GenomeNet

Database: RefSeq
Entry: NC_013967
LinkDB: NC_013967
Original site: NC_013967 
LOCUS       NC_013967            2847757 bp    DNA     circular CON 07-APR-2017
DEFINITION  Haloferax volcanii DS2, complete sequence.
ACCESSION   NC_013967
VERSION     NC_013967.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604027
            Assembly: GCF_000025685.1
KEYWORDS    RefSeq.
SOURCE      Haloferax volcanii DS2
  ORGANISM  Haloferax volcanii DS2
            Archaea; Euryarchaeota; Halobacteria; Haloferacales;
            Haloferacaceae; Haloferax.
REFERENCE   1  (bases 1 to 2847757)
  AUTHORS   Hartman,A.L., Norais,C., Badger,J.H., Delmas,S., Haldenby,S.,
            Madupu,R., Robinson,J., Khouri,H., Ren,Q., Lowe,T.M.,
            Maupin-Furlow,J., Pohlschroder,M., Daniels,C., Pfeiffer,F.,
            Allers,T. and Eisen,J.A.
  TITLE     The complete genome sequence of Haloferax volcanii DS2, a model
            archaeon
  JOURNAL   PLoS ONE 5 (3), E9605 (2010)
   PUBMED   20333302
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2847757)
  AUTHORS   Pfeiffer,F.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2016) Computational Biology Group, Max-Planck
            Institute of Biochemistry, Am Klopferspitz 18, Martinsreid D-82152,
            Germany
  REMARK    Protein update by submitter
REFERENCE   3  (bases 1 to 2847757)
  AUTHORS   Madupu,R.M., Hartman,A.L., Norais,C., Badger,J.A., Delma,S.,
            Haldenby,S., Khouri,H., Ren,Q., Lowe,T., Robinson,J., Furlow,J.M.,
            Pohlschroder,M., Pfeiffer,T., Allers,T., Daniels,C. and Eisen,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2010) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001956.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 04/07/2017 01:12:54
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,023
            CDS (total)                       :: 3,964
            Genes (coding)                    :: 3,857
            CDS (coding)                      :: 3,857
            Genes (RNA)                       :: 59
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 51
            ncRNAs                            :: 2
            Pseudo Genes (total)              :: 107
            Pseudo Genes (ambiguous residues) :: 0 of 107
            Pseudo Genes (frameshifted)       :: 66 of 107
            Pseudo Genes (incomplete)         :: 39 of 107
            Pseudo Genes (internal stop)      :: 27 of 107
            Pseudo Genes (multiple problems)  :: 23 of 107
            CRISPR Arrays                     :: 3
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2847757
                     /organism="Haloferax volcanii DS2"
                     /mol_type="genomic DNA"
                     /strain="DS2"
                     /db_xref="taxon:309800"
                     /note="type strain of Haloferax volcanii"
     gene            258..1952
                     /locus_tag="HVO_RS04710"
                     /old_locus_tag="HVO_0001"
                     /db_xref="GeneID:8926884"
     CDS             258..1952
                     /locus_tag="HVO_RS04710"
                     /old_locus_tag="HVO_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_004044954.1"
                     /db_xref="GeneID:8926884"
                     /translation="MDEEENPRGGARGEAGNSTPDDGGADADADAGTDTDDTPSNDAS
                     GGDGSADSSAVEDDVSPEDIDIQASIGPDADAPDASDEDLDQHKDPDVGLDKVVLNDD
                     EGSKGLFDDLLAGEPIFENKEVLRPSYTPHELPHRTDQINQMATILVSALRGETPSNI
                     LIYGKTGTGKTASAKFVSQELESTSQKYDVPCEVEYINCEVTDTQYRVLAQLANKFIE
                     KNVERIEAEQERLDEMRTRATEDPNALEETPYDSIAEIDERAAELDDDADEMETVPMT
                     GWPTDRVYTTFFDAVDYKERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELDNSRISI
                     MGISNDLKFTDFLDPRVKSSLGEEEIVFPPYDANQLRDILQHRADVAFKPGALTDDVI
                     PLCAAFAAQEHGDARRALDLLRTAGELAERGQADTVEEAHVRQAQDKIELDRVVEVVR
                     TLPTQSKIVLFAIILLEKNGVRNINTGEVFNIYKRLCEEIDADVLTQRRVTDLISELD
                     MLGIVNAVVVSKGRYGRTKEISLSVPIDETEAVLLTDSRLGDIESAQPFVQARFDN"
     gene            complement(2000..2797)
                     /locus_tag="HVO_RS04715"
                     /old_locus_tag="HVO_0002"
                     /db_xref="GeneID:8926122"
     CDS             complement(2000..2797)
                     /locus_tag="HVO_RS04715"
                     /old_locus_tag="HVO_0002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S26 family signal peptidase"
                     /protein_id="WP_004044955.1"
                     /db_xref="GeneID:8926122"
                     /translation="MLTRLRTAEEGPLLFVRELLTSALAVLAVGLLLFALSGVWPPMV
                     AVESGSMEPHMHKGDLVFITGPERYAPDSAVEGTAVVTAETGAEVDYRKFGGPGSVIV
                     YDDPGSAGPPIIHRAMFWVDDGENWYDRANPEYMSADNCRELANCPAEYSGFITKGDN
                     NPRYDQVSGIADPVRPEWVQGVARIRIPLLGWVRLTLANSIATTTPVAPAPVEFVDVP
                     TMETAVPDASTANAPAGDAPGSDAAATTAPLRVEAGNTPMRTAALAA"
     gene            2942..4543
                     /locus_tag="HVO_RS04720"
                     /old_locus_tag="HVO_0003"
                     /db_xref="GeneID:8924320"
     CDS             2942..4543
                     /locus_tag="HVO_RS04720"
                     /old_locus_tag="HVO_0003"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed DNA polymerase II small subunit"
                     /protein_id="WP_004044956.1"
                     /db_xref="GeneID:8924320"
                     /translation="MPLETPARIVRTLVGRGYNAEREAVTLIAGSDDPGRTLARVVEA
                     APDDALRITADHVREVLASAPAADPSGTEPTPPAAADAANAADADPAASAASDPSVSA
                     ATSHDNAAHTDQSAPAEAQGTPGGRNVDPALRSLEIANDMTGQSTGTGEYDDFVKVFR
                     DRYEKLSKLLRGRVNHRPAKAISNMSGGEDAELIGLVDDVRSTKSGHWIIDLEDTTGT
                     FPCLVMKDKDIAGYVDELLMDECIAVQGTLSGDAGILFVDSMHFPDVPRSHRSNTADR
                     DVQAALISDVHVGSQEFMADAWNRFADWLHTEEAARIEYLLIAGDMVEGVGVYPNQDE
                     ELDVIDIYEQYEAFSEHLKSVPGDLEIVMIPGNHDAVRLAEPQPGFDDELRDIMSAHD
                     ARITSNPSMVTLEGVNVLMYHGVSLDEVIAELPADKASYDEPHKAMYQLLKKRHVAPQ
                     FGGHTRLAPEELDYLVMEDVPDIFHTGHVHKLGWGKYHNVLAVNSGCWQAQTDFQKSV
                     NIDPDAGYAPIVDLDTLNMTVRKFS"
     gene            4686..5813
                     /locus_tag="HVO_RS04725"
                     /old_locus_tag="HVO_0004"
                     /db_xref="GeneID:8924855"
     CDS             4686..5813
                     /locus_tag="HVO_RS04725"
                     /old_locus_tag="HVO_0004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004974059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="WP_004044957.1"
                     /db_xref="GeneID:8924855"
                     /translation="MTDDALFDATSLNDLSLSNRVGLAPMTRISATDEGLATNEMAHY
                     YRKFADGGFGFLVTEGVYTDDAYSQGYLNQPGLVTDDHVEAWTNVTDAVHEVDTPIFA
                     QLMHAGAQSQGNPHLDGDRTLAPSAVQPDGQKAEAYGGSGEFAVPKAADETDLETARE
                     GFVRAATNAVEAGFDGVELHGANGYLLNEFLAANANRRDDEYGGGPESRVKFPAEVLS
                     AVTDAVPEEFVVGIRVSQEKVTDGDYEWPEGEDAAAVFFEELSAAGADYVHTTETDAT
                     TPTFGADGPTLAEAAAEYVTDDTVVIANGGLGDPDAARAAVDAGADLFTLGTSALANP
                     DWPARVAAGDDLDAFDPAKYLAPTAGLSDHEVPSEPPLADD"
     gene            complement(5936..6745)
                     /locus_tag="HVO_RS04730"
                     /old_locus_tag="HVO_0005"
                     /db_xref="GeneID:8926047"
     CDS             complement(5936..6745)
                     /locus_tag="HVO_RS04730"
                     /old_locus_tag="HVO_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ZIP family metal transporter"
                     /protein_id="WP_013035623.1"
                     /db_xref="GeneID:8926047"
                     /translation="MTAVEELFVSLAGSNPVMQGLLGGIVIAGMNMLGALLILVWRDP
                     SKRSLDTLLGFAAGVMLAASFTSLILPGIEAAGGSPIPVLVGFVIGVVVLDQADLWIP
                     HVHILVTGKTRADAPETDKKMASVVLFIVAITIHNMPEGLAVGVGFGSGDLGTAVPLM
                     LAIGIQNIPEGLAVSIAAVNAGLRNTTYATFAGIRAGLVEIPLAVFGAWAIQYAAALL
                     PYAMGFAAGAMLFVISDEIVPETHSNGHERVATFGTMVGVVVMLYLDVTLG"
     gene            complement(6854..7282)
                     /locus_tag="HVO_RS04735"
                     /old_locus_tag="HVO_0006"
                     /db_xref="GeneID:8926481"
     CDS             complement(6854..7282)
                     /locus_tag="HVO_RS04735"
                     /old_locus_tag="HVO_0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044961.1"
                     /db_xref="GeneID:8926481"
                     /translation="MDVRDAVDTDAEALAAVADAPIRAMRRLIRDRTVRLATAETSSD
                     PHADAPADDEPVLGFVGFDVRDGVLHVTRLGGTEAAVRRLLEEPLRFASAEDLPVEVL
                     VLESEAPLCEAVEHVGFDRVGHGPRFEGSPTLRYVLDETG"
     gene            7470..8648
                     /locus_tag="HVO_RS04740"
                     /old_locus_tag="HVO_0008"
                     /db_xref="GeneID:8924402"
     CDS             7470..8648
                     /locus_tag="HVO_RS04740"
                     /old_locus_tag="HVO_0008"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase"
                     /protein_id="WP_004044963.1"
                     /db_xref="GeneID:8924402"
                     /translation="MRVVAKFGGTSLGSGDRINRAADSIAAAVEHGHEIAVVASAMGS
                     TTDDLLDEIKFEADDRDRAEIVSMGERTSVRMLKAALAARGVNALFVEPGTDEWPVIT
                     NDLGEVDVEATRERAAKLAAELDGVVPVITGFLAQNHDGEITTLGRGGSDTSAVMLGN
                     YMDADEVVIVTDVEGVMTGDPRVVEGARNVGRITVDELRNLSFRGAEVVAPSALSYKD
                     AALDVRVVHYQHGDLLTGGTLIEGEFHNLIDMQEEPLACLTVAGRAIRNRPGILADLS
                     AALREEDINVDSVASGMDSITFYVLEDDSDRAEAVLHDRVVADDALSSVTVEDDIAVV
                     RVTGGELPNRPGVILDIVEPLSEAGINIHDAITSATSVAIFVAWDDREETLGIIQDEF
                     "
     gene            8873..10219
                     /locus_tag="HVO_RS04745"
                     /old_locus_tag="HVO_0009"
                     /db_xref="GeneID:8925777"
     CDS             8873..10219
                     /locus_tag="HVO_RS04745"
                     /old_locus_tag="HVO_0009"
                     /EC_number="4.1.99.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanase"
                     /protein_id="WP_004044965.1"
                     /db_xref="GeneID:8925777"
                     /translation="MKSYKAKMVEPIELPSREEREAALERAGYNAFNLDARDVYIDLL
                     TDSGTGTMSAEQWAAMIRGDEAYAGSESFARLAESVRDVMGFEHVVPTHQGRGAENVL
                     YGVLLEDGDVVPNNSHFDTTRAHVVNQGAEPVDCPSPAARDPNSTETFKGNFDIDAGY
                     ALVEEVGADAIPVVALTITNNSVAGQPVSMANIRATAEFARDIDAMFVIDACRFAENA
                     HFIKTHEAGYENHSVAEIARAQFEHADAITMSGKKDALVNIGGFAAMRDETVFEHAKQ
                     RAILYEGFPTYGGLSGRDIEAMAVGLREAVTPPYVTDRVEQVAELGDLLVEAGVPVYQ
                     PTGGHAVYLDAGEVFPHIPKEEFPGQELVCALYLEGGVRGVELGGFAFPGTDRPDLVR
                     LALPRRTYSREHLEHVAETAAKVMASAGEYGGLEIVAEPPMKELRHFSSRLEPVSN"
     gene            complement(10248..10907)
                     /locus_tag="HVO_RS04750"
                     /old_locus_tag="HVO_0010"
                     /db_xref="GeneID:8926721"
     CDS             complement(10248..10907)
                     /locus_tag="HVO_RS04750"
                     /old_locus_tag="HVO_0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004974046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_004044967.1"
                     /db_xref="GeneID:8926721"
                     /translation="MRLGVISDVHGNLPALEAVLESMPSVDRLVCAGDVVGYNPWPEE
                     CVSELAERDVPTVSGNHDRAVTSGTGFRFNSMAAAGVDYARDALSPASMDWLSALPKN
                     RTLADGRVKLAHGHPNHPDRYTYPDDFSPSLLDDEDLLVLGHTHVQGYRIYDDGIVLN
                     PGSVGQPRDGDPRAAYAVVDLDAMEIEAERVNYDIDRVAERVRKAGLPERLASRLYEG
                     K"
     gene            complement(10956..11528)
                     /locus_tag="HVO_RS04755"
                     /old_locus_tag="HVO_0011"
                     /db_xref="GeneID:8926306"
     CDS             complement(10956..11528)
                     /locus_tag="HVO_RS04755"
                     /old_locus_tag="HVO_0011"
                     /EC_number="3.5.4.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP cyclohydrolase"
                     /protein_id="WP_004044970.1"
                     /db_xref="GeneID:8926306"
                     /translation="MYVGRFVVVSPGIGAYRVSSRSFPNRRVVDRDDALTVGPTPDAP
                     ETDNPYIAYNCVREGGDYVVVGNGSQVDPVAEKLDLGYPPRDALAEILLALDYEKDDY
                     DTPRIAGVVGDDEAYIGIVRKDALVVEAVTEPTLVATYEEDDPRAFDLDAETAADAAR
                     ELYDHEFEHAVCAAAATVGDAVETSFYNGE"
     gene            11661..11733
                     /locus_tag="HVO_RS04760"
                     /old_locus_tag="HVO_3066"
                     /db_xref="GeneID:9527253"
     tRNA            11661..11733
                     /locus_tag="HVO_RS04760"
                     /old_locus_tag="HVO_3066"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:11695..11697,aa:Gln,seq:ctg)
                     /db_xref="GeneID:9527253"
     gene            complement(11897..12391)
                     /locus_tag="HVO_RS04765"
                     /old_locus_tag="HVO_0013"
                     /db_xref="GeneID:8926575"
     CDS             complement(11897..12391)
                     /locus_tag="HVO_RS04765"
                     /old_locus_tag="HVO_0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="KEOPS complex component"
                     /protein_id="WP_004044972.1"
                     /db_xref="GeneID:8926575"
                     /translation="MRLLEAEATVSDLDSFIAAVGDVADETGATVQAFDARYVVDREH
                     LERAVELADRAIARGNEIARDRAVEILLYASGRRQINRAFEIGVSEGTLPVVVLVDGG
                     DEAAAEAALFDRLDFEPAETLGDYDESLVRDVFDVGETELHVVDGDLPALVRERVALL
                     AVDR"
     gene            complement(12388..14871)
                     /locus_tag="HVO_RS04770"
                     /old_locus_tag="HVO_0014"
                     /db_xref="GeneID:8924702"
     CDS             complement(12388..14871)
                     /locus_tag="HVO_RS04770"
                     /old_locus_tag="HVO_0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="WP_004044974.1"
                     /db_xref="GeneID:8924702"
                     /translation="MRTADLTGLPTGIPEALRDEGIEELYPPQAEAVEAGLTDGESLV
                     AAVPTASGKTLIAELAMLSSVARGGKALYIVPLRALASEKKAEFERWEEYGIDVGVST
                     GNYESDGEWLSSRDIIVATSEKVDSLVRNNAAWMDQLTCVVADEVHLVDDRHRGPTLE
                     VTLAKLRRLNTNLQVVALSATVGNAGVVSDWLDAELVKSDWRPIDLKMGVHYGNAVSF
                     ADGSQREVPVGRGERQTPALVADALEGDGEGDQGSSLVFVNSRRNAESAARRMADVTE
                     RYVTGDERSDLAELAAEIRDVSDTETSDDLANAVAKGAAFHHAGLAAEHRTLVEDAFR
                     DRLIKCICATPTLAAGVNTPSRRVVVRDWQRYDGDYGGMKPLDVLEVHQMMGRAGRPG
                     LDPYGEAVLLAKDADARDELFERYIWADAEDVRSKLAAEPALRTHLLATVASGFAHTR
                     EGLLEFLDQTLYATQTDDPERLGQVTDRVLDYLEVNGFVEFEGETIQATPVGHTVSRL
                     YLDPMSAAEIIDGLEWAADHRTEKLRALAGETPEKPTRDRSESDESGGFQRASEMVAD
                     DGDGGGGEDGVGANGDGDSDDADGVETDRTYPTPLGLYHLVCRTPDMYQLYLKSGDRE
                     TYTELCYEREPEFLGRVPSEYEDVAFEDWLSALKTAKLLEDWVGEVDEDRITERYGVG
                     PGDIRGKVETSEWLLGAAERLATELDLDSVYAVREAKKRVEYGVREELLDLAGVRGVG
                     RKRARRLFEAGVETRADLREADKPRVLAALRGRRKTAENILEAAGRKDPSMDAVDEDD
                     APDDAVPDDAGFETAKERADQQASLGDFE"
     gene            14980..15225
                     /locus_tag="HVO_RS04775"
                     /old_locus_tag="HVO_0015"
                     /db_xref="GeneID:8925676"
     CDS             14980..15225
                     /locus_tag="HVO_RS04775"
                     /old_locus_tag="HVO_0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_004044976.1"
                     /db_xref="GeneID:8925676"
                     /translation="MRVEYDRDTCIGMFQCVDEWEGFEKNVDDGKADLVDGEETDDGV
                     FVREVPEDAEFDAKFAARVCPVEAIRILDDDGEQLVP"
     gene            15479..16336
                     /locus_tag="HVO_RS04780"
                     /old_locus_tag="HVO_0016"
                     /db_xref="GeneID:8925927"
     CDS             15479..16336
                     /locus_tag="HVO_RS04780"
                     /old_locus_tag="HVO_0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044977.1"
                     /db_xref="GeneID:8925927"
                     /translation="MFETRSLPSDLESVRDDYAPGALVLDVAGDFDTIPPEAAENLGL
                     VVDSLSPAAYPAEWLPDDAPQQLRRYASSDFTIGMPGDGTVSWSRQTDPPVVLVKYRA
                     KGTPDDFLDFLIAEAFVQAGNDEIPEHFLPFFGEQYADLAAATPLGPSETYQVAAALY
                     EGWVGLHTREAFASWEGDHDRLHEAWVDAGGRLDNRLENLPRLVALGRLSFAEATEFA
                     CSAVKHGRDLPAPFSALDTAAYRDHGPSYAVKWAEKTFEQLAADDDGADAESSDDADP
                     TADDAADSA"
     gene            complement(16358..16936)
                     /locus_tag="HVO_RS04785"
                     /old_locus_tag="HVO_0017"
                     /db_xref="GeneID:8926229"
     CDS             complement(16358..16936)
                     /locus_tag="HVO_RS04785"
                     /old_locus_tag="HVO_0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044979.1"
                     /db_xref="GeneID:8926229"
                     /translation="MDYELAIEDAPATIPGGTGILLLHPSIGETDRIDTDFFKVDTDR
                     FLVISTRTTAREVEQKLEHYEVDESSATILDTLSIERGYSRRSSENIHYVAAPDDLDA
                     IVEKTRQFLERHDGKLRLSVDSVTEMAYYADEDRAFEATKQILELLDEFDAVGLFHLS
                     KEVHDQETLDRFRELFDGVVDLNEDGTVTTEF"
     gene            complement(17030..17488)
                     /locus_tag="HVO_RS04790"
                     /old_locus_tag="HVO_0018"
                     /db_xref="GeneID:8924285"
     CDS             complement(17030..17488)
                     /locus_tag="HVO_RS04790"
                     /old_locus_tag="HVO_0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2391 family protein"
                     /protein_id="WP_004044988.1"
                     /db_xref="GeneID:8924285"
                     /translation="MVGVRRRFALADTAQQVVGGFLLAGPFVVTEEVWVLARSMSFAQ
                     ALLTLIIVLAVGYGALYKADDRDPDREREVGGIPVRFISLISVSYLSVFILALAFDAP
                     GTFLSDVSGEVLVSVLGYELDLAVLRITLKATSVGAVFSVIGAATADSLF"
     gene            17615..18295
                     /locus_tag="HVO_RS04795"
                     /old_locus_tag="HVO_0019"
                     /db_xref="GeneID:8925299"
     CDS             17615..18295
                     /locus_tag="HVO_RS04795"
                     /old_locus_tag="HVO_0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004974023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_004044996.1"
                     /db_xref="GeneID:8925299"
                     /translation="MSVRDEFDAWAADGRDKGMEDRHWHTAKHALARMPVEEGDTVVD
                     LGTGSGYALRALRDTKGIGRGFGLDGSPEMVQNARAYTDTDDLSFLVGDFDDLPFDDD
                     SVDHVWSMEAFYYAADPHHTLEEIARILKPGGTFYCAVNYYEENVHSHEWQEHISIDM
                     TRWSHAEYREAFRDAGLHVAEQDSIADLDIDIPAATEFPTDDWETREAMVERYRTFGT
                     LLTVGVAP"
     gene            complement(18323..19408)
                     /locus_tag="HVO_RS04800"
                     /old_locus_tag="HVO_0020"
                     /db_xref="GeneID:8925747"
     CDS             complement(18323..19408)
                     /locus_tag="HVO_RS04800"
                     /old_locus_tag="HVO_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004045000.1"
                     /db_xref="GeneID:8925747"
                     /translation="MRLELDAVSKRYGSATALDSVSLSVDDGEFFTLVGPSGCGKTTT
                     LRCIAGFESPTEGTVRFDGESMVGVAPESRGVGVVFQNYALFPHLSVGENVAYGLRFT
                     DPPGGGSRDDRVAELLDLVDLAGFEDRDPDSLSGGQQQRVALARALAPGPDLLLLDEP
                     MSALDARLRDRLRRQVKRIQSDLGVTTVYVTHDQSEALAVSDRVAVLNGGRVEQVGDP
                     RDLYHRPRTRFVAEFLGENNVLDGVVESRPETGGIRVGVGDAVFTLAEGPRVLGEAGS
                     RAGAGDELTFCVRPEQLRAGAGTNKIRGTVVDTEFQGATTRVRLDWGGTELVVAVEDG
                     GEQSDAGFEVGATLEVGFAPASAHVVE"
     gene            complement(19512..21233)
                     /locus_tag="HVO_RS04805"
                     /old_locus_tag="HVO_0021"
                     /db_xref="GeneID:8926191"
     CDS             complement(19512..21233)
                     /locus_tag="HVO_RS04805"
                     /old_locus_tag="HVO_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_004045002.1"
                     /db_xref="GeneID:8926191"
                     /translation="MSRASASVRRVARALEQRLLTLVAALTAVVLLVLFYYPVATVFA
                     DAVLADGRLTVEPIAAVLTSEFYLVDIIWFTAKQAFYSTLASLALGLPAAWLFARFEF
                     RGRETLRSLTILPFVMPSIMVAIGFVATFGRNGTLNRALSLVGLPPVELLFTLEAIVV
                     AHAFYNAPLVARVVTAAWESVDARTVETARSLGANPRRAFRDVVLPQLLPSIGVGATL
                     TFIFTFASFPIVLALGGFQLATIEVFVYSRVRDLAYAEAASLAVVETAVSITLTAVYL
                     RYEASQRSAGGAANPLPRQSVLPADWTPKSTLRTVGIGGYALVVGLVFVVPVASMVLA
                     SVTGGDGGLTLANYAFLAERQATGASFQVKPLPAILNSLGFAAGTLVVAVPMGVTMAV
                     LTTRRYRGRGLIDVLSMAPFAVSGIVVGLGLLRGLVFGVDVLGTRIRVTGALAIVAAH
                     AVGAYPFVTRNVAPLFARLDGRLVESARSLGATRTRALVDIELPLVWTGVVAGAAFAV
                     AISIGEFDSTIILAEGAGSYTMPVAVERFLGRRLGPATAMGCLLLLVTSASFLVVDRF
                     GGRWGEL"
     gene            complement(21243..22379)
                     /locus_tag="HVO_RS04810"
                     /old_locus_tag="HVO_0022"
                     /db_xref="GeneID:8926687"
     CDS             complement(21243..22379)
                     /locus_tag="HVO_RS04810"
                     /old_locus_tag="HVO_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004045003.1"
                     /db_xref="GeneID:8926687"
                     /translation="MRRRSFLRAAGAGGVSALLAGCTGTGGEQTTTEASGDATETTAT
                     TEGTTAGGESRTLTVGTYGSFVDAPSSSPGPWLKETFESEFDATLEWQTPDSGVNYYI
                     ERGLRGVESGADLYVGLDAQMLVRIDRELDEALFSPAEGLSRIDDVKEGLNFDPQGRA
                     VPYDTGYISLVYDETYGDGDFVAPETFDGLLDSEYAGALLAQNPTSSATGQAFLLHTI
                     DAKGEDSYLDYWASLKENDVRVLGNWEDTYNAYSNGEAPMVVSYSTDQVFAAESGEDM
                     ARHQIRFLNDQAYANPEGMAPFADASNPDLAVEFMDFMLRPEVQAEIAVRNVQFPATT
                     TAELPEDFAQYAQEPPEAVTFSYDRLQNNLSDWTDAWAREFASK"
     gene            22510..23400
                     /locus_tag="HVO_RS04815"
                     /old_locus_tag="HVO_0023"
                     /db_xref="GeneID:8925629"
     CDS             22510..23400
                     /locus_tag="HVO_RS04815"
                     /old_locus_tag="HVO_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="WP_004045004.1"
                     /db_xref="GeneID:8925629"
                     /translation="MTASRPYVLGGVFALFALLAAVLLVDVLATVFFAITVAYLLVPL
                     RRRLEACGASRWVASLAATVVAAVGVGVVLAPLVVILFLRLSDILELAALLPDVVTIE
                     FLGMVETVTLDDVVAVGLGLLRSVGRTAATAAPVVLIKLTLFGFLVFALLLSGDAVGR
                     TLPALVPADYRGAATALNERARETLFAIYVLQAATAVGTFAIGLVVFWALGYDYVVTL
                     ATVAAVLQFIPIVGPSVLLAAMAAYHAAVGDVVAAALVVALLAESVDLLGAELRVDDV
                     GGDGDERDESADDSVDPSQP"
     gene            complement(23410..24186)
                     /locus_tag="HVO_RS04820"
                     /old_locus_tag="HVO_0024"
                     /db_xref="GeneID:8925009"
     CDS             complement(23410..24186)
                     /locus_tag="HVO_RS04820"
                     /old_locus_tag="HVO_0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_004045005.1"
                     /db_xref="GeneID:8925009"
                     /translation="MVDVVSPTWLADRLDDVRVVDVRDGWEFDGIGHLPGAVSIPFDE
                     FRSADGDVGMLPGRDAWTDLLSGAGVAADDDVVAYDDTHGVFAARFLVTALLYGHDPD
                     RLHLLDGDFSAWNRERETTTEASEVAGTVYEITEPAETPLVDFEAVEAALDDPETVIV
                     DTRDPAEYDEGHLPGAVNLDWRELVDDETRGLKPRDELDAILDAVGVTPDRRVVLYCN
                     TARRISHTYVVLSHLGYDDVAFYEGSLTEWEERDGAVVEG"
     gene            24438..25298
                     /locus_tag="HVO_RS04825"
                     /old_locus_tag="HVO_0025"
                     /db_xref="GeneID:8923901"
     CDS             24438..25298
                     /locus_tag="HVO_RS04825"
                     /old_locus_tag="HVO_0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_004045008.1"
                     /db_xref="GeneID:8923901"
                     /translation="MSNSDYAKDVLVSADWVESHLDEFQSDDPAYRLVEVDVDTEAYD
                     ESHAPGAIGFNWESQLQDQTTRDVLTKEDFEDLLGSHGISEDSTVVLYGDNSNWFAAY
                     TYWQFKYYGHENVHLMNGGRDYWVDNDYPTTDEIPSFPEQDYSAKGPFEDIRAYRDDV
                     EKAVDKGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGASNISWAATVNDDGTFK
                     SADELRDLYADQGIEGDESTIAYCRIGERSSIAWFALHELLGYENVTNYDGSWTEWGN
                     LVGAPVEKGN"
     gene            complement(25352..26794)
                     /locus_tag="HVO_RS04830"
                     /old_locus_tag="HVO_0026"
                     /db_xref="GeneID:8926249"
     CDS             complement(25352..26794)
                     /locus_tag="HVO_RS04830"
                     /old_locus_tag="HVO_0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain fatty acid transporter"
                     /protein_id="WP_004045012.1"
                     /db_xref="GeneID:8926249"
                     /translation="MTNAIRQAAERSSKLVEQYLPDAFLFAIILTGVAFVLALVSVAP
                     AEGVGMVGHAGNLLLDGWYGGFWNLLSFGMQMTLILMTGYALAQTKPVDWLLTRLAGV
                     PNTERGAAAMVPVVAAGASFVHWGLGLVVGALFARKIATEMRGIDFPIVVAGAYSGFV
                     VWHGGLAGSIPLLLNTEGNFLIEAGILDTTFGTGGTIFTVANLVLVVAVGFLFLPALF
                     ALMYPTDDAKKTPIDPAAFETATDGGEQATGGWASTAVPDDASLATRIEHSLGIGVAI
                     GVVGLLAVALYFWEGVQNGTMPWNNLNLNIVNFGFLFLGVLFHGTPKAYIEAVVEAVE
                     NVWGIILQFPFYAGIMGIMAYAPEGSVSLATQIAQGMVAVAPDGTLPAFAFFTAGLVN
                     FFVPSGGGEWAVIGETLVTAAKASGESIPRVAVAASWGDAWTNMIQPFWAIPLLSISG
                     LSVRDIMGYCVMVLLGAGVLVAVGISVLPM"
     gene            26974..27573
                     /locus_tag="HVO_RS04835"
                     /old_locus_tag="HVO_0027"
                     /db_xref="GeneID:8925279"
     CDS             26974..27573
                     /locus_tag="HVO_RS04835"
                     /old_locus_tag="HVO_0027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045014.1"
                     /db_xref="GeneID:8925279"
                     /translation="MSELLDTLRDDHETPLSRLGSSKALYAVTGGEMDGDAVRAAAAA
                     EAAAAADLFDWWADDEPNDEAAALFSDLADTAREHAETVGAESDGSKPNVYDVLAEFE
                     TTDGRLGGALARALVSLKTVEQMVGFFVGDADPMAANDFRTLKSDLNDQLDTLEAAVS
                     DLVDDDAVAREAADAVVEAAYDEYVETLEGMGVKPKNVC"
     gene            complement(27832..28101)
                     /locus_tag="HVO_RS04840"
                     /old_locus_tag="HVO_0028"
                     /db_xref="GeneID:8924587"
     CDS             complement(27832..28101)
                     /locus_tag="HVO_RS04840"
                     /old_locus_tag="HVO_0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045016.1"
                     /db_xref="GeneID:8924587"
                     /translation="MTRAELERASNLLKDAAEATEGDVQERLYEQSDQLATLATREQG
                     PDHGRLARHMTVLHDLAEDLDGDAAETVREARSEVLEYRKGVPGV"
     gene            28190..30286
                     /locus_tag="HVO_RS04845"
                     /old_locus_tag="HVO_0029"
                     /db_xref="GeneID:8926468"
     CDS             28190..30286
                     /locus_tag="HVO_RS04845"
                     /old_locus_tag="HVO_0029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit UvrB"
                     /protein_id="WP_004045019.1"
                     /db_xref="GeneID:8926468"
                     /translation="MSESGPLSADRPDADREFRVDAPFDPAGDQPEAIEALARGFREG
                     ADVQTLLGVTGSGKTNTVSWVVEEIQKPTLVLAHNKTLAAQLYEEFKGLFPDNAVEYF
                     VSYYDYYQPEAYIEQTDTYIDKDMSINEEIDRLRHSATRSLLTRDDVIVVASVSAIYG
                     LGDPKNYTDMSLRLEVGQGMDRDELLRALVDLNYERNDVDFRQGTFRVRGDTVEVFPM
                     YGRYAVRIEFWGDEIDRMLKLDPLEGEVKSSEPAVLVHPAEHYSIPEEQLEGAISEIE
                     ELMEQRVKHFQRQGDLVAAQRIEERTTFDIEMLRETGHCSGIENYSVHLSDREPGDAP
                     YTLLDYFPDDFLTVIDESHVTLPQIKGQYAGDKSRKDSLVENGFRLPTAYDNRPLTFE
                     EFEETVGQTLFASATPGDYEREHSDQIVEQIVRPTHLVDPKVEVTEATGQVDDLMARI
                     DERIDRDERVLVTTLTKRMAEDLTEYLEEAGVDVAYMHDETDTLERHELIRSLRLGDI
                     DVLVGINLLREGLDIPEVSLVAILDADQQGFLRSETTLVQTMGRAARNVNGEVVLYAD
                     EMTDAMEAAISETQRRRRIQQEFNEEHGYTPTTIEKEVGETNLPGSKTDTRGVSGDEP
                     ADADEAVEQIAFLEDRMQEAADNLEFELAADIRDRIQNLRREFDVDALEDGVAPEYPD
                     EHDGEADDGLTPPDEF"
     gene            30293..30712
                     /locus_tag="HVO_RS04850"
                     /old_locus_tag="HVO_0030"
                     /db_xref="GeneID:8925647"
     CDS             30293..30712
                     /locus_tag="HVO_RS04850"
                     /old_locus_tag="HVO_0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_004045021.1"
                     /db_xref="GeneID:8925647"
                     /translation="MSSPPTLTFAAGGLLRRDDGRLCLVHRPRYDDWSLPKGKLEPGE
                     TLVETAVREVREETRCEVDCGRFAGRYEYRVPDDAGTRSGPKGVFVWHMRVVDEHQFE
                     PDAEVDARQWVTPVEALQRLTYETERALVRRAFELNE"
     gene            30912..31106
                     /locus_tag="HVO_RS20090"
                     /old_locus_tag="HVO_0031"
                     /db_xref="GeneID:31787461"
     CDS             30912..31106
                     /locus_tag="HVO_RS20090"
                     /old_locus_tag="HVO_0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081442879.1"
                     /db_xref="GeneID:31787461"
                     /translation="MVRGFEHGVLDSSGDHRTPAHPACDAVASSGDGEHARVGAADDS
                     ANGLFSTCHSTRVQANATAY"
     gene            31121..32206
                     /locus_tag="HVO_RS04855"
                     /old_locus_tag="HVO_0032"
                     /db_xref="GeneID:8925008"
     CDS             31121..32206
                     /locus_tag="HVO_RS04855"
                     /old_locus_tag="HVO_0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite exporter TauE/SafE family protein"
                     /protein_id="WP_004045023.1"
                     /db_xref="GeneID:8925008"
                     /translation="MSSQSLSHVQKSFLKYQHILVFIAPLLFLASVFTMAPTPSGVGM
                     EYWLQYWWLFPVFLTGATIVNTVGISGSALFVPFLIFIFPIFAHPLDSSTLVKVGLIS
                     EAFGLSSSAVAFIQYGLVDRRLALTLVGGSIPFVVGGALLSFVIPDVVFHALLGIALL
                     AASYLLFNADLGHDEPGSSDTDHAAATDGGTVSASLPNDPGKLGPAGVNTADDGTVTR
                     VDRDGDDYTYTRGGYLRRFANYSVGGMFQGLAGFGIGELGIISMLGTKVPVRVAIGTN
                     HIVVALTAILASLVHVFGGGLVGGHSLSLATTPWNMVVFTVPATVLGGQIAPYVSNAL
                     ETSVIKNFVGVLFAVISLALFLMALGI"
     gene            32276..32716
                     /locus_tag="HVO_RS04860"
                     /old_locus_tag="HVO_0033"
                     /db_xref="GeneID:8924129"
     CDS             32276..32716
                     /locus_tag="HVO_RS04860"
                     /old_locus_tag="HVO_0033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_004045027.1"
                     /db_xref="GeneID:8924129"
                     /translation="MYDHILLPTDGSDATDATIEHAATFAETYGATVHVLSVADSRNR
                     FESPSAGIAPDVWEKSELDRAESAADAAIEALPEGVETERIVVEGVPHSTIVDYAADG
                     DIDLVVMATHGRTGLDHYLVGSVTERVVRQSDAPVLTVRAADEE"
     gene            complement(32744..33238)
                     /locus_tag="HVO_RS04865"
                     /old_locus_tag="HVO_0034"
                     /db_xref="GeneID:8924265"
     CDS             complement(32744..33238)
                     /locus_tag="HVO_RS04865"
                     /old_locus_tag="HVO_0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioesterase"
                     /protein_id="WP_004045032.1"
                     /db_xref="GeneID:8924265"
                     /translation="MQQQSSVETRSLSASRAEMSEILMPNDTNNLGRALGGRILEWMD
                     VCGAIAGRRFAERQVVTASMDHVDFLAPIDVGDVVTVEAYVFDTGRTSMDIKVDVTAE
                     RPSEGDRRETLTSFFTFVALDDDEKPVPVPDLVCDSQEERELRDAALQKRREHRAALA
                     EEFE"
     gene            complement(33689..34879)
                     /locus_tag="HVO_RS04870"
                     /old_locus_tag="HVO_0035"
                     /db_xref="GeneID:8926537"
     CDS             complement(33689..34879)
                     /locus_tag="HVO_RS04870"
                     /old_locus_tag="HVO_0035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SPFH/Band 7/PHB domain protein"
                     /protein_id="WP_004045034.1"
                     /db_xref="GeneID:8926537"
                     /translation="MDSLFYQLGKLSASSSSSSSSGAERVDSDPGRLPRWLAPLAVAV
                     VVFGLAVVVFPVTPLTLAGYVVLALAVAAVYDAVEIVQAYEKRTLTVFGDYKGILEPG
                     LNVVPPFVSKTYRFDMRTQTLDVPSQEAITEDNSPVTADAVVYIRVMDPERAFLQVDN
                     YRRAVSLLAQTTLRAALGDMELDDTLARRDHINARIRRELDEPTDEWGVRVESVEVRE
                     VKPSKDVENAMEQQTSAERRRRAMILEAQGERRSAVEKAEGDKQSNIIRAQGEKQSQI
                     LEAQGDAISTVLRARAAESMGERAIIDKGMETLANIGTSPSTTYVLPQELTSLLGRYG
                     KGLSGSDVQQAAGLESKAFDEETRELLGLDDIGEILGELDGVETADISADAVDIEIED
                     GGVE"
     gene            34980..35174
                     /locus_tag="HVO_RS04875"
                     /old_locus_tag="HVO_0036"
                     /db_xref="GeneID:8925623"
     CDS             34980..35174
                     /locus_tag="HVO_RS04875"
                     /old_locus_tag="HVO_0036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045037.1"
                     /db_xref="GeneID:8925623"
                     /translation="MRTNRGRIDVEDLLKIILLLVLVWLVLEIIGEVLGLFGALLGPL
                     QPLLGLVVAALIVLWLLDRI"
     gene            35225..35722
                     /locus_tag="HVO_RS04880"
                     /old_locus_tag="HVO_0037"
                     /db_xref="GeneID:8925161"
     CDS             35225..35722
                     /locus_tag="HVO_RS04880"
                     /old_locus_tag="HVO_0037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2'-5' RNA ligase family protein"
                     /protein_id="WP_004045040.1"
                     /db_xref="GeneID:8925161"
                     /translation="MYSLNVPVPGRVARLASDLFPYLAPFDRVRDRHTLVCKRFEDAD
                     LDRLREQLRRALAGQPAFEARVTDVRFFEEPPRGAAPVVYLAVDSPGLLDLHRTLTDD
                     FGAIEGIEGDDYVPHVTLARGGSVADARAVASQPLDPIEWTVSQLDIYDSSFRETTAS
                     ISLPA"
     gene            complement(35776..37152)
                     /locus_tag="HVO_RS04885"
                     /old_locus_tag="HVO_0038"
                     /db_xref="GeneID:8923918"
     CDS             complement(35776..37152)
                     /locus_tag="HVO_RS04885"
                     /old_locus_tag="HVO_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome P450"
                     /protein_id="WP_004045041.1"
                     /db_xref="GeneID:8923918"
                     /translation="MSATPPGPKGLPLFGASRQYARDPFTFLTAVADAYGDVVHFDLG
                     PLDTYMLTNPADVETVLVSEASKFRKPQFQDRAIGDLLGDGLLMSEGATWKRQRQLAQ
                     PAFDVRRISTMAGMMTDRTESMLSSWGDGDVVDVQLEMARLTVEIIVDAMFGTDLDDE
                     RIRRVQENLEPLGARFEPDPLRFLTPDWAPTRENREYKQALSELESLVWDIVEERRGT
                     EYGETPASSVPADATGEERPMDLLSILLRAYDEGEQTEENLRDELMTMLLAGHDTTAL
                     TLTYAWYLLSQHPEAEAKLHRELDEVLGGRTPTFEDVRQLEYTERVLNEAMRLYPPVY
                     VMFREPKVDVRLGGYRVPAGSAIMLPQWVVHRSERWWDDPLEFDPDRWAPERAGDRPR
                     FAYFPFGGGPRHCIGKHLSLLEGRLILGTVAQRYELDYVRDEPFSLRGSLTMHPEEPM
                     GMRLRARD"
     gene            complement(37234..39438)
                     /locus_tag="HVO_RS04890"
                     /old_locus_tag="HVO_0039"
                     /db_xref="GeneID:8926421"
     CDS             complement(37234..39438)
                     /locus_tag="HVO_RS04890"
                     /old_locus_tag="HVO_0039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008090993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="WP_004045042.1"
                     /db_xref="GeneID:8926421"
                     /translation="MAHANGAPDDGDADGAWRFFPYDEPYPNQEAAMSGIADALDDER
                     NVLLEGATGTGKTISALVPALSYAREHDKTVVITTNVHQQMRQFVEDARAITREEAIR
                     AVVFRGKSSMCHIDVGFQECQTLRDTTRSIVEKESDKAELSEQTQSLLDGIREGESGA
                     ADARSAVTDELDAIDDELAELKEGNYCEHYYNNLTRNTDEFFQWLFDDVRTPDEIFEY
                     AGKQNLCGYELLKEGMEGIDLVVCNYHHLLDPMIREQFFRWLDRDPDDVITVFDEAHN
                     IEGAARDHASRALTENTLESAMTELEDEDDSRAESARNVIGTFLDALRDSYESAFGFG
                     EREQVGENWYDLSIASQGRRDDLTMEFLQSYEGRGIDVEVELALQLGKQLDEQYEDAY
                     KNGEATTRKECQTLQAANFIADWTELGDELGRHPVLSVRRDGGTDEIYGRAELYTCIP
                     REVTKELFEEVHASILMSATLRPFDVTESTLGLDDPVTMAYGLEYPEENRRTFSVSLP
                     ALFSSERDDPGTQETVEEVLADAAGFTPGNTLAFFPSYAEAERYHERLRANPNVDAEL
                     FLDEPGVRAEEMRREFVAEDGAVLLTSLWGTLAEGVSFDGDDARTVVVVGVPYPHLSE
                     RLEAVQDAYDRVYRRKKDAGWRYAVEIPTIRKTRQALGRVIRAPDDFGVRVLADKRYT
                     RESTSMGKYGVRGSFPVEERSEMVDIAPNKLKFAMLNFYTDHDAYDGDPPRP"
     gene            39586..40056
                     /locus_tag="HVO_RS04895"
                     /old_locus_tag="HVO_0040"
                     /db_xref="GeneID:8926727"
     CDS             39586..40056
                     /locus_tag="HVO_RS04895"
                     /old_locus_tag="HVO_0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045043.1"
                     /db_xref="GeneID:8926727"
                     /translation="MASETATTRLESTTATSWRTGVAAGSLAAVVMGAMMVVQMRPVL
                     EVAIPSMYGLTGGAAGFTIHVAHGAILGVAFAGLVSALDFDLDGSLRSLGAGVGYGVV
                     LWVVLAVLVMPVWLGAVGSPANPPLPNVNVTSLVGHVVYGAVLGASYPALDGVF"
     gene            complement(40093..40992)
                     /locus_tag="HVO_RS04900"
                     /old_locus_tag="HVO_0041"
                     /db_xref="GeneID:8924817"
     CDS             complement(40093..40992)
                     /locus_tag="HVO_RS04900"
                     /old_locus_tag="HVO_0041"
                     /EC_number="2.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_004045044.1"
                     /db_xref="GeneID:8924817"
                     /translation="MLETTHFTDIDDISASELDRVLTRAADIKSGDDETQLTRATLAM
                     LFEKPSTRTRVSFETGMTELGGHALFLGPEDIQLGHGEPLSDTARVLGRYGDAIMVRL
                     FDHEDLLEIAEHSDAPVINGLTDDAHPCQTLADLLTIREHVGDFDEVQAAWVGDGNNV
                     GQSFVLGCAMAGIDLTVATPPAYGVDDDVLEKAAELGSTPTITTDPEEAVADADVVYT
                     DVWISMGQEDQRHEKLQAFEGFQLNEDLLSSTDAKVMHCLPAHRGEEITGDVLEDERS
                     LVWDQAENRLHAQKGLIVELLEE"
     gene            complement(41076..42221)
                     /locus_tag="HVO_RS04905"
                     /old_locus_tag="HVO_0042"
                     /db_xref="GeneID:8925359"
     CDS             complement(41076..42221)
                     /locus_tag="HVO_RS04905"
