_xref="GeneID:8294695"
     CDS             969133..971628
                     /locus_tag="KLTH0H11330g"
                     /note="similar to uniprot|P43596 Saccharomyces cerevisiae
                     YFR013W IOC3 Member of a complex (Isw1a) with Isw1p that
                     has nucleosome-stimulated ATPase activity and represses
                     transcription initiation by specific positioning of a
                     promoter proximal dinucleosome has homology to Esc8p which
                     is involved in silencing"
                     /codon_start=1
                     /product="KLTH0H11330p"
                     /protein_id="XP_002556364.1"
                     /db_xref="GeneID:8294695"
                     /db_xref="UniProtKB/TrEMBL:C5E391"
                     /translation="MSDPLESDSKSSSEPSLEATVSEGTNSKSKPKKIQLTFQDFKNI
                     KSSTQSPEGLLKHATDMLESNRRRSRRVVPKRPVDEDDEETSRAAPKKKKKPAVKSKE
                     PNINREAVRERVKKQQQAIENPETAILEENWSPNVPLPSSDFKNHYSIVSRFRSPNMK
                     SVPYAKDVIQIMTFINKFSGFLPRDLWSLSFQDFELGLDLYPESDKETPLKLYQDFMP
                     IKDLVKCQDAMNLLFLSLMKLALNNNTPTSSKSLSEGPKPYSKFLGQLRTNAWAWGYP
                     KEWKFQVGDAHSKVFTDDDTEPVDPNNHEILTPNLPTWPQQYAIDSDPLLTPELEKLG
                     ILALSPSDRIVLLRILVQWCLSQSDKIHTEVFRLSHLKRDAPYGVPTYHVPRIFLEGE
                     IPTKAKFKRLCELVQARLEIKSTKKHVKKQLEHGKRADLSQKLALIKSIEQSREEVHS
                     NGEGEIAPPVDIFDREFDSWNEIIDGELPDHPMSSPYEDEIFKLRDLEFFIGRVPHVG
                     DFYIPRLHTYQEAKKRLIPTTYTDPRSLARTLDSFANNEVDTLTLFTQNGKLMSTHFK
                     VFYHDSPAMIRDVASQSTTRPKTYWYEMCHDCNTLREFITLLDYKLNLLESPGSEPAN
                     KGLINKNPLPKESKFNASREKLRSVRDYLTKLLPFLAAFEELDAKFDEIESSKRTLRR
                     SQRNRATYSKDDDLDDAYSEDEAYVEKEGGSGDELGQESESDAYADEDFPEEDDGNDD
                     FTDDENDDESYELRGAKPKIATTSRGRGRGRGRGRGRGRGRGRGKGGSTRGGTTTEGR
                     GGARGSGRGRGRGRGRGRGRGRGRGRGRGRGGE"
     gene            complement(971902..971974)
                     /locus_tag="KLTH0H11352r"
                     /db_xref="GeneID:8294696"
     tRNA            complement(971902..971974)
                     /locus_tag="KLTH0H11352r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=73.94"
                     /db_xref="GeneID:8294696"
     repeat_region   complement(972036..972281)
                     /rpt_type=long_terminal_repeat
     gene            complement(<973355..>974668)
                     /locus_tag="KLTH0H11396g"
                     /db_xref="GeneID:8294698"
     mRNA            complement(<973355..>974668)
                     /locus_tag="KLTH0H11396g"
                     /product="KLTH0H11396p"
                     /transcript_id="XM_002556319.1"
                     /db_xref="GeneID:8294698"
     CDS             complement(973355..974668)
                     /locus_tag="KLTH0H11396g"
                     /note="similar to uniprot|P22517 Saccharomyces cerevisiae
                     YOL016C CMK2 Calmodulin-dependent protein kinase and to
                     YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
                     CMK1 Calmodulin-dependent protein kinase"
                     /codon_start=1
                     /product="KLTH0H11396p"
                     /protein_id="XP_002556365.1"
                     /db_xref="GeneID:8294698"
                     /db_xref="GOA:C5E392"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5E392"
                     /translation="MGGLVDEYLSSQGKPEEPEKIEGHTFKKVLNKISGQPDSYVNKA
                     DYIFGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGKDVQLQMLYDELSILQKL
                     DHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILKAVEY
                     LHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVAPE
                     VLTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTSGRYPVTFHKPYWSS
                     ISDDAKDFILQALTVTPRYRPSATELLNHKWITGEYTKTDNLLPGIRKEFDARRKFRE
                     AVEIVKLNNRIKKLNQLYATGEEDDSDIEENSPSNSLNSSMSNLSVGGSRSSDKSVGS
                     KHLKSALTQDAFAQIVKAATQNKDRIMNYKDDQPLSDDNSSSSAK"
     gene            complement(<975327..>977459)
                     /locus_tag="KLTH0H11418g"
                     /db_xref="GeneID:8294699"
     mRNA            complement(<975327..>977459)
                     /locus_tag="KLTH0H11418g"
                     /product="KLTH0H11418p"
                     /transcript_id="XM_002556320.1"
                     /db_xref="GeneID:8294699"
     CDS             complement(975327..977459)
                     /locus_tag="KLTH0H11418g"
                     /note="highly similar to uniprot|P23337 Saccharomyces
                     cerevisiae or YLR258W uniprot|P27472 Saccharomyces