                     /old_locus_tag="HVO_0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322493.1"
                     /note="catalyzes N(2)-acetyl-L-lysine + H(2)O = acetate +
                     L-lysine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="[LysW]-lysine hydrolase"
                     /protein_id="WP_004045045.1"
                     /db_xref="GeneID:8925359"
                     /translation="MNAEIDREGHDESETEAESAAETAADTEVDADADTDALDEGEWV
                     DARHLLYDMVSTPSVSGDEEAAAEVLKAFFEAHDREVWIDEVGNVRAPADDAVLLTSH
                     VDTVPGDVPVKVEDGVLWGRGSVDATGPLCTMAAAAVETGVSFVGVVGEETSSRGAWH
                     LVEDREEPDAVVNGEPSGWDGVTLGYRGFLSGTYISTSELGHSSRPEENAIQSAVAWW
                     SRVADFFDEDRDGVFDTVTTKPVTFDGGPTEDGLAVEATVDVQFRVPPRLSIDDVREV
                     AESELTRGGVHWNKPIPPVMMSPRTDVARAFRVAIRNVGGVKPRLLRKTGTSDMNIFA
                     GTWDCPMATYGPGDSDLDHAPNEHLDLAEFDSAIDVLVDVCERLADD"
     gene            complement(42218..43354)
                     /locus_tag="HVO_RS04910"
                     /old_locus_tag="HVO_0043"
                     /db_xref="GeneID:8924546"
     CDS             complement(42218..43354)
                     /locus_tag="HVO_RS04910"
                     /old_locus_tag="HVO_0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine/succinylornithine family
                     transaminase"
                     /protein_id="WP_004045048.1"
                     /db_xref="GeneID:8924546"
                     /translation="MSGFVFNEKPIAIESGEGSYLYSDDGTEYLDFGASYAVAALGHS
                     HPAVTSAIQEQAAKLTYVQASYPVEVRTELYEKLATLAPGDISNVWLCNSGTEANEAA
                     MKFARSATGRQKIVATKRAFHGRTLGSLALTWKQKYKKPYEPVAGGVEFVSYGDEAEL
                     AEAVDDETAAVFLEPIQGEGGINPAAAEYLQTARDLTDDAGAALVFDEIQTGIGRTGA
                     LWACENAGVVPDILTSAKGIANGLPLGATLCADWIADGAASHGSTFSGGPVVCAAANA
                     TLDTIVEEDLPGHAAAVGDYLTTELEAAVEEHDLPVREVRGDGLMVGVEVKRGANRTL
                     KHLALSEQLLALPAGRTVVRFLPPLVIEEEHADRAVDAMTNVLS"
     gene            complement(43351..44334)
                     /locus_tag="HVO_RS04915"
                     /old_locus_tag="HVO_0044"
                     /db_xref="GeneID:8926164"
     CDS             complement(43351..44334)
                     /locus_tag="HVO_RS04915"
                     /old_locus_tag="HVO_0044"
                     /EC_number="2.7.2.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylglutamate/acetylaminoadipate kinase"
                     /protein_id="WP_004045050.1"
                     /db_xref="GeneID:8926164"
                     /translation="MTGYTREELLAAHEQLVDNEDNLIADGGIGIGDSGTSSALRADG
                     GKEPPVVVKIGGAKAVDPKGAVSDVAHLVANGTDVVVVHGGSTAVDETLEELGEEPTY
                     VESPSGVSGRFTDERAMEVFSMVMPGKLNTDLTALFREAGVDALGLSGVDGGLLTGPR
                     KSAVRVVEDGKKKIKRGDHSGKITSVNATLLETLLDGGYTPIVTVPMLADDGVPVNAD
                     ADRAAAAVAGALGAKLVVLTDVKGVYADPDDESTLIETADTPEEFSALESAAEGFMTK
                     KVMAAKEALDGGAAEVVVADANLNDPIVTALNGGGTHVTPGALVEAEGAEQ"
     gene            complement(44389..45432)
                     /locus_tag="HVO_RS04920"
                     /old_locus_tag="HVO_0045"
                     /db_xref="GeneID:8925746"
     CDS             complement(44389..45432)
                     /locus_tag="HVO_RS04920"
                     /old_locus_tag="HVO_0045"
                     /EC_number="1.2.1.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_004045051.1"
                     /db_xref="GeneID:8925746"
                     /translation="MSDQLTAGVVGGSGFTGGELLRLLDGHPNFEVEQATSRSYERKT
                     VGHVHPNLRHLDLRFTSPEDLESVDVLFTATPHGVSMEHIDAFQDAADTVVDLSADFR
                     LSEAAQYDEWYDGHVCPEYLEKSEYALPELNRENLPGADLIAAGGCNATATILGLKPL
                     FDAGILAGDEQVVVDVKVGSSEGGAGASKASSHAERSGIVRPYAPTGHRHEAEIEEYL
                     GLSVSFTVHAVDMVRGAAATCHVFPDGPVSKGDMWKAFRGSYGDEPFVRTVAGGGGVY
                     RYPEPKSVAGTNYGEVGFEVDPGNRRLVVFSAIDNMMKGSAGQAVHAANIALGLDETA
                     GLDFTGFHPVGSP"
     gene            complement(45429..46304)
                     /locus_tag="HVO_RS04925"
                     /old_locus_tag="HVO_0046"
                     /db_xref="GeneID:8926050"
     CDS             complement(45429..46304)
                     /locus_tag="HVO_RS04925"
                     /old_locus_tag="HVO_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysX"
                     /protein_id="WP_004045055.1"
                     /db_xref="GeneID:8926050"
                     /translation="MHVGLLYSRIRRDEKLLLNELRDRGHEVTKIDVRKEQFDLTEPP
                     ESFDGLDVVVDRCLATSRSIYITRFLKSYGIPVVNSHETADICADKAKNSLALADAGV
                     PTPNTKVAFTVDSAMDIVEEFGYPCVLKPVVGSWGRLMAKIDSESAAEAILEHKSTLG
                     NYEHKVFYIQEFVEKPGRDIRVLATDGEPVAAMVRSSDHWLTNAAKGASVDEFELDDR
                     AKELVKQASDAVGGGLLGVDLMETGDDYTVHEVNHTVEFKALNDAVEADVPATVVDWL
                     EAKADGAQSLAEVSA"
     gene            complement(46306..46485)
                     /locus_tag="HVO_RS04930"
                     /old_locus_tag="HVO_0047"
                     /db_xref="GeneID:8924052"
     CDS             complement(46306..46485)
                     /locus_tag="HVO_RS04930"
                     /old_locus_tag="HVO_0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine biosynthesis protein LysW"
                     /protein_id="WP_004045057.1"
                     /db_xref="GeneID:8924052"
                     /translation="MSDTITAEDPLSGEEIELPADVEVGEIIDSPATGAELEVVSLDP
                     VTLEEAPELEEDWGE"
     gene            46537..46815
                     /locus_tag="HVO_RS20095"
                     /db_xref="GeneID:31787462"
     CDS             46537..46815
                     /locus_tag="HVO_RS20095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081442880.1"
                     /db_xref="GeneID:31787462"
                     /translation="MKINAKKSLTGVICRIGRRYGSTERRVELGCHAHSTPETGPVVG
                     PVDPSPASVVVVVAAVPVGVVGAPPVVAARPLGVVGAGPRASRVRTQT"
     gene            complement(46806..48272)
                     /locus_tag="HVO_RS04935"
                     /old_locus_tag="HVO_0048"
                     /db_xref="GeneID:8924273"
     CDS             complement(46806..48272)
                     /locus_tag="HVO_RS04935"
                     /old_locus_tag="HVO_0048"
                     /EC_number="4.3.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_004045061.1"
                     /db_xref="GeneID:8924273"
                     /translation="MAGEDGDSEGVIRRNRFSGGPARGFMSSLAADERIFEADLAVDR
                     AHVVMLASQDIIESEVASEILAALDEVEAAGHDALSGGEDVHEAIEAAVIDIVGPDGG
                     KMHTARSRNDEVATCIRYRLREDVLSALDAALALRESLLETAAAHTETVMPGYTHLQP
                     AQPTTVAHFLLSYERAVARDCARLMCAYERINQSPLGSAAFAGTPFDVNRELAADLLG
                     FDRVMENSMDASATRDFLAETLSALTTHAVTLSGLAADLVIFSNKGLVELSDDYSSTS
                     SIMPQKKNPDTMELVRAVAGDAVGELTGLLTTLKGLPRAYNRDLQRAHKHAFRTVDDV
                     GEAAAVAAGAVASATWPEDELAAAAGDGFSTATGVADLLAMAGLPFRTAHEVVAEAAA
                     RSEGTPDVATLDAVATDVLGESLFTHVTAEAVEAALDPTESVASRDSVGGPAPAAVEA
                     TLSTARDELSDDAAAVADARDSLAAAAEGLDEEVSSYV"
     gene            complement(48274..49491)
                     /locus_tag="HVO_RS04940"
                     /old_locus_tag="HVO_0049"
                     /db_xref="GeneID:8926830"
     CDS             complement(48274..49491)
                     /locus_tag="HVO_RS04940"
                     /old_locus_tag="HVO_0049"
                     /EC_number="6.3.4.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="WP_004045062.1"
                     /db_xref="GeneID:8926830"
                     /translation="MKKVALAFSGGLDTTVCVPILEEEYGYDEVVGVTVDVGQPEEEF
                     EEAYETAEALGLEHYVVDAKQEFAQLCLDSVCANADYQGYPLGTALARPVIAKAILEL
                     AEEQDCDGIAHGCTGKGNDQLRFEAVWRASDLEVIAPVREMGMTREWEIEYAAEKDLP
                     VQGGNEGVWSIDTNLWSRSIEGGNLEDPGYVPPEDIYEWTDQPSDETELIEIAFEDGY
                     PVAVDDEEFEPLELISFLNEKAGKHGVGRTDMMEDRMLGLKVRENYEHPAATTLLNAH
                     EALEGLVLTKEERDFKATVDNEWSQKAYEGLIDAPLVGALNAFLEKTQERVTGTVTIK
                     FEGGQARPVGRESEYAAYSESAASFNTETVDGIEQADATGVAKYHGFQARLANQSAKK
                     RKPELAADGGSDE"
     gene            complement(49976..51190)
                     /locus_tag="HVO_RS04945"
                     /old_locus_tag="HVO_0051"
                     /db_xref="GeneID:8925170"
     CDS             complement(49976..51190)
                     /locus_tag="HVO_RS04945"
                     /old_locus_tag="HVO_0051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_004045066.1"
                     /db_xref="GeneID:8925170"
                     /translation="MAAALLEFGYLFAVLAVVGAVALRLGLSVIPLYVVGGVVAGPYV
                     AGRFGLPYVPNGEVVTVLAELGIVLLLFFLGLEFSLDRLRSSGAKIGRAGVIDLAVNL
                     PIGVAIGLVLGWSPVEALLLGGIVYISSSAIVTKTLIDLGWIADPESEPILGTLVFED
                     LAIAVYLAVVTSLVLGGDGGVAAIGRSLAIAFGFLGLLFVAVQYGTALFARVLDVENQ
                     EAFVLRALAVVVPISGAALALGVSEAVAAFFVGMGFSTSGHRERLEHLLVSVRDVFAA
                     VFFFWIGLGTDPTLLAAAAVPLAIAVVLSTPSKVLSGYLGGRAYDLSAHRSLRVGVGM
                     VPRGEFSLVIAALAAAGTTPVMRDIIPAFAVGYVFVMSALGTVLMQRSDLVERLVFRG
                     GAADGDASTESA"
     gene            complement(51190..51675)
                     /locus_tag="HVO_RS04950"
                     /old_locus_tag="HVO_0052"
                     /db_xref="GeneID:8925195"
     CDS             complement(51190..51675)
                     /locus_tag="HVO_RS04950"
                     /old_locus_tag="HVO_0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_004045067.1"
                     /db_xref="GeneID:8925195"
                     /translation="MTVYERDLPGVGKKHEVDLGDGSRLVIVTHNSGKREVFRRASAD
                     GDSEKLFELTDKLARQVGTLLEGAYFQPVQTETIETLLGDNTLIEWVEVGANSDIAGK
                     TLGESDLRQATGASVIAIERGDEVVTSPGGDAMVEAGDTLVVIGPKTACRDFVALVKG
                     A"
     gene            complement(51719..52321)
                     /locus_tag="HVO_RS04955"
                     /old_locus_tag="HVO_0053"
                     /db_xref="GeneID:8924302"
     CDS             complement(51719..52321)
                     /locus_tag="HVO_RS04955"
                     /old_locus_tag="HVO_0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045069.1"
                     /db_xref="GeneID:8924302"
                     /translation="MGRPSTAEVKRRLVHASGSGMPLLYLLGLVEWRTLGYLFVFLAA
                     VVSVLELLRLFGGLEWAVYDELTREYEQDNVAGYALYVYSQTAVALVFGPHIAVPGML
                     MLTIGDPISGLMGSAPVGELKSARTLAAMFAVCFALAAPFVIPVSGGVAGGLAAAAGA
                     AGATLADGAKPVVAGYVIDDNLSIPPVACTAIAATLWLLT"
     gene            complement(52328..54112)
                     /locus_tag="HVO_RS04960"
                     /old_locus_tag="HVO_0054"
                     /db_xref="GeneID:8923896"
     CDS             complement(52328..54112)
                     /locus_tag="HVO_RS04960"
                     /old_locus_tag="HVO_0054"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase"
                     /protein_id="WP_004045074.1"
                     /db_xref="GeneID:8923896"
                     /translation="MSEGDESAALTELAKRRGFFFGSSEAYGGVGGFYTYGPQGAALK
                     SNVEEAWRERFAVQEGNLEIEAPTIMPEPVFEASGHLDGFDDMLVECAECGESHRADH
                     LIEDNSELEDAETLSPEAAAEKIADLGLVCPTCGADLAGQSVEDFNLMFETNIGPGSS
                     TPGYLRPETAQGIFVEFPRIKEYARNSLPFGVTQVGRAYRNEISPRKSIVRTREFTQA
                     ELEHFIDPERDEADLSAVEDVEVLLYPATEQEADDGDYVETTIGEAVDDGIIGNAWLG
                     YFLGIAQEWYETVGVDMDRFRFRQHLAGERAHYSSDCWDAESEVDGDWIEIAGFSYRS
                     DYDLSKHGEYGDDDFTVFQQYDEPKTVERAVVDPDMATLGPEFGAQAADVAEALETLA
                     ERDPDAFDADEVTLDVDGEEITVDTDVANFAVETQTEAGEHITPHVVEPSFGIDRTVY
                     TLLAHAYETDEVDGEARSYLSLSPSVAPTNVGVFPLVSNVDGLVDLADDVAEELRAAG
                     FAVVYDDSGSIGRRYRRQDEVGTPFCITIDRDGLEGDGADTVTIRERDSGKQVRLPVD
                     DLVGTLVGLRAGTASFDDVLDDNEVVEA"
     gene            complement(54105..54959)
                     /locus_tag="HVO_RS04965"
                     /old_locus_tag="HVO_0055"
                     /db_xref="GeneID:8926378"
     CDS             complement(54105..54959)
                     /locus_tag="HVO_RS04965"
                     /old_locus_tag="HVO_0055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="WP_004045076.1"
                     /db_xref="GeneID:8926378"
                     /translation="MKVADAMTRGEEVVTVSLPGTRDDVLEYLQERGFSSVPVVKETD
                     EGTKYRGLISREDLIEHPDEDQLAVLVREVPTASADDDLEAVAATMVSEGARRIPVVD
                     GDAIEGILTVTDVVRAIARGDIDGETEVGDVAARDVNTTYVDVPLHIVEREIFYANVP
                     YAVVLDDEASLAGIVTEVDIIEVARVVEGEAGTGDSVANQDDEWMWEGIKAVGNRYIP
                     TRNVEIPAEPVSKFMTDDLVSVATRATAKDAAQTMIREDIEQIPLVSGDELIGVVRDI
                     NLLEALYE"
     gene            complement(55092..55670)
                     /locus_tag="HVO_RS04970"
                     /old_locus_tag="HVO_0056"
                     /db_xref="GeneID:8925671"
     CDS             complement(55092..55670)
                     /locus_tag="HVO_RS04970"
                     /old_locus_tag="HVO_0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045079.1"
                     /db_xref="GeneID:8925671"
                     /translation="MAELGDDETPEAERIASDADRRREAWGATLDDMTAMADEFEDEG
                     WETVRIPAGDSGPFGPSSGKGGEGAFGFAYVIPGDKAETVADLFEATSFPEYEVYRAE
                     NDGRVYIVTALFSPETETAVFIAGAWDLREALECATVAVEEGRMYSYLQKLDGTVVGV
                     VEHDDPEKFFPNLDAIRRYAPNSDGEGEGDEN"
     gene            complement(55732..56178)
                     /locus_tag="HVO_RS04975"
                     /old_locus_tag="HVO_0057"
                     /db_xref="GeneID:8925212"
     CDS             complement(55732..56178)
                     /locus_tag="HVO_RS04975"
                     /old_locus_tag="HVO_0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045081.1"
                     /db_xref="GeneID:8925212"
                     /translation="MEFDPRRFGVKAIDAVVYAVSLTGVVFVVTAVVSTLAGNGLPGA
                     KWLMFFLGFAMFGYASLKVRPKAAWKHGDGNDGDGGSDGGLFSGSDEPVGVEKLVGDA
                     LDAILPPRLRPANSDERPSSGVKLLLASVCILATSYAMEVVFELNY"
     gene            complement(56181..57515)
                     /locus_tag="HVO_RS04980"
                     /old_locus_tag="HVO_0058"
                     /db_xref="GeneID:8924322"
     CDS             complement(56181..57515)
                     /locus_tag="HVO_RS04980"
                     /old_locus_tag="HVO_0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_004045083.1"
                     /db_xref="GeneID:8924322"
                     /translation="MSTTSTEEERSTEARGDTILEVNDLKTYYEDGGFLGSNPVKAVD
                     GVSFDIQRGETLGLVGESGCGKSTLGRTLMRLEEATAGEVKLNGTDITTLSGSDLKQF
                     RKDVQMVFQDPDSSLNERMTVGEIVREPLDVHDWKTPSERRERVRELLETVGLQEQHY
                     YRYPHQFSGGQRQRIGIARALALEPEFIILDEPVSALDVSVQAKILNLLEDLQNEFGL
                     TYLFIAHDLAVVRHICDRVAVMYLGNMMEIGPADEMFDQPANPYTHALLSSIPEPDPT
                     IERDRITLRGTPPSPRDPPAGCPFSTRCPVKIRPEAYRDMDPELWERIEVFREVLRER
                     SRADPSLSDRVRKLLGRESHRAGMDEIIPELFGDFDAPSDVMNHIHEAADYAENDDED
                     AARTYLHEEFGSVCDHERPEQLAVGNRGRLSLCHRHEAEYEEPATVFETLVQ"
     gene            complement(57512..58591)
                     /locus_tag="HVO_RS04985"
                     /old_locus_tag="HVO_0059"
                     /db_xref="GeneID:8926805"
     CDS             complement(57512..58591)
                     /locus_tag="HVO_RS04985"
                     /old_locus_tag="HVO_0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004045086.1"
                     /db_xref="GeneID:8926805"
                     /translation="MSTEQARSARTEGEPLLSVENLRTSFYTDKEVIRAVDGISFDIF
                     RGETVGIVGESGSGKSVTARSIMRLVEKPGRIENGRIMYDGEDLLDKSAKQMRSIRGG
                     SIAMVFQDPLTSLNPVYTVGNQIKEALRLHRGLSGSKATKEAIELLEAVGIPDAHRRV
                     REYPHQFSGGMRQRAVIAMALACDPELLICDEPTTALDVTIQAQILELLEELQEERDL
                     GIMFITHDMGVIAEIADRVNVMYAGEIVESAPVVELFESPKHPYTQGLLNSIPGQGLD
                     EDERLATIEGDVPTPNEDPTYCRFAPRCPKAFTECDTVHPEPVEVGDGTGRHRASCLL
                     YPDDLPTEEAVAVHREGGQRGGDTR"
     gene            complement(58588..60027)
                     /locus_tag="HVO_RS04990"
                     /old_locus_tag="HVO_0060"
                     /db_xref="GeneID:8926009"
     CDS             complement(58588..60027)
                     /locus_tag="HVO_RS04990"
                     /old_locus_tag="HVO_0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004045088.1"
                     /db_xref="GeneID:8926009"
                     /translation="MSTTTETEIPLRQRVAENPQPALIWAAVGAVLIGAELGAILQVV
                     GAVAGVVVNLLPGDPGASAVQSLQAAFDAIPTLVSRDVIPNQGYWDGTSYENTFLGLS
                     PAVAWAIRVAVVYAYAFAVLAWAWNGYKRFRRHYRRVDWTPRDDVVNRFRGHSWGKFG
                     LIIVITFVVMAVFAPALGPTTMERNILQPYDYEVSYWSEDTQSVETVLVGEANLGSGS
                     QGAGDENVAPLTYDDFGRFHPFGTATNGKDLFTQVVFGARISLTIAVVAMGIAGLIGL
                     GLAMITAYYKGLADLATVLVSDSIQALPVIMVLILMLVIFQNTWVRELYDGAVLIILI
                     FSIVYWPFIWRSIRGPALQVSEQDWIDAAKSFGQSPSQVMRKHMAPYVFSYMLIYASL
                     SLGGIIISVAGLSYLGLGITAPTPEWGRLIANGQQYVASPSWHISLLPGLLITLVVTG
                     LNAFGDGIRDAIDPQADTGDEAAATGGGA"
     gene            complement(60034..61083)
                     /locus_tag="HVO_RS04995"
                     /old_locus_tag="HVO_0061"
                     /db_xref="GeneID:8925526"
     CDS             complement(60034..61083)
                     /locus_tag="HVO_RS04995"
                     /old_locus_tag="HVO_0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004045089.1"
                     /db_xref="GeneID:8925526"
                     /translation="MSRWQYFLRRVLMSIPVVIFGTTITFALIRLGPLDPVSAILGTQ
                     YNPQAAEQIRTNLGLNQPLWSQYLDFMYRLFTFQLGQSWVIAPGTTAYELIEIYAPRT
                     IWLGFWSVVIALFVGIPLGFYAGLNPNTPSDYAASFGGIVWRAMPNFWLAIMLVTALS
                     QLGTWTNGLFAWQTWIVRTNVVTPPALDFFQSPVEQFLEDPGGWTESFVRATKQIAPA
                     ALVLGSASMGNEMRIGRTAVLETINSNYVETARAKGVSGRSLVWKHIFRNALIPLVPI
                     ITGEAFLLLGGSVFVETVFAINGLGWLFFNAAINGDLPLIGTLMFIFILILVGTNILQ
                     DFLYTIIDPRVGYDG"
     gene            complement(61296..63134)
                     /locus_tag="HVO_RS05000"
                     /old_locus_tag="HVO_0062"
                     /db_xref="GeneID:8926550"
     CDS             complement(61296..63134)
                     /locus_tag="HVO_RS05000"
                     /old_locus_tag="HVO_0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004045090.1"
                     /db_xref="GeneID:8926550"
                     /translation="MPDTNKLSRRRFLKATGGAATAAALAGCTGGDGEETTTTESGGD
                     ETTTATTTEEDTGTELSGSVFNRILSGTITTMDPVAATDTSSGIIIQQVFDCLMSYQN
                     ALPTVENELAADYTVSDDFTTYTFQLADATYHNGETVTASDFIYAWERLAASSNSRRA
                     YFILDSIGVEHETDDEGNYVPGSLGVEVGETETELVVNLSEPFHDTLEMFAYTSFAAL
                     PEGILGDIEGHDGEMEYTEFASNNPIGAGPFEFAFWEQGTAAAVSKYDDYYGQVAQVD
                     NVRWQIIEDDTARYNYAMNENADYFGLPTAQYDPGLAQVESTDEYGREIGTYGPVRNG
                     KTLNYVGVPTLSIYYVGFNMNKVPKAVRQAFAYVLNQDQMVSEVFKGRGSAAEFFTPP
                     TIFPGGAQAASDLVSSDYPYSAGETDIEAARQVMEEAGYGPDNQFEVQWTQYNNNAWE
                     EMASILRDQLASAHINMQIQKADFSTLLERGRNGQLEAYTLGWIADWPAPDNFLQLLN
                     PPQTDTSEQGPISYVNWTAENGDAAQQATDAYQQVVNNPAPTDEAQQVRDEAYVDIEM
                     ANWEDVAMLPVYNQKEEMFWYDTVDIEPFGGMGPSRQKLNTVTLNR"
     gene            63622..64041
                     /locus_tag="HVO_RS05005"
                     /old_locus_tag="HVO_0064"
                     /db_xref="GeneID:8925919"
     CDS             63622..64041
                     /locus_tag="HVO_RS05005"
                     /old_locus_tag="HVO_0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF296 domain-containing protein"
                     /protein_id="WP_004045093.1"
                     /db_xref="GeneID:8925919"
                     /translation="MNARAVTVSEEYLARLEHGADWREEIEEFCARKDIESAWFNAMG
                     AVQDAELWFYDQTDQEYQSVTFDEPLEVAACVGNVALLDGEPFAHTHAILSRRSGQAL
                     AGHLDSATVFAGELNLRAFEEPLERDHDAVTDLDLWL"
     gene            64044..67652
                     /locus_tag="HVO_RS05010"
                     /old_locus_tag="HVO_0065"
                     /db_xref="GeneID:8924123"
     CDS             64044..67652
                     /locus_tag="HVO_RS05010"
                     /old_locus_tag="HVO_0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006055553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase II large subunit"
                     /protein_id="WP_004045095.1"
                     /db_xref="GeneID:8924123"
                     /translation="MREEETRYFRRIEARLDEAFDLAEAAKATGYDPKTEVEIPVAKD
                     MADRVENILGIDGVAERVRELEGEMSREEAALELVTDFVDGNVGDYDSREGKVEGAVR
                     TAVALLTEGVVAAPIEGIDRVEILENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADY
                     ARSLLDIDEYKARTDEVERYVEEINLYDKETGLQYSPKDKESRFIAENMPIMLDGEAT
                     GDEEVSGYRDLERVDTNSARGGMCLVMAEGIALKAPKIQRYTRQLDEVDWPWLQDLID
                     GTIGKDDDNAANADDAGDDGDEAEAETDPDAEADDAESDAPDGPTRVEPATKFLRDLI
                     AGRPVFGHPSAPGGFRLRYGRARNHGFATAGVHPATMHIVDDFIATGTQIKTERPGKA
                     GGVVPVDSIEGPTVRLANGDVRRIDDPEEAKELQNGVEKILDLGEYLVNFGEFVENNH
                     PLAPASYVFEWWIQEFEATEANVQALRDDPAVDLEEPSVEQALSWATEFDAPLHPVYT
                     YLWHDISVERFDALADAVAAGEIVAAEADGGTTAALEHDNEPEHGLEGTLVLDNAPEI
                     REALEHLLVAHRQTDEALRVPVWRPLARSLGLTDDRERTWELDDLSERARTWDDGDNA
                     VEAVNEVAPFNVRERAPTRIGNRMGRPEKSERRDLSPAVHTLFPIGEAGGSQRDVGDA
                     ARHRGESGKRGQISVRLGQRKCPDCGAFGFKSKCPDCGGHTEPHYECDDCGSVIEPDE
                     SGRVYCERCEWDVESAEWQDVDLNSEYRDALERVGERESSFQILKGVKGLTSANKTPE
                     PIEKGVLRAKHDVSSFKDGTVRYDMTDLPVTAVRPEELDVTADHFRELGYETDIDGEP
                     LRFDDQLVELKVQDIVLSNGAAQHMMQTADFVDDLLDQFYGLDRFYEIEERDDLIGEL
                     VFGMAPHTSAAVVGRVVGFTTAAVGYAHPYFHAAKRRNCDGDEDCVMLLMDGLLNFSK
                     KYLPDKRGGQMDAPLVMSSRIDPSEIDDEAHNMDIVRQYPREFYEATLRMEDPDDWED
                     EVTIAEEYLGTDREYTGFDHTHDTTDIAAGPDLSAYKTLGSMMDKMDAQLFLARKLRA
                     VDETDVAERVIEYHFLPDLIGNLRAFSRQETRCLDCGEKYRRMPLSGDCRECGGRVNL
                     TVHQGSVNKYMDTAIQVAEEFDCRDYTKQRLEVLEKSLESVFENDKNKQSGIADFM"
     gene            complement(67810..69072)
                     /locus_tag="HVO_RS05015"
                     /old_locus_tag="HVO_0066"
                     /db_xref="GeneID:8926424"
     CDS             complement(67810..69072)
                     /locus_tag="HVO_RS05015"
                     /old_locus_tag="HVO_0066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ repeat-containing protein"
                     /protein_id="WP_004045104.1"
                     /db_xref="GeneID:8926424"
                     /translation="MPRLRSRRRFLQLLGSASFGVAGCLGRDGGSSGPTTTEATTTTA
                     EPSTTYGPTSGPDERVTATPPGDPALSPSGAWPQYRFDAGNTGYNPDVSIPTDAEEYW
                     RLNAGGSPVLDGDRLYNLHGRGRDERAFVRREPSTMGERAVTPLVGYGVNSPPVVAGD
                     RVVVTTFIEVFCLAADRDEVLWRGPEMDGIHGPPAVGDGVAVVSGGGFDGVPTQLRAF
                     DLADGSERWRYDLESDAKGAPAVADGAVFVVTSDVVHAVDLATGERRFRVEVRTSEWT
                     TPVATPEAAYLSTRDGELLSLAPSDGTERWRSPGSGAPVVTDDVLHVAVDGETATLSR
                     DDGKEVATRFVGAPHARAREVVLVSDEQGRLAAYNTDEERQLWTHQTPEVQVSDVVSQ
                     GVAAAVPVDGAVYVVAADGFHGLGAAQD"
     gene            69249..69536
                     /locus_tag="HVO_RS05020"
                     /old_locus_tag="HVO_0067"
                     /db_xref="GeneID:8925538"
     CDS             69249..69536
                     /locus_tag="HVO_RS05020"
                     /old_locus_tag="HVO_0067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008610197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004065787.1"
                     /db_xref="GeneID:8925538"
                     /translation="MADETQPTVGMTVYAADGTELGSVRGFDDDGFFVTTREGLAGMS
                     VEHERAGHEFGEAELMWRCSDCGEMGDLDELPDACPNCGAEREQLYYWTED"
     gene            69607..70503
                     /locus_tag="HVO_RS05025"
                     /old_locus_tag="HVO_0068"
                     /db_xref="GeneID:8923937"
     CDS             69607..70503
                     /locus_tag="HVO_RS05025"
                     /old_locus_tag="HVO_0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketopantoate reductase family protein"
                     /protein_id="WP_004045108.1"
                     /db_xref="GeneID:8923937"
                     /translation="MRILVFGAGSLGTLVGGLLASVHDVTLVARDPHAARVSAAGLDI
                     IGAGSAHISPAATTTDTGHSADLALVTVKSFDTAAAADALADCDVDAVLSLQNGLTEE
                     TLASRLDAPVLAGTATYGARLVEPGRVECTGVGRIVLGALDGGPDPLAERVGKAFRDA
                     GLNTLVATDMPRRRWEKLAVNAGINAVTALARVENGALAGDDAGELAHRAARETARVA
                     RLERVSLPNRVAREAVDRVVEKTAANRSSMLQDVAAEKRTEVDAINGAVVDIAADHDF
                     EVPTNRTLAALLRAWERGAGLR"
     gene            complement(70535..72082)
                     /locus_tag="HVO_RS05030"
                     /old_locus_tag="HVO_0069"
                     /db_xref="GeneID:8926408"
     CDS             complement(70535..72082)
                     /locus_tag="HVO_RS05030"
                     /old_locus_tag="HVO_0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="WP_004045110.1"
                     /db_xref="GeneID:8926408"
                     /translation="MTAESPENVLFVVMDTVRKDHLTPYGYDRPTTPGLDRFADEATV
                     FEQAVAPAPWTLPVHASLFTGMYPSQHGANQENPYLEGATTLAETLSAAGYDTACYSS
                     NAWITPYTHLTDGFAEQDNFFEVMPGEFLSGPLAKAWKTMNDSDALRTLADKLVSLGN
                     TAHEYLAGGEGADSKTPAVVDQTIDFIDDSEEFFAFVNLMDAHLPYHPPEEYKERFAP
                     GVDSTEVCQNSKEYNAGAYEIDDDEWDDIRGLYDAEIAHIDDQLTRLFDHLKETDRWD
                     DTMVVVCADHGELHGEHGLYGHEFCLYDPLINVPLMVKHPDLDAERRGDQVELVDLYH
                     TVLDSLGVEGGEPATPGDDAVGLDRTRSLLSADYREFAQSSNDDPGQRRDGQYAFVEY
                     SRPVVELKQLEEKASSAGITLPEDSRFYSRMRAARRTDAKYVRIDRIPDEAYRIDDDP
                     EETENVVDADTGDEAIAETEAALAEFEDAIGGAWTDALDTDVSDDSVDQMDDEAQDRL
                     RDLGYLE"
     gene            complement(72161..72538)
                     /locus_tag="HVO_RS05035"
                     /old_locus_tag="HVO_0070"
                     /db_xref="GeneID:8925591"
     CDS             complement(72161..72538)
                     /locus_tag="HVO_RS05035"
                     /old_locus_tag="HVO_0070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045112.1"
                     /db_xref="GeneID:8925591"
                     /translation="MSTETQDGEDDLKERVVNFLRRNFPQIQMHGGSAAIRDLDRETG
                     EVTVLLGGACSGCGISPMTIQAIKTRMVKEIPEINEVHADTGMGGDGGMGGDSRGGSP
                     SFPGDTSDDTTDIEDDQGPQAPF"
     gene            complement(72583..72900)
                     /locus_tag="HVO_RS05040"
                     /old_locus_tag="HVO_0071"
                     /db_xref="GeneID:8925272"
     CDS             complement(72583..72900)
                     /locus_tag="HVO_RS05040"
                     /old_locus_tag="HVO_0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045114.1"
                     /db_xref="GeneID:8925272"
                     /translation="MTEFDPEKFEDKYANYFPELQRAYKNAFETMNDEFDSSLIHGVD
                     QQILNESEPFYDDGDFSVQLPDDPAERLTAVEIDDDELDAVLDRYVDEIESELRRVFG
                     VEA"
     gene            complement(73059..73280)
                     /locus_tag="HVO_RS05045"
                     /old_locus_tag="HVO_0072"
                     /db_xref="GeneID:8924364"
     CDS             complement(73059..73280)
                     /locus_tag="HVO_RS05045"
                     /old_locus_tag="HVO_0072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045116.1"
                     /db_xref="GeneID:8924364"
                     /translation="MATANSNEVEYDYPVGYEPEVQTETVELDRRTVERLDALREDDE
                     SYDELITELASIFAASELSAARVDSPLIE"
     gene            73836..74666
                     /locus_tag="HVO_RS05050"
                     /old_locus_tag="HVO_0074"
                     /db_xref="GeneID:8924108"
     CDS             73836..74666
                     /locus_tag="HVO_RS05050"
                     /old_locus_tag="HVO_0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 2"
                     /protein_id="WP_004045118.1"
                     /db_xref="GeneID:8924108"
                     /translation="MSADEPRYDDEGVLKKQQYKRELHRLQEELVKLQYWIKERDLRV
                     CVVFEGRDAAGKGGVIKRITRRLNPRVARVVALGKPTEREQGQWYFQRYVEQLPTEGE
                     MVLFDRSWYNRAGVERVMGFCTDEEYEEFLRTCPEFERMLVRSGVILVKYWFSISDEE
                     QERRFQKRTDDPKRRWKLSLMDLEARSRWVEYSKAKDRMFEHTDIDEAPWHVVHADVK
                     RHARLNCISHLLDQIDYEDLTPDPIELPPRQDDTGYERPPIDSQNWVPARFGENPVDD
                     "
     gene            complement(74663..76093)
                     /locus_tag="HVO_RS05055"
                     /old_locus_tag="HVO_0073"
                     /db_xref="GeneID:8924990"
     CDS             complement(74663..76093)
                     /locus_tag="HVO_RS05055"
                     /old_locus_tag="HVO_0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DHH family phosphoesterase"
                     /protein_id="WP_004045120.1"
                     /db_xref="GeneID:8924990"
                     /translation="MDGPVPELTEHAAACAARLRDADRVLLASHIDADGLTSAGIAST
                     ALERAGIPFETVFCRQLDEAAVADIAATDYDTVLFTDFGSGQLDIIADHEAAGDFHPV
                     IADHHQPAEGVETDHHLNPLRFGLNGASELSGAGASYVLARALEPDAGDNRDLAALAV
                     VGAVGDMQDTNGELRGANAGIVDEGVEVGVVEEGTDLRIYGRQTRALPKLLQYATDVR
                     IPGISNNEAGAIEFLTELDVPCRDDDGEWKRWVDLTGDERQTLASALMRRAIASGVPA
                     SRIDDLVGTTYVLSREREGTELRDVSEFSTLLNATARYDRADVGLAVCLGERDAALDR
                     ARRLLRNHRKNLSNGLQWVKEHGVRVEDNLQWFDAGDEIRETIVGIVAGMAVGTDATR
                     NGIPVLAFAEKEDGEVKVSSRGSYVMVRDGLDLSAVMREASRAVGGDGGGHDVAAGAT
                     IPKGEVEAFIAEADRIVGEQLAENAD"
     gene            complement(76230..77447)
                     /locus_tag="HVO_RS05060"
                     /old_locus_tag="HVO_0075"
                     /db_xref="GeneID:8925440"
     CDS             complement(76230..77447)
                     /locus_tag="HVO_RS05060"
                     /old_locus_tag="HVO_0075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004045122.1"
                     /db_xref="GeneID:8925440"
                     /translation="MTGNEAGEEARVETRDDSGDGSWRAVGSVAGWQTAASLCYYAIF
                     AATGFVRDAFSVSESLVGLFLTAGLLGYTVFLFPSGAAVDGYGEKPVMVVGLLALSVA
                     LVGVTFAPPSYLLLLVTVALLGAAYSTAMPASNRGIVAAAPAGSKNLAMGLKQVGVTV
                     GSGASSLVVTGVAVVAAWQVGFWAIAVFAAGYALVFATRYRGNLGTGRLERPRLAGLG
                     GNRAYVALVAAGLFIGASIFSMLGYTVLYVQDVVGTGPALAGGVLAATQVTGSVGRIG
                     AGSLADRLGGPRGAATVALVQLAGAVALFSLLVGTGGSFALTIAVFVTLGLTIHGSTG
                     VFYSCLSGVVDDGDIGAATAGGQTALNVGGLVAPPLFGFVVESTGYGAGWALVAGSTV
                     LATVLLFVVRRRI"
     gene            complement(77449..78192)
                     /locus_tag="HVO_RS05065"
                     /old_locus_tag="HVO_0076"
                     /db_xref="GeneID:8923961"
     CDS             complement(77449..78192)
                     /locus_tag="HVO_RS05065"
                     /old_locus_tag="HVO_0076"
                     /EC_number="4.2.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_004045125.1"
                     /db_xref="GeneID:8923961"
                     /translation="MSQQVRAAVFRPDDDRIERAVELLDSLGATPVPDPMLAIEPTGA
                     TPEPGAFVVLTSKTGVELLDEAGWNPGDAVLCCIGPATADAARDAGWTVDRVPDEYTS
                     AGLVDHLAPDVDGATVEVARSDHGSAVLTDGLRDAGADVHETVLYRLVRPEGAGESAE
                     LAAAGDLEAALFTSSLTVEHFLDAAAERGIREEAIAGLNDAVVGAIGPPTRDTAESHG
                     IDVTVVPDEATFEALAVAAVETAAPTYHE"
     gene            complement(78189..79070)
                     /locus_tag="HVO_RS05070"
                     /old_locus_tag="HVO_0077"
                     /db_xref="GeneID:8924801"
     CDS             complement(78189..79070)
                     /locus_tag="HVO_RS05070"
                     /old_locus_tag="HVO_0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_004045127.1"
                     /db_xref="GeneID:8924801"
                     /translation="MTGDDQRAGADEHSNDDATDDDGVGTVHLVGSGPGDPELLTMKA
                     ARLIDEADVVLHDKLPGPEILEMIPVEKREDVGKRAGGEWTPQEYTNTRLVELAREGK
                     DVVRLKGGDPFVFGRGGEEMEHLADNGIPFEVVPGITSAVAGAGAAGIPVTHRDHVSS
                     VSFVTGHEDPTKDESAVDWDALAATGGTLVVLMGVGKLPLYTAELREAGLAGDTPVAL
                     IERATWPDMRVATGTLDTIVDVRDETDIEPPAITVIGEVAATRDRVKGFLQGGGADAI
                     EMGADANPTSGGAGGDE"
     gene            complement(79072..80163)
                     /locus_tag="HVO_RS05075"
                     /old_locus_tag="HVO_0078"
                     /db_xref="GeneID:8925960"
     CDS             complement(79072..80163)
                     /locus_tag="HVO_RS05075"
                     /old_locus_tag="HVO_0078"
                     /EC_number="2.5.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_013035663.1"
                     /db_xref="GeneID:8925960"
                     /translation="MTTTLRLATRGSALARAQAASVQGALAGRRLDVELVEVETTGDR
                     IQDELIHRLGKTGAFVRALDERVLDGEVDAAVHSMKDMPTEKPADLVVAGVPERAPAG
                     DVLVTAEGHDIDDLPEGAVVGTSSLRRQAQLLNYRDDLEVEPLRGNVDTRIEKLLATH
                     LQREHEARVENDKERQGKKGKTDHDEAFDETADEWFEGLTELERQALGRQVETEYDAI
                     VLAEAGLKRSGLTEKVNYERLPRTTFVPAPGQGAIAVTAADSVVIELIRDKLDHPRTR
                     VETTVERTILAELGGGCIAPVGVHALLQGEHVHVDVQVLATDGSESIKTSRDLPVGNH
                     ANAAREFAAALCDRGAGQLVDAAREEAEE"
     gene            80270..80659
                     /locus_tag="HVO_RS05080"
                     /old_locus_tag="HVO_0079"
                     /db_xref="GeneID:8926801"
     CDS             80270..80659
                     /locus_tag="HVO_RS05080"
                     /old_locus_tag="HVO_0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045132.1"
                     /db_xref="GeneID:8926801"
                     /translation="MPALDSAVRQVGDFVVVALLLFGLTSVVAPLDLFLSSVGVEPPW
                     FAGLVAAALVALALLLARPLRLRLVACVWGVGLVVTAVWIPLLVFLELQGDPVGILVS
                     WAAALGVGVALTYPPLWRAAEARLRVE"
     gene            80735..80968
                     /locus_tag="HVO_RS05085"
                     /old_locus_tag="HVO_0080"
                     /db_xref="GeneID:8925797"
     CDS             80735..80968
                     /locus_tag="HVO_RS05085"
                     /old_locus_tag="HVO_0080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008612535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045133.1"
                     /db_xref="GeneID:8925797"
                     /translation="MSKCRTVIGLRGDDSDVNRSARLALTFGVAFVVALPLGFIFAPD
                     PTGIAPLFLTAGLAAVFGLPVYFGLSRASGSES"
     gene            complement(81002..82339)
                     /locus_tag="HVO_RS05090"
                     /old_locus_tag="HVO_0081"
                     /db_xref="GeneID:8926761"
     CDS             complement(81002..82339)
                     /locus_tag="HVO_RS05090"
                     /old_locus_tag="HVO_0081"
                     /EC_number="5.4.3.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="WP_004045135.1"
                     /db_xref="GeneID:8926761"
                     /translation="MNHDESRSLYDRALSVLAGGVNSSVRATQPYPFFVERGDGAHVI
                     DADGNRYVDYVMGYGPLLYGHDAPEPVQSAVQKHAAAGPMYGAPTEIEVEHAEFVARH
                     VPSVEMLRFVNSGTEATVSAVRLARGVTGRDKIVVMQGGYHGAQESTLVEGGPDGAKP
                     STPGIPSSFADHTIPVPFNDEETVREVFAEHGEDIAAVLTEPILANTGIVHPVDGYLE
                     ALRDVTEAHGALLIFDEVITGFRVGGLQCAQGKFGVTPDLTTFGKIIGGGFPVGAVGG
                     KAELVEQFTPGGDVFQSGTFSGHPVTMAAGHEYLKYAAENDVYGHVDRLGEKLRAGIT
                     DILEDQAPEYTVVGTDSMFKTVFTRHGAAERADACVDGCSQVESCPNYDACPKTGADV
                     SNTETDRWERVFWQEMKDRGVFLTANQFESQFVSYAHTDEDIEKTLEAYKAAL"
     gene            complement(82482..83189)
                     /locus_tag="HVO_RS05095"
                     /old_locus_tag="HVO_0082"
                     /db_xref="GeneID:8924898"
     CDS             complement(82482..83189)
                     /locus_tag="HVO_RS05095"
                     /old_locus_tag="HVO_0082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_004045137.1"
                     /db_xref="GeneID:8924898"
                     /translation="MVTVAVLGGLAVALFGMAAVGLLADRYLSDPDDLRADLLVSDAN
                     KWAVFALLCGYVLVVEGRPLSSMTGRSLAPLAFVAVVGGGVFVLFAANAVTTPVFDRL
                     GVGGLDEGMSGLGSLSVRHRLFVAGTAGITEEVLFHGYAIERLLELTGSPLLAGGVSF
                     AAFTASHAVGWERGAVARIAVPALLTTIMYLLVRDVVALVCIHALNDAVGLLLAGSVE
                     DAGDADGADAAADGTAR"
     gene            complement(83382..83753)
                     /locus_tag="HVO_RS05100"
                     /old_locus_tag="HVO_0083"
                     /db_xref="GeneID:8926484"
     CDS             complement(83382..83753)
                     /locus_tag="HVO_RS05100"
                     /old_locus_tag="HVO_0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-II family nitrogen regulator"
                     /protein_id="WP_004045139.1"
                     /db_xref="GeneID:8926484"
                     /translation="MSDADAPNDGEIKMVMAVIRPDKLSDVKTALAEIGAPSLTVTNV
                     SGRGSQPAKKSQWRGEEYTVDLHQKVKIECVVADIPADDVVDAIADAAQTGEKGDGKV
                     FTLPVESAVQVRTGKTGRDAV"
     gene            complement(83757..85127)
                     /locus_tag="HVO_RS05105"
                     /old_locus_tag="HVO_0084"
                     /db_xref="GeneID:8926178"
     CDS             complement(83757..85127)
                     /locus_tag="HVO_RS05105"
                     /old_locus_tag="HVO_0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="WP_013035275.1"
                     /db_xref="GeneID:8926178"
                     /translation="MLTPLQTDLASVVEGVNLVWVLTVTFLIFFMHAGFAMLEAGQVR
                     AKNVANQLTKNLLTWSIGVIVFFLLGAAVSSIVAALTSGSALDITGAFMSLYAPDASA
                     TTAWVDWLFGAVFAMTAATIVSGAVAGRARLRAYLTYTILIAGVIYPVVVGFTWGGGF
                     LDALGFHDFAGGMIVHGMGGIAGLTAAWIIGPRMDRFKPDGTANVIPGHSITFAVLGT
                     LILAFGWYGFNVGTAAAPLAYADGAVTLGSFAYVGRVALVTTLGMAAGAIGAGGVAMY
                     KTGKVDTLYVANGVLAGLVGITAIADDIVWPGALVVGLLAGAQLPVVFEFVEKRLRID
                     DVCAVFPVHGSAGVLGTLLYPVFAVPLWHDGASFVSLAVPQVIGVGVIAIWTFVATAV
                     VFDGFRALGQVRVSSDHEREGLDTAEHGVDTYPEFGSPDHDTGIRTDGSGVPSGDGFM
                     TTGRED"
     gene            complement(85507..85866)
                     /locus_tag="HVO_RS05110"
                     /old_locus_tag="HVO_0085"