                     cerevisiae"
                     /codon_start=1
                     /product="KLTH0H11418p"
                     /protein_id="XP_002556366.1"
                     /db_xref="GeneID:8294699"
                     /db_xref="GOA:C5E393"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:C5E393"
                     /translation="MARDIQNQLLFEIATEVANRVGGIYSVLKSKAPITCARYRDNYT
                     LIGLLNPETYQTEVEPLDWRDSATFESSSAHTPEIRNALENMSNRGVQFVYGRWLIEG
                     APRVLLFQLDSVRAHLNEWKSDLWDIAGIPSPEGDTWTDDAILLGYVVAWFLGELAHL
                     DQRHAIIAHFHEWMAGVALPLCRKRRIDVVTIFTTHATLLGRYLCAGNVDFYNNLDKF
                     DVDSEAGKRGIYHRYCIERAAAHTADVFTTVSQITAYESEYLLKRKPDGILPNGINVV
                     KFQAVHEFQNLHALKKEKINDFVKGHFHGHYDFNLDNTLYFFIAGRYEFRNKGADMFI
                     EALARLNYRLKMANSRMTVVAFIIMPAKNKSYTVDALKGQAVVTSLENTVKDVAGLIE
                     KRLFEYAMRHPDGGTSGIPTELDQLLKPSDKVLLKRRTLALRRPEGSLPPVVTHNMAD
                     DANDPVLNHIRRVQLFNNSNDRVKVIFHPEFLNANNPILSLDYDEFVRGCHLGVFPSY
                     YEPWGYTPAECTVMGIPSITTNLSGFGAYMEDLIEQDQAKDYGIYIVDRRFKNADESV
                     EQLVDYMESFVKKTRRQRINQRNRTERLCDLLDWKRMGLEYAKARQLALRRAYPDLFK
                     AVVGEEVSDANMNSLAGGKKFKISRPLSVPGSPRDPRAESIGSTILMTPGDLGTLQDA
                     NNADDYFHLSMGVEDEEEDEVNYLAAAD"
     gene            complement(<978785..>981295)
                     /locus_tag="KLTH0H11440g"
                     /db_xref="GeneID:8294700"
     mRNA            complement(<978785..>981295)
                     /locus_tag="KLTH0H11440g"
                     /product="KLTH0H11440p"
                     /transcript_id="XM_002556321.1"
                     /db_xref="GeneID:8294700"
     CDS             complement(978785..981295)
                     /locus_tag="KLTH0H11440g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0H11440p"
                     /protein_id="XP_002556367.1"
                     /db_xref="GeneID:8294700"
                     /db_xref="GOA:C5E394"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5E394"
                     /translation="MVLIKEVVLDLTNFVLSNANDAISFKPQLFYQVPAQDYVELRER
                     YIAFTGTSMRKNKSKLYFLPTNISDELQQLNPSIPESAKRVPRDGHVYYKNRLITELD
                     FENVKRVELACAYIAYAAVNKATGVEVDDVVAESGDYDADSGSLADPDPSSAGAGAGA
                     SGTDDSDKLSPAESTLQALRRGGVIGFRELGYLVSITPWHFHRVFKVITGLTIREYGQ
                     LCTEFVKKNRDIMNACKKKVEELKSQGHSFHCFDEPDFLKDGSLCYEPTTNVVLLPEY
                     FIDPNKSKEHKKKQKESKSSDGKCSQRVEARKRRSSVMSGRIRRASQTSIASNSSIQD
                     PLQSEVSYPSTPQLSPSEQAAAHHSGNSLSASPVVGFNLGGTMDAPVMGTRPLNPQYL
                     AKSRKGSLVNSATGVLSSASALGKVLKPRSSGGAVSGGSNFIRKMSEPSLALAARGLQ
                     SLPLEADGDEANAGITTVTSATDLNLQPVLSPQIDFKFDIFGTAGSREDPMGSGSCVA
                     SGSASGASLSVAETDSAQTPSNPNGESRTVSSLTAGSSNGSLNMGFADEIAPNALAPA
                     EQNEYSIGMPAGSSSTAATSVQGFASRANESLPRGSVHTLLDDITGLEPEENMLLDLN
                     AMHDEDLSAQSYGLLGPKAETGIHSSNSFTSLPNYAASSLHQDHQGQHDLQVLQQGHT
                     AQQQFSAQEISALSGGELPYSRNRLNSVAPEMDDLDRMFLSGYEGSTPGLSSALAAQF
                     STGDVDTLGMNAHMSSEQSTRDNTMATTATAATADTTDSTRAFEDKNTLESYTHLGFD
                     TLSPCASPTSRIDQSSFEAMISSSGNEEIVGNQFHFVQ"
     gene            complement(<981666..>982340)
                     /locus_tag="KLTH0H11462g"
                     /db_xref="GeneID:8294701"
     mRNA            complement(<981666..>982340)
                     /locus_tag="KLTH0H11462g"
                     /product="KLTH0H11462p"
                     /transcript_id="XM_002556322.1"
                     /db_xref="GeneID:8294701"
     CDS             complement(981666..982340)
                     /locus_tag="KLTH0H11462g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0H11462p"
                     /protein_id="XP_002556368.1"
                     /db_xref="GeneID:8294701"
                     /db_xref="UniProtKB/TrEMBL:C5E395"
                     /translation="MPPLYFRLYDLSSGREANRSAGFWLLGELAQQLHARCRGYQATN
                     WLARLVAAVPQWASGAHSPYVPRSGSFTVRRICICPSRPAPAESTGDTRARGNGLQET
                     HVYAAAAWANAYVRTHACVLHSQHARGIRVTPSPVQTEAGNRDSQGLLDRKRHSHVTT
                     NTITWTNGPTQPYFFRAAARSGARVSSCVIVLHFSLYSPFLHGGWRTGEKIMYIKVET
                     SYVCDV"
     gene            complement(<982395..>985235)
                     /locus_tag="KLTH0H11484g"
                     /db_xref="GeneID:8294702"
     mRNA            complement(<982395..>985235)
                     /locus_tag="KLTH0H11484g"
                     /product="KLTH0H11484p"
                     /transcript_id="XM_002556323.1"
                     /db_xref="GeneID:8294702"
     CDS             complement(982395..985235)