                     /db_xref="GeneID:8924217"
     CDS             complement(85507..85866)
                     /locus_tag="HVO_RS05110"
                     /old_locus_tag="HVO_0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-II family nitrogen regulator"
                     /protein_id="WP_004045143.1"
                     /db_xref="GeneID:8924217"
                     /translation="MSDGEQGIKMVMAIIRPDKLSDVKTALAEVGAPSLTVTNVSGRG
                     SQPAKKGQWRGEEYTVDLHQKVKVECVVADIPADDVVDAIADAAQTGEKGDGKIFVLP
                     VESAVQVRTGKEGETAV"
     gene            complement(85863..87281)
                     /locus_tag="HVO_RS05115"
                     /old_locus_tag="HVO_0086"
                     /db_xref="GeneID:8925222"
     CDS             complement(85863..87281)
                     /locus_tag="HVO_RS05115"
                     /old_locus_tag="HVO_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ammonium transporter"
                     /protein_id="WP_004045146.1"
                     /db_xref="GeneID:8925222"
                     /translation="MGWAVVIPLQVDPSVIAQGVNYVWILVVSFLIFFMQPGFALLEA
                     GQVRAKNVGNVLMKNMTDWALGVLVYFLVGAGVATIVGGLTSPGGFDVAAAFSYIGDS
                     GAWIDWLFGAVFAMTAATIVSGAVAERMDFRAYIVFAATITGFIYPVVQGLTWSGGLL
                     SSGGYIGAALGVGYLDFAGATVVHMCGGVAGLVGAKMVGPRKGRFDSNGNSQPIPGHS
                     MLLAVLGTLILAFGWYGFNVGTQATVLAATDSGGLEFMGAALGRVALVTTLGMGAGAV
                     AAMIVSTSYQGKPDPLWMANGLLAGLVAVTGAVPHVTWWGGLILGALGGAIVLPAYRW
                     TVDSLKIDDVCGVFAVHGVAGAVGTALIPVFAVSGFSGTQLVMQVVGVVVIAAWTIIA
                     SAVVFAIADAVFGLRVSEEEEEEGLDAGEHGVSVYPEFVGDAGPDGALGSPTATDGGS
                     DVRTDGGVEQDETVEANGGDSQ"
     gene            complement(87625..88608)
                     /locus_tag="HVO_RS05120"
                     /old_locus_tag="HVO_0087"
                     /db_xref="GeneID:8925513"
     CDS             complement(87625..88608)
                     /locus_tag="HVO_RS05120"
                     /old_locus_tag="HVO_0087"
                     /EC_number="4.2.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen synthase"
                     /protein_id="WP_004045148.1"
                     /db_xref="GeneID:8925513"
                     /translation="MKFTDRPRRLRTDGIRPLVSETTLDATDLVAPVFVDATTDERVP
                     IESIPGHERVPVAEAADRVAEVREAGVKAVIVFGIPESKDPEGSRAYARNGVVQEAVR
                     AITAETDAYVITDVCLCEYTDHGHCGVLEDHAEDDPTLTVENGPTLDLLAETAVSHAE
                     AGADMVAPSASMDGMVGAIRTALDDAGHDEIPIMSYAAKYESAFYGPFRDAADGAPAF
                     GDRRHYQMDPANAREALREVALDVEQGADVLMVKPGLPYLDIVRAIREGYDHPVAAYN
                     VSGEYAMLHAAAEKGWLDLDGVAHESLLSMKRAGADLIITYFAERVARQLD"
     gene            88714..89226
                     /locus_tag="HVO_RS05125"
                     /pseudo
                     /db_xref="GeneID:25143404"
     CDS             88714..89226
                     /locus_tag="HVO_RS05125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973955.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:25143404"
     gene            complement(89547..90341)
                     /locus_tag="HVO_RS05130"
                     /old_locus_tag="HVO_0091"
                     /db_xref="GeneID:8926326"
     CDS             complement(89547..90341)
                     /locus_tag="HVO_RS05130"
                     /old_locus_tag="HVO_0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PHP domain-containing protein"
                     /protein_id="WP_004045159.1"
                     /db_xref="GeneID:8926326"
                     /translation="MDESPPVADLHLHTTASDGRLTIDALPDAARAGGVDVVAVTDHD
                     RYHPELDAPVVERDGVTVVRGIELRVDAGDRRVDLLGYGLRERPALVETVERLQRNRV
                     ERAREIVAAIEEETGVRLEIDIHDGVGRPHVARAIDASEAPYDYQGAFDELIGADGPC
                     YVARELPTFDDGVAALRDACDVVGLAHPFRYRDPAGALELCADLDAVERYYPYGFDVE
                     ADLVEEAVERYGLLATGGSDAHDETLGRAGPPETDFARFAAAVDGL"
     gene            90474..90758
                     /locus_tag="HVO_RS05135"
                     /old_locus_tag="HVO_0092"
                     /db_xref="GeneID:8924125"
     CDS             90474..90758
                     /locus_tag="HVO_RS05135"
                     /old_locus_tag="HVO_0092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045161.1"
                     /db_xref="GeneID:8924125"
                     /translation="MRLNGLGDAIDRHEYPISSTDFAQRHGDEVIELQNGQETVAQIL
                     ARLGDETYTCPQDVRDALLTGVGHEAIGRRYYSDRDPSPLGENGPEMVSF"
     gene            complement(90921..91928)
                     /locus_tag="HVO_RS05140"
                     /old_locus_tag="HVO_0093"
                     /db_xref="GeneID:8926159"
     CDS             complement(90921..91928)
                     /locus_tag="HVO_RS05140"
                     /old_locus_tag="HVO_0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045168.1"
                     /db_xref="GeneID:8926159"
                     /translation="MARPLRFRYAPGRWDESRIGRDIFQPLDANLGAEMGAPWYAPPD
                     GYEARRFDMDNGDTALFAWTDDHAYWIGNTETPSSLWRTDKEGFDEAPFEVSRWAQRE
                     LIAELFDQSPWLKPYSHLSWFFLPVFLSKDGRETTREFFHDHAAGFPDATRKEALEFY
                     ESFFATGVLDEYREVMAGKLGTSEYFDPIRMAAAMGEFDVAYLLDDAGYDITPEIAVA
                     TGHSIDFRAENTRAGGALIEVTRPLPPNRRSVSNPVAAIRDTAQTKTNGEGQLAEHGG
                     GVTLFVDCSSFPDDDWAAIMGEKPDVRHRPAVVFRLRPSGAVEGYSKGSVPVDLPWLT
                     E"
     gene            complement(92298..92993)
                     /locus_tag="HVO_RS05145"
                     /old_locus_tag="HVO_0095"
                     /db_xref="GeneID:8924393"
     CDS             complement(92298..92993)
                     /locus_tag="HVO_RS05145"
                     /old_locus_tag="HVO_0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045170.1"
                     /db_xref="GeneID:8924393"
                     /translation="MNDAPEYGETWVYESIVGALPGVRIGEAGAIALQIAVFEVAVLV
                     FAWVYDLWAAAVAGTAAIVVAAAGSVVMLRMGEWTRAARVPAPYRRLLFGSSIEVVLG
                     VLAFVALVTHLFVFDPRQPGTPLMTTLFGPEPPVVVVYLTLLVLWDLCYRIGTSWWAA
                     VVGLWGAIRYRFDGPTAETVRRVNLLNVGFAVAQVLLLPFVADQPVLLLAVGGHVVAV
                     TVVSVTAAALTRT"
     gene            complement(93097..94029)
                     /locus_tag="HVO_RS05150"
                     /old_locus_tag="HVO_0096"
                     /db_xref="GeneID:8924626"
     CDS             complement(93097..94029)
                     /locus_tag="HVO_RS05150"
                     /old_locus_tag="HVO_0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="WP_004045172.1"
                     /db_xref="GeneID:8924626"
                     /translation="MKVLVTGATGFVGRHLVPLLLDADHDVVVFVRDAARYDGPPGVE
                     VVEGDIFEPATLDPAMAGVDAAYYLIHSMHAGGDFEARDRLAARNFVDAAGSAGVERL
                     VYLGGLGEDRDQLSAHLRSRREVEHILASGAPALTTLRAAIIVGAGSASFEMVRQLAT
                     RLPVMVTPQWVETRCQPVAIADVVAYLAGVLDHPETAGETYEIGGPDVLTYREMLQRV
                     GAQLGHAPRIVPVPVLTPRLSSYWIGLVTDVDTGVARPLIEGLKNPVVVGDDRIRDIV
                     AVDETPFDAAVERALREEREQREKTVEPASTTPT"
     gene            complement(94154..95038)
                     /locus_tag="HVO_RS05155"
                     /old_locus_tag="HVO_0097"
                     /db_xref="GeneID:8926539"
     CDS             complement(94154..95038)
                     /locus_tag="HVO_RS05155"
                     /old_locus_tag="HVO_0097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045175.1"
                     /db_xref="GeneID:8926539"
                     /translation="MRVDCEGCAGCCIDWRPVAPAALDHERRGPRAPLDDTYNLVPLT
                     RDEVRDFVEAGFGNALSPRLWEAPPGEGVEIDGVEIAAVDGKPAFFVGMRKPPKPVAP
                     FGLERTWLRACAFLDPETLQCRIHDTEFYPGECAEYPGHNLVLEQETECERVERHHGG
                     ERLLDDAAPDDLHGLLLGPHALGAKLFVHPEPERLAGTIDHLKRRELTPEDRAEFVGV
                     AVGSHPGSTEVDGDRASRARAKTLESESWAGEAVAAWDAVAGRLGSAAGDAPDPDEVE
                     VARGAPETPGWDAVRDDG"
     gene            95156..95359
                     /locus_tag="HVO_RS05160"
                     /old_locus_tag="HVO_0098"
                     /db_xref="GeneID:8925516"
     CDS             95156..95359
                     /locus_tag="HVO_RS05160"
                     /old_locus_tag="HVO_0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045177.1"
                     /db_xref="GeneID:8925516"
                     /translation="MTSEPCDACGKGVRIAGGIGDLWNFPTSSSGGMTLELVDGSEHF
                     LCFDCMERLPGDREPTAEDVAAL"
     gene            95441..97351
                     /locus_tag="HVO_RS05165"
                     /old_locus_tag="HVO_0099"
                     /db_xref="GeneID:8925278"
     CDS             95441..97351
                     /locus_tag="HVO_RS05165"
                     /old_locus_tag="HVO_0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="WP_004045179.1"
                     /db_xref="GeneID:8925278"
                     /translation="MDPSRIIDSFPAPSFRGAQERALRDIRDAFADGNDVVLVRAPTG
                     SGKSLLARAIAGSAATVDETSPAQATDAYYTTPQVSQLDDVAEDDLLSDLKIIRGKSN
                     YNCIIRGEEDTPVDRAPCARKRGFDCSVRHRCPYFSDRAIASNRQIAAMTLAYFMQTA
                     GSDVFRKRDVVVVDEAHGLAEWAEMYATIDLKPRTVPVWDDIGVPDVAAAGDPVERAS
                     RFAETLVGVCKREKDELLTKSELMPEEAARRDRLQELIGELNWFVEDYRDPQSPTTWV
                     VDQHDGEGSPIAIKPLDPAKYLKHTVWDRGNKFALLSATILNKAAFCRSVGLDPSKVA
                     LVDVEHTFPVENRPLYDVTQGKMTYEHRDETLPKIARLVVRLMAKHPDEKGLIHCHSY
                     AIQAELRRRLAEMGLGNRVRGHDRDDRNAELETWKATDRPEVFLSVKMEEALDLNGDL
                     CRWQVLCKAPYLNTNDSRVARRLEDGQWAWYRRAALRTVIQACGRVVRAPDDYGDTYV
                     ADSSLLQLFDKTRTDMPDWFAAQVDRMTKPDLPEFDPVVAGGRGSNAGNATGGTANLG
                     GSTGRSRGASGSGSDSRRDSTRGSRSAGSRAGGSGGTSSGGSDGRETGGSDGSADDSG
                     RSSHPLSDVWGE"
     gene            97756..97950
                     /locus_tag="HVO_RS05170"
                     /old_locus_tag="HVO_0099A"
                     /db_xref="GeneID:8925522"
     CDS             97756..97950
                     /locus_tag="HVO_RS05170"
                     /old_locus_tag="HVO_0099A"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045182.1"
                     /db_xref="GeneID:8925522"
                     /translation="MHTNALATAMTLYRSGALTLSQAAARSGYSEDDLLLALQRHGVP
                     VHEDDAPAASLSADRPASAD"
     gene            complement(98087..99214)
                     /locus_tag="HVO_RS05175"
                     /old_locus_tag="HVO_0100"
                     /db_xref="GeneID:8925275"
     CDS             complement(98087..99214)
                     /locus_tag="HVO_RS05175"
                     /old_locus_tag="HVO_0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045183.1"
                     /db_xref="GeneID:8925275"
                     /translation="MSESRDFCPRCGDPVPERPEPLPGMPRERDDVLCDSCYFEDFDL
                     VDAPDEVQVRVCAQCGAIHRGNRWVDVGARDYTDIAIEEVSNSLGVHLNAEEVRWGVE
                     PEQVDENNIRMHCHFSGVVRGTPLEESIVVPVSIARETCQRCGRIAGGYFASLVQVRA
                     DDRTPTTEEAETAIEIAESYIAEREDKGDRNAFITEVNRTPDGPNIKISTNQMGSGVA
                     KQIRERFGGTIEEHPTLVTEDGDGNEVYRVTFVARLPRYTAGDVIDPEDGDGPVLVRS
                     NRGRLKGTRLTSGDLYESEFEEGERPEAEDLGSIEDAAETTVVTVEDEHAVQVLDPET
                     YEAKTIPRPDYFDPDASMVPVLKSPSGLHIFPEEVVDDDEE"
     gene            complement(99292..99930)
                     /locus_tag="HVO_RS05180"
                     /old_locus_tag="HVO_0101"
                     /db_xref="GeneID:8926731"
     CDS             complement(99292..99930)
                     /locus_tag="HVO_RS05180"
                     /old_locus_tag="HVO_0101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="WP_004045184.1"
                     /db_xref="GeneID:8926731"
                     /translation="MFADREDAGRRLADLLDERDETADLVLAIPRGGLPVGREVADRL
                     RAPLDVVVASKVGAPDNPELAVGAVAGDGSAWWNEDLLSYLDVGEDYLDREREREAAA
                     ARDKVSLYRGGDPLPDVAEKRVVVVDDGVATGATARACLRQVVAGGAERVVLAVPVGP
                     PNTLSELEAECDAVVAVESPEAFGAVGAFYRDFAQVSDEEAATYLRDGAGEH"
     gene            100055..100936
                     /locus_tag="HVO_RS05185"
                     /old_locus_tag="HVO_0102"
                     /db_xref="GeneID:8924762"
     CDS             100055..100936
                     /locus_tag="HVO_RS05185"
                     /old_locus_tag="HVO_0102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metalloprotease HtpX"
                     /protein_id="WP_004045186.1"
                     /db_xref="GeneID:8924762"
                     /translation="MNWKPDWGLRGRMALTMFLLFALYIVFAGLLAWYFDGLFIMAGF
                     MGVFLFAQFFFSDKIALYSMGASVVDEDDGPQARKLHAMVGRLSQQADLPKPKVAIAD
                     TRVPNAFATGRSQKSSAVCVTTGLMETLDDDELEGVIAHELAHVKNRDVMVMTIASFL
                     SSIAFLIVRWGWLFGGDDNRQNAPVIVAIIASLVVWIISYLLIRALSRYREYAADRGA
                     AVITGRPSALASALLKISGRMDNVPKRDMRDTSEMNAFFIIPIKSDFIGRLFSTHPST
                     ENRVERLRDMEREMETA"
     gene            100943..101548
                     /locus_tag="HVO_RS05190"
                     /old_locus_tag="HVO_0103"
                     /db_xref="GeneID:8923904"
     CDS             100943..101548
                     /locus_tag="HVO_RS05190"
                     /old_locus_tag="HVO_0103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008847178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045188.1"
                     /db_xref="GeneID:8923904"
                     /translation="MGLFDSFRAMLGISAESDATTKADPEDLFGMSTAYLTMEADLRF
                     DSADEAALCFSSVDSTDFADTVDAVEDILTAGSEETGTEFSRHTDGHGYNWVVLADDD
                     PEDLVTSVHFAADEFIERGYGSRLLAALFGFERDGDRAYWIYSFRRGAYYPFAPQGTS
                     TRNQSLEFKLESVLDGELEIEGDESYWYPLWPSTPNGHPWD"
     gene            101807..102838
                     /locus_tag="HVO_RS05195"
                     /old_locus_tag="HVO_0104"
                     /db_xref="GeneID:8924867"
     CDS             101807..102838
                     /locus_tag="HVO_RS05195"
                     /old_locus_tag="HVO_0104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008847309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair and recombination protein RadA"
                     /protein_id="WP_004045193.1"
                     /db_xref="GeneID:8924867"
                     /translation="MAEDDLESLPGVGPATADKLVESGYDSYQSIAVASPGELSNKAD
                     IGSSTASDIINAARDAADVGGFETGSMVLERRQQIGKLSWQIDEVDELLGGGLETQSI
                     TEVYGEFGAGKSQITHQLAVNVQLPPEQGGLGGGCIFIDSEDTFRPERIDDMVRGLED
                     EALEATLDDREMEGSIDDEETIKALVDDFLDKIHVAKAFNSNHQILLAEKAKELAGEH
                     EDTEWPVRLLCVDSLTAHFRAEYVGRGELAERQQKLNKHLHDLMRIGDLFNTGILVTN
                     QVSSNPDSYFGDPTQPIGGNILGHTSTFRIYLRKSKGDKRIVRLVDAPNLADGEAIMR
                     VQDAGLKPE"
     gene            103089..104234
                     /locus_tag="HVO_RS05200"
                     /old_locus_tag="HVO_0105"
                     /db_xref="GeneID:8923922"
     CDS             103089..104234
                     /locus_tag="HVO_RS05200"
                     /old_locus_tag="HVO_0105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_004045195.1"
                     /db_xref="GeneID:8923922"
                     /translation="MTHRIVVVGGGTGGTVVSNRLAEELESEIDDGDVGVTLVSDDTK
                     HVYKPVFLYVPFGVAEPDDGVRDLRDLVDERVDIVTNRVRRVDTDEKCLYCQDGDEEL
                     DYDTLVLATGAKLDPDAVPGFREGAHHFYNADGAERLRDALAEFEGGRLVLSVVGTPH
                     MCPAAPLEFTFIVDDWLRSRGLREDTDLVYTYPMERSHGKPEVAEWADPILAARGVRV
                     ETDFVVDAVDPDERVVSAESGAEVDYDLLVGIPPHRGDELITDSGLGDAGWVDVDQRT
                     LHATAAEDVYAIGDTAALPIPKAGSAAHFQAFAVAERIAAEVRGRTPTKRYDGKTVCF
                     VETGLDEASFVSFDYETPATMRQPSKPVHWAKHAYNESYWLTARGML"
     gene            104245..104658
                     /locus_tag="HVO_RS05205"
                     /old_locus_tag="HVO_0106"
                     /db_xref="GeneID:8926525"
     CDS             104245..104658
                     /locus_tag="HVO_RS05205"
                     /old_locus_tag="HVO_0106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1641 domain-containing protein"
                     /protein_id="WP_004045197.1"
                     /db_xref="GeneID:8926525"
                     /translation="MQDHEPTTTTEQQVPEELVRAIENNPEEVALLVERMGLVNDLID
                     VLELGVGALDDEMVRSLARTGTSLAEVADDASDPDTVAGMKRLLRAVGDAEEAEATPV
                     GAVGLLRATRDPEVKAGLGYLVALAAALGAGTDEE"
     gene            complement(104705..105133)
                     /locus_tag="HVO_RS05210"
                     /old_locus_tag="HVO_0107"
                     /db_xref="GeneID:8925600"
     CDS             complement(104705..105133)
                     /locus_tag="HVO_RS05210"
                     /old_locus_tag="HVO_0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SUF system NifU family Fe-S cluster assembly
                     protein"
                     /protein_id="WP_004045199.1"
                     /db_xref="GeneID:8925600"
                     /translation="MGIGSDMYRQQIMDHYKNPRNHGRLESPTFTHTGENPSCGDTIT
                     MDVQLADDGETIERVAFSGDGCAISQASASMLTQRLPGTTLSELEAMDTDDITEMLGV
                     DISPMRIKCAVLARQVAQDGAKIHDGEIEIEKTKTEDGDD"
     gene            complement(105206..105793)
                     /locus_tag="HVO_RS05215"
                     /old_locus_tag="HVO_0108"
                     /db_xref="GeneID:8925296"
     CDS             complement(105206..105793)
                     /locus_tag="HVO_RS05215"
                     /old_locus_tag="HVO_0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel"
                     /protein_id="WP_004045201.1"
                     /db_xref="GeneID:8925296"
                     /translation="MLQSLTGFLVETLRETIAEFGTAVQDAAPKVLTAVVFLALAYVG
                     IKAILFVVRGVLDGLYPEEQDLVVELGVAVAGVFLWFGAALALLNIVGMTEIAASLGT
                     ATGFIALGVSYALSNMIADTVAGVYLLRDPDFNPGDRVKSDPVTGTVSSIELRKTRFE
                     SDEGDTVVVANRDVEKKWTKYDAPAAEDASTADAT"
     gene            complement(105867..107147)
                     /locus_tag="HVO_RS05220"
                     /old_locus_tag="HVO_0109"
                     /db_xref="GeneID:8924530"
     CDS             complement(105867..107147)
                     /locus_tag="HVO_RS05220"
                     /old_locus_tag="HVO_0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017343977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_049914909.1"
                     /db_xref="GeneID:8924530"
                     /translation="MRVQESYPVDVDAIRADFPILERKVGGDISTPGEHDDDTTPLVY
                     LDNAATSHTPEQVVDAIVDYYHGYNSNVHRGIHHLSQEASVAYEDAHDRVAEFIGASG
                     GREEVVFTKNTTESMNLVAYAWGLDELGPGDSVVMTEMEHHASLVTWQQIAKKTGAEV
                     RYIRVDDDGRLDMEHAKELIDDSTKMVSVVHVSNTLGTVNPVSELADMAHEVGSYIFV
                     DGAQSVPTRPVDVEDIDADFFAFSGHKMCGPTGIGALYGKRDILDEMGPYLYGGEMIR
                     SVTYEDSTWEDLPWKFEAGTPPIAQGVGFAAAVDYLDDIGMENVQAHEELLAEYAYDR
                     LTEFDDIEIYGPPGDDRGGLVSFNLDSVHAHDLSSILNEQGVAIRAGDHCTQPLHDKL
                     GVAASTRASFYIYNAREEVDKLVDAIDAARELFA"
     gene            107327..108373
                     /locus_tag="HVO_RS05225"
                     /old_locus_tag="HVO_0110"
                     /db_xref="GeneID:8926784"
     CDS             107327..108373
                     /locus_tag="HVO_RS05225"
                     /old_locus_tag="HVO_0110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing sensor histidine kinase"
                     /protein_id="WP_004045206.1"
                     /db_xref="GeneID:8926784"
                     /translation="MSNATSSSLAFSSLDALPTQLAILDEDGVILYTNRAWREFGTEH
                     DYQGDSSSVGTNYLGVCDLSADADATTASEGIRAVIDDDRDEFSFEYPCETPEERLWF
                     TMRATRFTDDGETYVQIAHLDITDRKRAELEAEEKAERLRNLARMLSHDLRNPLSVAV
                     GYVESLLDETAASDRLERVAGALDRMDDIITDALVLARHDTVEGLSTVDLETRAAAAW
                     EHVETGTATLVVADSVEFRADSNLLGHVFENLFRNSAEHGASDDDLTVTVGVLDGDAA
                     EAGFYVEDDGVGIPTETRDVVFEAGYSTGEEGTGLGLSIVAQAVRTHDWDVAVTEAEG
                     GGARFEITGVERPA"
     gene            complement(108419..108721)
                     /locus_tag="HVO_RS05230"
                     /old_locus_tag="HVO_0111"
                     /db_xref="GeneID:8924584"
     CDS             complement(108419..108721)
                     /locus_tag="HVO_RS05230"
                     /old_locus_tag="HVO_0111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF424 family protein"
                     /protein_id="WP_004045208.1"
                     /db_xref="GeneID:8924584"
                     /translation="MLLRERETPEGLLVSVCDPDCIGETYTDDGVSLDVTEDFYGGGE
                     AETADEDAVVDSLTRATVANIVGEESVSVAIDAGLVDEETVLEVDGTLHAQLLWLR"
     gene            complement(108722..109462)
                     /locus_tag="HVO_RS05235"
                     /old_locus_tag="HVO_0112"
                     /db_xref="GeneID:8925811"
     CDS             complement(108722..109462)
                     /locus_tag="HVO_RS05235"
                     /old_locus_tag="HVO_0112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_004045209.1"
                     /db_xref="GeneID:8925811"
                     /translation="MTDDGNRPHRFSEGQGFDEDYSDFSLDPPELSVDPTKVDPVDSR
                     VLTDILDQRNIDPEDVDVEKLLDVALSYMQINRFEEATGAFERVARYAGDDDNIAQEA
                     WVNKGAAHGQLEEWDEAIGSYREALKLDDDSEHAATAHTNLAYALWEAGQTADALDHA
                     ERAVELDPRFPQAWYNRGFFLHERGLNEDAVNAFDNAIRLGMRTPGVHEEKARALEEL
                     GRDEEAEQAQQQADDLREQAEAELVEEY"
     gene            109554..110171
                     /locus_tag="HVO_RS05240"
                     /old_locus_tag="HVO_0113"
                     /db_xref="GeneID:8925740"
     CDS             109554..110171
                     /locus_tag="HVO_RS05240"
                     /old_locus_tag="HVO_0113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase family protein"
                     /protein_id="WP_004045211.1"
                     /db_xref="GeneID:8925740"
                     /translation="MSAPPTTVVSFVRHAHVPSVSDAERTPGLSRHGRRDAARVTARL
                     ADLADVVATSPAERARATVEGVADAADAPLIVDDDLRERELADSPIEDFDEAVEHLWA
                     NPNASHPGGESHAEAQARGVAAVDRLVEAYPDRHVVVGTHATLMALVFNAYDPRYGRE
                     FWTGLTTPDVYEVTFVDSEAFSIARTWTPEEAAREGDADRDPAER"
     gene            110198..110752
                     /locus_tag="HVO_RS05245"
                     /old_locus_tag="HVO_0114"
                     /db_xref="GeneID:8924538"
     CDS             110198..110752
                     /locus_tag="HVO_RS05245"
                     /old_locus_tag="HVO_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 2',3'-cyclic phosphodiesterase"
                     /protein_id="WP_004045212.1"
                     /db_xref="GeneID:8924538"
                     /translation="MRCFLAVDLPDSLAAGVAAVQDRLSDADGLRFTDPESAHVTLKF
                     LGEVSPDRVGAVEDAVESAVEAAGVGPFDASVGGLGVFPSLDYIRVVWVGVDDGAAEL
                     TRLHEAIERETTALGFDPEDHEFTPHVTLARMDDARGKVLVRRVVGGESPTVGSFRVR
                     EVRLKKSDLGPDGPEYETVARVSL"
     gene            110903..111055
                     /locus_tag="HVO_RS05250"
                     /old_locus_tag="HVO_0115"
                     /db_xref="GeneID:8926643"
     CDS             110903..111055
                     /locus_tag="HVO_RS05250"
                     /old_locus_tag="HVO_0115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008421366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L39e"
                     /protein_id="WP_004045214.1"
                     /db_xref="GeneID:8926643"
                     /translation="MGKKSKSKKKRLAKLERQNSRVPAWVMLKTDMEVTRNPKRRNWR
                     RSNTDE"
     gene            111059..111337
                     /locus_tag="HVO_RS05255"
                     /old_locus_tag="HVO_0116"
                     /db_xref="GeneID:8924040"
     CDS             111059..111337
                     /locus_tag="HVO_RS05255"
                     /old_locus_tag="HVO_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008320016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31e"
                     /protein_id="WP_004045216.1"
                     /db_xref="GeneID:8924040"
                     /translation="MSANDFEERVVTVPLRDVQAVPAHERAGRSMTLIREHLAKHFKV
                     DAENVRLDTQINEDIWAHGRQSPPSKFRVRAARFDEDGESVVEAEPAE"
     gene            111341..112006
                     /locus_tag="HVO_RS05260"
                     /old_locus_tag="HVO_0117"
                     /db_xref="GeneID:8926328"
     CDS             111341..112006
                     /locus_tag="HVO_RS05260"
                     /old_locus_tag="HVO_0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275894.1"
                     /note="eIF-6; binds to the 60S ribosomal subunit and
                     prevents its association with the 40S ribosomal subunit to
                     form the 80S initiation complex in eukaryotes; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-6"
                     /protein_id="WP_004045218.1"
                     /db_xref="GeneID:8926328"
                     /translation="MLRASFAGSSYIGVFARATDDALLVRPDADDSLAEQMAEELDVP
                     LVKTTVGGSGTVGALATGNENGLLVSSRATSREKEALTDAVDLPVYELPGRINAAGNV
                     VLANDYGAYVHAELSDEAVAAVEEALEVPVERGDLADVRTVGTAAVANNRGVLCHPKS
                     REPELEALEALLDVRADIGTINYGGPLVGSGLVANDESYVVGEDTTGPELGRIEDALD
                     YID"
     gene            112088..112264
                     /locus_tag="HVO_RS05265"
                     /old_locus_tag="HVO_0118"
                     /db_xref="GeneID:8926095"
     CDS             112088..112264
                     /locus_tag="HVO_RS05265"
                     /old_locus_tag="HVO_0118"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18a"
                     /protein_id="WP_004045220.1"
                     /db_xref="GeneID:8926095"
                     /translation="MSQFIITGSFTSRGVVHEFTKTVEAPNENVAQERAFSLIGSEHG
                     IKRTKVELNEVTAA"
     gene            112264..112734
                     /locus_tag="HVO_RS05270"
                     /old_locus_tag="HVO_0119"
                     /db_xref="GeneID:8924689"
     CDS             112264..112734
                     /locus_tag="HVO_RS05270"
                     /old_locus_tag="HVO_0119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prefoldin subunit alpha"
                     /protein_id="WP_004045222.1"
                     /db_xref="GeneID:8924689"
                     /translation="MGGGQQQLQQLSQELQALDEEIESLEAEVSDLNDEKDEIDEAVE
                     AIETLETGSTVQVPLGGDAYLRAEVQDIDEVVVSLGANYAAEQEQSTAIETLRRKQDA
                     LDEEIASVRGQIEELEEESDEIEEQAMQAQQQMQQQQMQQMQQMQGEGDDGDDE"
     gene            112767..114137
                     /locus_tag="HVO_RS05275"
                     /old_locus_tag="HVO_0120"
                     /db_xref="GeneID:8924270"
     CDS             112767..114137
                     /locus_tag="HVO_RS05275"
                     /old_locus_tag="HVO_0120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="WP_004045232.1"
                     /db_xref="GeneID:8924270"
                     /translation="MFDGLKKKLNRFRNDVEETAEEKAEAAADEAESDADAEAESAPA
                     DTDNAAVEPEASEPAAADPDADAVGDADAGSEADAVDAADAPADAESSSAAVEADAES
                     ESESAATPEPDSEVDAGADTGDEPSGEPTADEVEPRESLASDAAKAALTEEDEDDSSG
                     PGRLRRAAAFATGKVVIEEEDLEDPLWELEMALLQSDVEMQVAEEILETIREKLIGET
                     RKQVESTGQLVSEALHDALYEVISVGQFDFDQRIAEADKPVTLIFTGINGVGKTTTIA
                     KLAKYFEKQGYSTVLANGDTYRAGANEQIREHAEALDKKLIAHEQGGDPAAVIYDGVE
                     YAEAHDIDIVLGDTAGRLHTSNDLMAQLEKIDRVVGPDLTLFVDEAVAGQDAVERARQ
                     FNDAAAIDGAILTKADADSNGGAAISIAYVTGKPILFLGVGQGYDHIEKFDPEQMVER
                     LLGEDE"
     gene            complement(114180..114797)
                     /locus_tag="HVO_RS05280"
                     /old_locus_tag="HVO_0121"
                     /db_xref="GeneID:8926661"
     CDS             complement(114180..114797)
                     /locus_tag="HVO_RS05280"
                     /old_locus_tag="HVO_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_004045233.1"
                     /db_xref="GeneID:8926661"
                     /translation="MTTLAFGLDAATYLAFCGAAVALILAPGPDTMYVLARGLDGRGP
                     GVRSALGIATGVLFHTLLATVGAAALFRTVPEAAAALKYVGAAYLGYLGVTSLRNDEF
                     DPSVETDAGASFRRGVLVNALNPKVALFFLAFLPGFAGQGAGAGVRMAGLGATYAALT
                     ALYLSVVALGANRLGSRLAETRVASALNYVGAGTMLLLGVVLALE"
     gene            complement(114831..115805)
                     /locus_tag="HVO_RS05285"
                     /old_locus_tag="HVO_0122"
                     /db_xref="GeneID:8926037"
     CDS             complement(114831..115805)
                     /locus_tag="HVO_RS05285"
                     /old_locus_tag="HVO_0122"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008610567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-2-hydroxyacid dehydrogenase"
                     /protein_id="WP_004045234.1"
                     /db_xref="GeneID:8926037"
                     /translation="MTTILVLDRPTHGIPASEYAAALRERLPDATVRHPKTTAETLDA
                     ATDATIITSTSLPDEVLDAADELRLFAGAAAGYDHLPLETLRERGVRVTNASGVHGPN
                     IAEHVIGWLLMITRRLDEGLRRQRRREWRRFQSYGELQGSTATVVGLGAIGQAVVERL
                     DAFGVETVGVRYTPEKGGPTDEVLGFDDLESALVRTDFLVVACPLTDETRDLIDRRAL
                     SALPEHAILVNVARGGIVDTDALVSHLRSNRLRAAALDVTDPEPLPEDHPLWGFENVY
                     ITPHVSGHTPHYWTRVADILAENVGRLASASDGETPTLRNQVVPSPNP"
     gene            115896..117293
                     /locus_tag="HVO_RS05290"
                     /old_locus_tag="HVO_0123"
                     /db_xref="GeneID:8925329"
     CDS             115896..117293
                     /locus_tag="HVO_RS05290"
                     /old_locus_tag="HVO_0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008004842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_004045235.1"
                     /db_xref="GeneID:8925329"
                     /translation="MVLDNLGSSLRGSLDKLRGKSRLDEDDVQEIVKEIQRSLLSADV
                     DVSLVMDLSDSIKTRALEEEPPGGTSARDHVLKIVYEELVDLIGESTEIPLESQTIML
                     AGLQGSGKTTTSAKMAWWFSKKGLRPAVIQTDTFRPGAYDQAKQMCERAEVDFYGDPD
                     CDDPVQIAREGLEATEDADVHIVDTAGRHALEDDLIDEIEEIEGVVQPDLNLLVLDAA
                     IGQGAKEQAQQFDESIGIGGVVITKLDGTAKGGGALTAVNETDSSIAFLGMGETVQDI
                     ERFEPNGFISRLLGMGDLKQLSERVERAMSETQAEDEDWDPEEMMKGNFTLKDMQKQM
                     EAMDKMGPLDQVLDMIPGFGGGIKDQLPDDAMDVTKDRMRSFEVIMDSMTEEELENPR
                     KVGASRVRRIAQGSGQDEETIQELLEQHRMMEQTIKQFQNMGDGDMQRMMKKLQNQGG
                     GGGGGMGGLGGMGPF"
     gene            117403..117984
                     /locus_tag="HVO_RS05295"
                     /old_locus_tag="HVO_0124"
                     /db_xref="GeneID:8925295"
     CDS             117403..117984
                     /locus_tag="HVO_RS05295"
                     /old_locus_tag="HVO_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004045236.1"
                     /db_xref="GeneID:8925295"
                     /translation="MTVRDVAVEAYKEALPALAASLVGGLVAGVVLGGMRAELRAVPG
                     LLVLVPALLATRGNVYGSLGARIATALHQGLIEPRVTGGDERLRAAATAALANGVLTS
                     TFAAVVAYFLLTFLGSRVAPLPILVGVAIVAGLLSGIVLTVVVVSVVFAGYRRGRNPD
                     TIVGPVVTTTGDVFGVLFLLIAVRTVLAVAGVF"
     gene            117985..118545
                     /locus_tag="HVO_RS05300"
                     /old_locus_tag="HVO_0125"
                     /db_xref="GeneID:8925880"
     CDS             117985..118545
                     /locus_tag="HVO_RS05300"
                     /old_locus_tag="HVO_0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004045237.1"
                     /db_xref="GeneID:8925880"
                     /translation="MPTEWTVRAITRAMLPVLLVLTLVELGSGLVLGSFEAQLFRYPS
                     LLVLVPVTIGTAGNLGSVLAARLSTSFHLGTLSFSPRDDELAGNAVATLALAVTVFPV
                     IGAGAWVATLLVSGDTSLALQKVVLVALSSGISLAVLAVVVTFSATYLAYRFGLDPDD
                     VVIPVVTNLCDVLGVVVLFGVAQVLV"
     gene            118620..119639
                     /locus_tag="HVO_RS05305"
                     /old_locus_tag="HVO_0126"
                     /db_xref="GeneID:8926146"
     CDS             118620..119639
                     /locus_tag="HVO_RS05305"
                     /old_locus_tag="HVO_0126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045238.1"
                     /db_xref="GeneID:8926146"
                     /translation="MQPSAVLPVLFEVLPRVARIAAYIAVGVFAANLVVAFGLVERIA
                     GLSRYLTSPANLPDEVGTAIVTTAASTTAGYGMLAEFRESGVLDDRATLVAVTINTFF
                     GFVQHIFTFYWPVLIPILGREVGFMYVGARAAIALAITATGVVAGAVLLADRNTTPVA
                     VTETDGSGGAVDAADSAADAGDSGDAAESDDSLRETVDDAARSTWKKLRRIVPRLAVV
                     YVAVTLLLRTTDLESFAALASPLTNLVGLPGAAVPVVVAFAFDTTTGAATIAPAIGET
                     FTPRQAVATMLIGGIISFAVSTFKRSIPFQYGIWGPEFGSKVIAVNTGLKIVFIAVAV
                     ALLVA"
     gene            complement(119674..120090)
                     /locus_tag="HVO_RS05310"
                     /old_locus_tag="HVO_0127"
                     /db_xref="GeneID:8924586"
     CDS             complement(119674..120090)
                     /locus_tag="HVO_RS05310"
                     /old_locus_tag="HVO_0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045239.1"
                     /db_xref="GeneID:8924586"
                     /translation="MIYSVDVRIEVPVRDTEVTDRVGDAVENIFPGVELDHEPGQLVG
                     EAHELERFSERLHEQAILDTARREFAKRRDDDGFSFALKKQAAFKGVVNFSVGNPDEL
                     GDIEVHVTVRDPSVDEVIDYIAPPTEEGRPVDPNDR"
     gene            complement(120093..120662)
                     /locus_tag="HVO_RS05315"
                     /old_locus_tag="HVO_0128"
                     /db_xref="GeneID:8925499"
     CDS             complement(120093..120662)
                     /locus_tag="HVO_RS05315"
                     /old_locus_tag="HVO_0128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014732047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body complex protein FliE"
                     /protein_id="WP_004045240.1"
                     /db_xref="GeneID:8925499"
                     /translation="MRVIGTVGLPGSGKGELAEVARNAGVPVVTMGDVIREECRKRGL
                     DPATDHGKIATALREEEGDDAIAARSLPMVEQHLESNDVVLVDGLRSGVELDRFREAF
                     GDDFVLVSVEAPFETRAERLLDRDRDDSDTDVEALKKRERRELDFGMGDAMDRADVVI
                     QNTGTLAEYRETITKLFEEGPEALAEADA"
     gene            120802..121179
                     /locus_tag="HVO_RS05320"
                     /old_locus_tag="HVO_0129"
                     /db_xref="GeneID:8926263"
     CDS             120802..121179
                     /locus_tag="HVO_RS05320"
                     /old_locus_tag="HVO_0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008612386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045241.1"
                     /db_xref="GeneID:8926263"
                     /translation="MSQRSFVVRALWFVFVGWWATPAVVNVAWFLNATVIGIPLGVAL
                     INLVPTVLSLKEPKTRLDPDSGRGQRSVVVRAVYFVFVGWWLSWVWANVAVLFTLTIV
                     GLPVGIWMLNRLPAVTSLYRFDG"
     gene            121223..121296
                     /locus_tag="HVO_RS05325"
                     /old_locus_tag="HVO_3016"
                     /db_xref="GeneID:8926557"
     tRNA            121223..121296
                     /locus_tag="HVO_RS05325"
                     /old_locus_tag="HVO_3016"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:121257..121259,aa:Arg,seq:tct)
                     /db_xref="GeneID:8926557"
     gene            121710..121985
                     /locus_tag="HVO_RS05330"
                     /old_locus_tag="HVO_0131"
                     /db_xref="GeneID:8926852"
     CDS             121710..121985
                     /locus_tag="HVO_RS05330"
                     /old_locus_tag="HVO_0131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045242.1"
                     /db_xref="GeneID:8926852"
                     /translation="MDVLGIVAAAVVFGVAAYNLVTSLDGRFARLLFGCLGVVAATLY
                     VIEQFGLAASLGLNVAHGLQFVAALLVVSALVDFLARRAEAGDSGSS"
     gene            121969..122181
                     /locus_tag="HVO_RS05335"
                     /db_xref="GeneID:25143405"
     CDS             121969..122181
                     /locus_tag="HVO_RS05335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049914910.1"
                     /db_xref="GeneID:25143405"
                     /translation="MPGRRERRDSPFGGRFEQTIDDAVVHGDADMESALHEGPVRVLV
                     NGWVEVPGGRYLSPHAVHHIDVRVPE"
     gene            complement(122368..122781)
                     /locus_tag="HVO_RS05340"
                     /old_locus_tag="HVO_0132"
                     /db_xref="GeneID:8924624"
     CDS             complement(122368..122781)
                     /locus_tag="HVO_RS05340"
                     /old_locus_tag="HVO_0132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045244.1"
                     /db_xref="GeneID:8924624"
                     /translation="MSPPESPATNADSDATTPANRPPLLAVVAPRISEAAALAGPLLH
                     GAGPLVRAPHSSAPSQLRATLAAMRRPDAPLVVATDSAAAVRDADRVHVVDGGVVVES
                     GAPSDLLEVPGVYARRYGAELGANFAGRGKDVDDE"
     gene            complement(123087..124739)
                     /locus_tag="HVO_RS05345"
                     /old_locus_tag="HVO_0133"
                     /db_xref="GeneID:8925267"
     CDS             complement(123087..124739)
                     /locus_tag="HVO_RS05345"
                     /old_locus_tag="HVO_0133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermosome subunit"
                     /protein_id="WP_004045245.1"
                     /db_xref="GeneID:8925267"
                     /translation="MIILGEDSQRTSGQDAQSMNITAGKAVAEAVRTTLGPKGMDKML
                     VDSGGQVVVTNDGVTILKEMDIDHPAANMIVEVSETQEDEVGDGTTTAVINAGELLDQ
                     AEDLLDSDVHATTIAQGYRQAAEKAKEVLEDNAIEVTEDDRETLTKIAATAMTGKGAE
                     SAKDLLSELVVDAVLAVKDDDGIDTNNVSIEKVVGGTIDNSELVEGVIVDKERVDENM
                     PYAVEDANIAILDDALEVRETEIDAEVNVTDPDQLQQFLDQEEKQLKEMVDQLVEVGA
                     DAVFVGDGIDDMAQHYLAKEGILAVRRAKSSDLKRLARATGGRVVSSLDDIEADDLGF
                     AGSVGQKDVGGDERIFVEDVEDAKSVTLILRGGTEHVVDELERAIEDSLGVVRTTLED
                     GKVLPGGGAPETELSLQLREFADSVGGREQLAVEAFAEALDIIPRTLAENAGLDPIDS
                     LVDLRSRHDGGEFAAGLDAYTGEVIDMEEEGVVEPLRVKTQAIESATEAAVMILRIDD
                     VIAAGDLSGGQTGSDDDDGGAPGGMGGGMGGMGGMGGMGGAM"
     gene            complement(124992..125534)
                     /locus_tag="HVO_RS05350"
                     /old_locus_tag="HVO_0134"
                     /db_xref="GeneID:8925137"
     CDS             complement(124992..125534)
                     /locus_tag="HVO_RS05350"
                     /old_locus_tag="HVO_0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544179.1"
                     /note="similar to yeast Dim2p protein that is essential
                     for 40S ribosomal subunit; structural studies show binding
                     to 3' end of 16S rRNA in complex with archaeal IF2 alpha;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-processing protein"
                     /protein_id="WP_004045246.1"
                     /db_xref="GeneID:8925137"
                     /translation="MQHVKVPQDRIGVLIGEGGSTLREIESRAEVRLDVDSENGSVAI
                     DSVGDPVLGMVAPDVVRAVGRGFAPEDAMALLDDDMMMFELIDIDRHTRNKNDMRRQK
                     GRLIGENGRTRELMEELTGADVVIYGTTLGIIGQPEEVEVVRRAVEMILDGAPHGAVY
                     SFLERKHNELTQGFNVRQNN"
     gene            complement(125628..126500)
                     /locus_tag="HVO_RS05355"
                     /old_locus_tag="HVO_0135"
                     /db_xref="GeneID:8925605"
     CDS             complement(125628..126500)
                     /locus_tag="HVO_RS05355"
                     /old_locus_tag="HVO_0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protein kinase RIO"
                     /protein_id="WP_004045247.1"
                     /db_xref="GeneID:8925605"
                     /translation="MTDEFGMVEPQEGEAFGDEWEEIDVSDDEADRIARRKDRDFDEF
                     RMRLKDADQFKVEQSVFDDATFAAIYKLVQDGHIDAFGGPISTGKEANVFEALGGDDA
                     DVAVKIYRINASDFRHMRDYLEGDPRFENIGHDKGQVVRAWVRKEFANLERAQRAGVR
                     VPKPIAVQRNVLVMELVGVVDDRARRLSEVRVENPQTAYEVVREYMRRLHRAGLVHGD
                     LSEYNLIIHDGELVVIDLGQAVTVHHPNAEEFLRRDCRNVANFFRRQGADADGDSLYE
                     FVTGDEGEDGDGDE"
     gene            complement(126602..126892)
                     /locus_tag="HVO_RS05360"
                     /old_locus_tag="HVO_0136"
                     /db_xref="GeneID:8923977"
     CDS             complement(126602..126892)
                     /locus_tag="HVO_RS05360"
                     /old_locus_tag="HVO_0136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015323084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor eIF-1A"
                     /protein_id="WP_004045248.1"
                     /db_xref="GeneID:8923977"
                     /translation="MSDDENESRRDLRMPNDDEVFAVVTNMLGANRIRVRCADGVERT
                     ARIPGRMQKRIWIREDDVVLVEPWDWQDEKADVSWRYEKSEADQLRREGHIQ"
     gene            126998..127177
                     /locus_tag="HVO_RS05365"
                     /old_locus_tag="HVO_0136A"
                     /db_xref="GeneID:8926110"
     CDS             126998..127177
                     /locus_tag="HVO_RS05365"
                     /old_locus_tag="HVO_0136A"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045249.1"
                     /db_xref="GeneID:8926110"
                     /translation="MLDKLGTKGIAGVVSLLLGIGIVASQAPVVAAGLAFVVAGLGLV
                     AGGLAEGVMKMFGMA"
     gene            complement(127203..128030)
                     /locus_tag="HVO_RS05370"
                     /old_locus_tag="HVO_0137"
                     /db_xref="GeneID:8926666"
     CDS             complement(127203..128030)
                     /locus_tag="HVO_RS05370"
                     /old_locus_tag="HVO_0137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_004045250.1"
                     /db_xref="GeneID:8926666"
                     /translation="MPRPSDVLVHRNRTVADREERTLTADVYCPESPAATEIAETTAS
                     PAAEPTRPLVVYVYGGAWETGSTGQFARWALDAADGGFVAAEVSYRLGHEAPFPAQIE
                     DVCEGIDWLTDRADEFGIDTDAVAVVGHSAGAHLALLAALSDGEFGRRTDIDAAVGVS
                     GVYDLRADDHEHAGESLPLFENRPSAAELRRCSPITYVDDDTDADADAPPTLLLHGSE
                     DSVVAPDQSARLADALEGAGTQVEYDAVDAADHVFLHSSYHYPAVRKRVFSFLRESL"
     gene            complement(128123..129109)
                     /locus_tag="HVO_RS05375"
                     /old_locus_tag="HVO_0138"
                     /db_xref="GeneID:8924345"
     CDS             complement(128123..129109)
                     /locus_tag="HVO_RS05375"
                     /old_locus_tag="HVO_0138"
                     /EC_number="6.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015911190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_004045251.1"
                     /db_xref="GeneID:8924345"
                     /translation="MDAYDLITRNASEVVTEDEVRALADDPEGKRAYVGYEPSGVLHI
                     GHMLTANKLIDLQAAGFEVVVLLADVHAYLNGKGTFEEIRETAERMKAQFIAYGLDES
                     QTEFVLGSEYQLDESYVLDLHAVELETTLSRAERAMAEIKSGDGVTVAQAVYPIMQAL
                     DIVYLDVDLAIGGMEQRKVHMLARDTLPSIGEESPTCMHTPLIADLGTGIGKMSSSEG
                     VTISMEDSTEDIEDKVNGAFCPPTADPEPTDEGEERENPVLQIFEYHVFPRFERVVVE
                     RPEQYGGNLDYDDYETLEADLESGELHPADAKGALADYLDELIEPGRAKIAE"
     gene            129130..129504
                     /locus_tag="HVO_RS05380"
                     /old_locus_tag="HVO_0139"
                     /db_xref="GeneID:8924290"
     CDS             129130..129504
                     /locus_tag="HVO_RS05380"
                     /old_locus_tag="HVO_0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_081442881.1"
                     /db_xref="GeneID:8924290"
                     /translation="MAYDFWKPPAGETDNTHRSQLRVMSDSGTTTRAPVIIFAALILV
                     VFGLLAVMWASVRGGHLLPHILGFAVYFLAFHVYLPYRVHKDATLKGRNATFWAVIAF
                     LLPLVGAALYFVVAVVGHDATD"
     gene            complement(129520..131589)
                     /locus_tag="HVO_RS05385"
                     /old_locus_tag="HVO_0140"
                     /db_xref="GeneID:8924893"
     CDS             complement(129520..131589)
                     /locus_tag="HVO_RS05385"
                     /old_locus_tag="HVO_0140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF460 domain-containing protein"
                     /protein_id="WP_004045253.1"
                     /db_xref="GeneID:8924893"
                     /translation="MNDRTSALDSVVFGVDIQSGDIRGDSPSYALVVLDTRDTESDEV
                     RIERDVVSFRKLRRLIERDEPRVVATDNMYELATDKDDLVRFLRWLPHGTQLVQVTGA
                     ERPEPLSRVASRHGVPYGKDPMKEAEAAARLALANVGYEVAAFENTTTVKVSRGRSTG
                     KGGWSQDRYTRRIHGSVKQQSREVESSLKEANLDYERDVTEKYGGYSQALFTVEGRPE
                     DIPVSSHRSGDTRVEIERERRDGIEFEPLVKRRDRVIVGIDPGTTTAVAVVGLDGRVL
                     DVHSTRTADTAAVIEWLIERGRPSLVAADVQPMPETVEKFRRSFDAAGWAPASDIPVD
                     EKLHRTREVDYENDHERDALAAALFAFDDHEDQFERISRKVPADVDREEVIARVLVSE
                     ESVEAVLREMADDGDGGDPDDADEEAHEEPELTPEEREIRELRSRVERLESHVGDLKS
                     TIEEKDETIEEYKEELSDARREERREARERREVTRLERENGRLERKVESLESDKAELA
                     DKLDQLKSLWKLDHSNFADVNTNGIFTSDSEWEVAGRESEANESGGNLVPVKIVEQFT
                     NGALDHTVEEYGIAAGDVVYLRDASGAGRTTAERLAEFDPKVVLRSGNLSEAADEVLF
                     EADVPVAPAGGVTIQEIDELAVAKESEVESAISDWEDRAEERQKEQREEMVDQIISEH
                     RAENRRG"
     gene            131765..132754
                     /locus_tag="HVO_RS05390"
                     /old_locus_tag="HVO_0141"
                     /db_xref="GeneID:8924170"
     CDS             131765..132754
                     /locus_tag="HVO_RS05390"
                     /old_locus_tag="HVO_0141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prohibitin family protein"
                     /protein_id="WP_049914913.1"
                     /db_xref="GeneID:8924170"
                     /translation="MSSDIPDPPSVTSRSLTRIALIGVVALLLIAAPIAGVLAWEPVE
                     EGNVKVVKKWGATTGTVFEPGAHFVNPVSQSTSSLSVRPQSYTMSSSTSEGDRRGDDA
                     ITVLSEDGLRTDIDVTVRYRIDAGQAVEFYRNYRTLATAEERLIRPSIRSVLRTEAGR
                     LPVTVIYTGESQTQLKAAAERELAEEFADDGLILEAVQVRNVELPAEYAQAVEQKEIT
                     EQRRQQKQDELAVEELEAERKRIEAQGQADANRILAESLSDEVLAQKYIGKLDETDTV
                     YIPVGDGGYPQFVRSLDSDGSSSSGSSAGSSSDTTSASSRSSTSSGSENETSN"
     gene            132763..133107
                     /locus_tag="HVO_RS05395"
                     /old_locus_tag="HVO_0142"
                     /db_xref="GeneID:8926474"
     CDS             132763..133107
                     /locus_tag="HVO_RS05395"
                     /old_locus_tag="HVO_0142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045255.1"
                     /db_xref="GeneID:8926474"
                     /translation="MRLLRELAVAVALLVIVGVLARSGVGRFVLPVVGLAVAAALVAL
                     LATQSAYPRTAVGPRTRIIESAAQSADAACVECGSPATARRRYVREWVVLGVPVVLLD
                     DGENPVCDAHRD"
     gene            complement(133150..134028)
                     /locus_tag="HVO_RS05400"
                     /old_locus_tag="HVO_0143"
                     /db_xref="GeneID:8924956"
     CDS             complement(133150..134028)
                     /locus_tag="HVO_RS05400"
                     /old_locus_tag="HVO_0143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhzF family phenazine biosynthesis protein"
                     /protein_id="WP_004045256.1"
                     /db_xref="GeneID:8924956"
                     /translation="MPQNAFHTVDAFATAKYAGNQLAVFEDADALRSEQMAALANEMN
                     YSETTFIEGGSPDDGYDVRIFTPDGEIPFAGHPTLGTAAVLRDHFGAGDEVTLNLGVG
                     PISVEVRGDGSDSEQYWMTQNAPRFGAELDRETLAEVLSLDANDFDADWPIQVVSTGL
                     PAVMIPLRDRDALARSEVFTPAYRSFFDDVGVENLFLFCPDPRDDANDFAARMYAPGH
                     GVTEDPATGSANGCFAGYLARHRYFGDDEIEVTVEQGYEMGRPSQLHLEAEDRGDEVA
                     VRVGGRVEFVSTGRLV"
     gene            complement(134083..135036)
                     /locus_tag="HVO_RS05405"
                     /old_locus_tag="HVO_0144"
                     /db_xref="GeneID:8925224"
     CDS             complement(134083..135036)
                     /locus_tag="HVO_RS05405"
                     /old_locus_tag="HVO_0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease Z"
                     /protein_id="WP_049914911.1"
                     /db_xref="GeneID:8925224"
                     /translation="MSMRATFLGTGGAVPTTARAPSAFLVNRDGERLLFDCGEGTQRQ
                     MMRYGTGFGVSHLFVTHLHGDHILGIPGLIQTLDFNDRDDSLAIHGPPGSKGHLEQLV
                     HAGGYQPGFHVSVHEVRPGNVAYRADDYEVRAFDTEHRTASVGYALVEDDRPGRFDRE
                     KAEELGVPVGPAFGRLHAGEDVELEDGTVVRSEQVVGDPRPGRTVVYTGDTRPLNSTV
                     EVACDADLLVHDATFTDEEAERAKQTAHSTAREAARVARDADVRRFALTHISARYAAD
                     PSPLLEQAREVYDGEAFVAEDGQKLEVPYADSDGGGAETGE"
     gene            135168..136193
                     /locus_tag="HVO_RS05410"
                     /old_locus_tag="HVO_0145"
                     /db_xref="GeneID:8924551"
     CDS             135168..136193
                     /locus_tag="HVO_RS05410"
                     /old_locus_tag="HVO_0145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605384.1"
                     /note="Part of the RFC clamp loader complex which loads
                     the PCNA sliding clamp onto DNA; in Methanosarcina and
                     Methanococcoides the RFC clamp loader is made up of two
                     similar small subunits and one large subunit; a mutation
                     in small subunit 1 eliminates the clamp loading activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_004045258.1"
                     /db_xref="GeneID:8924551"
                     /translation="MDAPLWTETHAPGLDDLPQPEVRDRLRRAVDEPMNLVVQGPPGV
                     GKTAAVRALAREAHADPENDLIELNVADFFNRTKKQIRADPRFEQFLDGRSRMAKRDM
                     INRVLKESAGYAPMSGEYKTIVLDNAESIREDFQQALRRVMEQHHRTTQFVITTRQPS
                     KLIPPIRSRCFPVPMPAPDDEALEALLADILDAEGVDYDAGGLQFLTDASNGNVRKAV
                     LSAQRTATEADEVTMSTVHAALGDVGFDDELKTLLINAREGDIKDARKTLTTLLDDEG
                     YEGQELLADILRVADSTPERFADGELARLHELAGQVDLDISTGIDDRLHITHLLTSWG
                     ADVRGEA"
     gene            136193..136798
                     /locus_tag="HVO_RS05415"
                     /old_locus_tag="HVO_0146"
                     /db_xref="GeneID:8926026"
     CDS             136193..136798
                     /locus_tag="HVO_RS05415"
                     /old_locus_tag="HVO_0146"
                     /EC_number="4.1.1.65"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="WP_004045259.1"
                     /db_xref="GeneID:8926026"
                     /translation="MRFAPGYRRFALPAFVGAAVAAVVFPPLGAVLLAVGAFVLWFFR
                     DPERSPPDEPGVVAPADGRVSVIRVEDGRVRVGVFMNVTDVHVNRAPVSGSVRTVTHR
                     PGAHKPAFSKDSDRNERVDIELDTDAGDHEVSLIAGAFARRIHSYVAPGDELVRGQKL
                     GHIDFGSRADVLLPPEFGSEDVVVEKGESVRAGETVLARRE"
     gene            137039..137458
                     /locus_tag="HVO_RS05420"
                     /old_locus_tag="HVO_0147"
                     /db_xref="GeneID:8924822"
     CDS             137039..137458
                     /locus_tag="HVO_RS05420"
                     /old_locus_tag="HVO_0147"
                     /EC_number="3.5.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit beta"
                     /protein_id="WP_004045260.1"
                     /db_xref="GeneID:8924822"
                     /translation="MTGEFVPGEVITADGTITLNEGRETAEVTVGNTGDRPIQVGSHF
                     HFFEANAALSFDREAAYGMRLNIPAGTAVRFEPGDQTSVELVAIGGKRRAHGMNGMVN
                     GSVDTDPSAAVERLRAAGFADTGAPDDEHGTAEGSSE"
     gene            137455..139161
                     /locus_tag="HVO_RS05425"
                     /old_locus_tag="HVO_0148"
                     /db_xref="GeneID:8924156"
     CDS             137455..139161
                     /locus_tag="HVO_RS05425"
                     /old_locus_tag="HVO_0148"
                     /EC_number="3.5.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006666930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit alpha"
                     /protein_id="WP_004045261.1"
                     /db_xref="GeneID:8924156"
                     /translation="MTKDIDREAYADLYGPSEGDRVRLADTELFAEVETDLRTHGDEA
                     VFGGGKTLRDGLGMAPDVTQADGALDWVITNATVIDPVLGVVAGDIGIRDGDIVGVGK
                     AGNPDTMDGVDMVVGPATDVYPAEGKIATAGALDIHVHWNSAQLHEHGLASGITTMLG
                     GGYGGGATTCTTGPQNIKRFLQAAEAWPVNVGFYGKGNASTPEPLIEQVEAGACALKL
                     HEDWGSMPAAIDTCLDVAEDEDVQVCMHTDTLNEAGFVENTFAAVDGRTMHLFHIEGA
                     GGGHAPDIMELVGEPNMLPSSTNPSMPYTDNTFDEHLDMVMVCHHLNPDVPEDVAFAE
                     SRVRAETIAAEDVLHDMGAISMMTTDSQAMGRQAELVSRTWQAASKMKSQRGPLPEDE
                     GTGADNHRIKRYLAKYTINPAISAGIDDYVGTLEPGKLADVVLWDPAFFGVKPAMIFK
                     GGFPVHSEMGEANGSLMTCEPILQRQRAGADGKAKHGLSLSFVSPAAADNDVGEAYGL
                     DSRVVPVGGTRTPGKEDMLYNDYCPDDIDVDPETFEVEVDGELVTCEPASELPLAQRY
                     TL"
     gene            139158..139553
                     /locus_tag="HVO_RS05430"
                     /old_locus_tag="HVO_0149"
                     /db_xref="GeneID:8926307"
     CDS             139158..139553
                     /locus_tag="HVO_RS05430"
                     /old_locus_tag="HVO_0149"
                     /EC_number="3.5.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit gamma"
                     /protein_id="WP_004045262.1"
                     /db_xref="GeneID:8926307"
                     /translation="MKLTPKEQERLTVFTAAEVARRRKERGVPLNHPEAVAYITDWCI
                     ERGRDGQSVAEIRSGASQLLGREDVMDGVPEMIDMIQVEPMFPDGTKLVTVHDPIRSD
                     SVGTADSTADAATDGGDTDDIDTSGGDDA"
     gene            139550..140173
                     /locus_tag="HVO_RS05435"
                     /old_locus_tag="HVO_0150"
                     /db_xref="GeneID:8923942"
     CDS             139550..140173
                     /locus_tag="HVO_RS05435"
                     /old_locus_tag="HVO_0150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004515860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreG"
                     /protein_id="WP_004045263.1"
                     /db_xref="GeneID:8923942"
                     /translation="MSLTHRDVATVGIGGPVGSGKTSLLTELVPQLRERGLNVGVIAN
                     DILTQEDADVLRERFAGVVPESLVAGVETGACPHTGIREDPSMNLQQIDDFLADHPEL
                     DIVLIESGGDNLAATFNPELADYSLYVISVAEGDDIPRKRGPGVVDCDLLVINKTDLA
                     PHVDADLDVMERDAKAVRSGPFVFTDCRSQTGIEEVLTHVREGVLFA"
     gene            140173..141072
                     /locus_tag="HVO_RS05440"
                     /old_locus_tag="HVO_0151"
                     /db_xref="GeneID:8924769"
     CDS             140173..141072
                     /locus_tag="HVO_RS05440"
                     /old_locus_tag="HVO_0151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011222587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreD"
                     /protein_id="WP_004045264.1"
                     /db_xref="GeneID:8924769"
                     /translation="MAADSPPPSFERYAAEPVPQAAVGAPGKDGVLELTFERTSRGTA
                     LVHDYATVPFHISGTLGHDPHPEAETVFVQSPTGGVAQGDRHDLTIAVEADAIAHVST
                     QSSTKVQTMERNYAGVDTALSVAAGGHLDYVPEPTILHADARYTQDLRLDVADGATAI
                     VGDVVVSGRLARGERFEFDRYRSRLRATGPDGLLFEDATHLAPDESDPSAPGLLGEHA
                     VYGTLFVVAPGRDAASLSDDLHEAVAATDARAGATELPNDAGVAVRALGDCADTVRTA
                     CDAAWDRARRALLDASAPSGRKY"
     gene            141072..141731
                     /locus_tag="HVO_RS05445"
                     /old_locus_tag="HVO_0152"
                     /db_xref="GeneID:8926565"
     CDS             141072..141731
                     /locus_tag="HVO_RS05445"
                     /old_locus_tag="HVO_0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreE"
                     /protein_id="WP_004045265.1"
                     /db_xref="GeneID:8926565"
                     /translation="MLVADTYLGHRDDPAVRGRLDEADAARVVLSDDDRRRSRVRTET
                     EDGRDLGVVVGRELDDGDVLETETGDLVVVELAAIDVLVVDVGAADVSTTAAVELGHA
                     LGNRHWNLAIRDGEALFPVPDTYERMEATVADHLPPGVTTRRETVSPALFDGDEPDHG
                     HGGHGHGGHDHSHEHGGHGHSHGEHSHDHDDGHSHGHDHDDGHDHSHDGLLRSARGDE
                     R"
     gene            141728..142417
                     /locus_tag="HVO_RS05450"
                     /old_locus_tag="HVO_0153"
                     /db_xref="GeneID:8926302"
     CDS             141728..142417
                     /locus_tag="HVO_RS05450"
                     /old_locus_tag="HVO_0153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreF"
                     /protein_id="WP_004045266.1"
                     /db_xref="GeneID:8926302"
                     /translation="MTDGARLESFRLADSFLPVGTYTASYGLEQFVQEELISDADDLR
                     ALLSTYLKQQVGPCELVALRAAHTAARDGDFDAVCRADRRLTAATLSKEFRKSARQSG
                     NRLLSLQRELRESPLLDEYAEAVDAGDATGNYAVVLGVAAASADIDASEACLLCCHGF
                     VTGLVGAAQRVLSLGHTDAQRILHDLQPVMTEAAADSADRGIDEMSPFAPLIDVLSAN
                     HERADRRLFMS"
     gene            142507..142956
                     /locus_tag="HVO_RS05455"
                     /old_locus_tag="HVO_0154"
                     /db_xref="GeneID:8925322"
     CDS             142507..142956
                     /locus_tag="HVO_RS05455"
                     /old_locus_tag="HVO_0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045267.1"
                     /db_xref="GeneID:8925322"
                     /translation="MQRRQVLASLGSLALLSGCLGGPAESPTETTTTTGTNTSESEST
                     ESGRAATTTSDCGRTEFCEGSELVRVRVDGGFSGKVVLNPACRESDIELSPGETETLI
                     RQTDAETCDVELLVDGEVAYDGRIQDYEYVMVRVGSDGEISLQKEVL"
     gene            complement(142995..143201)
                     /locus_tag="HVO_RS05460"
                     /old_locus_tag="HVO_0155"
                     /db_xref="GeneID:8925770"
     CDS             complement(142995..143201)
                     /locus_tag="HVO_RS05460"
                     /old_locus_tag="HVO_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045268.1"
                     /db_xref="GeneID:8925770"
                     /translation="MSRTVRETLAEAYDPDPRAMAIVAMGSSFLLVSLLSNPSSNPSY
                     LFGLVVAVLSLVVSVVVLAVETRR"
     gene            complement(143303..144259)
                     /locus_tag="HVO_RS05465"
                     /old_locus_tag="HVO_0156"
                     /db_xref="GeneID:8926177"
     CDS             complement(143303..144259)
                     /locus_tag="HVO_RS05465"
                     /old_locus_tag="HVO_0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="WP_004045269.1"
                     /db_xref="GeneID:8926177"
                     /translation="MELAGEEDAFAAREAEAAATGVTVVAPGLATARGVEPERARRLA
                     YTRRVVELVGRCAPDIEAARAVVAAANVDREGTVAVRARDVRGLTGISTTDAERELGS
                     ALVDRGFGVDLDDPDHELRVCFSEDACLVGWTAVEAVRDFTDRKPTDRPFFQPGSMAP
                     VDARAFVNMAGAEPGARILDPMCGTGGVLLEAGLVGADVVGVDAQAKMVGGARENLRH
                     YVGSGDVVRGDATALPLRDDSMDGAVFDAPYGRQSKIARHSLADLVGGALAEVRRVAP
                     ECVMVADRSWAEAAEDAGWGVERVFERRVHRSLVRYVHLLHR"
     gene            144416..144727
                     /locus_tag="HVO_RS05470"
                     /old_locus_tag="HVO_0157"
                     /db_xref="GeneID:8924472"
     CDS             144416..144727
                     /locus_tag="HVO_RS05470"
                     /old_locus_tag="HVO_0157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045270.1"
                     /db_xref="GeneID:8924472"
                     /translation="MTSHDAILWGAAALTCGLGDYVTTVLGVRTAGVQEGNPLVRRLS
                     GGDPGPGSFAVLKLVSVALFFAAYWALKPAVARLAVPLSLTVLGAVVTARNARIIHRR
                     A"
     gene            144786..145355
                     /locus_tag="HVO_RS05475"
                     /old_locus_tag="HVO_0158"
                     /db_xref="GeneID:8924913"
     CDS             144786..145355
                     /locus_tag="HVO_RS05475"
                     /old_locus_tag="HVO_0158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973891.1"
                     /note="TFIID; binds specifically to the TATA box and
                     functions in transcription; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TATA-box-binding protein"
                     /protein_id="WP_004045271.1"
                     /db_xref="GeneID:8924913"
                     /translation="MTDPKDTINIENVVASTGIGQELDLQSVAMDLEGADYDPEQFPG
                     LVYRTQEPKSAALIFRSGKIVCTGAKSTDDVHESLEIVFDKLRELQIPVDDDPEITVQ
                     NIVTSADLGENLNLNAIAIGLGLENIEYEPEQFPGLVYRLDEPSVVALLFGSGKLVIT
                     GGKQPTDAEAAVDVIISRLSELGLLNGSF"
     gene            145435..145812
                     /locus_tag="HVO_RS05480"
                     /old_locus_tag="HVO_0159"
                     /db_xref="GeneID:8925742"
     CDS             145435..145812
                     /locus_tag="HVO_RS05480"
                     /old_locus_tag="HVO_0159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045272.1"
                     /db_xref="GeneID:8925742"
                     /translation="MDALTLQTATGAPVTAVAGTFALFALFLSLTAHIAARNVLGDVE
                     LKKAFAVGPVPAAIAVVFTSFGWNSFVALALALGLDFGFVKYLYGRSTRLSAYVIVIH
                     FVVSVLLGLVLFGLSAILLTAPF"
     gene            145831..146799
                     /locus_tag="HVO_RS05485"
                     /old_locus_tag="HVO_0160"
                     /db_xref="GeneID:8925333"
     CDS             145831..146799
                     /locus_tag="HVO_RS05485"
                     /old_locus_tag="HVO_0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008608382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_049914912.1"
                     /db_xref="GeneID:8925333"
                     /translation="MPEAAEPPFVSPRRLLWNDAERRPRAPFRLLLTPVVFVAVSLVV
                     GFSLSTALGGLAGSSRLASLVVSLVSVGASGLAAFVVARYVDRRTVADLGLGLDREWA
                     VDLGFGLALGTGLMTAVFVVGVAAGWIAVSPAPLGVDRLLGVGSLLAFFVVVGIAEEL
                     LLRGIVLTDVAEGLRWRFGPDAAVAGGLAVSSAVFGVAHYTNPNAGFASTTSITLAGV
                     MLGLGYALTGDLAIPTGIHISWNFVQGGVFGFAVSGLDFGTSLVETTERGPDVITGGA
                     FGPEAGLLGVGAIVLGAVCIAAYVRVRRGDLGFEPSVTVPDLRWKE"
     gene            complement(146821..147666)
                     /locus_tag="HVO_RS05490"
                     /old_locus_tag="HVO_0161"
                     /db_xref="GeneID:8925892"
     CDS             complement(146821..147666)
                     /locus_tag="HVO_RS05490"
                     /old_locus_tag="HVO_0161"
                     /EC_number="2.4.2.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP phosphoribosyltransferase"
                     /protein_id="WP_004045274.1"
                     /db_xref="GeneID:8925892"
                     /translation="MRIAVPNKGRLHEPTIELLERAGLHLDNGAERKLYAGTVDPDVT
                     VLFARAADIPEYVRDGAAEVGITGLDQVRESGHELEDLLDLEYGKCRLVLAAPEDGDI
                     ETVADVSGKVVATEFPHIARTYFEEEGIDAEVVEVTGATELTPHVEMADAIIDITSTG
                     TTLRVNRLAVIDEVLSSSVRLFARPDVVDDPKVQQLLMALESVRSAEGKRYLMMNAPR
                     EKLDEVKEVIPGLGGPTVMDVAGDSTVAVHAVVNERDVFEVVSDLKNVGASGILVTEI
                     ERLVE"
     gene            147744..148844
                     /locus_tag="HVO_RS05495"
                     /old_locus_tag="HVO_0162"
                     /db_xref="GeneID:8926404"
     CDS             147744..148844
                     /locus_tag="HVO_RS05495"
                     /old_locus_tag="HVO_0162"
                     /EC_number="3.4.24.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035625.1"
                     /db_xref="GeneID:8926404"
                     /translation="MAPVTFAGALVGVSLLGAGWSRLSAGRLERRDVSVQRFRQRVRS
                     NWLYAAVLFVGVVWWTNADRALLAAVGLQTDWPWAALGWALTGVGAAVVATVSYMGAF
                     PVARRVRDADMGAGTVAAKMFRYHLVVAALVFCVVTVLHVEFRVLETSGLITLLAFAA
                     AAYAFSAPLVGVSQTTAVPDDATRERLDRLCDRASLSVSRIRLLDGGGHRSDHLVRGP
                     VGRKTLFLTDSLLDRYDDETVSALLAVDAARLGRFVYELRLFTVTAVAGLVVWGVGRS
                     PFGLLPSLLAFAGTGVILLVTGEYASKRLIYRADEAAAERVGRAAVADALAATADEVD
                     PGRAGSRLSFEPSLASRIERLRDGSGAGETDA"
     gene            complement(148866..149378)
                     /locus_tag="HVO_RS05500"
                     /old_locus_tag="HVO_0163"
                     /db_xref="GeneID:8926511"
     CDS             complement(148866..149378)
                     /locus_tag="HVO_RS05500"
                     /old_locus_tag="HVO_0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_004045277.1"
                     /db_xref="GeneID:8926511"
                     /translation="MSETRTRVADHIKHNPGVHFNELVRALDLAPGQVQHHVRRLLSD
                     ETVRRSEFYGRTHYFPPEFDAWERGALALVRRETARDILGHLLEHGDARPDDVADDIG
                     VARSTLEWHLDHLVERDVVRKERDLHNRVTLVLTHPERTTRLLDDVSPSLPERFVDRF
                     DRLLDHLVEG"
     gene            complement(149375..149722)
                     /locus_tag="HVO_RS05505"
                     /old_locus_tag="HVO_0164"
                     /db_xref="GeneID:8924412"
     CDS             complement(149375..149722)
                     /locus_tag="HVO_RS05505"
                     /old_locus_tag="HVO_0164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045278.1"
                     /db_xref="GeneID:8924412"
                     /translation="MEPPSNLALVPGHVQAGGPWMTAVVVLAGVSSVTLAALGVAVFL
                     RRRTRSHLLVALALLAFASRAAVAALTLGGVLSEFDHHVVEHLLDLAMAGLVLAAIYY
                     ARSIEREAGVNDP"
     gene            149886..151178
                     /locus_tag="HVO_RS05510"
                     /old_locus_tag="HVO_0165"
                     /db_xref="GeneID:8925286"
     CDS             149886..151178
                     /locus_tag="HVO_RS05510"
                     /old_locus_tag="HVO_0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_004045279.1"
                     /db_xref="GeneID:8925286"
                     /translation="MNTLRIAGGQVLRPDATVEDADVLVDRDEGTILDIGADLDADAD
                     ETLDAAGCLVTPGLVNAHCHVAMTLLRGYADDKPLDAWLREDIWPAEGALTPEDVRAG
                     AELGLVEMIKSGTTGFADMYFHVPEIAAAVEEAGLRARLGHGVVTLGKDDADARADID
                     ESLDVAREFDGAADGRIRTAAMPHSLTTVAEEYLHEFVADAHDEGIPVHYHANETTDE
                     VDPIVDERGERPLSYAKDLGMLTADDFLAHGVHVDDAEIDLLADAGTGVVHCPASNMK
                     LASGMAPVQKLLDAGVTVGLGTDGAASNNDLDMFDEMRDAAMLGKLAAEDASAVAAPD
                     VVRMATAGSAAAVDLPGGALEVGGAADLAVVDLDAPHLTPANDLVSHLAYAARGSDVR
                     HTVCDGRVLMRDREVLTLDEDAVMARAREAVASLRERV"
     gene            complement(151249..151560)
                     /locus_tag="HVO_RS05515"
                     /old_locus_tag="HVO_0166"
                     /db_xref="GeneID:8926114"
     CDS             complement(151249..151560)
                     /locus_tag="HVO_RS05515"
                     /old_locus_tag="HVO_0166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_004045280.1"
                     /db_xref="GeneID:8926114"
                     /translation="MLVIDNGKTLAEQELFALMSAPAVPDLLRVADEPLTVKELSCRA
                     DVPLSTAYREVKRLHEASLFEKSIMVDHSDGRHVAQYHRTFERMEVSVTDDGLRIELA
                     G"
     gene            151659..152945
                     /locus_tag="HVO_RS05520"
                     /old_locus_tag="HVO_0167"
                     /db_xref="GeneID:8926701"
     CDS             151659..152945
                     /locus_tag="HVO_RS05520"
                     /old_locus_tag="HVO_0167"
                     /EC_number="3.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylhomocysteinase"
                     /protein_id="WP_004045281.1"
                     /db_xref="GeneID:8926701"
                     /translation="MSEHYAPVSEHLDDVEAARTEGRRKMDWALQHMPILQELREQFE
                     SEQPLAGEVVGMAMHVEAKTANLVELLALGGAEVAITGCNPLSTHDDVSAALDANDDI
                     TSYAVRGVDEEGYYAAIDAVIAHEPTVTVDDGMDMVFTIHEEYPELIETIVGGAEETT
                     TGVHRLRAMDEDGELNYPVFAVNDTPMKRLFDNVHGTGESSLATIAMTTNLSYAGKNV
                     VVGGYGYCGKGVAKKASGQNANVIVTEVDPRRALEAHMEGYDVMPMEEAAKVGDVFIT
                     TTGNRDVITREDFENMKDGVLLANAGHFDIEIDLDALSDLAVDEYEARDGVDAYELED
                     GRRLNVLAEGRLVNLASPIALGHPVEVMDQSFGVQAVVVRELVENGDDYDAGVHDVPD
                     ELDREVAEIKLDAEGIEFDSMTDEQREYMGSWAHGT"
     gene            complement(153018..153350)
                     /locus_tag="HVO_RS05525"
                     /old_locus_tag="HVO_0168"
                     /db_xref="GeneID:8924395"
     CDS             complement(153018..153350)
                     /locus_tag="HVO_RS05525"
                     /old_locus_tag="HVO_0168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015763160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux SMR transporter"
                     /protein_id="WP_004045282.1"
                     /db_xref="GeneID:8924395"
                     /translation="MNPYVLLAGAIASELVGTTALKLSAGFSKPLPSLGVVAGYGLAF
                     YLVSLTLEELPIGVVYGTWAALGIVGVAAIGVVAFDEPVDLTGVVGLLLILAGIYCVN
                     VLSEMAAH"
     gene            153435..154259
                     /locus_tag="HVO_RS05530"
                     /old_locus_tag="HVO_0169"
                     /db_xref="GeneID:8925058"
     CDS             153435..154259
                     /locus_tag="HVO_RS05530"
                     /old_locus_tag="HVO_0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TrmB family transcriptional regulator"
                     /protein_id="WP_049914915.1"
                     /db_xref="GeneID:8925058"
                     /translation="MNLLTTGRRTPPHDRTRELGLSTYEEKAYRTLLATGAATAATVS
                     DASGVPNGRVYDVLNGLRSRRLVRAQSTQPTRYAAVDPGAAVERLLAERAAELREEWT
                     RYRDVADAVRSNLLPTPPADGSVWLGRLGGDEMRTAMHEHVRAATESVSAAVGPPYER
                     ASWETLRTEFDAFFEGARDDLGVSLLLSDPVLDSLPDEFRGLVASKPQTVRIRVLPHL
                     PVSFDVVDESVASVDIPHPQSAADRLGVVVVTDAGVVDEFDRQFRALWGDAVPLFE"
     gene            154332..154754
                     /locus_tag="HVO_RS05535"
                     /old_locus_tag="HVO_0170"
                     /db_xref="GeneID:8926173"
     CDS             154332..154754
                     /locus_tag="HVO_RS05535"
                     /old_locus_tag="HVO_0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid-structuring protein H-NS"
                     /protein_id="WP_004045284.1"
                     /db_xref="GeneID:8926173"
                     /translation="MSSNRKGDRRERELVNALDEAGFAVMRAPASGSATTRELPDVLA
                     GNGEVFYAIEAKASSGRPIYLSGEEVEALVYFSRNFGAKARIAVRFDREDWYFFHPGD
                     LYVTDGGNYRVKKETALAEGEDFESFTGGPTQTKLGGD"
     gene            complement(154782..155429)
                     /locus_tag="HVO_RS05540"
                     /old_locus_tag="HVO_0171"
                     /db_xref="GeneID:8925400"
     CDS             complement(154782..155429)
                     /locus_tag="HVO_RS05540"
                     /old_locus_tag="HVO_0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SWIM zinc finger family protein"
                     /protein_id="WP_004045285.1"
                     /db_xref="GeneID:8925400"
                     /translation="MRRKTTLPSDGLSGRARRARVEPMAVRPLRDGRYVVETDGGTYV
                     VDVEARTCTCPDNAIRHARCKHLRRVAIEITRGEVPPPGRRRATCAVCGDETFVPMDA
                     TGPQLCRDHDHRPGDLVRDRESGGLLVVTRALGTRADETPTETGTLVSAYETNADYGD
                     HEPTFEAVYLDSLPVNAGLSDLGELHAYRFPASRLSRVERGFVGANSLGERLARA"
     gene            155649..155852
                     /locus_tag="HVO_RS05545"
                     /old_locus_tag="HVO_0172"
                     /db_xref="GeneID:8925992"
     CDS             155649..155852
                     /locus_tag="HVO_RS05545"
                     /old_locus_tag="HVO_0172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004065604.1"
                     /db_xref="GeneID:8925992"
                     /translation="MAIEAEMRRKIAVSIVAVGVFIALIVGIGATYNQSGLVSTGGLA
                     LVGAITAFVLVMAGIGVWLSRSS"
     gene            complement(155952..157052)
                     /locus_tag="HVO_RS05550"
                     /old_locus_tag="HVO_0173"
                     /db_xref="GeneID:8926475"
     CDS             complement(155952..157052)
                     /locus_tag="HVO_RS05550"
                     /old_locus_tag="HVO_0173"
                     /EC_number="2.7.7.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_013035269.1"
                     /db_xref="GeneID:8926475"
                     /translation="MRPLHARYPFFAAAREAVESADVAIATLVAEDAPAVERGVERVE
                     RALMEGTVEPDPGEAYPRETKTELLSYPISRIIVSLVETPAAVDKYARAEADTSYERM
                     LADFDAGDDDVHGEARASLDDFLREFDLDGAVRAESNRNRNSRRAPDNYWVDVGPYLT
                     YSDTDWGADWRLVNRSLADGAVRVTREELSELLREAVRRRVAEGLPFAVRGSDAGDRL
                     ADALKPHVERLRNLLSDRGAVNVVYVDAVDPDHFPPCVEALLARAREGESLPNEAAFA
                     LAAFLVGVGLDPDEVGGVVGDETAEALQKRATVLADSSGSQYAPPTCETMQAYDLCVN
                     RDDRCDTIKHPMNYFETATNDADADAADEAAD"
     gene            157202..157795
                     /locus_tag="HVO_RS05555"
                     /old_locus_tag="HVO_0174"
                     /db_xref="GeneID:8924194"
     CDS             157202..157795
                     /locus_tag="HVO_RS05555"
                     /old_locus_tag="HVO_0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045288.1"
                     /db_xref="GeneID:8924194"
                     /translation="MPHFDYPCPDCRATTSLHDADCRFEGTPWVEVERAYVDIVSVLA
                     GGPCDEETLRREAPGEWGPLQQAALRRLKRDERVSDANSGVLRLRTAEEFREEVSEPT
                     REPMRTLHQYGSVPGCHDNAVFAMIAWYEMVGLSWPETRENVVNWLRDTGAWDRGGFE
                     EATPAELVEKKRHVYEAGYGWKEKAVSAKRVIDRYRS"
     gene            complement(157928..158671)
                     /locus_tag="HVO_RS05560"
                     /old_locus_tag="HVO_0175"
                     /db_xref="GeneID:8924994"
     CDS             complement(157928..158671)
                     /locus_tag="HVO_RS05560"
                     /old_locus_tag="HVO_0175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004047613.1"
                     /note="Sliding clamp subunit. Responsible for tethering
                     the catalytic subunit of DNA polymerase to DNA during
                     high-speed replication. Proliferating cell nuclear antigen
                     homolog; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase sliding clamp"
                     /protein_id="WP_004045289.1"
                     /db_xref="GeneID:8924994"
                     /translation="MFKAIVSAATLRDALDSVSVLVDECKIRLNEESLSIRAVDPANV
                     GMVDLTLDAAAFESYEAHGGVIGVNLSRLEEVAGMAGAGDLIHLTLDEETRKLNIRID
                     GLSYTLALIDPDSIRQEPDIPDLDLAANIVLEGTHLDRGIKAADMVSDHIRLRVDGAE
                     ETFHIEAEGDTDDVDLSLPPADLISIEAGAADSLFSLDYLKDMNKAIPTDAEVTVELG
                     EEFPVKLHYQIAEGMGTITYMLAPRIQSD"
     gene            158945..159406
                     /locus_tag="HVO_RS05565"
                     /old_locus_tag="HVO_0177"
                     /db_xref="GeneID:8925427"
     CDS             158945..159406
                     /locus_tag="HVO_RS05565"
                     /old_locus_tag="HVO_0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsC family transcriptional regulator"
                     /protein_id="WP_004045290.1"
                     /db_xref="GeneID:8925427"
                     /translation="MTDAADVDVDADTDATTTRVAFVCVQNAGRSQMATAFARRERDE
                     RGVGDRIEVVTGGTDPADHVHDEVVEVMGEKGFDLADETPRAIEQDEIMNVDIVVTMG
                     CSAEGICPMTWRGDARDWDLDDPDGRDLDAVRAIRDDIEGRVSALFDELAG"
     gene            complement(159403..161649)
                     /locus_tag="HVO_RS05570"
                     /old_locus_tag="HVO_0176"
                     /db_xref="GeneID:8926227"
     CDS             complement(159403..161649)
                     /locus_tag="HVO_RS05570"
                     /old_locus_tag="HVO_0176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008606137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_004045291.1"
                     /db_xref="GeneID:8926227"
                     /translation="MSDEELAKDLGLLSALTIGIGTMIGAGIFVLPGVAASTAGPVVV
                     ASFVVGGLIALVNALSVSELGTAMPKAGGGYYVNRALGPLFGSIAGLGDWMGLAFASA
                     FYSIGFGQYLATLVPMPEFLFLNEVQVGALVAGAVFVGVNYIGAKETGGVQTVIVTVL
                     LAILALFAVQGWLSFDVATLVGDGGIAPFGYGAILPGTALVFVSFLGYAKIATVAEEL
                     KNPGRNLPLAVIGSVAIVTVLYAILVSIMLGVVPWPDLSQSAPLTQATQLAFPGGLAG
                     LAVTVVTLGALLATVSSANASILASARINFAMGRDRVVTNWLNEIHPNYATPYRSILV
                     TGAVIILFIAALGRDIEVLAKAASVLHLVVYALMNAALIVFRETDPEYDPAFTVPLYP
                     VTPLVGMALSLGLLAFVGGEELLLSGLFVVGAVVWYFVYARNNADRQGLLGRHILSRG
                     DELPNTVVDAAATVAPNGSGRIDDAPATTTMVAVSNPRTERALVTLAAALAKFDGGRV
                     LATHVIQVPDQTSLAAADDQRDRISKASERLMADARADVEQLDVPVDTRTILSHEGLA
                     EVFDAARQHGVDRVIMGHSGAKLAGGRVEGALDELTHDLPCDVVVLDGEEFDPSEVLL
                     PTAGGHSSDLSAEVARALQATTDAHISVLHVADEVAAGRGFLEQWVAEHDLHGVEQLV
                     ETGDVETVIGEAAADKSLVLVGATETGLLSRLVGGSLALSVLDDLETTVLLAERPRRR
                     SLRERLFG"
     gene            162031..162816
                     /locus_tag="HVO_RS05575"
                     /old_locus_tag="HVO_0179"
                     /db_xref="GeneID:8925816"
     CDS             162031..162816
                     /locus_tag="HVO_RS05575"
                     /old_locus_tag="HVO_0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_004045293.1"