                     /locus_tag="KLTH0H11484g"
                     /note="some similarities with uniprot|P43597 Saccharomyces
                     cerevisiae YFR016C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11484p"
                     /protein_id="XP_002556369.1"
                     /db_xref="GeneID:8294702"
                     /db_xref="GOA:C5E396"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5E396"
                     /translation="MDGIEDFMLTQDQPTTSEDKATMPLSPPEEQASQRPESHAAAVA
                     PAPDHKTCAGEPQRTIEAAGALASGGENEAIEVEETNVDSDNNSRLRTKPSDLGRGHQ
                     DGDAAVAEAVAEPSPNIELGASAQGSIDAHADEVPKHEEPSALNPVGETPDRKPQRKQ
                     SLKREEHSKDESEHEGPDETSAGSRVASCGEIAKKNYQGGATIKGGERSGAAPLKAES
                     KPNNNRNGRVPDKKDEADKTDDADLKNGTLIERKKNNAGLDEDLQPAGTDAAAENLEK
                     ASGEIKEDASGKCEKGAESADEDASVIEQQTQTQSANKAVGSGAAADSTPDLRGSAKG
                     EEREEHERALDGGDAPNAHDTVEAREPANGELAMGEEAVELTSAEPTETAEAVEPTSA
                     EPTETAEQAEEAEHPAQRAESRGAELSHRPKTSDVRESREPEVPEAGDAELVGRKEAH
                     AAQQDDEGLAGRDGQAAHALQDKQGIQATIALQGEHENPAGAAGLASDADPSEQKHND
                     RANLGAETAAAQTENPEPNKARGTDRPETLRHTERKEATCTDPAQTTQCDSGSAVLGA
                     AAASRNRDAQQPGFRAATHTKDKEDEDATTEDQAQETGPEANSDLISDLLSELHLEPQ
                     PDPRSHVVAQTEPEAGLDHNKQTQASRPKQSPTASSSADQSSDPENQLNATDGAADDV
                     AFDADGSAEPPAARVSAANSESASPAQSSTSEPAAVPSGSNTPPTHVKPGPAVPESIN
                     NDQRAEVTKQDVPDAEHQQTSVDSSGNHAKSGPAPAHPDAPSPLSAARDSDAPAQSQS
                     RALADEIDDLLRGLEASSGVADKSSAEKGAARSPSVGGDKNKSISAISAISDILASEP
                     VYLYTSLAGGGFHMPSRTNRLAHILSANRVDFSYRDLGTDDEARRVWKRFGRGRSLPA
                     VVRGRDDIIGNWEEMDQANEDYRVRELIYETL"
     gene            complement(<985252..>986166)
                     /locus_tag="KLTH0H11506g"
                     /db_xref="GeneID:8294703"
     mRNA            complement(<985252..>986166)
                     /locus_tag="KLTH0H11506g"
                     /product="KLTH0H11506p"
                     /transcript_id="XM_002556324.1"
                     /db_xref="GeneID:8294703"
     CDS             complement(985252..986166)
                     /locus_tag="KLTH0H11506g"
                     /note="weakly similar to uniprot|Q06146 Saccharomyces
                     cerevisiae YLR257W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11506p"
                     /protein_id="XP_002556370.1"
                     /db_xref="GeneID:8294703"
                     /db_xref="UniProtKB/TrEMBL:C5E397"
                     /translation="MERSSTPSLVGVSVRSINDSNNPDFKGNRGPSVAEARSSPQLLE
                     KIHSSTQLNKLSSAYTTVDELNREGALLTDDNDVDLDKVVQGDTEGASGRRKVLLRRK
                     KNNSSSSKMPSSSSLSVSSMMSPSRSRSSLVTSTDPVHDHASEGEARAGAATADNEDR
                     IRNSYGEFIPNRSHRPHLAGGESYQSTQNDSTGEDADAERPGRSSKREDASRGYLRSL
                     SRSLSRDPQKKAHDQEQEDARMYSTNNYRISQLDLENAPHVIKEEIEEEQDQGALMDD
                     EGNEEYSEPLRESASKQLDNDKLQEGDH"
     gene            complement(986667..986737)
                     /locus_tag="KLTH0H11528r"
                     /db_xref="GeneID:8294704"
     tRNA            complement(986667..986737)
                     /locus_tag="KLTH0H11528r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=62.63"
                     /db_xref="GeneID:8294704"
     gene            <986923..>988524
                     /locus_tag="KLTH0H11550g"
                     /db_xref="GeneID:8294705"
     mRNA            <986923..>988524
                     /locus_tag="KLTH0H11550g"
                     /product="KLTH0H11550p"
                     /transcript_id="XM_002556325.1"
                     /db_xref="GeneID:8294705"
     CDS             986923..988524
                     /locus_tag="KLTH0H11550g"
                     /note="similar to uniprot|P53109 Saccharomyces cerevisiae
                     YGL160W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11550p"
                     /protein_id="XP_002556371.1"
                     /db_xref="GeneID:8294705"
                     /db_xref="GOA:C5E398"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /translation="MAMTLLPRHGKTHLANIPYGYYTATVSLIFIILLIGARKLIPVR
                     QRNRSKWAKWALSSARGGSPLLYLVVLFVALLVPFVHHYSLLGYVGLYLKRLGRLSYV
                     LATLNLFLTLRPNFLLPGYVYLDLIPLHKWLSRSLCLLALVHGVGFLVKWALDSQVSF
                     VAKAFYNIPNLAGLVVGALMAFMVLLSVRPVRRFSYRSFYLTHIIGAWVFVFLTAYHA
                     RPGVFVPYTLLNAGLFVFYILSKTVPARGVELVSKSTDDVNNCLTRIVLPRKAMPEHF
                     APGSHLRISPYRRVNPLYYMLPSHPYTVASMPEDKDVELIVREHASGFHLLTGLGYTI
                     QNHYESVPRQCLQSATRIALVCGGSGLSYALPIFRHFASEEKADQVKYLRLIWLVRDK
                     YDVNVLGNIRSLASSVAQFDIFVTRSVPPDDTVESGSKLSPAQQQSPITDDLEFELES
                     FGDQLDQNGALITPEIPNLPSGLASSFHFGRKLDWMTDLAQFVEREDLGSTWLVACGP
                     KGLNDAAKLYAQQNEINLASETYAL"
     gene            complement(<989095..>992808)
                     /locus_tag="KLTH0H11572g"
                     /db_xref="GeneID:8294706"
     mRNA            complement(<989095..>992808)
                     /locus_tag="KLTH0H11572g"
                     /product="KLTH0H11572p"
                     /transcript_id="XM_002556326.1"
                     /db_xref="GeneID:8294706"
     CDS             complement(989095..992808)
                     /locus_tag="KLTH0H11572g"
                     /note="similar to uniprot|P12351 Saccharomyces cerevisiae
                     YLR256W HAP1"
                     /codon_start=1
                     /product="KLTH0H11572p"
                     /protein_id="XP_002556372.1"
                     /db_xref="GeneID:8294706"
                     /db_xref="GOA:C5E399"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E399"
                     /translation="MGAQMKRKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHL
                     CHYMEQTWAEEAEKELSKESELKQLRERIKALEETLAKMHSASSNTPESASVALEEPR
                     VFQESKLIQEPKLLQSNKYDNDELDLSRQFDMLHLKNNGTVHLGATHWLAIMKGDPYL
                     KLLWAHIFTMREKMSEWVQHKKKGAGTSGGTHLAGRCPVIHQPAASRCPVSGATASNL
                     GHHTKETAKCPVDHQALLSHHREDRVPESRPDSGLSGVSAREPLDSAPRCPVAHNFSG
                     SPPGLNSRSGSEGAGSGLKCPVAHDTHGEIQPSNKVSASGPGTNGRPAPLLPSFDKLA
                     SKCPVIHDNSPPPPSGLGPNPSNVTQDQAITEICKLLPPKRIIALILDKFFKHIYPVI
                     PILDEQSFKHQISQIVQSKDETISLRLAKSSDCCTLGILIIILRLTWLSLPQNACEVD
                     LGPQCAAFFVPRITTSTVAQSREELLLLNFETPAETVHLVRKYLIRLDEMTSFSNSNV
                     NLTTVQFAIFYKLYLMCCPEKTTDTQLNAFTSTSQDNEAHQMLLSSIVQMAFSCGLHR
                     DPDNFPQLAASTKGKLNKEAISNTERLKHTWRKTWYIIVSLDVQQSISLGSPRLLRNL
                     RDFSDTKLPCTSKIDYVRDIKELIVVKNYTLFFQIDNCIVAVLNHILNVSMAKTVRKF
                     ELDSLIEILKKLCFGGGNVSEALGKLVNKGLLFTTEGSADQSYDEFYPLPSLEEVLSP
                     PPPSENEKDKKVNLPHEMTTRALFFSKHIMLRMLLYLLNYILFTYYEPKGEVDADTRP
                     LAKEYAQEALNYAMDGFRNCLLFFSNSKAGEGGNGSIFNHMEVVLAPYCLDIGHRALQ
                     FMVCLILRARCGPLTGMNESPILSSGNNTSGSEDENETRSSEVKKKEDNAEIADVTKD
                     ISLDVGDELAEILISRMTLFHKLTKQVSAKYHYAKRMMKSTGFFITLLRNPSSKSQLG
                     EKNSSGYKFQHPSIAKMTGFFKNVPSLVLSANGDQIKRCPVYQDAIGFLPRNNSVVSG
                     PRSKPETPVQLPPFRAYQPITYLSNDLRRTSDVRNADNKRRKLTPRGSVTGSPVEEPV
                     KQEGWRAMSPPAPNFGTPIMSPVPNSPAFRTDILPPLERLTETASPAAPNSRNNSILS
                     GPPHGLNSPAGMSENSSVNYTPDFEDFLMQNSNFNGLMINPSSIVEAVGFDNYAHNDS
                     SSVGAAADFLPIDTTEIDGLSEIPANPGFPVWD"
     gene            <994752..>995753
                     /locus_tag="KLTH0H11594g"
                     /db_xref="GeneID:8294707"
     mRNA            <994752..>995753
                     /locus_tag="KLTH0H11594g"
                     /product="KLTH0H11594p"
                     /transcript_id="XM_002556327.1"
                     /db_xref="GeneID:8294707"
     CDS             994752..995753
                     /locus_tag="KLTH0H11594g"
                     /note="similar to uniprot|P53110 Saccharomyces cerevisiae
                     YGL159W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11594p"
                     /protein_id="XP_002556373.1"
                     /db_xref="GeneID:8294707"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023401"
                     /db_xref="UniProtKB/TrEMBL:C5E3A0"
                     /translation="MCSAIIQDAQVQKHFLNVSHKALCRYIDQLQIALHRYSSRPEII
                     PPRLVDTTMNGNTTHLIMPVLDDVFSGLKWLGYNPQGGLGFVGAVTVTDPRSGGLIGV
                     VQAKQLTGVRTALASCIGIRNQLSAFKNKTSITVFGTGLQSFWHIFVCAKLLEGREIA
                     VNVIYRSSPMDTALLEDHLPSLKVAQFQLSDTEQVRDKVSQSNIIFGCVPSTEPSILK
                     KYLEASSGPEYTYISLIGSYKSHMHECDTALVEQFKDQGVQILVDSKEHTLIEAGELI
                     DANVAPTQLLEIGNLEPNKPLPKSTCKNGKLVTLCKIVGLAIMDVSMAKTLLADLSS"
     gene            <996041..>996616
                     /locus_tag="KLTH0H11616g"
                     /db_xref="GeneID:8294708"
     mRNA            <996041..>996616
                     /locus_tag="KLTH0H11616g"
                     /product="KLTH0H11616p"
                     /transcript_id="XM_002556328.1"
                     /db_xref="GeneID:8294708"
     CDS             996041..996616
                     /locus_tag="KLTH0H11616g"
                     /note="similar to uniprot|Q06568 Saccharomyces cerevisiae
                     YLR254C NDL1 homolog of nuclear distribution factor NudE