                     /db_xref="GeneID:8925816"
                     /translation="MPYRNTDHRLDEIDRRILYALMDDARNTSASTLAAEAGVSGATI
                     RNRIHKLEDSGIIRGSTAQVDFELAGGKLTNLYLCDVPVTEREALAHEARAIPGVINV
                     RTLMTGRRNLHVLAVGESTGDLRRVARLLTDIGIHIEDEDLLEEELFAPYGPFDPDDG
                     GHAPEANDFISLTGDASVVEVPVQSDAPIASLTLEDASERGILDDETLVIAIERGDRE
                     LTPHGDTVIEPDDIVTVLSRAGGDADADALSAFRGPQTESSPG"
     gene            162982..163761
                     /locus_tag="HVO_RS05580"
                     /old_locus_tag="HVO_0180"
                     /db_xref="GeneID:8924944"
     CDS             162982..163761
                     /locus_tag="HVO_RS05580"
                     /old_locus_tag="HVO_0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968929.1"
                     /note="Specifically methylates the uridine in position
                     2552 of 23S rRNA in the fully assembled 50S ribosomal
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAM domain-containing protein"
                     /protein_id="WP_004045294.1"
                     /db_xref="GeneID:8924944"
                     /translation="MARKDHYYNKAKQEGYRARSAYKLKQLDGDAGLFGPGNTVVDLG
                     AAPGGWLQVVSEEVGDHGKVVGVDLQRIRGIDRDNVQTIRGDMTEDETKEELTAVIGE
                     RGADAVVSDMAPNMTGEYSLDHARSVYLARQAFEVAQELLATGGDFAVKVFDGPDVAD
                     LRADMEREFQYVRSMRPDASRDSSSEQYLVGKHFLTAPVRKGDELDVEIVDVGSEGDG
                     IAKVEEFTLFVSGTEAGDMPTVRVTDVKPRFAFAEPIDDED"
     gene            163911..164312
                     /locus_tag="HVO_RS05585"
                     /old_locus_tag="HVO_0181"
                     /db_xref="GeneID:8926789"
     CDS             163911..164312
                     /locus_tag="HVO_RS05585"
                     /old_locus_tag="HVO_0181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045295.1"
                     /db_xref="GeneID:8926789"
                     /translation="MSADTTTTESQPLFTGLPSGIVPYVAILGALASVYAHLSLAPVL
                     MQFDQTQAILFVLAGVGFLAGIAVYLSKFWRREFYLVAIAFALAQIAAWAVMSGRVSE
                     MAILSKGGEAVFSAAAAYLYLSDSPETDGAA"
     gene            complement(164618..165337)
                     /locus_tag="HVO_RS05590"
                     /old_locus_tag="HVO_0183"
                     /db_xref="GeneID:8924750"
     CDS             complement(164618..165337)
                     /locus_tag="HVO_RS05590"
                     /old_locus_tag="HVO_0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VUT family protein"
                     /protein_id="WP_004045297.1"
                     /db_xref="GeneID:8924750"
                     /translation="MSEGRSAIGQVALVGLFVTALTTAQLTASKLLSIPLPSAVGELP
                     FVGAAILMPGAALAYALTFFASDCYSELYGRRAAQVMVNVGFAMNFVLLGLVWSTIAA
                     PAANPEFAAQFATVLSSGTNVVAGSLLAYLVSQNWDVVVFHGIRELTDGSLLWLRNIV
                     STATSQAIDTVIFVGVGFYAAPTVLGIGDVLPWNVLVGLAVGQYLLKLLIAIVDTPFV
                     YGTVALLRGDDESSTDGWVAD"
     gene            complement(165330..165506)
                     /locus_tag="HVO_RS05595"
                     /old_locus_tag="HVO_0184"
                     /db_xref="GeneID:8925963"
     CDS             complement(165330..165506)
                     /locus_tag="HVO_RS05595"
                     /old_locus_tag="HVO_0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="WP_004045298.1"
                     /db_xref="GeneID:8925963"
                     /translation="MAKISVEIPDELLADLDEHVGDDKKFVNRSDAVRASIRKTLDIL
                     DEIDDRHNRLVEDE"
     gene            complement(165626..167782)
                     /locus_tag="HVO_RS05600"
                     /old_locus_tag="HVO_0185"
                     /db_xref="GeneID:8926452"
     CDS             complement(165626..167782)
                     /locus_tag="HVO_RS05600"
                     /old_locus_tag="HVO_0185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatC"
                     /protein_id="WP_004045299.1"
                     /db_xref="GeneID:8926452"
                     /translation="MSSALDEDTQQTIAAGRETAGAMLRAAQKDLQKVFIVFLVGFLG
                     TFYALRLYVWEFFRGVTKAQMDASVSGNVSIIAQTPFDVILLQAKIGLVVGVLFALPP
                     FIYVSRGALKARDAWPKSPVAPWKLALIGLTMVALFAAGVAYGYFVFFPFTFAFLAQN
                     AISAGFTPSYSIVKWAQFIFLLTLSFGLASQLPLAMTGLSYAEVVPYELFRDKWRHAI
                     VGIFAFGALFTPPDPFTQIMWAVPVILLYAFSLYLARVVVTAKRGSEKIDVKSTATTH
                     WNLLAGVGVVVGLLVYAFYEYGGVELANDGLAAIGSDYVFLAPGSGVALGAFVVAGGF
                     VGLAFGLAYLVYRDIERLERTEIGVGDPTKLDLSALDVAGVRAAPPEAFADLEEDEVM
                     ALASAAIDDGDKAKAQALIDRFDEAEADREAEAADAEDEPGELEDRTTRAGGAFVSEL
                     TEGETDEDDIGGYYTDIAFIVDSLTSRAFWVVGWFMLVLATTFGWLYTGGIRDVYDDF
                     LGRLPAAVRPEEVLNVVALHPMEALIFEVKFSTILAVLATLPLVAYFVWPALRERNII
                     RKRRRTVFVWTGALAGGLLGGFALGYTYVAPTVITFLVEDALAANMIITYRITNFFWL
                     IFFTTAGIGLLADVPILMVLLNTAGISYRMMRNRWREVTVFILAISAVFTPASITTMF
                     MVTLPLMAAYGVGLGVLFVLTVGGRRDLSPARGAAE"
     gene            167913..169238
                     /locus_tag="HVO_RS05605"
                     /old_locus_tag="HVO_0186"
                     /db_xref="GeneID:8923939"
     CDS             167913..169238
                     /locus_tag="HVO_RS05605"
                     /old_locus_tag="HVO_0186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatC"
                     /protein_id="WP_004045300.1"
                     /db_xref="GeneID:8923939"
                     /translation="MADEERDAGLSAADDETDASDDTDQRSSDGDADDADDASSSSDG
                     PVYGRVTPRDETVTHGSDDDASADVAAETGDNGDDSDSDTDAAPDDADDSATDSDADS
                     DDEPRLLADDEHTSHVPEGTYDDSSDESADDVDPDAAADGASPALTGEDEMGGVAPSS
                     VSAEDADFDDEDVGGLVGEAPESDQEMPLTAHIEEMIRRLAVVLGVAGAITLVLFPGA
                     DILNALVDTQAAFGVHIPSATDVINFLWNSHIPGAETIVDRRPRLYGPLELILTKLKV
                     AGLAGTVIGLPVFVYETYLFMRPGLYPKERKYYLAAVPTSLVLALVGVLFAHFVVLPA
                     IFAYFTSYTEGTAVVAFGLKETFNLILILMGYMAVVFQIPLFVELAIMMNLVTRRWLE
                     DRRLLFWGAFLGLAFLVSPDPTGMAPIIIGATMITLFEGTLAALRWTGN"
     gene            169351..169671
                     /locus_tag="HVO_RS05610"
                     /old_locus_tag="HVO_0187"
                     /db_xref="GeneID:8925796"
     CDS             169351..169671
                     /locus_tag="HVO_RS05610"
                     /old_locus_tag="HVO_0187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008606140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045301.1"
                     /db_xref="GeneID:8925796"
                     /translation="MADLVALSAVALPLWFAVSVWAGIDATRHSSHNAFLWSLSVFVG
                     GILGLALYLNPGRDEPGVGRRAGQSRSPDGISSARTETVSCPNCHSLEEADRDTCRFC
                     GESL"
     gene            complement(169702..170184)
                     /locus_tag="HVO_RS05615"
                     /old_locus_tag="HVO_0188"
                     /db_xref="GeneID:8926586"
     CDS             complement(169702..170184)
                     /locus_tag="HVO_RS05615"
                     /old_locus_tag="HVO_0188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC domain-containing protein"
                     /protein_id="WP_004045302.1"
                     /db_xref="GeneID:8926586"
                     /translation="MAHELVTSIEIDAPPERVWEALVDFDRYPEWNPFMRIAGRPNEG
                     ATLTVHLRPPGGRESEFEPDVVYCEKHRELRWVGHLVVPGLFDGEHRFRLEPLDGGER
                     TRFEHAETFSGVLAGLLLRFVGEQTRAGFVAMNEGLKTRVEGVVAAENRKATESSDAV
                     "
     gene            170259..170897
                     /locus_tag="HVO_RS05620"
                     /old_locus_tag="HVO_0189"
                     /db_xref="GeneID:8924532"
     CDS             170259..170897
                     /locus_tag="HVO_RS05620"
                     /old_locus_tag="HVO_0189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine phosphatase family protein"
                     /protein_id="WP_004045303.1"
                     /db_xref="GeneID:8924532"
                     /translation="MATLLLARHGETTWNRAGRVQGWVPVSLTERGREQADALARHVA
                     DSYEVDRLVSSDIERAQETARPVARELGLEPVLDSAWRERDVGSFQGLEFDELTDRYP
                     QYFLSAVGAPAARERPPSGESLVEVRRRVLNAHEGLADSLDADETVLVVSHGAPIRLS
                     LGEVKGLDIVETMLSQPLDNGGICEFEVELSDDGDEPLVHVVAENETRFLTT"
     gene            complement(170943..171839)
                     /locus_tag="HVO_RS05625"
                     /old_locus_tag="HVO_0190"
                     /db_xref="GeneID:8925066"
     CDS             complement(170943..171839)
                     /locus_tag="HVO_RS05625"
                     /old_locus_tag="HVO_0190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent sacrificial sulfur transferase
                     LarE"
                     /protein_id="WP_004045304.1"
                     /db_xref="GeneID:8925066"
                     /translation="MSERDVAAKADAVREALAERESVLIAFSGGVDSSVVAALAHEAL
                     GDDAVACTAKSETLPDAELDDAKRVAEEIGIEHLTVEFSELDNPDFVANDDDRCYHCR
                     TMRLGRMYEAARDRGIEAVCDGTNASDPGEGHRPGLRAVEELEVLSPLLAHGITKEEV
                     RAIADDYDLSVADKPSMACLSSRIPTGLEVTEERLSRVERAETILRTWGFEQFRVRDH
                     DGLARIEVAPEELDRALDADFVRAARDHLKDAGFDHVTLDLHGYRTGSVSPGAEAETD
                     ADAGDDDLLVDDVFAQDYPMRK"
     gene            172017..174011
                     /locus_tag="HVO_RS05630"
                     /old_locus_tag="HVO_0191"
                     /db_xref="GeneID:8926699"
     CDS             172017..174011
                     /locus_tag="HVO_RS05630"
                     /old_locus_tag="HVO_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_004045305.1"
                     /db_xref="GeneID:8926699"
                     /translation="MDFETIPGVGEKTAAALAELDDAERALTDGDVAALARAPGLTEG
                     RAAAIARGAIRRDHDDPGGFLATDRASEIYRDALGLLQARTVTTYAEKRLETLFPTGS
                     APRIEEVRAFAADATDLDPDPDVLAALSGVEPLADPTPRRVRERCIATADAERYAAAK
                     EAFPELSIEVVEDGRDIAELARSYSTVVVLDESFAGIDVDGDVRVLPDAAERTDEVVP
                     ERLLAFFAANREALEAAAAVHEVAELDPPCDLAALRDVLSRLADDGTVLGDDELERLS
                     NAVDDLDTAVSTAESVANDRLRDVIRERDVTIEGTDFLSLVEQGARVDSLLSRELEDE
                     FDEALSAARDHLVESLSLRPGEADLTERVFPDDPSFPLGHDEEAVGRLRTELKAARDR
                     RAAKLKAGLAADLGDLRDPVETLVRDALELDVRLAVSRFARDFDCVFPEFTGAAGDDG
                     AGSFAIEAGRSPLLDVDFSDVDPVDYEVSGVTLLSGVNSGGKTSTLDLVGLVVVLAHM
                     GLPVPAESVRLSRFSELHYYAKSQGTLDAGAFESTLRDFAALTDGAADRLVLVDELES
                     ITEPGASAKIIAGILEELAEQGAAAVFVSHLAGGIREAADVSVAVDGIEAVGLEDGEL
                     VVNRSPVKDHLARSTPELIVEKLAGENETSFYGRLLEKFD"
     gene            174066..174335
                     /locus_tag="HVO_RS05635"
                     /old_locus_tag="HVO_0193"
                     /db_xref="GeneID:8925980"
     CDS             174066..174335
                     /locus_tag="HVO_RS05635"
                     /old_locus_tag="HVO_0193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045306.1"
                     /db_xref="GeneID:8925980"
                     /translation="MPSDSLSPEERQQYDLVYHATKNAIWDVLGTAVYVLFLVFGGFL
                     VLFVFVLPALSALSQTGGTPVVLGVGAVGLILFVAIGYRIVRLLQ"
     gene            complement(174329..174736)
                     /locus_tag="HVO_RS05640"
                     /old_locus_tag="HVO_0192"
                     /db_xref="GeneID:8925443"
     CDS             complement(174329..174736)
                     /locus_tag="HVO_RS05640"
                     /old_locus_tag="HVO_0192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045307.1"
                     /db_xref="GeneID:8925443"
                     /translation="MATRAQLTALLVSLALVGGGVLGFGFAADEDYSYRYEQQLSETP
                     ETVPPLYSELSQSEQRAVDRALAGEVLRFEDDPGNLPGLVERDGNYYAFEFDATTDYT
                     APTTVGSLVAVLLGAVGVVATVRWELASRYVTY"
     gene            174892..176016
                     /gene="cdc6"
                     /locus_tag="HVO_RS05645"
                     /old_locus_tag="HVO_0194"
                     /db_xref="GeneID:8924784"
     CDS             174892..176016
                     /gene="cdc6"
                     /locus_tag="HVO_RS05645"
                     /old_locus_tag="HVO_0194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968942.1"
                     /note="Involved in the initiation of DNA replication;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ORC1-type DNA replication protein"
                     /protein_id="WP_004045308.1"
                     /db_xref="GeneID:8924784"
                     /translation="MREDPEEGMLSWDETVFRDEHVFEIDHVPETFNHRESQLRSLKY
                     ALRPAVRGSRPLNTMVRGPPGTGKTTAVQKLFGELGTQSGVRTVRVNCQVDSTRYAVF
                     SRVFEHIFEYEPPSSGISFKKLFGQITDRLVEDDEVLVVALDDVNYLFYENEASDTLY
                     SLLRAHEAHSGARIGVIIISSDLSLDVIDELDGRVQSVFRPEEVFFPRYDVDEIVDIL
                     RGRSKRGFHEDVIGAPELDQVAEFTADSGDLRVGIDLLRRAGLHAEMRASRTVDMEDV
                     EAAYDKSKYVHLSRCLQGLSDPERELVRVVAEYDGERAGAVYDAFNEATGLGYTRYSE
                     LVNKLDQLGVIEARYTEIEGRGRTRAISLAYDADAVLDRL"
     gene            176077..176769
                     /locus_tag="HVO_RS05650"
                     /old_locus_tag="HVO_0195"
                     /db_xref="GeneID:8926325"
     CDS             176077..176769
                     /locus_tag="HVO_RS05650"
                     /old_locus_tag="HVO_0195"
                     /EC_number="5.3.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase RpiA"
                     /protein_id="WP_004045309.1"
                     /db_xref="GeneID:8926325"
                     /translation="MKTTGGTDAQKRRAAAAAVEAVEDGAVVGLGTGSTTAFAIRAIG
                     DRVADGLDVRGVPTSFAARELARECGIPVVDLDEVDAVDLAIDGADQVALADSALVKG
                     GGAAHAREKVVDAFADRFLVVADPSKIAETLSHAVPVEVLPSARTTVAAGVSDLGGEA
                     TLRRAERKDGPVVTDNGNLVLDCEFGAIPNPESLATDLASLPGAVEHGLFVGLADAVY
                     VGTDDGVEVTEL"
     gene            complement(176934..177101)
                     /locus_tag="HVO_RS05655"
                     /old_locus_tag="HVO_0196"
                     /db_xref="GeneID:8925569"
     CDS             complement(176934..177101)
                     /locus_tag="HVO_RS05655"
                     /old_locus_tag="HVO_0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020222877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1931 family protein"
                     /protein_id="WP_004045310.1"
                     /db_xref="GeneID:8925569"
                     /translation="MADLIVKAAVKEALKDKNVASDFYDALDEEVKELLEDAARRAEQ
                     NDRKTVQPRDL"
     gene            177286..178047
                     /locus_tag="HVO_RS05660"
                     /old_locus_tag="HVO_0197"
                     /db_xref="GeneID:8925084"
     CDS             177286..178047
                     /locus_tag="HVO_RS05660"
                     /old_locus_tag="HVO_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel pincer cofactor biosynthesis protein
                     LarB"
                     /protein_id="WP_004045311.1"
                     /db_xref="GeneID:8925084"
                     /translation="MRDILEAVADGSLSPAEAEVRLSGYATTDAGRFDAARETRRGVP
                     EAILAEGKTPDETATLAVAAVETSGRALVTRADTAHAEAVADALPDADIDRDARAKTV
                     VAAAPEFERPDLDATVAIATGGTSDAEAAGEAAAVLREMGVDVERIEDVGVAHLGRVL
                     DNLDTLREADVVVVAAGREGALPTVVAGLVDTPVIGLPVSTGYGHGGDGEAAVLGMLQ
                     SCTVLSAVNVDAGYIAGAQAGLIARAVADARDDDA"
     gene            178439..178678
                     /locus_tag="HVO_RS05665"
                     /old_locus_tag="HVO_0198"
                     /db_xref="GeneID:8926147"
     CDS             178439..178678
                     /locus_tag="HVO_RS05665"
                     /old_locus_tag="HVO_0198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GIY-YIG nuclease family protein"
                     /protein_id="WP_004045312.1"
                     /db_xref="GeneID:8926147"
                     /translation="MHFVYVIECNDGSLYTGYTTDVERRVAEHDAGEGAKYTRGRTPV
                     ELVHVEEFDSKSAAMSREYEIKQLRRREKQRLVES"
     gene            178741..180114
                     /locus_tag="HVO_RS05670"
                     /old_locus_tag="HVO_0199"
                     /db_xref="GeneID:8924370"
     CDS             178741..180114
                     /locus_tag="HVO_RS05670"
                     /old_locus_tag="HVO_0199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase/phosphomannomutase family
                     protein"
                     /protein_id="WP_004045313.1"
                     /db_xref="GeneID:8924370"
                     /translation="MDEISFGTDGWRATLDTFTDDRVRVVGQAVADYLADEGFTAPVL
                     VGYDARETSPGFAESLAEVVAGNGFDVLLPERDCPTPLVAYAIADRGLSGALMVTASH
                     NPPEYNGVKFIPSDGAPALPDVTDAVAERLAEPDLLPESERGTIERVDVVSPHADHAM
                     DLVGDDLSDLTVVYDAMHGSGRGVTDALLEAAGAEVVRLRCERDADFGGISPEPSAEN
                     LGGLAEAMAEHDADLGVANDGDADRIGIATPDRGVLDENLFFAAVYDYLLESDSGPAI
                     RTVSTTFLIDRIAEAHGEEVFETAVGFKWVADGMREHDALMGGEESGGFSVRGHVREK
                     DGVLMGLLAAAATAEEDFDARLDRIEAEHGDIVADKISVACPDAEKARVIDDLEDVLP
                     ETVAGRDIAKVVTLDGFKLLLDDGSWLLVRPSGTEPKMRVYAEAGSEDAVSTLLEAGR
                     ELVEPLV"
     gene            complement(180124..180504)
                     /locus_tag="HVO_RS05675"
                     /old_locus_tag="HVO_0200"
                     /db_xref="GeneID:8926320"
     CDS             complement(180124..180504)
                     /locus_tag="HVO_RS05675"
                     /old_locus_tag="HVO_0200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_004045314.1"
                     /db_xref="GeneID:8926320"
                     /translation="MAHRDRSDRILTDWDRVFDALADPSRRYVLEYLHDRSEPASVWD
                     LAVALAVRTTDLPPDEVDVQVVQQAEVGIVHVHLPKLQAADLVESGGDGVSLTEHAET
                     LPLFTPAYRGVVRPVGDEEERREP"
     gene            complement(180588..180998)
                     /locus_tag="HVO_RS05680"
                     /old_locus_tag="HVO_0201"
                     /db_xref="GeneID:8925454"
     CDS             complement(180588..180998)
                     /locus_tag="HVO_RS05680"
                     /old_locus_tag="HVO_0201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_004045315.1"
                     /db_xref="GeneID:8925454"
                     /translation="MEDTERDRETGGARVREGDPDELVAVMRVLDAGLLEADAGEIRD
                     RLAAGDCLVAEASGRVVGALALDGDYIEAVAVSPSRRGRGVGTQLVRAALDRRGRLVV
                     DFDGGVKPFYESLGFDIEDRSDDEGRFRGVLRDE"
     gene            complement(181007..181207)
                     /locus_tag="HVO_RS05685"
                     /old_locus_tag="HVO_0202"
                     /db_xref="GeneID:8926718"
     CDS             complement(181007..181207)
                     /locus_tag="HVO_RS05685"
                     /old_locus_tag="HVO_0202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MoaD/ThiS family protein"
                     /protein_id="WP_004045316.1"
                     /db_xref="GeneID:8926718"
                     /translation="MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGR
                     PVPEDQSVEVDRVKVLRLIKGG"
     gene            181313..182296
                     /gene="rfc"
                     /locus_tag="HVO_RS05690"
                     /old_locus_tag="HVO_0203"
                     /db_xref="GeneID:8925016"
     CDS             181313..182296
                     /gene="rfc"
                     /locus_tag="HVO_RS05690"
                     /old_locus_tag="HVO_0203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275527.1"
                     /note="Part of the RFC clamp loader complex which loads
                     the PCNA sliding clamp onto DNA; in Methanosarcina and
                     Methanococcoides the RFC clamp loader is made up of 2
                     similar small subunits and one large subunit; the proteins
                     in this cluster are small subunit 1 which is necessary for
                     clamp loading activity; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication factor C small subunit"
                     /protein_id="WP_004045317.1"
                     /db_xref="GeneID:8925016"
                     /translation="MSEAAESGDAPAGREIWIEKYRPQTFDDVYGQDDIVERLRSYIE
                     RDDLPHLLFAGPAGVGKTTSATAIARAIYGDDWRGNFLELNASDERGIDVVRDRIKNF
                     ARSSFGGHDYRVIFLDEADSLTNDAQSALRRTMEQFSDNTRFILSCNYSSKIIDPIQS
                     RCAVFRFSPLGDDAIAEQVRDIAAAEDIEVTEDGLDALVYAAGGDMRRAINSLQAAAT
                     TGEVVDEEAVYMITSTARPEDIEEMVRAAIDGEFTAARKQLETLIVDTGMAGGDIIDQ
                     LHRSVWEFDLDERDAVRLMERIGEADYRISEGANEQVQLEALLASLALSQN"
     gene            complement(182364..184730)
                     /locus_tag="HVO_RS05695"
                     /old_locus_tag="HVO_0204"
                     /db_xref="GeneID:8924148"
     CDS             complement(182364..184730)
                     /locus_tag="HVO_RS05695"
                     /old_locus_tag="HVO_0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_049914914.1"
                     /db_xref="GeneID:8924148"
                     /translation="MHATDPTVFVDDDFDDIALGDGVTVASASDENDPSDAACVVVTD
                     PDAEIPRDVPTILYTEVSPEAVERPARFDAYVSRGDRSGLESQVRWVLASTADRDAEE
                     VALARNDAEWDRLKRLYEGTTDLITAGTVDELYERAIGLTEHILEFDNTSFFVHDGDS
                     FYVAANNDDMAGTGPIPSDTGLLGETHRTKRSFLVDDVRDHPVADPDDPAYRSAVSVP
                     LGDDGVFQAISNEVGAYDETDLTLAELLVSYVSETRSRIESEAAVRKSREQIERLHRG
                     ATELAAATSLDELFEQTVEITDDILEFDISYVGVVEDGYIVPAAISSDAPADGAERVP
                     LDDGGIAAEVYLSGNTDITDDVRNHPEARPVKRMYRAVLSVPIGDLGVFQATTFTPGA
                     FDERDAELAELLMAHVAVTAERIRAESRLREERDRSTALFEHVSDAAVAYDVEAGAVT
                     VRDVNRAFQSAFGYDADDVVGSDLLGRIVPPEPDPDPVPEPGADETIPELLVATGESY
                     RGEVRRRTDGGVREFILNVVPLSPGEERGAGYAIYTDITERKTRESELERQNERLEEF
                     ANIVSHDLRNPLSVARGNLELARETGDEVRFDTAERALEQMEELIDDLLSLARRGQLV
                     DETERVDLGAVARQAWATTDTGDAELVTSQSVVVDADEDRLAELLSNLFRNAVEHGST
                     GNQTASGDAVEHGSTGSRDTPDDAVEHDGRDVRVEVGGVDGGFYVEDDGPGIEPERRD
                     EVFEPGETTGEDGIGYGLAIVQSIAEAHGWSAIVTSGTAGGARFEFRA"
     gene            complement(184851..185336)
                     /locus_tag="HVO_RS05700"
                     /old_locus_tag="HVO_0205"
                     /db_xref="GeneID:8926571"
     CDS             complement(184851..185336)
                     /locus_tag="HVO_RS05700"
                     /old_locus_tag="HVO_0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan-rich sensory protein"
                     /protein_id="WP_004045319.1"
                     /db_xref="GeneID:8926571"
                     /translation="MKLASLRRRPAVELLAWVALAQLAGALGSVFTVTDAGSWYATLA
                     RPWFAPPNWVFGPVWVTLFTLMGVAAWLVSRRDHPRRERALAVFVGHLVVNVAWSAAF
                     FGLRSPAVGLAVIVVLLAAILATTREFAAVNRRAAALLVPYLLWTCFAAALNYGFWSL
                     N"
     gene            185459..188227
                     /locus_tag="HVO_RS05705"
                     /old_locus_tag="HVO_0206"
                     /db_xref="GeneID:8926581"
     CDS             185459..188227
                     /locus_tag="HVO_RS05705"
                     /old_locus_tag="HVO_0206"
                     /EC_number="6.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--tRNA ligase"
                     /protein_id="WP_004045320.1"
                     /db_xref="GeneID:8926581"
                     /translation="MSELEAEYRLDYFEEEGFYRKQCPVTGVHFWTRDPDRETCGEPP
                     ADDYTFIDNPGFDEEYTLEEMREKFLSFFEEHDHERIDPYPVAANRWRDDVLLTQASI
                     YDFQPLVTSGETPPPANPLTVSQPCIRMQDIDNVGKTGRHTMAFEMMAHHAFNAREEA
                     GDKYAYEGEVYWKDETVRLCDEFFESLGADISEITYIEDPWVGGGNAGPAFEVLYRGA
                     ELATLVFMSMKQDPDGDYELKDGNTYSPMDTYIVDTGYGLERWTWVSQGTPTVYEAVY
                     PDMIEFLKDNVGIEHTDEEEELIHRAAKLSGHLDIDEIDDLATARAEVAGELGVDEAE
                     LTSLLRPLEDIYAIADHCRTLAYMFGDGIVPSNVGTGYLARMVLRRTKRLVDNLGVDA
                     PLDELVDMQAERLDYQNRDTIRDIVRSEERKYRKTLERGSRKVQQLADDYADTDEPIP
                     LDELIELYDSHGIQPDMVQDIAEERGATVDIPDDFYSLVADRHEQVDGEGEADERDDR
                     LGDLPATDKLYYDDQERTEFEAVVLDVFEREEGYDVVLDQTMFYPEGGGQPADHGSLA
                     TDDTTVEVTDVQIVGDVVLHRTDEDPGKGEFVRGQLDAERRRRLMRHHTATHVIGHAI
                     RTVLGDHIRQAGASKGVDRSRLDVTHYDRITREEVTQIERVANEIVMRNIPVKQEWPD
                     RRDAEKKYGFDLYQGGIPPGEQIRLIHVGSDVQACGGTHVKRTGDIGAVKVLTTEPVQ
                     DGVERVVFAAGDAAVEATQRTEDALYGAADVLDVNPADVPETAERFFTEWKERGKTID
                     RLKTELAEARAAAGADEIDIDGTPAVVQRLDGDADELRATANALVEEGKVAVLGSAAG
                     GSAQFVVGVPDDVGINAGQVVGRLAGKVGGGGGGPADFAQGGGPDVDALDGALDEAPD
                     VLRTVLNA"
     gene            188332..189108
                     /locus_tag="HVO_RS05710"
                     /old_locus_tag="HVO_0207"
                     /db_xref="GeneID:8926082"
     CDS             188332..189108
                     /locus_tag="HVO_RS05710"
                     /old_locus_tag="HVO_0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta fold hydrolase"
                     /protein_id="WP_004045321.1"
                     /db_xref="GeneID:8926082"
                     /translation="MPTAVADGVELYYDSEGDGETVAFVGDAGYGAWQWGWQHAAVAG
                     RYESLVTDLRGAGRSDAPAGPYSVATLVSDLVAVLADANVRKAHLVGFGLGGLVALEA
                     ARTTNRARSLTLVGTAASGDGIDPDPLSAAPDDPAALRESLAPALSEEFRAEQPDVVE
                     QLVSWRKREDADPEAWAAQAAAVADYDAGPLYEVTVPTLVLHGGDDPVWPVEGGRALA
                     EGLPRGEFESFAGARHLVTVERSRLVNDALVSFLESLDDD"
     gene            189223..189936
                     /locus_tag="HVO_RS05715"
                     /old_locus_tag="HVO_0208"
                     /db_xref="GeneID:8925270"
     CDS             189223..189936
                     /locus_tag="HVO_RS05715"
                     /old_locus_tag="HVO_0208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045322.1"
                     /db_xref="GeneID:8925270"
                     /translation="MTRPRLAFLDASHGDSSTSRNFRRELDADLVEFDVTDGRLPDHF
                     DYDGVVISGSSSSVYWDEPWIRNLVSWVADADERGVPLLGVCFGHQVVAAALGGTVED
                     MGAFELGYNEIERTRPDDGNDILAGIGERFTVFTSHGDRVTELPSGADLLAENEFGVH
                     AFRRNHAFGVQFHPEYDTDTAEAIARQKDFLPDERIRSVVDGITPENYAAACEAKRLF
                     DNFVTYVNRTNAGSVESAA"
     gene            190112..191275
                     /locus_tag="HVO_RS05720"
                     /old_locus_tag="HVO_0209"
                     /db_xref="GeneID:8925915"
     CDS             190112..191275
                     /locus_tag="HVO_RS05720"
                     /old_locus_tag="HVO_0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_004045323.1"
                     /db_xref="GeneID:8925915"
                     /translation="MLDYLELEGDLTGEEKLVRDEARRFVDEQVKPDIGEHYEAGTFP
                     TDLIPKMGDLGFYAPNLDGYGLPGLGERAYGLLMQELEAGDSGLRSMASVQGSLVIYP
                     IHAYGSDEQKQRWLPKLGSGEAVGCFGLTEPQHGSDPSGMETRAERDADGYVLNGSKT
                     WITNSPIADVAVVWARDVSAEGSPVRGFLVETDRDGVTTNKIEGKLSMRASVTGEIGL
                     DDVRVPEEDVLPGVEGMNGPLSCLTQARFGIAWGVVGAARDAFEDARQYAKDRDQFGG
                     PIARFQLQQGKLAEMATQITNAQLMAHRLTDLKERGDLRHQQVSMAKRHNVRVAREVT
                     RTAREMLGGNGITTDYSPMRHMENIETVYTYEGTDDIHTLVLGADLTGIEAFH"
     gene            191384..191674
                     /locus_tag="HVO_RS05725"
                     /old_locus_tag="HVO_0210"
                     /db_xref="GeneID:8925112"
     CDS             191384..191674
                     /locus_tag="HVO_RS05725"
                     /old_locus_tag="HVO_0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045324.1"
                     /db_xref="GeneID:8925112"
                     /translation="MTTSAQDRPTALDLSREETWIVHAALLDAIERAVDADEEPTPAP
                     GLLARVEAGDEDFDSAELDYLVDALRTYRTQAPARDDHHISRVLEHIEAARA"
     gene            191877..192200
                     /locus_tag="HVO_RS05730"
                     /old_locus_tag="HVO_0211"
                     /db_xref="GeneID:8924617"
     CDS             191877..192200
                     /locus_tag="HVO_RS05730"
                     /old_locus_tag="HVO_0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin family protein"
                     /protein_id="WP_004045325.1"
                     /db_xref="GeneID:8924617"
                     /translation="MAIDSNFDQNRERAGEENGVAVWGPVEPPEKLGIHGTHVAVDYD
                     ICLADGACLENCPVDVFTWVDTPDHPVSEKKVEPTNEDQCIDCMLCVDICPVDAIDVD
                     ASRQA"
     gene            192245..192619
                     /locus_tag="HVO_RS05735"
                     /old_locus_tag="HVO_0212"
                     /db_xref="GeneID:8923993"
     CDS             192245..192619
                     /locus_tag="HVO_RS05735"
                     /old_locus_tag="HVO_0212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_004045326.1"
                     /db_xref="GeneID:8923993"
                     /translation="MGLIHTALVVSDIDATLDFYADLGLERTNEFELDGVRNVYVGSD
                     DTDMELQFKYDPTSAARVEPAGIDHVAVEVADADRAFEDIVEAQSPDIVKPPVDIDPV
                     NARAAFVKDPDGYVVELVSIED"
     gene            192742..193194
                     /locus_tag="HVO_RS05740"
                     /old_locus_tag="HVO_0213"
                     /db_xref="GeneID:8926713"
     CDS             192742..193194
                     /locus_tag="HVO_RS05740"
                     /old_locus_tag="HVO_0213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rubrerythrin"
                     /protein_id="WP_004045327.1"
                     /db_xref="GeneID:8926713"
                     /translation="MSEDVTALLKRAYQDEIETVMNYMTNSIVLDGVRAEEIKESLQT
                     DIQEELTHAEQLGNRLKQLDEQPPGSASFEARQHDLQPPEDSTDVLAVINGVLTAEED
                     AIETYRALIDAAEEANDPVTEDLAVTILADEEAHRTEFRGFKKEYDRE"
     gene            193386..194348
                     /locus_tag="HVO_RS05745"
                     /old_locus_tag="HVO_0214"
                     /db_xref="GeneID:8925662"
     CDS             193386..194348
                     /locus_tag="HVO_RS05745"
                     /old_locus_tag="HVO_0214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="WP_004045328.1"
                     /db_xref="GeneID:8925662"
                     /translation="MSTERGKGTVAVVGGAGAVGSSTAFALMESSLVGEIILVDIAEE
                     RVEGEAMDLNHGAYFTSPVRVRTGDYEDCWDADVVIVTAGASQKPDETRLDLMERNAD
                     IFADMIPQITEGLNDDAVMLIVTNPVDVLSYVTWKVSDLPAERVIGSGTVLDTSRFRH
                     SLSREFDLDPANVHAYVVGEHGDSEVLVWSSANLGGIPFESYATSHGVDDIDALKARV
                     EEEVREAAYEIIERKERTNYGVARSVAATTERILGGDNSILTVSTLVSGEHGIDDVYM
                     SLPCTVNQSGVRDVHEFDLSADETAALRESAGVIRESIDRLDLQ"
     gene            complement(194367..196481)
                     /locus_tag="HVO_RS05750"
                     /old_locus_tag="HVO_0215"
                     /db_xref="GeneID:8924698"
     CDS             complement(194367..196481)
                     /locus_tag="HVO_RS05750"
                     /old_locus_tag="HVO_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S dicluster domain-containing protein"
                     /protein_id="WP_004045329.1"
                     /db_xref="GeneID:8924698"
                     /translation="MDFAAQADVTRETFWTISPVGEALFYGLAAIASLVFLYGVYERF
                     ARYAKGGEDPFDRLSDLPGRTVRAAKVVFSNEKQFKRDRFAGVMHAFIMWGFLTLLIG
                     TTILAIDIDVWRRVTGSSFFVGDFYLSYSFVMDLMGLLFVVGVGMALWRRYGVRHPRL
                     WGKHTGFEDAAFVWTLFFLGVGGYVLEGIRIVGTDFPDFETVSFVGYFVALVFDAAGM
                     GQGLAQTLYWFGWWSHALLALAFVAAVPYAKPLHMLTSFANVVTADEKAGTRLPKVPA
                     DTPPDEIGYVSEDDFSWKAMLDMDACTKCGRCTDACPAKASGRNLDPRDVILDLKAYR
                     ESVDAGGDSIDIVADGGTSVVDAESMESCMACMACMDACPVDIEHLTHFTEMNRRLTE
                     TGQQQEPVQEAMMNIFQNGNAFGDPQRKRPDWTDDLDFEVPDARDESVEFLWYVGDYP
                     SYDERNRAVARSLAQIFEEAGVSYGILYEDEGHDGNDVRRVGEEGLYEMLVEDNVDAM
                     ADCEFDKIVCTDPHSYNTFKNEYPEMDDSFDYPVYHYTQLVERLVGDDRLGLAGDELA
                     AQTVTYHDPCHLGRYNGEYEAPREVIRATGVELAEMPRNRDQSFCCGGGGGGLWMDHD
                     EESKPSEERLREALDDTTGGVERFVVACPMCATMYEDGRKTGDYEEAIDVVDISELVV
                     EALDAKAAATGTGADTTPASAD"
     gene            complement(196563..197267)
                     /locus_tag="HVO_RS05755"
                     /old_locus_tag="HVO_0216"
                     /db_xref="GeneID:8924394"
     CDS             complement(196563..197267)
                     /locus_tag="HVO_RS05755"
                     /old_locus_tag="HVO_0216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter permease"
                     /protein_id="WP_004045330.1"
                     /db_xref="GeneID:8924394"
                     /translation="MLTYEPGDTLAHRLDPRTKLAVQVAFAAAGFAHTTPAGLVALGV
                     VAAGCLRAADASPVSALRDLRYAIPLLALGPVVEAARLGAPWFDLEAAVEPALASVRV
                     LLVFFVAAAYVRTTPVRESRAAIQLLVPGRFGVALGVGVALVFRFLPLVRRDLRRVRE
                     AQAARLGSERRLDERLSLVAAAGLRRSFARADALALALRARCFAWNPTLPEIRFGRRD
                     APGLVLAAALLVSLAL"
     gene            complement(197261..197962)
                     /locus_tag="HVO_RS05760"
                     /old_locus_tag="HVO_0217"
                     /db_xref="GeneID:8924182"
     CDS             complement(197261..197962)
                     /locus_tag="HVO_RS05760"
                     /old_locus_tag="HVO_0217"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004045331.1"
                     /db_xref="GeneID:8924182"
                     /translation="MIRVEGLVHRYGDTVAVNGVDLAIDDGECVVVAGANGSGKTTLV
                     RHFNGLLDPDEGTVSVNGRTVSDHLVAARTAVAMVFQHPEDQLVAATVGADVAFGPEN
                     LGLDRGDIDRRVRESLAAVNLDGREDERVDSLSGGEVERLAIAGALAMRPDHLVLDEP
                     FTGLDEPARRSVLARLRDLRAEGTSLVVVTHDLRDVAELADRVVVLADGDVALDAAPD
                     EAADRLPDLDVRPPC"
     gene            complement(197963..198541)
                     /locus_tag="HVO_RS05765"
                     /old_locus_tag="HVO_0218"
                     /db_xref="GeneID:8926117"
     CDS             complement(197963..198541)
                     /locus_tag="HVO_RS05765"
                     /old_locus_tag="HVO_0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004968964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin transporter BioY"
                     /protein_id="WP_004045332.1"
                     /db_xref="GeneID:8926117"
                     /translation="MATERESVELVGDELVGNIARAALFAALMGASGYVSFPNPISPI
                     PVTMQVLVVFLAGIFLGPVWGGGSIALYLAAGGLGAPVFAGGSAGLAPLVGPTAGYLW
                     SYPVAAVVVGLVVHGGISAGDYRVSTPRLVGAMVAGTVVVYAFGTLGFAYVNRVGLES
                     AFWTASAAFIPAEAFKIAAAVGIVRSDAIAAQ"
     gene            198709..199314
                     /locus_tag="HVO_RS05770"
                     /old_locus_tag="HVO_0219"
                     /db_xref="GeneID:8925311"
     CDS             198709..199314
                     /locus_tag="HVO_RS05770"
                     /old_locus_tag="HVO_0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045333.1"
                     /db_xref="GeneID:8925311"
                     /translation="MDEKTAELRDIFIEATGSDTVTEQQSESRGSLADVDDPEAVRER
                     VRDIVATMRERYAFDTEFDDDALVALVVGFFDGDSDADLAVELDASPEAVRTARFDLH
                     LVRDADREFPFDADRFDTLLVDGADDEAIVEALDVPVEVVSECRPVAEADIRSSRANY
                     RFRDDFAELLTDDDLSNRMAEDARRDGLREATEDIETDVSL"
     gene            199368..201476
                     /locus_tag="HVO_RS05775"
                     /old_locus_tag="HVO_0220"
                     /db_xref="GeneID:8926447"
     CDS             199368..201476
                     /locus_tag="HVO_RS05775"
                     /old_locus_tag="HVO_0220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="minichromosome maintenance protein MCM"
                     /protein_id="WP_004045334.1"
                     /db_xref="GeneID:8926447"
                     /translation="MAQAPQNRDLTERFIEFYRNYYREEIGTLAQQYPKEKRSLHIDY
                     DDLYRFDSELADDYITKPGQFQEYAEEALRLFDLPADVKLGQAHVRMRNLPETVDIRN
                     LRVNDDHIGTLISVQGIVRKATDVRPKITEAAFECQRCGTMSYIPQGDGGFQEPHECQ
                     GCERQGPFRIDFDQSNFVDSQKLRVQESPEGLRGGETPQSIDINLSDDVTGKVTAGDH
                     VTVVGVLHIEQQTSGNEKTPVFDYYMEGISLTIEDEEFEDMEISDEDVAEIVELSNDP
                     AIYEKMVESVAPAIYGYEQEKIAMILQLFSGVTKHLPDGSRIRGDLHMLLIGDPGTGK
                     SQMLSYIRHIAPRSVYTSGKGSSSAGLTAAAVRDDFGDGQQWTLEAGALVLADKGIAA
                     VDELDKMRPEDRSAMHEGLEQQQISVSKAGINATLKSRCSLLGAANPKYGRFDQYEPI
                     GEQIDLEPALISRFDLIFTVTDDPDPDEDSKLADHILKTNYAGELNTQRTNVANSEFT
                     EQQVDAVTDEVAPTIDADLLRKYIAYAKRTCYPTMTDEAKEVIRDFYVDFRARGADED
                     APVPVTARKLEALVRLGEASARVRLSDKVTREDAERVTGIVESCLRDIGMDPETGEFD
                     ADIVETGRSKTQRDRIKNLLELIRTMQEEYEEGAPHEEVLERANSELNMDEKTVNDQL
                     DKLKMKGDIYEPRGDVYRAT"
     gene            201577..201879
                     /locus_tag="HVO_RS05780"
                     /old_locus_tag="HVO_0221"
                     /db_xref="GeneID:8926626"
     CDS             201577..201879
                     /locus_tag="HVO_RS05780"
                     /old_locus_tag="HVO_0221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045335.1"
                     /db_xref="GeneID:8926626"
                     /translation="MDRISAIRNIEDAIRDLESGDADLASTEQRVVTVLRTFATEFED
                     DAGDGTLDAWTAVGDDRAEGLVVLAADADDARARVRDLLDEATGDADDVTFSVERV"
     gene            202030..202368
                     /locus_tag="HVO_RS05785"
                     /old_locus_tag="HVO_0222"
                     /db_xref="GeneID:8923998"
     CDS             202030..202368
                     /locus_tag="HVO_RS05785"
                     /old_locus_tag="HVO_0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045336.1"
                     /db_xref="GeneID:8923998"
                     /translation="MLLVVTYSQAARTTLRNICRTHDEVVVRQLGRAALFDETELAAF
                     LALRLREKHDEDVQIEQTQPFNEFAAVPDAVREAAAAYEDRESPATPYSKFASGTDHP
                     SAAEMQRREL"
     gene            202365..203306
                     /locus_tag="HVO_RS05790"
                     /old_locus_tag="HVO_0223"
                     /db_xref="GeneID:8925394"
     CDS             202365..203306
                     /locus_tag="HVO_RS05790"
                     /old_locus_tag="HVO_0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045337.1"
                     /db_xref="GeneID:8925394"
                     /translation="MRLRLPDGTAVEGRAIDLASDSVAVDADEVVAAIRADGRADAPG
                     AVRIDCSSPGPGHDRLGRVPVSDPAPSRGWLLAAVGRSRGRRAPVADDLDRLEAKLAE
                     HRDRAAGESNADDPERVDTSAAALRQARHRVAAAGEDESRLRERVATLRGRVNAHRDA
                     GDDEATAAARQELVEAATELSEVETERVAAEQRLSALEQASRAERDRRDARLKLEDAV
                     ENRRRDARAYFAAELGAEFEAALRDLASLPAAATPAVDSPPVPPAPESDPVARSLAAV
                     RLADLSAPVVLSCGRFSDAEAAADWLGAPVVRCSPSD"
     gene            203358..204212
                     /locus_tag="HVO_RS05795"
                     /old_locus_tag="HVO_0224"
                     /db_xref="GeneID:8925710"
     CDS             203358..204212
                     /locus_tag="HVO_RS05795"
                     /old_locus_tag="HVO_0224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045338.1"
                     /db_xref="GeneID:8925710"
                     /translation="MHSDIDVSADDGVALVSVRVDNDAPVDRRVRLRNRLDGPVLPPR
                     RAGVPEPGWDNEGFEGVVPAGSTVALGYAVPLSPPGDRDAEAVDADGLPEHAVDVETL
                     GRADESDEAADSTPEGAIRSLGSARPPADAVPVSADPPPTVSAPETPESAPDTAGDER
                     PDPLPRPDPDAAGGERSTPSEQPTDADVSAAVETREPRDHETQRPSEPASLAAVERRI
                     DLAERLDGASVADAAAALSEAERGVEALESLDADRERLRRLAARATALADRAADADPD
                     VDALRRLA"
     gene            204209..204871
                     /locus_tag="HVO_RS05800"
                     /old_locus_tag="HVO_0225"
                     /db_xref="GeneID:8926289"
     CDS             204209..204871
                     /locus_tag="HVO_RS05800"
                     /old_locus_tag="HVO_0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_004045339.1"
                     /db_xref="GeneID:8926289"
                     /translation="MILAVVSGKGGVGKSTLSFELAAELGSVVVDADLGMANLPYAPG
                     PDLHDVLAGRADPLEAVRSGGPVSILPCGRTLAGARAADTRLLADALHAVEAAYGDVV
                     VDCPAGMRADAGVPLAVADACVVVASPKGYALADAVRTRELARELGCGLAAVAVNRVV
                     DAVPLDAFADVLGAPATGIPADSRLAEAVERFEPVVASSPESLPSARIRELADAVRVS
                     GR"
     gene            complement(204965..205831)
                     /locus_tag="HVO_RS05805"
                     /old_locus_tag="HVO_0226"
                     /db_xref="GeneID:8923919"
     CDS             complement(204965..205831)
                     /locus_tag="HVO_RS05805"
                     /old_locus_tag="HVO_0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription initiation factor IIB family
                     protein"
                     /protein_id="WP_004045340.1"
                     /db_xref="GeneID:8923919"
                     /translation="MSEARSPQGCPECDGHLGFEAGETVCTDCGLVVSEYRIDHGPEW
                     RSFADDDRNPARTGAPLTRSRHDRGLSTEIGRSTRIKGRKRRQFARMRRQHNRARIST
                     KRERNQVYAFTEIRRVTSALSLPNHIRDQACSLFESAQNEDLLRGRSLEGFAAACVYA
                     ACRVAGVSRSVEEVCDVSKATEAEHQAAYGALNRDLGLPVAPADPTEYLPRFATKLDL
                     DSDTERRAREYVAEARDEGLVGGKNPCGVAAACLYTAASDRGEDCTQAEAADVADVTP
                     VTLRKTYVALRE"
     gene            205994..206515
                     /locus_tag="HVO_RS05810"
                     /old_locus_tag="HVO_0227"
                     /db_xref="GeneID:8924738"
     CDS             205994..206515
                     /locus_tag="HVO_RS05810"
                     /old_locus_tag="HVO_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045341.1"
                     /db_xref="GeneID:8924738"
                     /translation="MGLSEIAAALETTTTEQRSRCVPTVDDTDVSLRERFEAHADALP
                     CAPAAAERVVEAHGSGTSVGASARDAGVAPVTAAKLLHRCGEAGVTPLAPEARRIVRD
                     WIDGRISRADALALTGAEPSEFALATYVETHDPIDPLVEAVEGALADRTDAAVAKRDS
                     LAETMSSVTDMQF"
     gene            complement(206630..207373)
                     /locus_tag="HVO_RS05815"
                     /old_locus_tag="HVO_0228"
                     /db_xref="GeneID:8925632"
     CDS             complement(206630..207373)
                     /locus_tag="HVO_RS05815"
                     /old_locus_tag="HVO_0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division inhibitor"
                     /protein_id="WP_004045342.1"
                     /db_xref="GeneID:8925632"
                     /translation="MSIPTTIALVGATGGAGTTRLSLELAAALATDGRDVAVLDAAFA
                     TQGLSDYVSGTLDPDATALVTDAADVPLESGLVAFETDAEGRVAVCPAAAPFERLARA
                     MTPDAARAFEGRIAEAADGFDHVLVDAPLLASNQTVAAAAACDRVALVAPATDRGADA
                     VGRLSARAADIDTDIDAVVSTFGALDDADVVVPETEATGLADAPACREDAELAAGVAA
                     VAEVLLDIEIDAVAATDGVLGSVSEYVRR"
     gene            complement(207442..208257)
                     /locus_tag="HVO_RS05820"
                     /old_locus_tag="HVO_0229"
                     /db_xref="GeneID:8924434"
     CDS             complement(207442..208257)
                     /locus_tag="HVO_RS05820"
                     /old_locus_tag="HVO_0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045343.1"
                     /db_xref="GeneID:8924434"
                     /translation="MAVLQSFRTALRIVTETPVLVAFALAFGLVGALNNASGPAGAVG
                     SLLQLLAVPALTGAFYTVADGARPGSDTDLRASTAAQRYYVSLLGATLLAGLVVFVVA
                     MVVGGSVLGYVGFDRLNAVLNGSASLTPAELAASGVALVVLMAVVYVFIFFDTAVVLD
                     GQTAGGSLSRSVDFVLSNLRAVVGYAVVATAVTSVVDLPVLWFVTLDGATTVAGAVTA
                     FQAPMSTVDIAVVAVGSTVTTLVGRTYKVCFYRACADAAPGADPESGDGEWTA"
     gene            complement(208346..208762)
                     /locus_tag="HVO_RS05825"
                     /old_locus_tag="HVO_0230"
                     /db_xref="GeneID:8925370"
     CDS             complement(208346..208762)
                     /locus_tag="HVO_RS05825"
                     /old_locus_tag="HVO_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family protein"
                     /protein_id="WP_004045344.1"
                     /db_xref="GeneID:8925370"
                     /translation="MSDCIFCAIVDGDIPGRIVHETDQSLAFLDANPLAPGHTLVVPK
                     EHHARLDEVPADAAADLFAAVNDLVPRVEAAVDADATNVGINNGPAAGQEVDHVHVHI
                     VPRFEGDGGSPIHAVAGERPDLSDEELADIEAAISG"
     gene            complement(209051..209686)
                     /locus_tag="HVO_RS05830"
                     /old_locus_tag="HVO_0231"
                     /db_xref="GeneID:8924709"
     CDS             complement(209051..209686)
                     /locus_tag="HVO_RS05830"
                     /old_locus_tag="HVO_0231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_004045345.1"
                     /db_xref="GeneID:8924709"
                     /translation="MVDADPRFPDADETLVLEPDCARCPALVDCRNRISWGVGPDDAT
                     VMVVGEAPGAGNPDAERWRGGNWTGMSYTARHSGRRIRETMAAVGYESGVFYTNAVKC
                     FPSDGEGSNRAPTAAEKANCRDHLVSELEAVDPDVVVPTGRHATESVLALDDASLDGF
                     LDTVLDPVESERFGYTVVPLLHPSYRDVWLSRLGYELEEYLADLEALLPER"
     gene            complement(209687..209917)
                     /locus_tag="HVO_RS05835"
                     /old_locus_tag="HVO_0232"
                     /db_xref="GeneID:8925561"
     CDS             complement(209687..209917)
                     /locus_tag="HVO_RS05835"
                     /old_locus_tag="HVO_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045346.1"
                     /db_xref="GeneID:8925561"
                     /translation="MGRYGDIDYPRMTKTGLGLGLALFLFGAIGAKVALAVSGGAIPG
                     WERTLFFDAEWLGIALVLFSPIIFGIVLPLTE"
     gene            complement(209972..210823)
                     /locus_tag="HVO_RS05840"
                     /old_locus_tag="HVO_0233"
                     /db_xref="GeneID:8926399"
     CDS             complement(209972..210823)
                     /locus_tag="HVO_RS05840"
                     /old_locus_tag="HVO_0233"
                     /EC_number="2.7.6.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate diphosphokinase"
                     /protein_id="WP_004045347.1"
                     /db_xref="GeneID:8926399"
                     /translation="MLVPGASSQALAAALADELGESLAAVEYDRFPDGETLAAVPGFD
                     ADAATIVASTASNDAYVELLQLQDAVREAGASAVTTVIPYMGYARQDKAFEAGHPISA
                     RAVARAVSTTTDRVVLVNPHEDAVADFFDVPVDIVDAAGRLAEPLPELDAPLFLSPDS
                     GAIDIAETVRDAYGEGETDYFEKVRHSGTDVDITPSDADFEGRDVVITDDIIATGSTM
                     SEAVGVLADGGAKRVFCATVHPLLARNARTKLARAGIERVVGTDTIERDVSEVSVAPV
                     LAGEIER"
     gene            complement(210884..211711)
                     /locus_tag="HVO_RS05845"
                     /old_locus_tag="HVO_0234"
                     /db_xref="GeneID:8924238"
     CDS             complement(210884..211711)
                     /locus_tag="HVO_RS05845"
                     /old_locus_tag="HVO_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045348.1"
                     /db_xref="GeneID:8924238"
                     /translation="MADFDLSIDEKRVYADKSGKQTAYVAAGVGVVTVDVSDDLVGGF
                     RIDRRCTALDAAGSPGEVVVATDEDVLLVQGDDYHELDFGPAAAVGFHRNRVVAADDS
                     GRVARFDESGWTDLGAVGAVRALDGSLVAADDGVYRIGDGGLSHVGLNDVTDVSDPAG
                     RLGGDSGTPLAATDSGLYALGNGWMDALDGAFSAVASMPDGRAHAVGPDGVVARDEES
                     GAWEAAPIPLDESVVALAHDARAAYAVTDAGSFCVRLTGGDWRTQVLGLETVGVAVR"
     gene            complement(211808..212152)
                     /locus_tag="HVO_RS05850"
                     /old_locus_tag="HVO_0235"
                     /db_xref="GeneID:8925118"
     CDS             complement(211808..212152)
                     /locus_tag="HVO_RS05850"
                     /old_locus_tag="HVO_0235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014732067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004065483.1"
                     /db_xref="GeneID:8925118"
                     /translation="MDSADDWRAALAETGRLSPQIVQAIVDAHGDRGVTAIEAVSERR
                     VKRYRDFDVVVGYDDEYVVEDRGCTCKDSQYNLDPDEGERCWHVLAVDVAEALDELDH
                     HDMWYSDVREFL"
     gene            212299..213429
                     /locus_tag="HVO_RS05855"
                     /old_locus_tag="HVO_0236"
                     /db_xref="GeneID:8926673"
     CDS             212299..213429
                     /locus_tag="HVO_RS05855"
                     /old_locus_tag="HVO_0236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973754.1"
                     /note="Dimethylates a single guanine residue of a number
                     of tRNAs using S-adenosyl-L-methionine as a methyl group
                     donor; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine(26)-N(2))-dimethyltransferase"
                     /protein_id="WP_004045350.1"
                     /db_xref="GeneID:8926673"
                     /translation="MHVSEGGVEIEVPDARDGASAGTGDDVFYNPTQELNRDITAAVL
                     RAFREREPRAESYLDAMAASGIRGVRAAAEGYDVTCADLDADAVELAQSNLDRAGNGG
                     EAVHRNANALMYDEVFDVVDLDPFGTPMPFADPTFANTRDLVCVTATDTAPLCGAHQK
                     SGIRKYGCLPQNTDYHPEMGLRTLLGAMVRTAARYDKAAVPILSHATRHYARAYLELD
                     ERATKADELLESTGFVYHCEDCLHREAERSLVAHPPEACANCDSTRILEAGPIWLGPV
                     SEPAFAGAVRDEVTEDFGTAKRARKLLDTLAVELDTPTHFDQHRLCKLWGRSASKMET
                     FLETLRDAGYDATPAHYHGTAFKTDATVAEIREVTAALDPEA"
     gene            213507..214844
                     /locus_tag="HVO_RS05860"
                     /old_locus_tag="HVO_0237"
                     /db_xref="GeneID:8926042"
     CDS             213507..214844
                     /locus_tag="HVO_RS05860"
                     /old_locus_tag="HVO_0237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihY/virulence factor BrkB family protein"
                     /protein_id="WP_004045351.1"
                     /db_xref="GeneID:8926042"
                     /translation="MSANIRTAVPVARAVVDTIREKEISFLAASISYYALVSLIPLLV
                     LGVVVATAVGGAALQAQLQTLVEQYLVPTGQGLVEEALSDRTGQGSVGAVGLGLTVWG
                     ALKLFRGLDIAFSRIYGSEAGGLLDQLRDGAIALASIGVGTIGVAVLTALLGLLDVPF
                     LQLLSPLLLLLTLCAAFFPLYYVFPDADLSPRQVVPGTVFAAVGWTLLGVGFGIYASV
                     AGASVAGALGTLLLLVTWFYFSGLILISGAVVNAVLAGVGGDASPAEPRDPPGGPRGV
                     DRQVQHTGGRHDARTDMSDDRGDTDGPRTEDADDAETGASVSPRGAPDIEELESQVEE
                     LRADLDAFEDDVTDRTVEKPKLEAELKRYVRRRMRRGKARGWGPYLVLGYGVVLTLGA
                     FHYLQSDLIAVVAMLIIFLSTLGLYVLFVIFGIGLSALGVPGRAIDAVRKRRG"
     gene            214846..215811
                     /locus_tag="HVO_RS05865"
                     /old_locus_tag="HVO_0238"
                     /db_xref="GeneID:8924761"
     CDS             214846..215811
                     /locus_tag="HVO_RS05865"
                     /old_locus_tag="HVO_0238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="WP_013035308.1"
                     /db_xref="GeneID:8924761"
                     /translation="MFRSALSLQTRGFGELVLADAPDALVFLFGLVTQLGDQWFFFVA
                     FTSLYWLCRPRITARPRRTAASFVGLALGSLALVTALKVGFALPRPPTAAVAAAPAWP
                     SPLSDLFVSFTTDDGFGFPSGHALGTTVVYGAAVSLLDVWDRRRRLVAAAVVVGIVSL
                     SRVFLGVHYGVDIVVGVLLGLGFLKAVSVVAAADDPDATGHLDPARLFAIAAGLSVLA
                     LAVVFATGLSGHTENAAAALGGSLGGLFGWTRLAGHESLPTLSPPVALVAFLGAGGLW
                     VGVDVADASVPVTVLVTAAVVAFILVAPRIQGRLGLGNGATRRAD"
     gene            complement(215944..217314)
                     /locus_tag="HVO_RS05870"
                     /old_locus_tag="HVO_0239"
                     /db_xref="GeneID:8924457"
     CDS             complement(215944..217314)
                     /locus_tag="HVO_RS05870"
                     /old_locus_tag="HVO_0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I glutamate--ammonia ligase"
                     /protein_id="WP_004045354.1"
                     /db_xref="GeneID:8924457"
                     /translation="MTEDNALTDGGLSDEAQAVIDEIEEKNVDFLRLQFTDILGTVKN
                     VSIPASQAEKAFTEGIYFDGSSIDGFVRIQESDMRLEPDPSTFAVLPWRKKENSAAGR
                     LICDVFNTSTGEPFSGDPRGVLKRAIERAEELGYDVNVAPEPEFFLFEEDEDGRATTV
                     TNDAGGYFDLAPKDLASDVRRDIIYGLESMGFDIEASHHEVAEGQHEINFTYDDALST
                     ADNVATFRSVVRAIAAEHDLHATFMPKPIPRINGSGMHTHISLFKDGENAFHDGDDEF
                     DLSDTAKSFVAGILDHAPAITAVADPTVNSYKRLVPGYEAPVYIAWSDRNRSALIRKP
                     AARTPAASRIEARFPDPSCNPYLAFAALIHAGLDGVEKGLDCPDPVRENIYEFDEAKR
                     EEYGIETLPKDLGGAVDALEEDEVIQEALGDHVFEKFVEAKRSEFKDYLVDVSQWELD
                     RYLETF"
     gene            217441..217899
                     /locus_tag="HVO_RS05875"
                     /old_locus_tag="HVO_0240"
                     /db_xref="GeneID:8925321"
     CDS             217441..217899
                     /locus_tag="HVO_RS05875"
                     /old_locus_tag="HVO_0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_004045355.1"
                     /db_xref="GeneID:8925321"
                     /translation="MTYENLDAKLINALLGDGRASLRSLAEELDVSVTTVSNHLRDLE
                     DEGVIEGYTPRVNYDALGYDVTAVIQLKVEGSALPEITERLRAEKQMISVYEVTGDYD
                     IIAIGKFRDTDGMNTQIKKLLTDADIRESNTSVVLNAVTENEQFDLDLEE"
     gene            complement(218337..219419)
                     /locus_tag="HVO_RS05880"
                     /old_locus_tag="HVO_0242"
                     /db_xref="GeneID:8926315"
     CDS             complement(218337..219419)
                     /locus_tag="HVO_RS05880"
                     /old_locus_tag="HVO_0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004595377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_004045357.1"
                     /db_xref="GeneID:8926315"
                     /translation="MDPRIREHARTIVDHSTSVEAGDNVVVSAPSVAEDLVTAIHELL
                     GDRGANVVAMDANPRFTRAFLRAGDDDYETPEHVLALYEETDVIIRVRGETNATEQSD
                     VPPETNAAYKRAYKPVQGEMLSKRWCLTQYPAKGSAQLAGMSTEAYENFVYDAVTLDW
                     DAQGELQQQLVDILNDGDEVRITSGDETDVTMSIAGNTAINDTAEHNLPGGEVFTAPV
                     RDSVNGEVHFDLPLYRQGREVSGVRVRFEDGEVVDYSAEGNEEVLDGVFDTDEGARYL
                     GELGIGMNRGIDQFTYNMLFDEKMGDTVHMAVGSAYPETVGADNELNESAEHVDMIVD
                     MSEDSVIEVDGEVVQRDGTFVFEDGF"
     gene            219536..220561
                     /locus_tag="HVO_RS05885"
                     /old_locus_tag="HVO_0243"
                     /db_xref="GeneID:8924094"
     CDS             219536..220561
                     /locus_tag="HVO_RS05885"
                     /old_locus_tag="HVO_0243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_004045358.1"
                     /db_xref="GeneID:8924094"
                     /translation="MIDLRSDTVTLPSDEMREAARDAAVGDDVYGDDPTVNELEARAA
                     ELVGKEAALFVPSGTMGNQIAARVHADPGQEALVDEKAHVYEWEVGGFAQLSGLQVRA
                     YDAGERAAPTPAQVRDHAREESLHVAGTGVLCLENTHNARGGVAVPKADIDAAADAAR
                     DLGIPVHLDGARLFNACVALDEDPTAMVERVDTVMCCLSKGLGAPVGSMLAGPEAFIE
                     EAVRVRKQFGGGMRQAGLIAAPGLVALDNVDRLADDHANATVLAEGLDAVSGLSVPTP
                     DTNIVVVDSEGAGLTAEEFVELCDDVGVLGGTFGQYHTRFTTNLNVSRADVERAVDLV
                     ADAVESR"
     gene            complement(220622..221566)
                     /locus_tag="HVO_RS05890"
                     /old_locus_tag="HVO_0244"
                     /db_xref="GeneID:8924987"
     CDS             complement(220622..221566)
                     /locus_tag="HVO_RS05890"
                     /old_locus_tag="HVO_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_013035473.1"
                     /db_xref="GeneID:8924987"
                     /translation="MAGSTSVVVAALFANGVIAVLKFLGYLATGSPSMLSETYHSISD
                     TGNQVFLLIGIRDSKRGETQSHPFGHGKSQFFYSFLVSVMLFGIAGWESAKHGYDALM
                     HPGHGGGGEALVLLGFEIEPVLVNVAILLGAIAFESYAFLKANAELRRQIEEYEWSGL
                     VEAFRETSDVTTLTAFTEDTVALVGAVLALAGIGLTELTGNELFDAGAALLIGILLMG
                     FAIALAWENKRLLIGESVPVDEEQALRDIVKNDPRVVHIDHFRASYVGPEKLLVALDV
                     SFDPELDTEELDDHITEIEDELKAADDRVHFVYIEPEL"
     gene            221699..222217
                     /locus_tag="HVO_RS05895"
                     /old_locus_tag="HVO_0245"
                     /db_xref="GeneID:8925502"
     CDS             221699..222217
                     /locus_tag="HVO_RS05895"
                     /old_locus_tag="HVO_0245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_004045360.1"
                     /db_xref="GeneID:8925502"
                     /translation="MLVVVSDTHSTDGHRLTDRTLDAVREADLVVHAGDFMRESVLDA
                     FVDEADSFLAVYGNNDGSEIRDRIPAARNVIYGGVEFAVTHTRRGGNTALSMFGRERG
                     ADAVVFGHSHRPGFHGTGPIPLLNPGSHAQPRGNRKAHAELEELPDGGLRGRLVTVDG
                     ETFETFRIVPDE"
     gene            complement(222424..223386)
                     /locus_tag="HVO_RS05900"
                     /old_locus_tag="HVO_0246"
                     /db_xref="GeneID:8924443"
     CDS             complement(222424..223386)
                     /locus_tag="HVO_RS05900"
                     /old_locus_tag="HVO_0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_013035407.1"
                     /db_xref="GeneID:8924443"
                     /translation="MADLIPSSPGDPDDDRDDRDPKVIGLDSDEADDLLGAISSSTAR
                     TVLASLHESPATPSDLAAEIDTSLQNVQYHLGNLSEAGLIEVADTRYSEKGREMNVYT
                     PADRALVVVAGREDETKGLKGALTRLIGGVGVLGIGAAVVNRLARAGSMLPFGLGGST
                     GGAGDSGAGQSGGSGADLNATRTADSANATPATAETASTPTRTATETATTDGGGGFSI
                     AEATTTADSTTQTAEATRTAVESTPTVTEAAQTATETVTATPTQTPVPDTTAAQTATE
                     TAARVTSGSGGLAETIGTLSPGTLFFLGGLTVLLAWVAVGVLRD"
     gene            223693..224892
                     /locus_tag="HVO_RS05905"
                     /old_locus_tag="HVO_0248"
                     /db_xref="GeneID:8926038"
     CDS             223693..224892
                     /locus_tag="HVO_RS05905"
                     /old_locus_tag="HVO_0248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic phosphate transporter"
                     /protein_id="WP_004045364.1"
                     /db_xref="GeneID:8926038"
                     /translation="MVAAGTLATFVVAALASLFMAWAIGAGSSGSTPFAPAVGANAIS
                     VMRAGFIVGLLGFAGAFLQGANVTNAVGTELIGGVTLTAGAAVVALLTAAVLVAIGVF
                     AGYPIATAFTVTGAVVGVGLAMGGDPAWSKYQQIVSLWVLTPFVGGGASYATARLLRA
                     DGVSERWTVPALAGLVGLLVANMEFAGLGGASGSASVARAAAVELTGLGGLGETGWFV
                     AASLLVALAAAAVVGRWVTTDKTRGQRRFLLVLGGLVAFSAGGSQVGLAIGPLVPLLD
                     VVAVPLPALLVGGGLGLLAGSWTGAPRMIKALAQDYSSLGPRRSIAAMIPSFAIAQTA
                     VALGVPVSFNEIIVSAIIGSGYAAGGSGVSGRKMLYTVLAWIGSLALALGLGYGVFTL
                     ASSVLGV"
     gene            224889..225164
                     /locus_tag="HVO_RS05910"
                     /old_locus_tag="HVO_0249"
                     /db_xref="GeneID:8924300"
     CDS             224889..225164
                     /locus_tag="HVO_RS05910"
                     /old_locus_tag="HVO_0249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045365.1"
                     /db_xref="GeneID:8924300"
                     /translation="MNVRALRVALTTLVSALWAAFGVYHVAMAVVTGISLRGFAFGTV
                     GLGAFALAIRFRGRARRLGDGTADATGLVVLALASLVLVVLSVTLLE"
     gene            complement(225232..226647)
                     /locus_tag="HVO_RS05915"
                     /old_locus_tag="HVO_0250"
                     /db_xref="GeneID:8925247"
     CDS             complement(225232..226647)
                     /locus_tag="HVO_RS05915"
                     /old_locus_tag="HVO_0250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyC/CorC family transporter"
                     /protein_id="WP_013035472.1"
                     /db_xref="GeneID:8925247"
                     /translation="MGLPPTQLPPASTLAAAQVSNIPLDDTTITVLGVAAIIVLVGLS
                     AFFSSSEIAMFSLAKHRVDSMVEEGIPGAERVKSLKDDPHRLLVTILVGNNIVNIAMS
                     SLATGLLAVLDFGAGESVLISTFGITTLVLLFGESAPKSYAVENTESWSLRIARPLKY
                     AELLLLPLVVLFDHLTRLVNRVTGGQTAIETTYVTRDEIQNLIETGEREGVIEEEERE
                     MLDRIFRFNSTIAKEVMTPRLDMTAVPKDATIDEAIETCVQADHERVPVYDGNLDNII
                     GIVNIRNLVREKYYGERGVGIADIVSPTLHVPESKNVDELMAEMQDTRMQMVVVIDEF
                     GTTEGLITLEDMVEEIVGDILEGDEEEPFESVDENTYLVRGEVNIDEVNEMLDIELPE
                     GEEFETLAGFIFNRAGRLVEEGEEISYNDIVIRIEQVDNTRIMKARIRTNAGIEAADG
                     NGDGDDEENGGDEEAEVEPDT"
     gene            226809..227072
                     /locus_tag="HVO_RS05920"
                     /old_locus_tag="HVO_0251"
                     /db_xref="GeneID:8925490"
     CDS             226809..227072
                     /locus_tag="HVO_RS05920"
                     /old_locus_tag="HVO_0251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_004045367.1"
                     /db_xref="GeneID:8925490"
                     /translation="MADEQPAITLYRLQACPFCERVVRTLDEQGLAYQSRFVEPMHSD
                     RNVVKRVSGKRSVPAIVDDNTGVTMSESANIVDYLEHTYGEGA"
     gene            227072..227578
                     /locus_tag="HVO_RS05925"
                     /old_locus_tag="HVO_0252"
                     /db_xref="GeneID:8926167"
     CDS             227072..227578
                     /locus_tag="HVO_RS05925"
                     /old_locus_tag="HVO_0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redoxin domain-containing protein"
                     /protein_id="WP_004045368.1"
                     /db_xref="GeneID:8926167"
                     /translation="MPEFDVVSLPDHDAPSVGDTAPDFTRPLVNAEFWEDAALSDLTD
                     DGPVLLVFHTMAGAFPATYVWNELRDRGVPDEVQTVGVSISSPYEHKSFLAERGVDAR
                     LFSDPAAGVAADYDLEHDLDGMAGVTEHRPAVFLLDEERTVQYRWVAAEWPDFPDYEG
                     IADALDDL"
     gene            227672..228271
                     /locus_tag="HVO_RS05930"
                     /old_locus_tag="HVO_0253"
                     /db_xref="GeneID:8924178"
     CDS             227672..228271
                     /locus_tag="HVO_RS05930"
                     /old_locus_tag="HVO_0253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008579724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_013035374.1"
                     /db_xref="GeneID:8924178"
                     /translation="MSDDVQRAAAAIRRGEAVVYPTETVYGMGADATNADAVERVFDI
                     KGRDRDNPLSAGFPDVDAALELVEVDDREEAFMRRFLPGPVTVVVERRDSLPDALVAG
                     KDRIGVRIPDHELALALFRASGTPVTATSANRSGTGSITHPSQLSDEIREAVAVVLDG
                     GTTPGTESTVVDPGRGVVHRRGAMADDIEAWLDEHDDDA"
     gene            complement(228343..229032)
                     /locus_tag="HVO_RS05935"
                     /old_locus_tag="HVO_0254"
                     /db_xref="GeneID:8924919"
     CDS             complement(228343..229032)
                     /locus_tag="HVO_RS05935"
                     /old_locus_tag="HVO_0254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045370.1"
                     /db_xref="GeneID:8924919"
                     /translation="MSALVAASDLACAAYCPRQLYYARRDDDRTPPPAVREVRALAFD
                     YPDLLDATDDELASRPISVSPAAYRERLTRLRERDDWDALTDPVARDELLAGKDCRGV
                     AHKLVGAPDGEGDRPPVPVPSLVSPGEPPERGVWEPQRVRAVALAKALAWEREAPVPR
                     ALVEYPAVGVVRTVGLTTGNKAAYRRALRVARDLDFVPSRLRDSAKCESCTYRERCGV
                     KTWSLSSLLGR"
     gene            229170..230783
                     /locus_tag="HVO_RS05940"
                     /old_locus_tag="HVO_0255"
                     /db_xref="GeneID:8925120"
     CDS             229170..230783
                     /locus_tag="HVO_RS05940"
                     /old_locus_tag="HVO_0255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008606067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermine synthase"
                     /protein_id="WP_004045371.1"
                     /db_xref="GeneID:8925120"
                     /translation="MASTATGSWLRMTRPELAVFVSGVTSMGLEILAGRMVAPEFGSS
                     IYTWGSIIGVFLAALSLGYHRGGQQAEQASNGALARVFIGTAAYIAGVILLGDLFIQS
                     TAGLPVPSRFASLPAITLLFGPPTYFLGFISPYAAELSGRTDVGSASGHVYAVGTVGS
                     IIGAFATTYVLIPSLSVTNIGLVFGLVSVVTALALVRPEIGREEAVWSVGIAAVLVLA
                     SATGGVGLDSRGSTVYHTQTAYQELRVADAGGTRTLYLDGQPHSAMDLDDPTRHVFDY
                     TSYFHVPFLLSDDIDRVLFVGGGGFTGPRVFLEKYPNVTVDVVELDPEVVDIAEEYFR
                     VEESPRLNVHTMDGRQYLRETNRTYDLIVLDAYQKDKVPFQLTTQEFMQLTSDRLDDD
                     GVLFANVISAPSGPASQFYRTEYKTIQSVYPQVYSFPTAGRVVVQNIEVVATKDETLV
                     TAEELQRRNRNRNIGIDLAAELTSYRNDEPTDDVPLLTDDRAPVDSLLDPMVGQRYVV
                     QRTNETEQRAADRNATPRSAVAGTAVRAA"
     gene            230787..231071
                     /locus_tag="HVO_RS05945"
                     /old_locus_tag="HVO_0256"
                     /db_xref="GeneID:8926012"
     CDS             230787..231071
                     /locus_tag="HVO_RS05945"
                     /old_locus_tag="HVO_0256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045372.1"
                     /db_xref="GeneID:8926012"
                     /translation="MVHDRIHAREPTHDRDRWTEGVVESTVERDGHWVARARPAGSDR
                     PADETVERAGDGSVELVVTFAVRDLFLRRLDVDAGESPVGCRFWYRKKRR"
     gene            complement(231140..231331)
                     /locus_tag="HVO_RS05950"
                     /old_locus_tag="HVO_0257"
                     /db_xref="GeneID:8926813"
     CDS             complement(231140..231331)
                     /locus_tag="HVO_RS05950"
                     /old_locus_tag="HVO_0257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045373.1"
                     /db_xref="GeneID:8926813"
                     /translation="MSIQPLDVLGGVMFLAGLTVVTGVVASAVAPGQRLGVGASLMVL
                     GTAAVAGPRMYQTALETTN"
     gene            complement(231538..232569)
                     /locus_tag="HVO_RS05955"
                     /old_locus_tag="HVO_0258"
                     /db_xref="GeneID:8923920"
     CDS             complement(231538..232569)
                     /locus_tag="HVO_RS05955"
                     /old_locus_tag="HVO_0258"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_004045374.1"
                     /db_xref="GeneID:8923920"
                     /translation="MNGPSELKPREAVRRYLDRRGTELSESSIKTYRYRLKLWVEWCE
                     DQNIERVSDLNGWTFEQFEAFRAGQGIASPTLHGEMETLLGFIEYLERIEAVEDGLSK
                     KVHVPSVPMSERSRDTMLVPDDALRLLRYYRSHSSVRGTRFHAVLELAWHTGARLGAL
                     RGLDLRDYYPDEQYVEFVHRPESETPLKNQMNGERTVSLLPEVVESLNTYIEKFRPDG
                     HDDFGRSPLFVTHHGTRISKNGFRGWMYQATQPCVAGPCPHEYEKDSCEFAGSYTQGS
                     KCPSSRSPHHIRTGSITWHRDRGFPAEVTAERVNASQEVIEQHYDKASQRERMELRRR
                     PHLDKLRIE"
     gene            complement(233026..233268)
                     /locus_tag="HVO_RS05960"
                     /db_xref="GeneID:25143406"
     CDS             complement(233026..233268)
                     /locus_tag="HVO_RS05960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045376.1"
                     /db_xref="GeneID:25143406"
                     /translation="MIFVGPERGGSSTALRKGPSIAMTEAKTTGVTTRIATDAAQFDK
                     GDESTCEVCLLRPAVGVDAETRLSACRKCAALEVDR"
     gene            233436..233702
                     /locus_tag="HVO_RS05965"
                     /old_locus_tag="HVO_0260"
                     /db_xref="GeneID:8925974"
     CDS             233436..233702
                     /locus_tag="HVO_RS05965"
                     /old_locus_tag="HVO_0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045377.1"
                     /db_xref="GeneID:8925974"
                     /translation="MTIWDDRILEWAREHESASAAAMKDTEYFQVSRSSLSRRLSKLN
                     EKGLLQHLGNGVYVITATGESYLEGELSAEELNGENGEEGSASA"
     gene            233714..234040
                     /locus_tag="HVO_RS05970"
                     /old_locus_tag="HVO_0261"
                     /db_xref="GeneID:8925123"
     CDS             233714..234040
                     /locus_tag="HVO_RS05970"
                     /old_locus_tag="HVO_0261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045378.1"
                     /db_xref="GeneID:8925123"
                     /translation="MRKSGDWMTIWDDRILEYLLEHGWGSPETIHWEIGRETTLHQIR
                     ERCRVLCHAGLASPFIDERSADMFEITIWGQLYLEGKVNAGLIRPLPKPRPPDKVRPR
                     YWSQIA"
     gene            234157..234963
                     /locus_tag="HVO_RS20100"
                     /old_locus_tag="HVO_0262"
                     /db_xref="GeneID:31787463"
     CDS             234157..234963
                     /locus_tag="HVO_RS20100"
                     /old_locus_tag="HVO_0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4747 family protein"
                     /protein_id="WP_004045379.1"
                     /db_xref="GeneID:31787463"
                     /translation="MEYDRKVRESLTDFVELEGAVAQGDSEEWYFGRPEFDANMIYGK
                     FGKVYADEPLTYDDEIGDFVEGDEPNKEADYSLFAIDLENNLVIFSSTYRVRHRNFTK
                     YLKKGYDSFTGGDASIHLELVRNKEGVETVIQNYPVHKIHAELVPSNPSPDEEWEELD
                     ESLREMLADKLGITAEQYNDGGLDFSESFLSQVASMSQSKYGESWEITYSDDDGEFKV
                     ISSDDDPASKVIDEEPTTTGGLKAHIEGILSYGLTFLDSVPHKASSASCF"
     gene            complement(235110..236276)
                     /locus_tag="HVO_RS05975"
                     /old_locus_tag="HVO_0263"
                     /db_xref="GeneID:8926832"
     CDS             complement(235110..236276)
                     /locus_tag="HVO_RS05975"
                     /old_locus_tag="HVO_0263"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISH3-like element ISH51 family transposase"
                     /protein_id="WP_013035611.1"
                     /db_xref="GeneID:8926832"
                     /translation="MSNNQQTDDEIHEDQLLNFLVNSLDEEVALSLAENAELDAEDIY
                     EVLVGACADGTSVSTLCKRSEDAPHENSVLYHLRTKFDLETLEQIGNTLLQKDILNVL
                     PQQVEVCADLHLRPYYGDEDDTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVRR
                     LEDGDTASSVLAEFLGILDGLDLGVKAVYLDREFYDSKCLTLLQAHNHAYVMPIVRWG
                     QTIKRELSEGWSRVIQHSLTAKLDGHSWTVEFPVYIDCTYQNGRYDEHGVARHGYAAD
                     APFIDSPRDARYHYAKRFGIEASYRLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWRY
                     LHWEYVATPRRGGRRLWEWSFKEFINMVRRAAWTALAVRRAVPANRPPDDRFHR"
     gene            236612..236932
                     /locus_tag="HVO_RS05980"
                     /old_locus_tag="HVO_0264"
                     /db_xref="GeneID:8926417"
     CDS             236612..236932
                     /locus_tag="HVO_RS05980"
                     /old_locus_tag="HVO_0264"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045384.1"
                     /db_xref="GeneID:8926417"
                     /translation="MFVFEYTVALAIITSLLGSILQTVEYSEYMFWIFVFFFIYLLLS
                     TMQIVSTIIEYGDKIGEFSKANNFEPNEDLKKDMQDLIQEHGNFDEDDNQTRNRGENE
                     SESE"
     gene            complement(236934..237194)
                     /locus_tag="HVO_RS05985"
                     /old_locus_tag="HVO_0264A"
                     /db_xref="GeneID:8925477"
     CDS             complement(236934..237194)
                     /locus_tag="HVO_RS05985"
                     /old_locus_tag="HVO_0264A"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045386.1"
                     /db_xref="GeneID:8925477"
                     /translation="MTKRTSLKLTDERQLLFDKASEIVARDVSDDPPRSDVIDAALTH
                     LIESYENLEEVRDAYPPQTVKDCCNTSVLGMRYRTSLESQWR"
     gene            237481..237741
                     /locus_tag="HVO_RS05990"
                     /old_locus_tag="HVO_0265"
                     /db_xref="GeneID:8925784"
     CDS             237481..237741
                     /locus_tag="HVO_RS05990"
                     /old_locus_tag="HVO_0265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045389.1"
                     /db_xref="GeneID:8925784"
                     /translation="MASATRDDNGEEGVEFIHEDDGSITARDIETGIASFGETKSEAL
                     RMLSEALLLHEGGGEPVTDEDLEELGLDTDEFDDRELPDFMQ"
     gene            237743..237988
                     /locus_tag="HVO_RS05995"
                     /old_locus_tag="HVO_0266"
                     /db_xref="GeneID:8926401"
     CDS             237743..237988
                     /locus_tag="HVO_RS05995"
                     /old_locus_tag="HVO_0266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system HicA family
                     toxin"
                     /protein_id="WP_013035318.1"
                     /db_xref="GeneID:8926401"
                     /translation="MARTTFSGREVVKALTRHDFEPAGRTGSHVQLRYEHPETDEVRT
                     VTVPMKSDIPTGTLQSIAKQSGAKDFHSWCEWIEQTL"
     gene            complement(237992..238198)
                     /locus_tag="HVO_RS20105"
                     /old_locus_tag="HVO_0267"
                     /db_xref="GeneID:31787464"
     CDS             complement(237992..238198)
                     /locus_tag="HVO_RS20105"
                     /old_locus_tag="HVO_0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035468.1"
                     /db_xref="GeneID:31787464"
                     /translation="MFRKLRNHDGTPLIALDKNELEMDGVLENGTAPEGKQMHVQRLD
                     EGVYVVRNVTDGGIAELPESIPHR"
     gene            238338..238736
                     /locus_tag="HVO_RS06000"
                     /old_locus_tag="HVO_0268"
                     /db_xref="GeneID:8925467"
     CDS             238338..238736
                     /locus_tag="HVO_RS06000"
                     /old_locus_tag="HVO_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045393.1"
                     /db_xref="GeneID:8925467"
                     /translation="MEFDPEDAAALVATFIGTTAMAGIASWSLFDVTLSDVAFQLAGN
                     DVTLATLLTLGALGVTILTNDNAELSTLHQQAKDLDNYYYYSIVASVGLLVGWVFFGD
                     VSSFVQSQDLWGVGYVAVSLTAQMAIGWML"
     gene            238733..238948
                     /locus_tag="HVO_RS06005"
                     /old_locus_tag="HVO_0269"
                     /db_xref="GeneID:8926595"
     CDS             238733..238948
                     /locus_tag="HVO_RS06005"
                     /old_locus_tag="HVO_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045395.1"
                     /db_xref="GeneID:8926595"
                     /translation="MNLDLDDLDLETVAIIGAGVGSLDAGLSAATDITLLSDLLGGSL
                     ETGLIAVGAAGGVVIADKLGLVEVFES"
     gene            238945..239475
                     /locus_tag="HVO_RS06010"
                     /old_locus_tag="HVO_0270"
                     /db_xref="GeneID:8924489"
     CDS             238945..239475
                     /locus_tag="HVO_RS06010"
                     /old_locus_tag="HVO_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045398.1"
                     /db_xref="GeneID:8924489"
                     /translation="MRRGRATLALVGLLVAAVAAVAFVGLGAATVTTDSANFTSVGND
                     SLANQTIDVTNDTRSLYVELDNDTATASEPVEVAVFEVDADGNETEVDRVQISAADGT
                     TELYEFDALDPTNVSTYRVEVLGTASAIDSSALDVGTVAAVSSGGGFLGGSSGGIGIG
                     AIAVVGIGGYLALKED"
     gene            239482..241095
                     /locus_tag="HVO_RS06015"
                     /old_locus_tag="HVO_0271"
                     /db_xref="GeneID:8924982"
     CDS             239482..241095
                     /locus_tag="HVO_RS06015"
                     /old_locus_tag="HVO_0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045401.1"
                     /db_xref="GeneID:8924982"
                     /translation="MLRLASTYAAVGLSVAAAYLAGVHGDHHAAAIVAAVAVLFVALR
                     LSFGDVLRLGALDADRVKVKARQLGTLAAVSLVVTTVATSGVVPGASPVGDASAEWVD
                     CSLSDPLLGAAFNTLTGTDTGCRWESGEQIDYENVSKTDAYASALGIADASESYTTTT
                     SNFLEDTRSVAWSKAKITIVNELNNGSTVSQAKVAANQTVAEYYTGVQRNVIADWNAK
                     TYTLGYLHTESGLALTPDGFSHITEWDNKTYTLSDGSTQTLRAMDYSTNGDYHVAPET
                     TIMPRSTADPGITTMGSIQAEDPSDGSTTHVLSAVAYAEILDNTYNQSNQIQANVDEY
                     ADDAYAQYQAGDINTSDLLDPTTIASQAATDYNSTGYYSFAAVQLASLGASGDLNASH
                     TIETGDGTTLNGTLYYTGDDAPAGGWVTNETYTVSNFSGTFYVAAQQQDGNGSIVDLS
                     TYENFTIVDAVNTRTGESLNATQPETYIYDSTNASALADEIDRLRDLRAEYEQAGGSG
                     GGGGIGIGTEDRLIIAGAIVALILVATRN"
     gene            241129..241704
                     /locus_tag="HVO_RS06020"
                     /old_locus_tag="HVO_0272"
                     /db_xref="GeneID:8925140"
     CDS             241129..241704
                     /locus_tag="HVO_RS06020"
                     /old_locus_tag="HVO_0272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005533715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045403.1"
                     /db_xref="GeneID:8925140"
                     /translation="MRRTIITLVILIAVVSPALVGTVAAQESTNSTTTTAPSTTPEAT
                     QTIELSPTTRIKSWSFSNGTFSLVVEADIPTRIAITDAGELSRILSEGDGAAAGKARV
                     RRMTLTPGTTVVKFRAESVGDASAITVSSSNADGIVAIRSDAIKTGNPPVEYGTVQTL
                     LASTAVAAAGGTFLWVRKKRNEKQLEVEREW"
     gene            241698..242492
                     /locus_tag="HVO_RS06025"
                     /old_locus_tag="HVO_0273"
                     /db_xref="GeneID:8926372"
     CDS             241698..242492
                     /locus_tag="HVO_RS06025"
                     /old_locus_tag="HVO_0273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045404.1"
                     /db_xref="GeneID:8926372"
                     /translation="MVNDWVKLGAVGAVFAYFGGYQFPEWAPLAASGLVIAGIGALFA
                     TGKINDLLPDPPRVRLVQVNANSDDPLACWSLSPDKFAEMQVEWGPLYPHEQAHGDVY
                     ECYAYDPSSNVAVGTWRRSLPGSSLVGRHDTDDVLDVVGELRGDLEPAARRGQELRQA
                     LPAIVRRVKHDTMEAQNAALDPSAPMITDQPTVDEIITSELPEELRPGRLQNGDLRDL