                     NUDEL"
                     /codon_start=1
                     /product="KLTH0H11616p"
                     /protein_id="XP_002556374.1"
                     /db_xref="GeneID:8294708"
                     /db_xref="UniProtKB/TrEMBL:C5E3A1"
                     /translation="MENKHLSLDDAFQIIEDLQKQIEELEAASHEYETELEGVVKKLE
                     SQLNEKDAFIASLQQAQMPTGGFKERLTVLEIQVDELESENYALRSRLKLLEAENDSV
                     IEQNVLLQHELADVRQGTKPSIETPKADSLINVSNPPNRTCSTHSSRSSNALKVSSNQ
                     NSLRVSPRNARADTSATHLSSTSVVSTTSYK"
     gene            complement(<996661..>998358)
                     /locus_tag="KLTH0H11638g"
                     /db_xref="GeneID:8294709"
     mRNA            complement(<996661..>998358)
                     /locus_tag="KLTH0H11638g"
                     /product="KLTH0H11638p"
                     /transcript_id="XM_002556329.1"
                     /db_xref="GeneID:8294709"
     CDS             complement(996661..998358)
                     /locus_tag="KLTH0H11638g"
                     /note="similar to uniprot|Q06567 Saccharomyces cerevisiae
                     YLR253W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11638p"
                     /protein_id="XP_002556375.1"
                     /db_xref="GeneID:8294709"
                     /db_xref="GOA:C5E3A2"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E3A2"
                     /translation="MVQPLLNLARIAPLKLGARGPFRSYSSSAKSFVRPKSPVITTKR
                     VLVVTAFAAAAYVYTDDTAKSAVRHLGVTSKRVGVVAQATMRCVYNYQRTLSANYSSE
                     QERSDALKKCHQLCAKVTLRALETNGGVFIKLGQHIAAMTYLLPPEWTETMVPLQDKC
                     PQSTHQEIEDLFKQDLKIDIQDMFSDFDPEPIGVASLAQVHVATLRSTGEKVAVKCQH
                     PSLKEFVPLDVLLTQTVFNVVDVLFPEYPLTWLADELQNSIYVELDFTKEAENARRTA
                     DYFSNYISETALRIPKVIVANKRILIMEYIGGHRLDDLAYLDENHISRAQVSSCLSHI
                     FNNMIFTPNVGIHCDPHGGNLAIRHLEKSRGHHNFEIILYDHGLYRHPTTEMRRDYAK
                     FWLALLDNDVANMKKYAMKFANINEDQFPLFAAAITGRSIDAAQSSDILKPRSDEEIR
                     VMADALMEGSLLGDLMTFLCKVPRVVLLILKTNDLTRHLDECLQSPLSVERTFLIMTQ
                     YCARTVYEEVRQNINEQYQKWSLTWIFKEITAWWEYERRKNQLVLYDLGFWFKNRFL"
     gene            complement(<998622..>999224)
                     /locus_tag="KLTH0H11660g"
                     /db_xref="GeneID:8294710"
     mRNA            complement(<998622..>999224)
                     /locus_tag="KLTH0H11660g"
                     /product="KLTH0H11660p"
                     /transcript_id="XM_002556330.1"
                     /db_xref="GeneID:8294710"
     CDS             complement(998622..999224)
                     /locus_tag="KLTH0H11660g"
                     /note="similar to uniprot|Q06563 Saccharomyces cerevisiae
                     YLR251W SYM1 Protein homologous to mammalian peroxisomal
                     membrane protein Mpv17 required for ethanol metabolismand
                     induced by heat shock localized to the inner mitochondrial
                     membrane"
                     /codon_start=1
                     /product="KLTH0H11660p"
                     /protein_id="XP_002556376.1"
                     /db_xref="GeneID:8294710"
                     /db_xref="GOA:C5E3A3"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:C5E3A3"
                     /translation="MSMLLNFYTSSLKKNPKTTNAIMTGSLFGIGDAIAQIGFPSSHS
                     KAQGYDIARTVRAVTYGSLIFSFIGDKWFKVLNNKVRFSNRPTNHWSNLPLRVGTDQL
                     LFAPLCIPFYFGILTLMEGKSLKHADTKVRAVWWDILKTNWMVWPLFQLINFSIIPVQ
                     HRLLAVNVLAIFWNTFLSFRNSEASHADHQFPVNNPPVPE"
     gene            <1000534..>1003563
                     /locus_tag="KLTH0H11682g"
                     /db_xref="GeneID:8294711"
     mRNA            <1000534..>1003563
                     /locus_tag="KLTH0H11682g"
                     /product="KLTH0H11682p"
                     /transcript_id="XM_002556331.1"
                     /db_xref="GeneID:8294711"
     CDS             1000534..1003563
                     /locus_tag="KLTH0H11682g"
                     /note="some similarities with uniprot|P36111 Saccharomyces
                     cerevisiae YKR015C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11682p"
                     /protein_id="XP_002556377.1"
                     /db_xref="GeneID:8294711"
                     /db_xref="UniProtKB/TrEMBL:C5E3A4"
                     /translation="MFVDYSSQNKFMSINYKFADKYLEMLHIEKLSSPENRLECLKVR
                     TEGLGIKIIQNLEINDFAGDFNWIVYLYGLVLSKEQMLECGETLLSCPTLYMVEFALQ
                     GCRIEDAFSEESTLSSQLKLAIKCAYYEFIGPCEKIIYSLKTHFLSLRPRYDLPFNKF
                     GYFQKVLYNEMFTDQAGNYKIHAGLLIMPSKFPSSYRILISEEGYPKSNIKVRFHKWS