                     LEAAGDQDDNRGDWGDGLGMVFDDDLADDALEPVPTDPLVNDGGNR"
     gene            242489..243640
                     /locus_tag="HVO_RS06030"
                     /old_locus_tag="HVO_0274"
                     /db_xref="GeneID:8924075"
     CDS             242489..243640
                     /locus_tag="HVO_RS06030"
                     /old_locus_tag="HVO_0274"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_013035542.1"
                     /db_xref="GeneID:8924075"
                     /translation="MSGRKQGDSAVYAAAQGREFLRGALRDKSNEYIREFAGMIDDPD
                     VLDFLNRYCSIYEERGKNFLETHVGRHVVRSAATSMADRAYREGNVSQLQGMVGLTNQ
                     KRDGSEAIVEAAKRLADEGAIYLVLGPPGAGKTAFALDVARVFGSLTGGTVLANVAWD
                     GADRVTTSSGSMLDAMGSTDGQVLQLIDEAGQSLTSRGAEAAITDEFVKSLKYVRKKE
                     DGDTYAKRGSVLLIGHTRKDTAAEIRRLASGAFVKPTRNDPGRVVFLDSEGGADSFEE
                     AAEFTGVTDTREKYDEHEASHFSVTLDGGDDDQDDSPDPNQIRWESAVATVIKACKPW
                     DEENGMSYPDAAELVIFGDSWVGNRVREWKRGDHRDIVSSPEGDFEWRR"
     gene            243876..245228
                     /locus_tag="HVO_RS06035"
                     /old_locus_tag="HVO_0275"
                     /db_xref="GeneID:8926008"
     CDS             243876..245228
                     /locus_tag="HVO_RS06035"
                     /old_locus_tag="HVO_0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="WP_013035249.1"
                     /db_xref="GeneID:8926008"
                     /translation="MGSMTYSPPDSVIVDRIQRAFPSDELRERARATNLVQRERKFDI
                     VALFYTLSFGFAAGSDRSLQAFLERYVEMADCDELSYASFHDWFEPGFVALLREILDD
                     AIENLDTGREDLNGRLERFRDVLIADATIVSLYQDAADIYTATGDHQAELKLHLTESL
                     STGLPTRFRTTDGTTHERSQLPTGEWVADALILLDLGFYDFWLFDRIDQNGGWFVSRV
                     KDNANFEIVEELRTWRGNSIPLEGESLQAVLEDLQRQEIDVRITLSFERKRGSGASAT
                     RTFRLVGLRNEETDEYHLYLTNLAREDYSAPDIAQLYRARWEVELLFKELKSRFGLDE
                     IKTTDGYIIEALIIMAAISLMMSRVIVDELRSLEARQREGEAAADADSSASRLPRRRC
                     SLAVERHGHLIQLYLMIELGYELPDLDELLLWASRNPNPHRDRLREQVERGEFGFDRY
                     "
     gene            245331..246683
                     /locus_tag="HVO_RS06040"
                     /old_locus_tag="HVO_0276"
                     /db_xref="GeneID:8925209"
     CDS             245331..246683
                     /locus_tag="HVO_RS06040"
                     /old_locus_tag="HVO_0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="WP_013035080.1"
                     /db_xref="GeneID:8925209"
                     /translation="MGSMTYSPPDSVIVDRIQRAFPSDELRERARATNLVQRERKFDI
                     VALFYTLSFGFAAGSDRSLQAFLERYVEMADCDELSYASFHDWFEPGFVALLREILDD
                     AIENLDTGREDLNGRLERFRDVLIADATIVSLYQDAADIYTATGDHQAELKLHLTESL
                     STGLPTRFRTTDGTTHERSQLPTGEWVADALILLDLGFYDFWLFDRIDKNDGWFVSRV
                     KDDANFEIVEELRTWRGNSIPLEGESLQAVLDDLQRQEIDVRITLSFERKRGSGASAT
                     RTFRLVGLRNEKTDEYHLYLTNLARESYSAPDIAQLYRARWEVELLFKELKSRFGLDE
                     IKTTDGYIIEALIIMAAISLMMSRVIVDELRSLEARQREGEAAADADSSASRLPRRRC
                     SLAVERHGHLIQLYLMVELGYELPDLDELLLWASRNPNPHRDRLREQVERGEFGFDRY
                     "
     gene            246714..247094
                     /locus_tag="HVO_RS06045"
                     /db_xref="GeneID:25143407"
     CDS             246714..247094
                     /locus_tag="HVO_RS06045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004045411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004045411.1"
                     /db_xref="GeneID:25143407"
                     /translation="MNRSRKAARYGRLAEEAARRIYDLDADHASWHDAHTSDGRPVET
                     KAAMLNRADGTEGRFRIFEDYHERLVRHDGLYVFIPYRARGRGIQVVDARSVEASKLR
                     FKFYGAGGHRESQQVKIHPRRVFG"
     gene            248186..249184
                     /locus_tag="HVO_RS06050"
                     /old_locus_tag="HVO_0278"
                     /db_xref="GeneID:8924053"
     CDS             248186..249184
                     /locus_tag="HVO_RS06050"
                     /old_locus_tag="HVO_0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS110-like element ISHvo9 family transposase"
                     /protein_id="WP_013035031.1"
                     /db_xref="GeneID:8924053"
                     /translation="MYLGIDLHKRYAQVAVMDLEGEIVEEVRVKNANLDDLAQRYAGS
                     RAVIEATSNYYHVYDTLAEYLDVTVAHPGKLTLIARSDKKTDRVDAKELARLLRLNSV
                     PQSYVPTDEIREARALVRGRQTLVEDRTKFANKIHGLLADNGITQTVKPLSVEGREFL
                     RELSLPSPWDSLLDSYLDVVETLTEQMTQLEAAIEERAGSLKETQLLMTIPGVSYYSA
                     LLVYAELGEIDRFDGHKEVVSYMGLNPTIRESGDSRIEGGISKRGSGRVRWILVQSAY
                     SAVYTCKDAYLSTFFHRLNRRMNSKKAIVATARKLLVSMYYMLVREEVYDPPGVSA"
     gene            complement(249749..251479)
                     /locus_tag="HVO_RS06055"
                     /old_locus_tag="HVO_0279"
                     /db_xref="GeneID:8925326"
     CDS             complement(249749..251479)
                     /locus_tag="HVO_RS06055"
                     /old_locus_tag="HVO_0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix domain-containing
                     protein"
                     /protein_id="WP_004044642.1"
                     /db_xref="GeneID:8925326"
                     /translation="MTAAPFIDPQPHEGDVHLIFDEYGLKPYFALDSVRKDYDGWQTT
                     GKPTRKVSWRNQTWHLAYDYDVQPIDPRDHEDYQLQTVPLFRIYFVADDSLYDDEPAD
                     QSARTTGGTMTIRPRWPDMTKDGKPVRGIPNLGGPYLDVQIQASNIDHHLYHDLVQTA
                     MEAFGVSRRYFQTPHEMSNVQDLAVYVRLSREHSGAIYAPDGPIARTHSVMTSGMSGY
                     RMHKEDHRKIPGYYVSTHITDERAGDIIRGHRLGKEAKHYYPLNPEQFDEDHPLYNPK
                     VEVSLQTSITDETVYWSDLDDALRELDETLLNYLSWAGLTTRADDEVFESDVHFDAES
                     ETRRSRRLVDCPLPEIEDEQEHVVMRIWGDMKTSDRDFTRSLIEDGGTPTREELAERT
                     GWSYRTVRRYVNRCEGIVADAAGKLEIGSKHMQNMLLSRVRAAAENFETAMEDAVMTA
                     ADAAAGRRRSEWSEIKNRYAARVVEHDCRRDEIHVEYRPTDWENRTDMLRDIKRAARD
                     RWTSLRRVTVTYHDHLGGEHTTILSDLQLTTGNITNLDVRSVREKVESVDWEAWKAGL
                     PQPTEDRDDT"
     gene            complement(251728..251964)
                     /locus_tag="HVO_RS20110"
                     /old_locus_tag="HVO_0280A"
                     /db_xref="GeneID:31787465"
     CDS             complement(251728..251964)
                     /locus_tag="HVO_RS20110"
                     /old_locus_tag="HVO_0280A"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008610516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081442882.1"
                     /db_xref="GeneID:31787465"
                     /translation="MMLLESQSDASSCRYCGSHVTRDFRRVYGDSNNHVHRCRECDTL
                     IRLQRGSGAGLSVSVPDPQHACGRHGGSPEGRSK"
     gene            complement(252026..252098)
                     /locus_tag="HVO_RS06060"
                     /old_locus_tag="HVO_3017"
                     /db_xref="GeneID:8925282"
     tRNA            complement(252026..252098)
                     /locus_tag="HVO_RS06060"
                     /old_locus_tag="HVO_3017"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(252062..252064),aa:Pro,seq:tgg)
                     /db_xref="GeneID:8925282"
     gene            complement(252148..254004)
                     /locus_tag="HVO_RS06065"
                     /old_locus_tag="HVO_0282"
                     /db_xref="GeneID:8926854"
     CDS             complement(252148..254004)
                     /locus_tag="HVO_RS06065"
                     /old_locus_tag="HVO_0282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SLC13 family permease"
                     /protein_id="WP_004044640.1"
                     /db_xref="GeneID:8926854"
                     /translation="MVAITPDILVVFAVILVALAFFATEPVPVDVTAIGVMVSLMLIQ
                     PASEALASAGMLGAPIVLFESYPGDALSGFANTATLTVLAMFILSEGVQRTGIIQLLG
                     AKISTFTGDSELRQLGATVGVVGPISGFINNTAAVAILLPMVTDLAERGRTSPSKLLL
                     PLSYASMFGGMLTLIGTSTNILASDVYSRITGEAPFSMFEFTALGAVVMAVGVVYLMT
                     IGRRLTPGRIEPRRDLTEEFEMAGYLTEVVVREDSPLVGQQVQRALVETEFDVDLLQL
                     IRGESVFLEPLGPKEIQPGDVFTLRTDRNTLVELLDVEGLDLVPATVTEDELELADRG
                     QNLVEVVVAPGSALVGESLASASFRQRYDATVLALRRGGELIRRRMDNLPLRVGDTLL
                     VQATVESIERLDNNRNFIVAQEIERHDYRESKIPVAVGIVAGVVALAALGFLPIVVAA
                     LLGALAMVATKCLRPTELYDAVQWDVIFLLAGVIPLGIAMENSGAAGLLAELVVMTGD
                     YLPLIAVLGVFYFVTALLTNVISNNASVVLMIPVAIEAAATLGADPFSFVLAVMFAAS
                     TAFMTPVGYQTNLFVYGPGGYKFTDYIRVGGPLQLLLGVVTTIGVAYFFPLT"
     gene            complement(254076..256130)
                     /locus_tag="HVO_RS06070"
                     /old_locus_tag="HVO_0283"
                     /db_xref="GeneID:8925879"
     CDS             complement(254076..256130)
                     /locus_tag="HVO_RS06070"
                     /old_locus_tag="HVO_0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_004044639.1"
                     /db_xref="GeneID:8925879"
                     /translation="MSKQVTRVDTLFLHQTGDDYLVVARRDGKRVLRGKLELKETNAG
                     PRPLRFLVTRKGEDSPRDPSQFVELARSAARIRISQQTPKDGRDELKEMLDGYQLEAL
                     TVRTCRRCAVNGRYSPITDDTAIKAEHEHICRDCAVQELEGELSFAGGLTQAAQERLE
                     ELLYETGDLTRITNLLQGELDPDLTKFDTISATTEDVELVETNTLDLHPNLKSMLTER
                     FDTLLPVQSLAIDNGLLDGDDQLVVSATATGKTLVGELAGINRMLNDDGKMLFLVPLV
                     ALANQKHEDFKERYGHLGKVTIRVGASRINDDGNRFDPNADVIVGTYEGIDHALRTGK
                     DLGDIGTVVIDEVHTLKEEERGHRLDGMIARLKHYCESRADRREGYGGAQWIYLSATV
                     GNPKWLAQNLRANLVEYEDRPVPIERHVTFADGQEKPRIENRLVRQAFDSKSSKGYRG
                     QTIIFTNSRRRCHEIARKMDYNAAAYHAGLDYGQRKRVERQFANQDLAAVVTTAALAA
                     GVDFPASQVIFDTLAMGIEWLSVQEFSQMLGRAGRPDYHDKGVVYLLVEPDASYHNTM
                     EMTEDEVAFKLLKGEMEEVRTVYDQSSAVEETLANIVVAGTKAKALNNRMLGELPTTH
                     AVGKLLEWGFIDGLDPTPLGLAVTRQFLSPKEAFAILDGIRKGSSPYKIVADLELDEE
                     GR"
     gene            complement(256281..256670)
                     /locus_tag="HVO_RS06075"
                     /old_locus_tag="HVO_0284"
                     /db_xref="GeneID:8925703"
     CDS             complement(256281..256670)
                     /locus_tag="HVO_RS06075"
                     /old_locus_tag="HVO_0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_004044638.1"
                     /db_xref="GeneID:8925703"
                     /translation="MSDSRPEPVVKRSADIEYEAVGAADGMSKGVLVSEADGAPNFAI
                     RRFVLDPGASVPKHTNEVEHEQYVLSGRYVVGIGDEEYEVEAGDSLLIPAGVVHWYRN
                     ESDAEGAFLCAVPNGDDAIELAADADA"
     gene            256758..257930
                     /locus_tag="HVO_RS06080"
                     /old_locus_tag="HVO_0285"
                     /db_xref="GeneID:8924181"
     CDS             256758..257930
                     /locus_tag="HVO_RS06080"
                     /old_locus_tag="HVO_0285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CBS domain-containing protein"
                     /protein_id="WP_004044637.1"
                     /db_xref="GeneID:8924181"
                     /translation="MRGIRIGSVFGIPIKLDLTFLIVLPLFAWLIGSDVTNLAAIVND
                     LFGSTIDGAAISAGSMQWVLGSAAAIGLFAGVLLHEFGHSLVAMRYGYEIESITLWLF
                     GGVARFKEIPEDWKQEFTIAVAGPVVSVAIGVASYAGFLLLPESQAPAQFVLGYLALV
                     NVSLAVFNMLPGFPMDGGRVLRALLARNRPHAKATQMAAEVGKVFAFLLGLFGLFFNL
                     FLVALAFFIYMGASGEAQQTVLKATFQDVVVRDIMTGRENLDVVDEKTSVAELLERMF
                     VERHTGYPVLRNGDLVGMVTLDDARGVKEVERDAFRVDDIMSDELTTITPDADAMDAI
                     ALMQERGVGRLPVVDEAGELVGLVSRSDLVTAFNIIRSRGSLDAMPRSDAGLAQLR"
     gene            complement(257951..258775)
                     /locus_tag="HVO_RS06085"
                     /old_locus_tag="HVO_0286"
                     /db_xref="GeneID:8924875"
     CDS             complement(257951..258775)
                     /locus_tag="HVO_RS06085"
                     /old_locus_tag="HVO_0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence/damage-inducible protein A"
                     /protein_id="WP_004044636.1"
                     /db_xref="GeneID:8924875"
                     /translation="MQIAILTVGNELLAGDIENTNATWLARRLTEGGATVARIQTVPD
                     DHEVIAETVADWAAAFDAVLVTGGLGGTPDDITMEAVAAGLDRAFVVNEEAAAQVEST
                     IAAILERRPDIDFDLEPEWYASMPADAEVLPNEEGLAPGCRAGNVYVLPGIPDEMKPM
                     FEGIAERFAGDVESRECYADAPEGAVARELGVVAERFGVGVGSYPNSGGPTRVKLTGG
                     DPAALDDAMAWFRSNATVDLYESEAAVETAREAEAGGEERSQIGRDDGRLGSRDGE"
     gene            complement(259298..259370)
                     /locus_tag="HVO_RS06090"
                     /old_locus_tag="HVO_3070"
                     /db_xref="GeneID:9527255"
     tRNA            complement(259298..259370)
                     /locus_tag="HVO_RS06090"
                     /old_locus_tag="HVO_3070"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(259334..259336),aa:His,seq:gtg)
                     /db_xref="GeneID:9527255"
     gene            259521..259982
                     /locus_tag="HVO_RS06095"
                     /old_locus_tag="HVO_0289"
                     /db_xref="GeneID:8926742"
     CDS             259521..259982
                     /locus_tag="HVO_RS06095"
                     /old_locus_tag="HVO_0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044634.1"
                     /db_xref="GeneID:8926742"
                     /translation="MAITDKIYLKNHRQIVSQLDTNIPKRVFSGATLEILYSGEGLAK
                     VDDATRDRLLDFAQDFLDCENSDDIYTGYPERQFIEYLLELRAQGLGPDAIVDVMSDD
                     YMVYAYPGDVLSFLDDSVRTLESVEALADVEGDREMRDEARRAKQDLVGPR"
     gene            complement(260022..260435)
                     /locus_tag="HVO_RS06100"
                     /old_locus_tag="HVO_0290"
                     /db_xref="GeneID:8924278"
     CDS             complement(260022..260435)
                     /locus_tag="HVO_RS06100"
                     /old_locus_tag="HVO_0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008002178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="WP_004044633.1"
                     /db_xref="GeneID:8924278"
                     /translation="MGNKNKTISFRVNEDAFETLREIAEERDISLSAVFRDYVDTLVA
                     HDGQVQVVPKHELEKLREGEDESFPPTVEVPKSFIREHERLELEAEHLREQLEEHKGY
                     VNYLREQVENDHDDVEEVIQLEDLDTGDEPSFRLG"
     gene            complement(260600..261190)
                     /locus_tag="HVO_RS06105"
                     /old_locus_tag="HVO_0291"
                     /db_xref="GeneID:8925168"
     CDS             complement(260600..261190)
                     /locus_tag="HVO_RS06105"
                     /old_locus_tag="HVO_0291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rpa-associated protein"
                     /protein_id="WP_004044632.1"
                     /db_xref="GeneID:8925168"
                     /translation="MSSNEIPTREVARRVFAQEFNDAGYTFKESDDERAPVYLLLPTG
                     ESANRVFLVGTLTEKEDVGEDNEYWRGRIVDPTGTFFVYAGQYQPEAASALRDLDAPA
                     YVAVVGKPRTYETDDGSINVSVRPESITEVDAATRDRWVTETADKTLDRIAAFDEEGD
                     EYARMAREHYDLDPEEYKRAAIAALESLEQADELSA"
     gene            complement(261191..262126)
                     /locus_tag="HVO_RS06110"
                     /old_locus_tag="HVO_0292"
                     /db_xref="GeneID:8924234"
     CDS             complement(261191..262126)
                     /locus_tag="HVO_RS06110"
                     /old_locus_tag="HVO_0292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058279.1"
                     /note="Replication protein A protects and stabilize the
                     intermediate ssDNA that is generated by the unwinding
                     action of a DNA helicase at the replication fork. In
                     addition, SSBs prevent the formation of secondary
                     structures by single-stranded template DNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044631.1"
                     /db_xref="GeneID:8924234"
                     /translation="MTDLRTHAAEIADQFSDHLDVSADEVEERLESLVTEYRVPVDEA
                     RRSVVNSYLDEAGIERDELAGGSGGNEQTLLNDIDEDEQWVDVRAKVVELWEPRSESI
                     AQVGLLGDDSGRMKFVSFTTSELPELEEGKSYALGNVVTDEYQGNFSVKLNRTTSITE
                     LDEEIEVGDDSTSVEGALVDSQSGSGLIKRCPEEGCTRVLQNGRCSEHGSVEGEFDLR
                     IKAVVDDGDEVHEVIFNREMTEELTGIELDEAKQMAMDALDTTIVEEEMRGDLVGYYY
                     RVTGPTLGRYVLANEVERLREPADAEELLIKARSM"
     gene            262298..262579
                     /locus_tag="HVO_RS06115"
                     /old_locus_tag="HVO_0293"
                     /db_xref="GeneID:8924888"
     CDS             262298..262579
                     /locus_tag="HVO_RS06115"
                     /old_locus_tag="HVO_0293"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044630.1"
                     /db_xref="GeneID:8924888"
                     /translation="MDDRLESIIRSAARSAGKRYEEAKRAYRDGRDPSPTHSLPRDAE
                     GRAKIVCRRHAEHRAVAVDAKGRPACFDPDHPDCQGCVDDIREGMVETW"
     gene            262634..263638
                     /locus_tag="HVO_RS06120"
                     /old_locus_tag="HVO_0294"
                     /db_xref="GeneID:8925870"
     CDS             262634..263638
                     /locus_tag="HVO_RS06120"
                     /old_locus_tag="HVO_0294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="WP_004044629.1"
                     /db_xref="GeneID:8925870"
                     /translation="MDRPLVALVLAGGTGTRLYPASRSDRPKQFLPLGGDRSLLAETV
                     ARADFADHVVVSTRPAFTDDIADHAPDAEVVVEPAAKDTGPALVYATHRIAASYDDPV
                     VVVLPSDHHVGDGFAEAMTSGARVAADTDSLVAFGVEPTRPETGYGYIEPGADRDDAR
                     DLAAFHEKPDAETAARYVDQGYLWNAGMFAWTPEALFSAARDSPLSPLLDALDDGDAD
                     AGFAAVEGVSIDYAVMERAADAAVVPADFEWDDLGSWDALERIVDADEDGNVALGDDP
                     VFVDAADNVVATDGATVSLVGVSDLAVVAWGDRVLVVPKEEAQKVREVVSRLKRKEMF
                     "
     gene            263680..264327
                     /locus_tag="HVO_RS06125"
                     /old_locus_tag="HVO_0295"
                     /db_xref="GeneID:8926505"
     CDS             263680..264327
                     /locus_tag="HVO_RS06125"
                     /old_locus_tag="HVO_0295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044628.1"
                     /db_xref="GeneID:8926505"
                     /translation="MGDRHLPNRRQRVEQLLTQYECLQSEKQDLIDQQSRRIQGLMAA
                     IAAVIGYALYAGHLVYLGMVPILIGLVFVEVILTHNQMLFVAKHLAVIEAALAGSSDS
                     PFRHERVRGGVFGDERGRGRWLALADVPHLFQLALGVVAYGCFAVISTRPVAWERYGG
                     TVPSVVGIDLNADLVGAALLVYFAGLLLVGLSHLALRSRVHRGVAASVSPSKIAP"
     gene            complement(264341..265126)
                     /locus_tag="HVO_RS06130"
                     /old_locus_tag="HVO_0296"
                     /db_xref="GeneID:8926509"
     CDS             complement(264341..265126)
                     /locus_tag="HVO_RS06130"
                     /old_locus_tag="HVO_0296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_004044627.1"
                     /db_xref="GeneID:8926509"
                     /translation="MELGLDGDTVVVTASSAGLGRASAAALADEGANVVVCGRDPERL
                     AATESELGDLDGDVLGVETDITNKGDVEALVEAAVEEFGGVDHVVTSAGGVPPGGFAD
                     LTEREWYGAFDMLVMSAVWTVRAARPHLEASDVGTITCITSTSVKEVIDDLILSNAVR
                     RGVIGLVKSLSRELAPGVRVNAVLPGAHETSRIEELVEAAVERGDHDTYEEGLDSWSD
                     GIPLGRVGDPRELGDVVAFLASDRASFVTGACVPVDGGRLRSA"
     gene            complement(265238..265732)
                     /locus_tag="HVO_RS06135"
                     /old_locus_tag="HVO_0297"
                     /db_xref="GeneID:8924578"
     CDS             complement(265238..265732)
                     /locus_tag="HVO_RS06135"
                     /old_locus_tag="HVO_0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tfx family DNA-binding protein"
                     /protein_id="WP_004044626.1"
                     /db_xref="GeneID:8924578"
                     /translation="MSDAGRDDETVPDVDQLLDRAGFDPETSVLTRRQAEVLALRERG
                     VRQSTIADFLGTSRANVSSIEASARANVEKARETVTFVDALTAPVRVEVPTGSDLYDV
                     PKQVYDACDEAGVKVNQTAPDLMKIVSDAAGDAVEGREIKEQLFVGVTSDGRVRVRRH
                     ADGV"
     gene            complement(265809..266291)
                     /locus_tag="HVO_RS06140"
                     /old_locus_tag="HVO_0298"
                     /db_xref="GeneID:8925555"
     CDS             complement(265809..266291)
                     /locus_tag="HVO_RS06140"
                     /old_locus_tag="HVO_0298"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAM domain-containing protein"
                     /protein_id="WP_004044625.1"
                     /db_xref="GeneID:8925555"
                     /translation="MSDCPLADDCPSFSERIAGMGCQYYGDRGGAEWCDHYERPISEL
                     KQQPVKPGEEVIVTVEDIHESGAGVGRTEDGFIVFVDGLLPDARAIVRIDRVKGSHAR
                     AKKIVERLPLDPEAEGDEAGETSGAGESTGADAKSKGSGRDGPKRPEALGSRDNFWGE
                     "
     gene            266382..267068
                     /locus_tag="HVO_RS06145"
                     /old_locus_tag="HVO_0299"
                     /db_xref="GeneID:8926103"
     CDS             266382..267068
                     /locus_tag="HVO_RS06145"
                     /old_locus_tag="HVO_0299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044624.1"
                     /db_xref="GeneID:8926103"
                     /translation="MAERVPEFALLIGVFLGLSATVSAAVLSGALFRPLLFGAAVCYP
                     FAAFGVLRSEDPSEALPPRVVLGLGVAIGLLTAAAAVLERATVEPLDGVFAAVVVSLP
                     PVAYAVRFGADVNPLSPVQSLACCAVVGTAFLALAPRLGTTSALLGFVLGLSGALYAD
                     ARGFRPTHRQQRAGIAAGVFVGVAVAAAGVATGLPLGSTTATAVAAALTPSLSVALAR
                     NRRQPHRFRS"
     gene            complement(267117..268112)
                     /locus_tag="HVO_RS06150"
                     /old_locus_tag="HVO_0300"
                     /db_xref="GeneID:8925092"
     CDS             complement(267117..268112)
                     /locus_tag="HVO_RS06150"
                     /old_locus_tag="HVO_0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004268057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_013035304.1"
                     /db_xref="GeneID:8925092"
                     /translation="MISKGCEQCAMGGKMVLFVYGYCDQRDCFYCPLGENRKNVTDVY
                     ANERKVESDADVIEEAKRMDALGSSITGGEPQEALDKTCRYISLLKDEFGEDHHIHLY
                     TGITGGRENMRRLAEAGLDEIRFHPPLELWGDMHGTEWEDILYIAREEGLTPAFEIPG
                     IRAEPEFLDFLDEGAAEFCNINEFEMSDGNYRRMQEKGYELQDGHMSAVDGSKEAILD
                     EMGDHERVYFCTSVFKDAAQHRNRLKRMARNLRRPFDEVTDDGTLVYGKTYTPAERFI
                     ELGVPDEFYSIKSNHVEVAWWLLEEMIEDGDVDDGEIVEQYPTYDGTVVERTPLA"
     gene            268262..270109
                     /locus_tag="HVO_RS06155"
                     /old_locus_tag="HVO_0301"
                     /db_xref="GeneID:8924426"
     CDS             268262..270109
                     /locus_tag="HVO_RS06155"
                     /old_locus_tag="HVO_0301"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_004044622.1"
                     /db_xref="GeneID:8924426"
                     /translation="MLLVDDTESAADTMSALSGCDRLDVAAVDAPTAAVDAHAESPFD
                     CIVTEFEFDGTGGLDALLRVRELPNPPPVILFTRLDSEETVREAVAAGVADVVDKRPT
                     DAQIAVLAHRISKAVAAARQSTELDELHAWLRVVAEQSLVGLYVIRDGRVAFVNEYLS
                     NLLGYDTDEVVGRPITEFVVEEDRTIVEESLRNRSHGSVESMSYTVRVRDYADELTAL
                     EITGQRTTVDGEPVVVGTAMDVTARLESERLLRRSERLTSQIISSLPDMVFISEPTEF
                     DIVYINDQFESVWGRDVSLLYDDPNSFLDLIHVDDRDQLTRAIDEMFVDIRDGAVDDQ
                     YEFEFRFVPEGSERIHWATARAVPLLGENGDVTNILGVISDLTERISHERELAQQNAR
                     LDAFARVLSHDIRGPLAVAQGRLELARELDDDSHLDHVERAHRRITDVVEDVLSLARD
                     ERSVLDATEVSLADAAATGWEMCSSNADHVRCEIGELPVVEADESRTTRLFENLFRNA
                     LQHARNGRAGAADRGDEPTDLVIRVGALPSRRGFFVEDNGPGIPASIRDRVFDAGFST
                     KDGDGNGLGLGIVRQIADSHGWAVRVVDGAAGARFEVLFDPVGEAGAAE"
     gene            270240..271373
                     /locus_tag="HVO_RS06160"
                     /old_locus_tag="HVO_0302"
                     /db_xref="GeneID:8925592"
     CDS             270240..271373
                     /locus_tag="HVO_RS06160"
                     /old_locus_tag="HVO_0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF373 family protein"
                     /protein_id="WP_004044621.1"
                     /db_xref="GeneID:8925592"
                     /translation="MLLVLCVDLDDDLGRKTGLSTPVVGRQRVEDAAVALATADPEDS
                     DVNVLFQGIQVHDELLESEDEEVEVAAVTGLEGSDVKANRAIGDEIDTVLASLSTGEP
                     VHAIVITDGAQDESVLPVIRSRVPIDGVRRVVVRQAQNLESMYYTMKQVLADPETRGT
                     ILVPLGILLLIYPFVTIASFFDVPGAVVLGLISALLGLYTLFRGLGLESAVDEAADRA
                     RNVLYAGRVTIITYVAAAALLVVGGVRGVELLETVSESVAGDPPAGLVLATLVHGAVE
                     WFAAAGITSSLGQVTDEYLHDRFKWRYLNAPFYVLAIAIVLYALSGFFLPEGVVGVQT
                     FYLPGLAVALTVGTLLGVLSTLTFAVAESRYPTGSDGENEQPA"
     gene            complement(271412..272254)
                     /locus_tag="HVO_RS06165"
                     /old_locus_tag="HVO_0303"
                     /db_xref="GeneID:8924789"
     CDS             complement(271412..272254)
                     /locus_tag="HVO_RS06165"
                     /old_locus_tag="HVO_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyprenyl synthetase family protein"
                     /protein_id="WP_004044620.1"
                     /db_xref="GeneID:8924789"
                     /translation="MEYLERRVTMVNDRLEEVVSAVEPSELADQLDHVALAGGKRVRP
                     AVTILACEAVGGTPEDAVDFAVGVELVHNASLVVDDIIDRSDIRRGTPSAWAEYGYGP
                     AIIASDGLLGEAFALLSSSDRATRIVAESMVELGEGEATELVAVPSNEAEYMQLAHRK
                     TGALFRAAAELGAVAASGDAHVVEAFGDYAARVGVAFQIRDDVLDATADAEELGKPTG
                     QDAEMGRPSLVQVTDLTPEEANRRARKQADEALSALDDSGVDDSEPLEYLRDLAEFVI
                     VRES"
     gene            complement(272558..273511)
                     /locus_tag="HVO_RS06170"
                     /old_locus_tag="HVO_0304"
                     /db_xref="GeneID:8923911"
     CDS             complement(272558..273511)
                     /locus_tag="HVO_RS06170"
                     /old_locus_tag="HVO_0304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit
                     alpha/FixB family protein"
                     /protein_id="WP_004044619.1"
                     /db_xref="GeneID:8923911"
                     /translation="MSDVLAVVEHRRGSLRDVSFELVTAGSDLVGDTGGDLHLAIIGG
                     DVDAFAGELSLAGVDAIHTVAEGDEFNHDVTVQAVEALAEELDPTYVLMGNTVNGLDY
                     APAVAERLDRPLVTDAIGLENDGGLVVTREMYASKVESTVEVDADRAAVTVRPGEWDA
                     TEEPGEPAIEAFSFDLDESRVRSRVTGFEEVGSGDVDIADADVLVSVGRGIEEEENIE
                     LVQELADALGATLSSSRPIVDNGWLPKDRQVGQSGKVVTPKFYIAVGISGAVQHVAGM
                     KGAENIVAINTDPDAPIFDIADYGIVGDLFDVVPELIEQFE"
     gene            complement(273508..274305)
                     /locus_tag="HVO_RS06175"
                     /old_locus_tag="HVO_0305"
                     /db_xref="GeneID:8925543"
     CDS             complement(273508..274305)
                     /locus_tag="HVO_RS06175"
                     /old_locus_tag="HVO_0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta/FixA
                     family protein"
                     /protein_id="WP_004044618.1"
                     /db_xref="GeneID:8925543"
                     /translation="MKILVTVKEVAEVEEDFELDGLRVADQYLDYDLNEWDEYAVEEA
                     VQIAEESDDDVEVVAVTIGPERSEETIRMALAKGVDRAVRVWDDALDGVDLLDVAAKT
                     RLLSAVVEDEDPDLVLTGVQANDDSFGATGVSLASAIGFEWAAVVNALDLDADGGVAN
                     VRRELEGGVEELTEVDLPAVLTIQTGINEPRYASLRGIRQAQSKEIKPLALSDLGLDA
                     AAVESDLVLTDVYEPETESDATYFEGDAGEQAADLATVLREKGVGAQ"
     gene            complement(274375..275553)
                     /locus_tag="HVO_RS06180"
                     /old_locus_tag="HVO_0306"
                     /db_xref="GeneID:8926174"
     CDS             complement(274375..275553)
                     /locus_tag="HVO_RS06180"
                     /old_locus_tag="HVO_0306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044617.1"
                     /db_xref="GeneID:8926174"
                     /translation="MRSAVLIVALLTIVAGVAVPVTATDVAAAGTQSADAVAGVPDTD
                     VTDSSADADETATLAKLGGGPRAAQQTTLERSPETEVSIQLRADRSANWRVETRYELE
                     TQNETAAFEEFAREYEQGTVDAGPDAAFFERVSQTAAEQTGRSMAVQNATRRGYVENE
                     TGVLVLTFTWTNFLEQTDEGLRLGDALSADDDGTWLTSLRSNQNLTIQTPPGYAVSDT
                     NLPLENNALVVEGPRTFESIDQLTVTYVSTGPERAIPWTLVGGGAVVLAVLVAGVVLF
                     TRRRPSGAEPAGASVSSEPRQEPTPEPTDESAPDDGEEHDEVDVDLDLLSDEERVELL
                     LERNGGRMKQANIVKETGWSDAKVSQLLSAMADEERVEKLRLGRENLISLPDEDEDEE
                     "
     gene            275700..277091
                     /locus_tag="HVO_RS06185"
                     /old_locus_tag="HVO_0307"
                     /db_xref="GeneID:8926471"
     CDS             275700..277091
                     /locus_tag="HVO_RS06185"
                     /old_locus_tag="HVO_0307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044616.1"
                     /db_xref="GeneID:8926471"
                     /translation="MKALPLVVVMLLVASPVLGAVGPTDGSSRSPALDGATHAQVESP
                     SNETIHVLDIPSSELVRSTVEAHHVDLGPSLDFSALRAGGRIQTGASLERIESASDDS
                     TRQQLILDELNGIEQRAIALQSAQRSVIERFNDDNLTARELLIELARIDAEARALNER
                     RVALRDVTSRTSDFSISSGRLAALERELDTFTGPVRTHAVAVMTGEADAARFSVRTSE
                     TGVVLSVVADGEYVREAYRADLRDRDQRTVTYEEALDIVAENYPTIYSSRTAQNGTNV
                     ISAGDSHRVRINYNYGQLTAYVDTGSGRVFKESQTRPLRSISTTATATGVRDGLALTV
                     DRTYPGGPLRIQLNESETGDPVDANVTIGLEASQESTLLGHTGSDGTLWTVSPSAPYT
                     VTVIKGNSAVVLTADPTPTPTLAANPTDTENDTSPTVTSTPTESIESPGPSRTVPQGA
                     PGDSPTVGSPTVG"
     gene            277131..277613
                     /locus_tag="HVO_RS06190"
                     /old_locus_tag="HVO_0308"
                     /db_xref="GeneID:8924975"
     CDS             277131..277613
                     /locus_tag="HVO_RS06190"
                     /old_locus_tag="HVO_0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilin"
                     /protein_id="WP_049914903.1"
                     /db_xref="GeneID:8924975"
                     /translation="MPCQFRRSTRGSSVLIGSVLLIGLVVVVAAAVGAAAFDAADASP
                     TPTRPTALSLGVSGDTLSLTHEGGAPLDVDSLAVRISVDGESLAHQPPVPFFSASGFR
                     PGPTGPFNAAADPRWTVGETATLKLAGTNDPTIEPGATVTVRVFDGDTPVAALEATAS
                     "
     gene            complement(277680..278303)
                     /locus_tag="HVO_RS06195"
                     /old_locus_tag="HVO_0309"
                     /db_xref="GeneID:8925582"
     CDS             complement(277680..278303)
                     /locus_tag="HVO_RS06195"
                     /old_locus_tag="HVO_0309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="WP_004044614.1"
                     /db_xref="GeneID:8925582"
                     /translation="MGVLENKARARLFYKYLSKVYDRVNPFIWNEEMRDEALEMLDIQ
                     QGDRVLDVGCGTGFGTEGLLRYTDDVHGLDQSIHQMQKAWEKFGKHDEVRFYRGDAER
                     LPFAEDSFDVIWSSGSIEYWPNPVTALEEFRRVVKPGSKVLVVGPDDPKSGVFQKLAD
                     AIMLFYDEEEADRMFEAAGFVDIEHHILQRQPGSPRAIVTIARAPEE"
     gene            278458..278790
                     /locus_tag="HVO_RS06200"
                     /old_locus_tag="HVO_0310"
                     /db_xref="GeneID:8925156"
     CDS             278458..278790
                     /locus_tag="HVO_RS06200"
                     /old_locus_tag="HVO_0310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase archaeal subunit H"
                     /protein_id="WP_004044613.1"
                     /db_xref="GeneID:8925156"
                     /translation="MPRQEVLERIKTAEQEADDIVEEAEAEREELVAEAREEADEIRS
                     EAEEEAAELESERLQEGRADIETERERILEEGEDARDELVAEAEDHIDDAVEFAIGKF
                     EEAVDAQT"
     gene            278777..280978
                     /locus_tag="HVO_RS06205"
                     /old_locus_tag="HVO_0311"
                     /db_xref="GeneID:8925415"
     CDS             278777..280978
                     /locus_tag="HVO_RS06205"
                     /old_locus_tag="HVO_0311"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit I"
                     /protein_id="WP_013035358.1"
                     /db_xref="GeneID:8925415"
                     /translation="MLRPEQMSKVSVTGSKGVMPEVIETVHDLRLLHVTEYDGSWQEE
                     FGFETGSPIEGAESASDKLVTVRSLKSILGVEDTDSGRQRIVPDDALGEPLEEIRAEV
                     NELDDRRSELENELRAVDEEIDAMEPFVDLGLDLDLLSGYETLQVVVGQGKVEPVERA
                     VVDADDISAYEIFSGERTHAVFGRPVDGADEMALADALVGVEFATLEVPDASGSPEEH
                     IRDLEQQKRETESKLETVESELHDTAVEEGEFLLAAEERLAIDVQKTEAPLSFATTEN
                     AFVAEGWIPTERYNTFAGTLKDEVGEHVAVEELERAEFSRDGHDHAREDVTETGGTAA
                     VTDGGTVSMSNDDPPVVQKNSGAVKPFEILVQAVNRPNYHELDPTIILFLTFPTFFGF
                     MIGDFGYGVIYTAIGFFLYSKFEDGALKSMGGVTLAAGLFTTLFGILYGEIFGFHLIT
                     QYFWEGMLGLSHPPIEKGLSPATSEWALGWLTVSVAVGIFHINVGYILDFFENYELHG
                     AKEAVLESGSWILMLNGLWIWIFSDALGGVPPEFLFTTFAADGLIPLGFSGFSFTVGW
                     IGLGLYFLGAGLLGTAELAELVEFAAPLSNVLSYTRLGAVLIAKASMAFAVNLLVFGV
                     YVDDHGGWHFGLGGMPDAAALEAAGTVSYHGHEVTEILFGGIFHTGAAGVVGGLLVLV
                     VGHLVVLALGVTSAGLQAVRLEYVEFFNKFFEGGGRAYNPFGYDREFTTED"
     gene            281153..281410
                     /locus_tag="HVO_RS06210"
                     /old_locus_tag="HVO_0312"
                     /db_xref="GeneID:8924758"
     CDS             281153..281410
                     /locus_tag="HVO_RS06210"
                     /old_locus_tag="HVO_0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit C"
                     /protein_id="WP_004044611.1"
                     /db_xref="GeneID:8924758"
                     /translation="MIEAIEPLMTALQSEAASSPAITADAAAALSVGIAAFAAGYAER
                     GIGSAAMGAIAEDDDLFVNGLVLTVLPETLVILALVVVFAA"
     gene            281432..282016
                     /locus_tag="HVO_RS06215"
                     /old_locus_tag="HVO_0313"
                     /db_xref="GeneID:8926671"
     CDS             281432..282016
                     /locus_tag="HVO_RS06215"
                     /old_locus_tag="HVO_0313"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322775.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the E subunit is part of the
                     catalytic core of the ATP synthase complex; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit E"
                     /protein_id="WP_004044610.1"
                     /db_xref="GeneID:8926671"
                     /translation="MSLDNVVEDIRDEARARAEDIRQDGQEQADEIVAEAEADAEELL
                     ESRKADVEQQLEREREQALSSAKLEAKQARLSARRDVLQRVREQVERELAELEGDRRE
                     ELTRSLLDAAAVEFEDADEVSVYGRADDEELLSSILEDYDGYEFAGERDCLGGVVVEG
                     SNSRVRVNNTFDSVLDTVWEDNLKEVSARLFDDQ"
     gene            282013..283059
                     /locus_tag="HVO_RS06220"
                     /old_locus_tag="HVO_0314"
                     /db_xref="GeneID:8926092"
     CDS             282013..283059
                     /locus_tag="HVO_RS06220"
                     /old_locus_tag="HVO_0314"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit C"
                     /protein_id="WP_004044609.1"
                     /db_xref="GeneID:8926092"
                     /translation="MSTTGGSNPEYVIARVRARRSALFGDEEYRKLVRMGPAEIARFM
                     EESEYEAEVNALGSRFSGVDLIEYALNQNLAKQFNDILDWADGRLYDLIARYLRKFDA
                     WNVKTVIRGLYSGASREEVESDLIRAGEFDDRLISRLLDAGEIEEVVSVLSGTIFGDG
                     LAAAYEEYEEVGVLVPLENAVDRAFYEQLLDDLVVGEEAKQYREFLEAEIDFRNARNA
                     LRIARSGADLDPVDYFIEGGTLFRATELASLATSPDELVSKIRDSRYGDRLSAALSDL
                     EAADSLIGFERALDAALLEYADTLGYVFPLSVTPIVSYILAKEREVDNIRAIARGREA
                     GLDPDAIEAELVIL"
     gene            283056..283376
                     /locus_tag="HVO_RS06225"
                     /old_locus_tag="HVO_0315"
                     /db_xref="GeneID:8925189"
     CDS             283056..283376
                     /locus_tag="HVO_RS06225"
                     /old_locus_tag="HVO_0315"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044608.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the F subunit is part of the
                     catalytic core of the ATP synthase complex; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit F"
                     /protein_id="WP_004044608.1"
                     /db_xref="GeneID:8925189"
                     /translation="MSQEIAVIGSPDFTTGFRLAGVRKFENVPDEAKDDELDEAVTRT
                     LEDEDVGIIVMHEDDLDHLSRNARQSVERSIEPTLVTLGGSGGASGLRDQIKRAIGID
                     LMDE"
     gene            283383..285143
                     /locus_tag="HVO_RS06230"
                     /old_locus_tag="HVO_0316"
                     /db_xref="GeneID:8924169"
     CDS             283383..285143
                     /locus_tag="HVO_RS06230"
                     /old_locus_tag="HVO_0316"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005577682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit A"
                     /protein_id="WP_004044607.1"
                     /db_xref="GeneID:8924169"
                     /translation="MSQATQDSVREDGVIASVSGPVVTARGLDARMNDVVYVGDEGLM
                     GEVIEIEGDLTTIQVYEETSGVGPGEPVESTGEPLTVDLGPGMMDAIYDGVQRPLDVL
                     ESKMDSAFLDRGVDAPGIDLDEKWEFEPTVSEGDEVAPGDVVGTVPETVTIEHKVMVP
                     PDFGGGEVVAVEEGEFSVTEAVVELDSGEEITMHQEWPVRQARPAAEKKTPREPLVSG
                     QRILDGLFPIAKGGTAAIPGPFGSGKTVTQHQLAKWADADIVVYVGCGERGNEMTEVI
                     EDFPELDDPKTGNPLMARTCLIANTSNMPVAARESCIYTGITIAEYYRDMGYDVALMA
                     DSTSRWAEAMREISSRLEEMPGEEGYPAYLAARLSEFYERAGYFTTVNGEEGSVSVIG
                     AVSPPGGDFSEPVTQNTLRIVKTFWALDADLAERRHFPAINWNESYSLYQEQLDPWFV
                     ENVEDDWAEERQWAVDVLDEENELQEIVQLVGKDALPEDQQLTLEIARYLREAYLQQN
                     AFHPTDTYCSPEKTYGILTAIHAFNDEAFKALEAGVPVEEIQAIEAAPRLNRIGVQED
                     WEAYIEDLKAEITEQLRELY"
     gene            285148..286554
                     /locus_tag="HVO_RS06235"
                     /old_locus_tag="HVO_0317"
                     /db_xref="GeneID:8926298"
     CDS             285148..286554
                     /locus_tag="HVO_RS06235"
                     /old_locus_tag="HVO_0317"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit B"
                     /protein_id="WP_004044606.1"
                     /db_xref="GeneID:8926298"
                     /translation="MKEYQTITEISGPLVFAEVDEPIGYDEIVEIETPQGETKRGQVL
                     ESSEGLVAIQVFEGTSGIDRNASVRFLGETLKMPVTEDLLGRVLDGSGQPIDGGPEIV
                     PDERRDIVGAAINPYSREYPEEFIQTGVSAIDGMNTLVRGQKLPIFSASGLPHNDLAL