                     GYRAKSNLNRLEMNDVKPSCIENKVISVWKQGHSSELFGHYSYMLRLGKLPSNEEPPS
                     ETTVVMKDIKARSAKRTEKLRQFEDFVTSGNSWSSQKGQGVSSTYKSADLSFEGCQNS
                     FNSKTDPSNEVLEFKARPSKRSRILPEGVMRSDSTACNTSIQGHIVSSRCGEQSPTSF
                     IKENCTPVPIEPPNTAGDTNAGPHEIMRKTSSGVYENNKINSSLSNKYSRPKGQQTCV
                     LAQCEKPLLPKKRLLVKSGTAGYREMTELEKDIYHLLEIRQTPKGVRGSAPLPSRSDK
                     ISAEKAKRFQQVRQELMENEEEFLFSSKKAGPPLSGDGVIDRHLKIAASTSRPQNAIN
                     PNLVKSLKPVSEIVAIIEKAEKVVAGQDLVQQLEGISQELKCSKSLESLSSSTLGKSF
                     DNYSTARCYSSPGVPVNERGKNKTIAPAEKAACPPGENPLPNASIVQNRVTVPLDKAL
                     SSNDFYKFMNSSETLDSEQSVIIRRHLFSSEHEVQGQVYPSPEGQKENNASLSGEFLI
                     EANSVSSSYDSSEIPEKCCVRSWQHITEAKNSIEAKKRPERSSCEAVFSYEPSDSSPE
                     RLKDLSAGEFSNFRNRNSALLTTSKDSGSYSASQPCSPTFSDAASLATSHTRPLDLKS
                     KCASECSNNALCAKNRYCSIESGYVATELPVFKINENDPDLLYRVYMADPQNCLGQPE
                     VIFRKPFEQRSNGLTQKLRKFMSSHSSSRKNTKSEPTYQEMYPALSNIRFRDFLRFKS
                     RKLREDVRYFSHVAKLCVTDFKERPITAERELYEQFK"
     STS             1002292..1002803
                     /locus_tag="KLTH0H11682g"
                     /standard_name="D1S3694"
                     /db_xref="UniSTS:474272"
     gene            complement(<1003625..>1007182)
                     /locus_tag="KLTH0H11704g"
                     /db_xref="GeneID:8294712"
     mRNA            complement(<1003625..>1007182)
                     /locus_tag="KLTH0H11704g"
                     /product="KLTH0H11704p"
                     /transcript_id="XM_002556332.1"
                     /db_xref="GeneID:8294712"
     CDS             complement(1003625..1007182)
                     /locus_tag="KLTH0H11704g"
                     /note="similar to uniprot|P12351 Saccharomyces cerevisiae
                     YLR256W HAP1"
                     /codon_start=1
                     /product="KLTH0H11704p"
                     /protein_id="XP_002556378.1"
                     /db_xref="GeneID:8294712"
                     /db_xref="GOA:C5E3A5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5E3A5"
                     /translation="MSGPKIRAGGSCLVCRRRKVKCDRTKPVCLACIKYKSDSACDYE
                     TKRNVRFLHMVYSEPTGNIDGENKVTKPQLQKPNTNVSNVGGSNCNMTFKKTKGVEAS
                     EQRLPTQLLAFGHMSFYDGYEAVEIKASRLLFTGALHSIAVLRRDPFLYVLVAMIRKD
                     RSKLHERISKAEPSSSRKYPVPLYTQEEIASQLIINARANHEHPCSNSVDDCRRYSRS
                     GRSQNDSKISESLKLEPQKPGFPSQGKLTSADISTDTKFQQKLIENEGLDEVKSVVEE
                     GNLPRNPLSVVNLLNEDSQAKSSLANSSTQNNDKNKDIEIWRKLQSMLATLQQRQHRL
                     MRQLEPSRKNDLNAITSASFLGAMPSPEMSVLAKVREILPPTKIIWLHLRNYFRSPLH
                     ALFPVLTEDWFCDTVKEFIKNHKDDMSKPEVVVTQRCDFGKIGCMLIIMRLSFLMYAD
                     KAEKNLPEEQRDVYAHSIGPEFISTAELCLSLFRLLRKAILPVLHCAVLLRIYRRYAP
                     DEGDIADSGGSEPFSGILTKMATSIGLHVDAEFSGQFAFSKMYSQAWRKCWYVIYFLD
                     LYEGMNSGNATTINEHSFSTRLPVVGTNEDGTLSSYITVPELEIASIECLRKNYDFSI
                     ACHKLLNLVMNRNFKVSCEKVQSAAGELELLLKKTYEKGLRKILKHPAKTIDESITKC
                     NDFKVFIETYSFLFMVYFHLFLHVDKLVIGDPDRCPPSTSFHYLQKLLEIYVELEPAL
                     VVLRASKDYHGNDSEFFDTLFGNNSKLVVIQSCGMFIVRFTTILQCLAARLLHLKYNF
                     LLRPSPYRLAGEEREVPGVSEAADELITLLLKKLSIINEVTQSLSETYFYAWRISKGN
                     SYIYDLLMAEDSILDHKSNISRSYRAACKDEPAFNSEKPMPFVNFYDVIPESNSLLHA
                     KVSDLKKLLFILQSDDGNLLSSLTHRSHSFVTENTPLSAFQSPLSKFEEPGQNALSLI
                     GMSSIKKATDASSDPNTFTSLASPTSFRVEGTSSGSNSLNSQKMEKSRSYVNSEDIDT
                     FWYKIKLRNANMSAERSFSQSSGPPNRPNASDEKSKIFSSSWHNNNHNPPSPTERLVR
                     NELHDTGHFNEIFNNQSLLQEHVMQQLQQLTEEQPIPQNPSRQGEYVESFTPHLAPNH
                     REDKRNIEGSFLNNNSLEAGDFDMFLPTFDAFIEDIDFT"
     gene            complement(<1007328..>1009139)
                     /locus_tag="KLTH0H11726g"
                     /db_xref="GeneID:8294713"
     mRNA            complement(<1007328..>1009139)
                     /locus_tag="KLTH0H11726g"
                     /product="KLTH0H11726p"
                     /transcript_id="XM_002556333.1"
                     /db_xref="GeneID:8294713"
     CDS             complement(1007328..1009139)
                     /locus_tag="KLTH0H11726g"
                     /note="weakly similar to uniprot|Q06247 Saccharomyces
                     cerevisiae YLR173W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11726p"
                     /protein_id="XP_002556379.1"
                     /db_xref="GeneID:8294713"
                     /db_xref="UniProtKB/TrEMBL:C5E3A6"
                     /translation="MESQDLEEQPLLRPEPHYEATSPPPQKKTKTRRRGWTKLIWGFI
                     IILLLHAGVVLWAARYIPSQQLIQDYYEDATNVKLRHLAFDGWYSDSNGSHIENEDSP
                     KYLKLRAQLDVWFDYDQVHKFENSSASVRKQRTIRFMSQSVVKSLCFDFDSIRAFNDN
                     ETDSQDLGTISIPTRTCIDVRHQKVNQLDVPILIRPDAKNVASVIMKIWKGEFKKLDL
                     WSSLNVRLSKKVLNKWDLPLWKLKIARLDWKQFLNLDSLSSKLDSIRAALSQAVEVQS
                     LEITDDVENDMNFRISVAYIVPEEIRSDMIFPQDSVFPPTSWNIQLPGCDPTRPVSLE
                     NALFRAPAIRLNDLAPGELANMDIVGNIQGPLPDDLLYQVCSSDEENVVTPVNLLLNK
                     IFNATELLQFEILGHGYTDSQGSILPPNFMDQLLPSIQQPINANLSLNSNNLVEYVTV
                     EGMRLRWIQSGWDERKLTIKGKVIAVINLPYYNSAFAGGEETVAIEKIKGLTKLFHND
                     VHFVNVPMDVWLNAESEFLPTEDPKHNQLSVSFDIAHQDVEIVNSFELTRCLNEILIR
                     GQAQVHVEGKLDLMADTKLGAIVVLGLEGEGTTIVKK"
     gene            <1009647..>1010546
                     /locus_tag="KLTH0H11748g"
                     /db_xref="GeneID:8294714"
     mRNA            <1009647..>1010546
                     /locus_tag="KLTH0H11748g"
                     /product="KLTH0H11748p"
                     /transcript_id="XM_002556334.1"
                     /db_xref="GeneID:8294714"
     CDS             1009647..1010546
                     /locus_tag="KLTH0H11748g"
                     /note="highly similar to uniprot|P32469 Saccharomyces
                     cerevisiae YLR172C DPH5 Methyltransferase required for
                     synthesis of diphthamide which is a modified histidine
                     residue of translation elongation factor 2 (Eft1p or
                     Eft2p) not essential for viability GFP-Dph5p fusion
                     protein localizes to the cytoplasm"
                     /codon_start=1
                     /product="KLTH0H11748p"
                     /protein_id="XP_002556380.1"
                     /db_xref="GeneID:8294714"
                     /db_xref="GOA:C5E3A7"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:C5E3A7"
                     /translation="MLYLIGLGLSYTTDITVRGLEAIKKCDRIYLEHYTSILMAASLE
                     ELEQFYGKPVTLADRELVESGCEEILRDADKQDVAFLVVGDPFGATTHTDLVLRAKRQ
                     GLPVEVIHNASVMNAVGSCGLQLYTFGQTVSMVFFTDDWRPDSWYNKIWENRKIGLHT
                     LVLLDIKVKEQSIENMARGRLIYEPPRYMSISQCCEQLLEIEETRGTKAYTPDTPVVA
                     ISRLGSASQEFKSGTIEELSRYDAGEPLHSLVILGRQCHELELEYLLDFASDREAFKQ
                     AVIKDQEYFKPAPWVPPAEEDDE"
     gene            <1010683..>1011153
                     /locus_tag="KLTH0H11770g"
                     /db_xref="GeneID:8294715"
     mRNA            <1010683..>1011153
                     /locus_tag="KLTH0H11770g"
                     /product="KLTH0H11770p"
                     /transcript_id="XM_002556335.1"
                     /db_xref="GeneID:8294715"
     CDS             1010683..1011153
                     /locus_tag="KLTH0H11770g"
                     /note="highly similar to uniprot|P35181 Saccharomyces
                     cerevisiae YLR170C APS1 Small subunit of the
                     clathrin-associated adaptor complex AP-1 which is involved
                     in protein sorting at the trans-Golgi network homolog of
                     the sigma subunit of the mammalian clathrin AP-1 complex"
                     /codon_start=1
                     /product="KLTH0H11770p"
                     /protein_id="XP_002556381.1"
                     /db_xref="GeneID:8294715"
                     /db_xref="GOA:C5E3A8"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:C5E3A8"
                     /translation="MTQIKYMLLVSRQGKVRLMRWYSAYDSKGKSKISRELATMVLAR
                     KAKMCNILEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVC
                     ELDIIFNFTKAYEILNEVLVCDGSMTETSKQAILRSVMTMDSLETSDSLDQVLS"
     gene            complement(<1011230..>1011598)
                     /locus_tag="KLTH0H11792g"
                     /db_xref="GeneID:8294716"
     mRNA            complement(<1011230..>1011598)
                     /locus_tag="KLTH0H11792g"
                     /product="KLTH0H11792p"
                     /transcript_id="XM_002556336.1"
                     /db_xref="GeneID:8294716"
     CDS             complement(1011230..1011598)
                     /locus_tag="KLTH0H11792g"
                     /note="some similarities with uniprot|Q04814 Saccharomyces
                     cerevisiae YMR252C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0H11792p"
                     /protein_id="XP_002556382.1"
                     /db_xref="GeneID:8294716"
                     /db_xref="UniProtKB/TrEMBL:C5E3A9"
                     /translation="MLNRVFANSSNSLLRALARSGSRFVHSSAPALLYKKWGDISLKD
                     KQAFINNYVGLYKEKHPCSKSNVMYQTLVGEMEEYDDAPYVFGILYNEIRSVSQNESA
                     DNAKGSGAMGDPDFEKLLYR"
     gene            1011877..1011948
                     /locus_tag="KLTH0H11814r"
                     /db_xref="GeneID:8294717"
     tRNA            1011877..1011948
                     /locus_tag="KLTH0H11814r"
                     /product="tRNA-His"
                     /note="tRNA-His (GTG) cove score=66.56"
                     /db_xref="GeneID:8294717"
     gene            1012387..1012500
                     /locus_tag="KLTH0H11836r"
                     /db_xref="GeneID:8294718"
     tRNA            join(1012387..1012424,1012457..1012500)
                     /locus_tag="KLTH0H11836r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8294718"
     gene            <1013677..>1015374
                     /locus_tag="KLTH0H11858g"
                     /db_xref="GeneID:8294719"
     mRNA            <1013677..>1015374
                     /locus_tag="KLTH0H11858g"
                     /product="KLTH0H11858p"
                     /transcript_id="XM_002556337.1"
                     /db_xref="GeneID:8294719"
     CDS             1013677..1015374
                     /locus_tag="KLTH0H11858g"
                     /note="some similarities with uniprot|P38623 Saccharomyces
                     cerevisiae YLR248W RCK2 Protein kinase involved in the
                     response to oxidative stress identified as suppressor of
                     S. pombe cell cycle checkpoint mutations"
                     /codon_start=1
                     /product="KLTH0H11858p"
                     /protein_id="XP_002556383.1"
                     /db_xref="GeneID:8294719"
                     /db_xref="GOA:C5E3B0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5E3B0"
                     /translation="MVPQALDESVTPVLGPLVQEKANAEVLETNLYNSDSTTNAASNA
                     ASNGGSSQSALNDRSDTRVPDIDAGDIRAYNDLHGLKGGIVGGSEVAGLVSETESEPG
                     LVEVISVGDDEASSSSSLDEDPEGDFVEQLELQDYKLISKIGEGAFSKVYRGVPRAES
                     SKSFLFKTFKHVAIKVINKKHLTSSQKDSKSKATSREQVLKEVAIHRTVSASENVVSF
                     VDFHESPSYYFIVQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHSLGIIH
                     RDIKPENLLFEPVDYEPSPKPVLRKSDDPKTKQDEGVFKPSVGGGGIGIVKLADFGLS
                     KQIYSTNTKTPCGTVGYTAPEVVKDERYSLQVDMWGIGCVLYTILCGFPPFYDEKIDV
                     LTEKISRGEYTFLRPWWDEISDGAKHAVRKLLEVDPSKRYNIDEFLADPWLNSYDCLR
                     GQALKKHKNESMENVHSLASKKKKRYAKHNFKRDSSLLYSPAAVAMRDAFEVNNALQR
                     KEEDRRRTPTPSNLGQLQEDEEMSLEQDMFQLRLNSSTIIKRRKNKDEVTVPATLAE"
     gene            <1016025..>1016711
                     /locus_tag="KLTH0H11880g"
                     /db_xref="GeneID:8294720"
     mRNA            <1016025..>1016711
                     /locus_tag="KLTH0H11880g"
                     /product="KLTH0H11880p"
                     /transcript_id="XM_002556338.1"
                     /db_xref="GeneID:8294720"
     CDS             1016025..1016711
                     /locus_tag="KLTH0H11880g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0H11880p"
                     /protein_id="XP_002556384.1"
                     /db_xref="GeneID:8294720"
                     /db_xref="UniProtKB/TrEMBL:C5E3B1"
                     /translation="MLSKESNPQQTSRTSTTTVIKILRDFSRRGIIFNTTRNVVDSAP
                     CHKVRATSNSTSTLVLVDQTCNDTGLLLLLSATKRLVQPTLDTSVAQAPVLIWHKHRK
                     DELRLIPDERTGSIVRATLMLYWFISGTCLCTVAYWPSTPPLQIRTSTCCPAASFSQE
                     NLLRTHPTARLACFIFPHATHDPAQGAVFRCRLSYPSSAFPQRVRTVSRKSTTTRTNR
                     SLWDLIVCHV"
     gene            <1017096..>1020230
                     /locus_tag="KLTH0H11902g"
                     /db_xref="GeneID:8294721"
     mRNA            <1017096..>1020230
                     /locus_tag="KLTH0H11902g"
                     /product="KLTH0H11902p"
                     /transcript_id="XM_002556339.1"
                     /db_xref="GeneID:8294721"
     CDS             1017096..1020230
                     /locus_tag="KLTH0H11902g"
                     /note="highly similar to uniprot|P53978 Saccharomyces
                     cerevisiae YNL014W HEF3 Translational elongation factor
                     EF-3 paralog of YEF3 and member of the ABC superfamily
                     stimulates EF-1 alpha-dependent binding of aminoacyl-tRNA
                     by the ribosome normally expressed in zinc deficient
                     cells"
                     /codon_start=1
                     /product="KLTH0H11902p"
                     /protein_id="XP_002556385.1"
                     /db_xref="GeneID:8294721"
                     /db_xref="GOA:C5E3B2"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_x