                     QIARQATVPEDEESGEESEFAVVFGAMGITQEEANEFMEDFERTGALERSVVFTNLAD
                     DPAVERTVTPRLALTTAEYLAFDKDYHVLVILTDMTNYCEALREIGAAREEVPGRRGY
                     PGYMYTDLAQLYERAGRIQGRDGSVTQIPILTMPGDDDTHPIPDLTGYITEGQIYIDR
                     DLNSQGIRPPINPLPSLSRLMDDGIGEGLTREDHADVSDQMYAAYAEGEDLRDLVNIV
                     GREALSERDNKYLDFAERFEAEFVNQGFDTDRSIEDTLDIGWDLLSTLPKSELNRIDE
                     ELIEDYYEDDAESVEAEA"
     gene            286684..288660
                     /locus_tag="HVO_RS06240"
                     /old_locus_tag="HVO_0318"
                     /db_xref="GeneID:8925506"
     CDS             286684..288660
                     /locus_tag="HVO_RS06240"
                     /old_locus_tag="HVO_0318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008576999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="WP_004044605.1"
                     /db_xref="GeneID:8925506"
                     /translation="MDATSSPTRVLAVVGPAVDRERLVDVLSPLSVSVAPSVDAAGRR
                     AEAESVDCVVLGTDRLAHVNAVHGALAVPLVVVVPPDGDLSAATARDAGAADVVPVVD
                     SNLFERLPERVESAVAWRRRGAAAASKITEDLKEQAIDEAPVGITVADCSLPDRPLVY
                     VNEAFETMTGYSADAALGRNCRYLQGPNTDPERVAELRRAIEAEESASVELLNYRANG
                     ETFWNRVDVAPLSGSDGEVTHYVGFQTDITERVRAEAAAERYAARVDEERARLQTLVE
                     HIEGLLADVTSALVRAESRQELEAAVCDRVTAAGSFDCAWVGHCDLSPAVIVPNERAG
                     TDTEFLDGLEISRSNPDDPTARAAETRTVQSADVGDGSVSAETLVPFGSVIAVPLVHS
                     GTLYGVLTVYTDVAELDDQVRVVFGTLGRAVGAAIDAFESRRSLLSDERLELELEVRD
                     ETQPLVRLAVAGDCELSYRGSAQHDDGTVSLFVSTHPATEFGEADTDLDGLRSVDVLP
                     RGDDAELYELTFDDGSLLHLVADAGGRLVDLEVDRLGCRLTVIISDRVAGRALLDDLQ
                     TVAANAELRSVTNRSEPPEARREFVASVTDDFTDRQQSALQLAYLGGYFEWPHAVTGE
                     ELAETTGVSRATFHQHLHAAERKLISRFFDSNPY"
     gene            288859..289566
                     /locus_tag="HVO_RS06245"
                     /old_locus_tag="HVO_0319"
                     /db_xref="GeneID:8926781"
     CDS             288859..289566
                     /locus_tag="HVO_RS06245"
                     /old_locus_tag="HVO_0319"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit D"
                     /protein_id="WP_004044604.1"
                     /db_xref="GeneID:8926781"
                     /translation="MAEDVKPTRKNLMAIEDRIELSERGHDTLEQKRDGLIMEFMDIL
                     DQAQDVRANLNQDYERAQNKINMARAMEGDVAVRGAASALKEYPEITTQSKNIMGVVV
                     PQIESSRVKKSLDQRGYGLLGSSARIDEAADAYEELLESIILAAEVETAMKKMLEEIE
                     TTKRRVNALEFKLLPELYENQEYIEQKLEEQEREEIFRLKKIKAKKEEEEKEERAAEK
                     AAAEADADADAEAATAD"
     gene            289648..290031
                     /locus_tag="HVO_RS06250"
                     /old_locus_tag="HVO_0320"
                     /db_xref="GeneID:8925433"
     CDS             289648..290031
                     /locus_tag="HVO_RS06250"
                     /old_locus_tag="HVO_0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044603.1"
                     /db_xref="GeneID:8925433"
                     /translation="MSCPDCDGDLAVFAVPEPLESHAPEAALTVGLCADCLRLHSTEA
                     PPSDGASRPLAGALPDGDAGAAVALLVGMLDSLALNRAGIVDCVEFAERSGTDVHLTL
                     DRLQQTATAPHFDVARRQRQLDAFL"
     gene            complement(290089..291333)
                     /locus_tag="HVO_RS06255"
                     /old_locus_tag="HVO_0321"
                     /db_xref="GeneID:8924652"
     CDS             complement(290089..291333)
                     /locus_tag="HVO_RS06255"
                     /old_locus_tag="HVO_0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004048860.1"
                     /note="Directs the termination of nascent peptide
                     synthesis in response to the termination codons UAA, UAG
                     and UGA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="WP_004044602.1"
                     /db_xref="GeneID:8924652"
                     /translation="MSSDAEEASEDRRKYEFKKVIEDLREYEGSGTQLVTIYIPEDKQ
                     ISDVVEHVITEHSEASNIKSKQTRTNVQDALTSIKDRLRYYGNFPPDNGIVMFSGAVD
                     AGGGQTTMVTKVLESPPEPIQSFRYHCDSNFLTGPLEDMLMDKGLFGLIVLDRREANV
                     GWLKGKRVEPVKSASSLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMANDLFVPK
                     RHDMDGILVGGPSPTKDEFLDGDYLHHELQDLVVGKFDVAYTDESGLYDLVDAGQDAL
                     ADQEVIKDKKQMEEFFEKLHRGNESTYGFEATRKNLVMGSVDRLLISEDLRKDIAVYD
                     CGGQEEYELVDHRHDTPTHECDDGSEAELKDREDVIEWLMDLADQRGTETKFISTDFE
                     KGEQLYDAFGGIAGILRYSTGV"
     gene            291490..293214
                     /locus_tag="HVO_RS06260"
                     /old_locus_tag="HVO_0322"
                     /db_xref="GeneID:8924523"
     CDS             291490..293214
                     /locus_tag="HVO_RS06260"
                     /old_locus_tag="HVO_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinD"
                     /protein_id="WP_004044601.1"
                     /db_xref="GeneID:8924523"
                     /translation="MARVYAVASAKGGVGKTTSTANLGTTLAMAGHDVVVVDGDLGMP
                     NLAGALGVDPDGATLHDVLTGEAAVETAVYDGPAGLSVLPGSNALEAFATANAKELEP
                     VISTLEASYDIVIIDTGAGLSDDTFVPLKLADEVILVSTTEREALGDTEKTRQLADRI
                     GADVVGVVLTRVDQSKPNADVVASLLDTGVIAVVPESPAIREALSTRDPVVVHSPDSI
                     ATAGYRALAEALTGTPVPVPGLDDETDEADATPEPADAADPEPNPEPAPDSDFVEDSG
                     DGVDDGAGPAATPDLDSGSDSVADPDAAAVADEDRATADPELESEAEPNVEAEPEGES
                     TVETEPEAEPNAETEPEPAVDSDTDDDLAALIPFSASTAEEPDDPAEPDPTDGADASE
                     SAADPAVDSAVDPGDDAPADPLAADASDDPVLADSDPVGDEETDTDPLAADLDAVTRG
                     TPAADEETVAVADDEVVSDVDADTDSADADPLAEDTAADESRSASSASVEGADAPGAD
                     EPLVAEAEPDAAEAESDATEADPDADDSPEDDEEGVYTTSLVEEVESFDDDERDEKKK
                     GFLSRFLG"
     gene            complement(293437..295200)
                     /locus_tag="HVO_RS06265"
                     /old_locus_tag="HVO_0324"
                     /db_xref="GeneID:8925807"
     CDS             complement(293437..295200)
                     /locus_tag="HVO_RS06265"
                     /old_locus_tag="HVO_0324"
                     /EC_number="6.1.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine--tRNA ligase"
                     /protein_id="WP_004044599.1"
                     /db_xref="GeneID:8925807"
                     /translation="MFRQFREEVETALSAALSSLDLPTDDLGVEEPPEDVPATLASSV
                     AFRLAGVVGAPPPKIAADIAEELSVEGYDYLAAVDTQGPYVNFHVSDAYYDDTLDAAA
                     SDEAYGRLPATGDSVVVEHTSANPTGPVHVGRTRNPVIGDAVANLLDFAGNDVDRHYY
                     VNDAGRQMAVFTWAYETFDEDDLESEPARERVEYDLVRYYRKGNAFLEEADPEEVERA
                     EAEITEILQGIEEGDEETYARVETVVDQVLGGMRECLERLPAEFDEFVKETRFMFDGS
                     TRDLAERLKETDHAVYEEDAWQLELDDYGFEKNLVFLRSDDTSLYTTRDLAHHEWKFD
                     NYDRAVTVLGEDHKLQSGQLRAALDILGNDVDKLENVIYSWVNLPGGETMSTRKGTGV
                     MLDDLLDEAIDRARDEVETRLEGRTRDDDLDEADIDRIARQVGIGAVRYDIVSKQPTK
                     TITFEWDQALNFEAQSAPYIQYVHARCCGIADEAATAGLDASEADPAVLTTDAERDLL
                     ATIARFPAVVETAADDLEPHTVATFARELAEVFNTFYRECPVLDADEEVGAARLALVE
                     ASRNAVANALAIVGVEAPESM"
     gene            296025..296738
                     /locus_tag="HVO_RS06270"
                     /old_locus_tag="HVO_0326"
                     /db_xref="GeneID:8924213"
     CDS             296025..296738
                     /locus_tag="HVO_RS06270"
                     /old_locus_tag="HVO_0326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF120 domain-containing protein"
                     /protein_id="WP_013035596.1"
                     /db_xref="GeneID:8924213"
                     /translation="MSESAVAAAVGYDELATLKLVALDGGRSGPVKLSCSGVANRLDV
                     SNQTASRRLQRLEEADFIDREVVSDGQWITITDAGESALRQEYADYRRIFETPSVVVL
                     EGQVTGGMGEGRHYISLSGYMKQFKDRLGYEPFPGTLNVRLDDDAVRARAGMTALDAV
                     PIDGWEDDERTFGPATCYAASVTVGGDSYEPVHIIVPERTHHDESQLEIIAPDKLRDE
                     LDLDDGDAVTVRVEEAEYE"
     gene            296735..297424
                     /locus_tag="HVO_RS06275"
                     /old_locus_tag="HVO_0327"
                     /db_xref="GeneID:8926335"
     CDS             296735..297424
                     /locus_tag="HVO_RS06275"
                     /old_locus_tag="HVO_0327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
                     /protein_id="WP_004044596.1"
                     /db_xref="GeneID:8926335"
                     /translation="MSRTAESTGDFDAVSRVLDAFRAGEPVLVHDFDDREGETDLVYP
                     AGAVGSADVARMRNDAGGLVCVALPNDVSESLGLPFMDDVLDHPAASSHDLAYDSRSS
                     FSFTVNHRDSFTGITDRDRAMTISRLAPVAEAARAGEYDADDFGGEFRAPGHVHLLRG
                     APNLLSDRQGHTELGLALADEAGISPAVVVCEMLDDETGAALPKDAARDYADRHGFAF
                     VDGDGLIDELV"
     gene            complement(297455..298345)
                     /locus_tag="HVO_RS06280"
                     /old_locus_tag="HVO_0328"
                     /db_xref="GeneID:8925447"
     CDS             complement(297455..298345)
                     /locus_tag="HVO_RS06280"
                     /old_locus_tag="HVO_0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_004044595.1"
                     /db_xref="GeneID:8925447"
                     /translation="MSLESVAVTGGTGNLGPTVVAHLRASGYTVTNLSRHSESSLADH
                     DYRVSALDPGDLTAALSDVDADAVVHLGTISTPTNDPGHRVFESNVQSTYVVLEVAAA
                     LGIDRVVVASSMSAIGGSFEPDPARIDFLPVDESHRATPSNPYGLGKYVAEQTAAGFV
                     RRADAPETVASLRFPWMPSEEEGRQTFAEADRSLSGLRDAGHFHTARNTLFSYLGRED
                     AARLVRRALEADFAGHEVFWAAAADTSTTVESATLASEVYPDAETRESLSGHEALVST
                     EKAKRLLGWEPTWSWRDGRA"
     gene            298435..299373
                     /locus_tag="HVO_RS06285"
                     /old_locus_tag="HVO_0329"
                     /db_xref="GeneID:8924934"
     CDS             298435..299373
                     /locus_tag="HVO_RS06285"
                     /old_locus_tag="HVO_0329"
                     /EC_number="2.6.1.42"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transaminase"
                     /protein_id="WP_004044594.1"
                     /db_xref="GeneID:8924934"
                     /translation="MGFDEMDVSTIWQSGEYKDWEDATVHVLTHGLHYGTGVFEGVRA
                     YDTDRGPAIFRWEEHLERLYQSAKPYDMEIPYTREELTEATLEVIRRNDLDGGYIRPI
                     AFYGYDSLGVSPKDNPTEVAIAAWPWGTYLGEDALENGVDVMVSSWRKHASSQIPTNA
                     KTTGLYVNSMLAGEEARRNGYVEAIVLNKEGNVAEGPGENIFMVRDGKIYTPGLSQSI
                     LDGITRDTVITLARERGYEVDDSATISRGELNTADELFFTGSAAEVTPIRKVDNVVIG
                     EGTRGPVTEELQSAFFDLVERRTDDHEEWFTYVDEQ"
     gene            complement(299452..300096)
                     /locus_tag="HVO_RS06290"
                     /old_locus_tag="HVO_0330"
                     /db_xref="GeneID:8925613"
     CDS             complement(299452..300096)
                     /locus_tag="HVO_RS06290"
                     /old_locus_tag="HVO_0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF502 domain-containing protein"
                     /protein_id="WP_004044593.1"
                     /db_xref="GeneID:8925613"
                     /translation="MSSWRRDFASGLVVLVPLIVILYILAFFYNGITSIPYVATVLST
                     DGTVTPLSEALGFIISIIIFLLLVLSVGYLMRTTAGRLLESGLDAAMNKVPLVRIVYN
                     ASKLAVETALTGTEDLQKPVRLETWPGIRMTAFKTGKTTKDGKVIVFMPTAPNITTGF
                     VMEVDPEDIEETGEKVEEALTRVLSAGFAEQDHVDEFNIEVTEESGDGRVPSNE"
     gene            complement(300176..301015)
                     /locus_tag="HVO_RS06295"
                     /old_locus_tag="HVO_0331"
                     /db_xref="GeneID:8926724"
     CDS             complement(300176..301015)
                     /locus_tag="HVO_RS06295"
                     /old_locus_tag="HVO_0331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline dehydrogenase"
                     /protein_id="WP_004044592.1"
                     /db_xref="GeneID:8926724"
                     /translation="MIPPIASRFVAGESAAGALDHARRMNDDGVAVILNLLGEHYAER
                     APADEDAAAYVDLVEDIASTGIDACVSVKPSQIGLDAGDHVFEENYRRIAEAADEHGV
                     FLWCDMEDHETTDVTLDAFEELAREFDGGMGLCVQANLKRTPDDLERLADVPGKIRLV
                     KGAYDEPAAVAHKQKSAVNEAYKELLAYLFREYDGGIAVGSHDPEMIAYAHDLGAEYD
                     RDYEVQMLMGVREDAQRDLAADGVEVWQYAPYGDKWVSYFYRRVRERKENALFALRAV
                     VGV"
     gene            301142..301684
                     /locus_tag="HVO_RS06300"
                     /old_locus_tag="HVO_0332"
                     /db_xref="GeneID:8924416"
     CDS             301142..301684
                     /locus_tag="HVO_RS06300"
                     /old_locus_tag="HVO_0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol
                     synthase"
                     /protein_id="WP_004044591.1"
                     /db_xref="GeneID:8924416"
                     /translation="MVVSLVATAFWAMLPAYVPNNAAVLAGGGRPIDGGRTWGGRRVL
                     GDGKTWRGTAAGTLAGTLLAVVLNAAAPAASGALGVSLPTFPLAAGFGLALGAMLGDI
                     GASFIKRRSGRERGAAFPGLDQLDFVVGALALAFVAAPGWFAATFSLPVLAVVLVMTP
                     VLHVVTNVGAYLLGLKNEPW"
     gene            301751..302281
                     /locus_tag="HVO_RS06305"
                     /old_locus_tag="HVO_0333"
                     /db_xref="GeneID:8923880"
     CDS             301751..302281
                     /locus_tag="HVO_RS06305"
                     /old_locus_tag="HVO_0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="WP_004044590.1"
                     /db_xref="GeneID:8923880"
                     /translation="MANAALIEALRAADAVQFGEFELSHGGTSSYYVDKYLFETDPRC
                     LKLIAEAFAERVADDDKLAGVALGAVPLVAATAVETNKPYVIARKKAKEYGTAKRIEG
                     ALDEGEEVVVLEDIATTGQSAVDAVEALREAGAVVDRVVVVVDRQEGAAELLADHDIA
                     LESLLTAEDLLADADG"
     gene            302356..303069
                     /locus_tag="HVO_RS06310"
                     /old_locus_tag="HVO_0334"
                     /db_xref="GeneID:8926034"
     CDS             302356..303069
                     /locus_tag="HVO_RS06310"
                     /old_locus_tag="HVO_0334"
                     /EC_number="2.4.2.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008582228.1"
                     /note="Catalyzes a salvage reaction resulting in the
                     formation of AMP, that is energically less costly than de
                     novo synthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_004044587.1"
                     /db_xref="GeneID:8926034"
                     /translation="MNRAEKAALQLQAVSVLRMLKETRTYDELAELTGLPAGDLNRYV
                     NGHVLPGVERAREVVEGVGRDALADELEARVRFDDEGYVDNSGVVFDQSFLDLVAPVA
                     ANALDLERPDVILTAATDGITLGAAMASYFGARLAYAKKSKETAVEDFIESRQRLASG
                     IELTYYLPASAIDDGERVLVVDDLIRSGETQELLLDIALQADADIAGVFALIAVGDEG
                     TNRARELTDAPVGALSSFD"
     gene            303256..304668
                     /locus_tag="HVO_RS06315"
                     /old_locus_tag="HVO_0335"
                     /db_xref="GeneID:8925700"
     CDS             303256..304668
                     /locus_tag="HVO_RS06315"
                     /old_locus_tag="HVO_0335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NCS2 family permease"
                     /protein_id="WP_004044586.1"
                     /db_xref="GeneID:8925700"
                     /translation="MGLSETLANYFDVHKHGSTVRTEILAGITTFLTMSYIVVVNPSL
                     LTDQPYIEGVDGIAIAGYTPGEVQSMLAVVTILAAAIATTVMAFYANRPFAQAPGLGL
                     NAFFAFTVVGALGVPWQTALAAVFIEGLIFIALTAVGAREAIIKVFPEPVKMAVGTGI
                     GLFLAIIGLQAMGIVVNDNSTLVTMGNLASNPIAIVSIVGLFFTFALYAANVPGSIII
                     GIVGTSLLGWGLTASGVVSAEAGLVANSSAATYDITPLAGAFISGFGNVEAFSFALIV
                     ITFFFVDFFDTAGTLVGVGQAGGFLNDDGDLPDIDKPLMADAVGTTAGAMLGTSTVTT
                     YIESATGVEEGGRTGLTALVVALLFLGSLAIVPLATAIPQYASHIALVVIGVVMLRNV
                     VDIEWDDLTFTIPAGMTILVMPFTYSIAYGIAAGIVSYPLVKVAAGEYDDVSAGQWAL
                     AVAFVLYFVVRTSGMLQAQV"
     gene            304921..306147
                     /locus_tag="HVO_RS06320"
                     /old_locus_tag="HVO_0336"
                     /db_xref="GeneID:8926259"
     CDS             304921..306147
                     /locus_tag="HVO_RS06320"
                     /old_locus_tag="HVO_0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_004044585.1"
                     /db_xref="GeneID:8926259"
                     /translation="MSVQGYTFQGNTNPKKPARVVSVGERGSLQWTYDDSVNGNAWFF
                     DVDPLPNGNLLVSSPRGTDTVVFELDPDTRERVWEQRFDMEDTHDVDAFGEDELLIAN
                     MREWNDSAGVSEDRIVVYNRTTDEITWEWYFKNHFPADTDGGYNADWSHVNDVDYIGD
                     GRLLLSPRNFDQAIVVDMESKDIVERLGTDDDYDVLNEQHNPDWLVSENGTPTMLVAD
                     SGNNRVVEYAKEDGEWVRTWSVGKNTLNWPRDADRLPNGNTLIVDTLNHRVIEVTPTG
                     EVVWEYYATWGPYDAERVAHGDESSGPTIRDLNASGSYPITGSANITAGGDGSVGFVS
                     RVQSTFAGTPLEEPMSGLSTRLSHVLPWLRPVWMTPWDLFWAACAVGVGITATAGELY
                     LMRQRLLDAVRGLFGR"
     gene            306250..306504
                     /locus_tag="HVO_RS06325"
                     /old_locus_tag="HVO_0337"
                     /db_xref="GeneID:8924124"
     CDS             306250..306504
                     /locus_tag="HVO_RS06325"
                     /old_locus_tag="HVO_0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="WP_004044584.1"
                     /db_xref="GeneID:8924124"
                     /translation="MSDLILYELQGCPYCAKVKDKLSDLDLEYESRMVPSAHAEREEV
                     EEVSGQTGVPVLVDEEHGVEGMPESDDIVDYLEETYGSAA"
     gene            complement(306563..307537)
                     /locus_tag="HVO_RS06330"
                     /old_locus_tag="HVO_0338"
                     /db_xref="GeneID:8924946"
     CDS             complement(306563..307537)
                     /locus_tag="HVO_RS06330"
                     /old_locus_tag="HVO_0338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012659519.1"
                     /note="hth-type transcriptional regulatory protein;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004044583.1"
                     /db_xref="GeneID:8924946"
                     /translation="MSRSALVGNVAAMLQDAGFVVSDRIAIRPKSFDLAARRGEDLLL
                     LKILGNIDAFDGVTGSEMRRLGSYLDATPLVVGLRTRDEDLKPGVVYFRHGVPVLNPD
                     TAMDLFVEEVPPLIYAAPGGLYVSLDGDVLAEERQERGWSLGQLATELGVSRRTVSKY
                     ENGMNASIEVAIHLEELFDRPFSNPVDVLTGAEDVRDAEPTPDDPDVDPDDEHVLSVL
                     TRAGFTVHPTARAPFKAVSEDAGRKKETNVLTGHSPFTRSAEKRAQIMSSLGEITRTR
                     SVYFVEEQQKRESVDGTGIVSCEELAAIDDPDEIRDLIRERTRDPAES"
     gene            307680..308948
                     /locus_tag="HVO_RS06335"
                     /old_locus_tag="HVO_0339"
                     /db_xref="GeneID:8924150"
     CDS             307680..308948
                     /locus_tag="HVO_RS06335"
                     /old_locus_tag="HVO_0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1743 domain-containing protein"
                     /protein_id="WP_004044582.1"
                     /db_xref="GeneID:8924150"
                     /translation="MTVIGLDDTDSRTLGMCTTYLATLVAEAVEARGGTVERRLLVRL
                     NPAVEHKTRGNAALAIHTDLPAGAAFDLAREELDRWAVLDDDRTSPGVVVAPGSPDTV
                     STAVADFARDAVRDFHDLDDAVALAERSGFLTEGWHGGRGRIGALAAVGAWAAFDEWT
                     YEHISYREFHRCGTPREVDVDSVFDAADAAYPDAWDTVDREEGEGVCVPNAPGPILHG
                     IRGDDADTVREVAAAIDSEPVDRSATFRTNQGTDAHLRDGVVSDLRDGRAYRVAGTVA
                     SDPETRRGGHVFFDLEAGDAVVAVAAFEPTKRFRNRVRALRVGDAITACGEVGDGTLK
                     LEKFAVRDLVRTEPATPVCPDCGRTMKSAGRNQGYRCRDCGTDAPGKVERAVDRDLEP
                     GWYEVPPCARRHIAKPLVRGGFDAATHPER"
     gene            complement(308973..309416)
                     /locus_tag="HVO_RS06340"
                     /old_locus_tag="HVO_0340"
                     /db_xref="GeneID:8924921"
     CDS             complement(308973..309416)
                     /locus_tag="HVO_RS06340"
                     /old_locus_tag="HVO_0340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044581.1"
                     /db_xref="GeneID:8924921"
                     /translation="MLDMFRSDTRAIEGLPVRLVVALVVGVASMSVMLNMLSGVQGLA
                     TSELDVKPTPDVVGPGEQALDFTVVDHEGNPVEGATVIVKSGTAEIDGVATAKSDDGG
                     SATVNVDAELGANREDGTLVVDVKPPAGESFVDRRENTNVLVVQD"
     gene            309492..310541
                     /locus_tag="HVO_RS06345"
                     /old_locus_tag="HVO_0341"
                     /db_xref="GeneID:8926440"
     CDS             309492..310541
                     /locus_tag="HVO_RS06345"
                     /old_locus_tag="HVO_0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_004044580.1"
                     /db_xref="GeneID:8926440"
                     /translation="MHTIGRKSDEEGPACRLGCYRARDGSDGATVGLDVNRPHAAVVV
                     GKRGSGKSHTLGVMAEGLARAAGVAPVVIDPMGVFCGLTESPIDATVHDSPRVRADAL
                     PPSAWPELLGLDPTAPAGSLVWRLAAEEDSLVAMRGAVDDDDAAPETRRAAANHLALA
                     DSWDVFHPEGLDPRSLCGSSPDVLDLSGLEATPASAVVRVVARGLYDARVAGSVPRIP
                     WLLLDEAHAFAGGLADPALRTLLTRGRAPGVGVVLATQRPSALPEVAVSQADLRVVHR
                     LTAGPDVSAMAAADPTYFDESLRARLPRERGCALVVDDTTETVHDVRVRPRETPDGGA
                     TPRAVSEPGSSETIE"
     gene            310562..310897
                     /locus_tag="HVO_RS06350"
                     /old_locus_tag="HVO_0342"
                     /db_xref="GeneID:8926602"
     CDS             310562..310897
                     /locus_tag="HVO_RS06350"
                     /old_locus_tag="HVO_0342"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome condensation protein CrcB"
                     /protein_id="WP_004044579.1"
                     /db_xref="GeneID:8926602"
                     /translation="MDRSELALVALGGFAGATLRYAVSVAIPGAGGTLAVNVLGSFAL
                     GTFITSVSSHRAQLFFGTGLLSSFTTYSTFAVQTASLSPVGGALNVGANYALGFAAAA
                     LGLTFGGRR"
     gene            310894..311250
                     /locus_tag="HVO_RS06355"
                     /old_locus_tag="HVO_0343"
                     /db_xref="GeneID:8924504"
     CDS             310894..311250
                     /locus_tag="HVO_RS06355"
                     /old_locus_tag="HVO_0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CrcB family protein"
                     /protein_id="WP_004044578.1"
                     /db_xref="GeneID:8924504"
                     /translation="MTPSLLSAVLVGVGGMGGAVARHTVDQRVVGKWSTVTVNVLGSV
                     ALGFIVTASVGDAAATLAGTGFCGAFTTFSSFAVGVAELAEAGDYDTAARYAFGTLVA
                     ALVGVAIGGAMGGLVG"
     gene            complement(311653..311725)
                     /locus_tag="HVO_RS06360"
                     /old_locus_tag="HVO_3018"
                     /db_xref="GeneID:8925398"
     tRNA            complement(311653..311725)
                     /locus_tag="HVO_RS06360"
                     /old_locus_tag="HVO_3018"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(311689..311691),aa:Asp,seq:gtc)
                     /db_xref="GeneID:8925398"
     gene            complement(311755..311827)
                     /locus_tag="HVO_RS06365"
                     /old_locus_tag="HVO_3019"
                     /db_xref="GeneID:8926843"
     tRNA            complement(311755..311827)
                     /locus_tag="HVO_RS06365"
                     /old_locus_tag="HVO_3019"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(311791..311793),aa:Asp,seq:gtc)
                     /db_xref="GeneID:8926843"
     gene            312095..312322
                     /locus_tag="HVO_RS06370"
                     /old_locus_tag="HVO_0346"
                     /db_xref="GeneID:8926847"
     CDS             312095..312322
                     /locus_tag="HVO_RS06370"
                     /old_locus_tag="HVO_0346"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit H"
                     /protein_id="WP_004044577.1"
                     /db_xref="GeneID:8926847"
                     /translation="MVDVSQHKLVPEHTKLDDEAVEDVLQEYNVEKTNLPKIKLKDPA
                     LPEDAEPGDVIKIVRNSRTTDKAVVYRLVIE"
     gene            312319..313884
                     /locus_tag="HVO_RS06375"
                     /old_locus_tag="HVO_0347"
                     /db_xref="GeneID:8926115"
     CDS             312319..313884
                     /locus_tag="HVO_RS06375"
                     /old_locus_tag="HVO_0347"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008444332.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. The beta
                     subunit is part of the catalytic core which binds with a
                     sigma factor to produce the holoenzyme; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit B''"
                     /protein_id="WP_004044576.1"
                     /db_xref="GeneID:8926115"
                     /translation="MNRQARREVSRKYFSEERLAEHHFRSFNAFLERGMMDVVEEKAT
                     IETDIGDKEGEEPVYVELGGVRVETPRVREADGSEELLFPQEARLRNITYSAPVFMEM
                     SIVRGGEEEEEVVVDTAETKVGRMPIMVGSSKCNIAELSDEDLVEIGEDPVDPGGYFI
                     VNGSERVLMTSEDLAPNKILAEYDTKYGDEIQVAKTFSQRRGYRALVLCERNREGLLE
                     VSFPSVSGSVNFVTLVRALGLESDEEIVHRVSDDPEIVKFMLENLEEAEVQTQEQAIE
                     ALGKRVAGGQGKNYQLKRANYVIDRYLLPHLHEEGAEEEEVRMNKAYYLCRMAEACFE
                     LALQRRDSDDKDHYANKRLKVSGDLMKDLFRTALNKLARDVKYQLERANMRNRNLTVN
                     TVVRSDVLTERLEHPIATGNWVGGRSGVSQLVDRTDYMGVLSHLRRLRSPLSRSQPHF
                     EARDLHATQWGRICPSETPEGPNCGLVKNFAQAMELSQNVEDEQSLKRELASMGVEGI
                     PGIDSVDAAPADD"
     gene            313886..315715
                     /locus_tag="HVO_RS06380"
                     /old_locus_tag="HVO_0348"
                     /db_xref="GeneID:8926659"
     CDS             313886..315715
                     /locus_tag="HVO_RS06380"
                     /old_locus_tag="HVO_0348"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005554552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit B"
                     /protein_id="WP_004044575.1"
                     /db_xref="GeneID:8926659"
                     /translation="MAQAQREAKVYVNGSLVGTHPDPNQLAAQIREARRRGDVSQMVN
                     VSVKERTREVIINADAGRARRPLIVVEDGEPLLDDDHVEALDNDELDFDDLVERGLVE
                     FIDAEEEEDIYVAVDEDELNEDHTHLEIDPQLIFGIGAGMIPYPEHNASPRITMGAGM
                     MKQSLGLPAANYRIRPDTRQHLMHYPQLSMVKTQTTEQIGFDERPAAQNFVVAVMSYE
                     GFNIEDALVMNKGSVERALARSHFFRTYEGEERRYPGGQEDRFEIPSQDVRGARGEDA
                     YSHLDEDGLVNPETVVDENSVLLGKTSPPRFLEEPDDMAGLSPQKRRETSVTMRSGES
                     GVVDTVTLMEGEDGSKLAKVSVRDQRVPELGDKFASRHGQKGVVGHLAPQEDMPFTAD
                     GVVPDLVLNPHALPSRMTVGHVLEMLGGKVGALEGRRVDGTAFQGENEEELRSALEER
                     GFMSSGKEVMYSGVTGEKIEAEIFVGIIFYHKLYHMVSNKLHARSRGPVQVLTRQPTE
                     GRAREGGLRLGEMERDTVIGHGAAMVLQERLLDSSDKEKVYISADTGMVAVEDRDQRR
                     IYDPVTGDEDNIHEIEISYAFKLLLDEMVALGVRPRIELKDAV"
     gene            315728..318652
                     /locus_tag="HVO_RS06385"
                     /old_locus_tag="HVO_0349"
                     /db_xref="GeneID:8924398"
     CDS             315728..318652
                     /locus_tag="HVO_RS06385"
                     /old_locus_tag="HVO_0349"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit A'"
                     /protein_id="WP_004044574.1"
                     /db_xref="GeneID:8924398"
                     /translation="MQTPKEIGSIQFGLMDPETYRDMSATKVITADTYDDDGYPIDMG
                     LMDPRLGVIDPGLQCRTCGQHSGSCNGHFGHIELAAPVIHVGFTKLIRRLLRSTCREC
                     GRLSLTDEEADEYRDKLGRTKELGDDWSDVMKSAVRQARKANRCPHCGSPQHDIKHEK
                     PTTYYEVQNVLAGDYSERIAEAMQPDPDDEDDEGVDPVTLANETGLDAERVNQVLAGE
                     FRPVGDDRKALEKALDLDLTEEDMNKLMPSDIRDWFEDVPDEDLVTLGIDPDRSRPEW
                     MILTVLPVPPVTARPSITLDNGQRSEDDLTHKLVDIIRINQRFMENREAGAPQLIIED
                     LWELLQYHVTTFIDNEISGTPPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSA
                     RTVISPDPTLSLNEVGVPDRVASEMTQTMNVTERNVDEARQYVRNGPESHPGANYVRR
                     PDGRRLKVTEKNCEELAEKVELGWEVNRHLVDGDIVIFNRQPSLHRMSIMAHEVVVMP
                     YKTFRLNTVVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFGENIIG
                     AIQDHISGTYLLTHDNPEFVETQALDLLRATRVDTLPEPAGENEGGQPYWTGQQIFSE
                     LLPDDLNMEFTSKVGDTVSIEDGQLVQGTIDEDAVGAFGGEIVDALAKDYSKTRSRIF
                     INEIASLAMRAIMHFGLSIGIDDESIPDEATAQVDEAIDAAYDKIQELIEIYEAGELE
                     SLPGRSVDETLEMKIMQRLGKARDSAGEIAEDHFEEDNPAVVMSKSGARASMLNLTQM
                     AGCVGQQAVRGERINRGYEGRTLSHYQKGDLSAEAHGFVENSYRAGLTPREFFFHAMG
                     GREGLVDTAVRTSKSGYLQRRLINALSELEAQYDGSVRDTSGTIVQFEFGEDGTSPVK
                     VSSDDETPIDVENIADRILTSEFSSDEEKERFLGERAPPTNLSEHAEPRVDARAGVES
                     DD"
     gene            318645..319904
                     /locus_tag="HVO_RS06390"
                     /old_locus_tag="HVO_0350"
                     /db_xref="GeneID:8925081"
     CDS             318645..319904
                     /locus_tag="HVO_RS06390"
                     /old_locus_tag="HVO_0350"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit A''"
                     /protein_id="WP_004044573.1"
                     /db_xref="GeneID:8925081"
                     /translation="MTDTDATADYEFVDDAIVDVVESKELSRRLKDRIYQTIEEREGV
                     TLDQAGEIAQAVEARYLDTRVDPLDPVGTVSAQSIGEPGTQMTMNTFHYAGVAEIDVT
                     QGLPRLIELVDARKTPDTPMMTVYLEDEYANNRELAHQVVWNIESTKILALGDISTNV
                     ADMVVQVNLNDETLLERWPTYDDEGVVASEIAETIEDALGIKTRREGTLIEFGPESPS
                     YRRLLQLVEELRDIVFKGIEEVSRVVIRKENNEDTDEEEFVLYTEGSAFGDALAIEGV
                     DASRTTSNNIHEVHKQLGIEAAREAIIDETMNTLREQGLDDVNIRHLMLVADIMTNDG
                     TIESIGRHGISGSKDSVLARAAFEVTVNHLLDAAIHGEEDDLDGVIENVIVGKPIAIG
                     TGDVDLRMGSLDVEDADANAAPEPSDD"
     gene            319907..320326
                     /locus_tag="HVO_RS06395"
                     /old_locus_tag="HVO_0351"
                     /db_xref="GeneID:8924488"
     CDS             319907..320326
                     /locus_tag="HVO_RS06395"
                     /old_locus_tag="HVO_0351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NusA-like transcription termination
                     signal-binding factor"
                     /protein_id="WP_004044572.1"
                     /db_xref="GeneID:8924488"
                     /translation="MKVTLSDTARRFIALFEEETEATAHDCLVFDDRVVFLVAAGDMA
                     TAIGPGGRTVQSVERQLGRTVELVEDADTPEAFVASALAPAAVRHVTLSRQNDTVAYV
                     EVAEADRGVAIGASGKTIDTARELARRHYDIDDIQLT"
     gene            320381..321157
                     /locus_tag="HVO_RS06400"
                     /old_locus_tag="HVO_0352"
                     /db_xref="GeneID:8926598"
     CDS             320381..321157
                     /locus_tag="HVO_RS06400"
                     /old_locus_tag="HVO_0352"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel"
                     /protein_id="WP_004044571.1"
                     /db_xref="GeneID:8926598"
                     /translation="MSSIRPSVGVAAGQLDPTQFADYEELASATAGFAVAAVVVYLVG
                     RLLLVPGVTRLVSARNRNNPTLQSATETYAHAVVIGALISGLFLVADPDFNVGDWISW
                     PGGEGVVEAVDFRVTRVRTVNNETISVPNTELTTNALTRPYGRERYRLTERVDIAYAD
                     DAELALRELVETAREDDRVLDDPEPTARIVEFAGSSVGLQTEFWVGSPMDANLVDVRS
                     QYRRRVKRRFDEEGLTLGPASGREVSGRLDVDLVGGRDGE"
     gene            321385..321813
                     /locus_tag="HVO_RS06405"
                     /old_locus_tag="HVO_0353"
                     /db_xref="GeneID:8926636"
     CDS             321385..321813
                     /locus_tag="HVO_RS06405"
                     /old_locus_tag="HVO_0353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004515440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_004044570.1"
                     /db_xref="GeneID:8926636"
                     /translation="MANGKYAARKLKQDRQKRRWSDSEYARRERGLGKKSDPLEGAPQ
                     GRGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAG
                     IGGAKGRAMGDLSGVNYKVEKVNGVSMIELVRGNAEKPVR"
     gene            321816..322430
                     /locus_tag="HVO_RS06410"
                     /old_locus_tag="HVO_0354"
                     /db_xref="GeneID:8925819"
     CDS             321816..322430
                     /locus_tag="HVO_RS06410"
                     /old_locus_tag="HVO_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_004044569.1"
                     /db_xref="GeneID:8925819"
                     /translation="MSESDAPEPESPASSEEAKENALLFGVWDVSEMEYTDPSMSRYI
                     KATPIAHTMGRHASKQFQKSEISIVERLINRLMQTEDNTGHKQKTSKIVKDAFEIVNE
                     RTEENPVQVLIRAVENAGPREETVRLKYGGISVPQAVDVAPQRRVDEALKFIAQGTLS
                     GSYKTTTTAAEALAQQLIGAADYDVQTYAISQKEEKERVAEAAR"
     gene            complement(322539..323294)
                     /locus_tag="HVO_RS06415"
                     /old_locus_tag="HVO_0355"
                     /db_xref="GeneID:8924927"
     CDS             complement(322539..323294)
                     /locus_tag="HVO_RS06415"
                     /old_locus_tag="HVO_0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044568.1"
                     /db_xref="GeneID:8924927"
                     /translation="MDLRVVGGAPADPFLSAADLFETEFELSYPVFVRVRDDPDSRTW
                     AGHYQDHHVLNISRQAATSAMARELALHELSHMARNEEGHVSHYQSTREAVFLALAGR
                     TVERRKLAHCYQIANHCKDIYADDLTLSVAPADKLVQFLESQLAAALADRPQASGRPG
                     SRLVTAGSDPEITAVNAGFALALVERHDLVESDHRLYDLAHAAGDDAPSVSLETFKEH
                     FRTLADDPSKSEYRRTLVDVVKRYVVNPRMAAD"
     gene            323485..325668
                     /locus_tag="HVO_RS06420"
                     /old_locus_tag="HVO_0356"
                     /db_xref="GeneID:8924078"
     CDS             323485..325668
                     /locus_tag="HVO_RS06420"
                     /old_locus_tag="HVO_0356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007110269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor EF-2"
                     /protein_id="WP_004044567.1"
                     /db_xref="GeneID:8924078"
                     /translation="MGRRKKIVQECEKLMDKPEQIRNIAIAAHVDHGKTTLSDNLLAG
                     AGMISDETAGQQLAMDTKEDEQERGITIDAANVSMTHEWEGENHLINLIDTPGHVDFG
                     GDVTRAMRAVDGALVVVDAVEGAMPQTETVLRQALREGVKPALFINKVDRLINELQEG
                     PEEMQKRLVDVISDVNELIRGMTEEKDYDWTVSVEDGTVAFGSALYKWGVSMPSMEET
                     GISFGDIMELERGGDRQELHERTPLSDVVLDMVAEHFPNPLDAQPRRIPTVWRGDSES
                     DLARQMREVDDDGEVVFMATDISMDPHAGEIATGRLFSGTIRKGQELYVSGTAGKNRV
                     QSVGVFMGGEREELDRGVPAGNIAAVTGLRDAIAGSTVSSVEMTPFESIEHISEPVIT
                     KSVEAERMDDLPKLIQTLQQVAKEDPTIRIEINEDTGEHLISGQGELHLEVITQRIRD
                     NQGIPVRTGEPIVVYREQVQGESHEVEGVSPNRHNKFYITAEPLSQDIVDSIKLGEIS
                     MDMPELERREALQEAGMDKDTSQNVEHIHGTNILIDDTKGIQHLNETMELVIEGLEEA
                     LDDGPLAAEPVQGTLLRLHDARLHEDTIHRGPAQVIPATRDAVHRALIAGQVKLLEPI
                     QNVRIDVPSEYMGSASGEIQGRRGRVDDMYQEGDLMVIEGIAPVEEMIGFSSDVRSAT
                     EGRASWNTENAGFRVLSDNLQREKIMEIRERKGMKLELSQAIDYI"
     gene            325966..326535
                     /locus_tag="HVO_RS06425"
                     /old_locus_tag="HVO_0357"
                     /db_xref="GeneID:8924113"
     CDS             325966..326535
                     /locus_tag="HVO_RS06425"
                     /old_locus_tag="HVO_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044566.1"
                     /db_xref="GeneID:8924113"
                     /translation="MSAQDLDGESDAEADGSGEMPKPHTIRLELVDEPGQLLAALKPI
                     SDNGGNLLSIFHERGSLTPRGHIPVEVDLECPPDRFARIVEALRDAGVNVIRAGAEHF
                     GEEVMVILVGDIVDSDLSDTLHRIESSADATLQDLSLSAREGTDEASSARLRLAVRSG
                     RVDETFGVVRDIAAEKELHVVEPLAEGSQ"
     gene            326532..327485
                     /locus_tag="HVO_RS06430"
                     /old_locus_tag="HVO_0358"
                     /db_xref="GeneID:8926420"
     CDS             326532..327485
                     /locus_tag="HVO_RS06430"
                     /old_locus_tag="HVO_0358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_004044565.1"
                     /db_xref="GeneID:8926420"
                     /translation="MSLRLAVLGAGAVGGSVLDLAGDYGHEVVAFADSSSSVVDPDGL
                     DPSAVHDRKEREGVVGGADPEAVFDVDYDVLVEATPTTLGDAEPGFSHVERALADDRH
                     VVLANKGPVAERYADLRALEAESGGTVQFEAAVGGAIPILSTISDLGAPHVTAARGVL
                     NGTANFILSRMAAEGLDYEHVLAEAQDLGVAEADPTFDVDGIDAALKFVILANVLSDG
                     ETEYALDDAAVEGIRNVPGTALDLAAEDGRTVRLIGEATADGVRVAPRLIPQGSALSV
                     TGTQNIVQLETKHAGQLNISGRGAGGPETATAVLSDVSRLE"
     gene            327676..328941
                     /locus_tag="HVO_RS06435"
                     /old_locus_tag="HVO_0359"
                     /db_xref="GeneID:8925759"
     CDS             327676..328941
                     /locus_tag="HVO_RS06435"
                     /old_locus_tag="HVO_0359"
                     /EC_number="3.6.5.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor EF-1 subunit
                     alpha"
                     /protein_id="WP_004044564.1"
                     /db_xref="GeneID:8925759"
                     /translation="MSDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREE
                     AEEKGKGGFEFAYVMDNLAEERERGVTIDIAHQEFDTDEFYFTIVDCPGHRDFVKNMI
                     TGASQADNAVLVVAADDGVAPQTREHVFLARTLGIGELIIAVNKMDVVDYSEDKYKDV
                     KEQVNKLLKQVRFNSDDATYVPISAFEGDNIAERSDNTSWYDGDILLEALNNLPAPQP
                     PTDAPLRLPIQDVYTISGIGTVPVGRIETGTLNPGDNVSFQPSDVGGEVKTVEMHHEE
                     VDQAGPGDNVGFNVRGVGKDDIRRGDVCGPADDPPKVAETFKAQVVVMQHPSVITAGY
                     TPVFHAHTAQVACTIESIDQKLDPASGEVAEENPDFIKSGDAAIVTVRPQKPLSIEPS
                     SEIPELGSFAVRDMGQTIAAGKVLEVNER"
     gene            328944..329252
                     /locus_tag="HVO_RS06440"
                     /old_locus_tag="HVO_0360"
                     /db_xref="GeneID:8925294"
     CDS             328944..329252
                     /locus_tag="HVO_RS06440"
                     /old_locus_tag="HVO_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020221555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_004044563.1"
                     /db_xref="GeneID:8925294"
                     /translation="MQQARVRLAGTSPEDLDDICDDVREIANKTGVNLSGPIPLPTKT
                     LEVPARKSPDGEGTATWEHWEMRVHKRLIDLDADERALRQLMRVQVPNDVSIEIVLED
                     "
     gene            329507..329578
                     /locus_tag="HVO_RS06445"
                     /old_locus_tag="HVO_3020"
                     /db_xref="GeneID:8925441"
     tRNA            329507..329578
                     /locus_tag="HVO_RS06445"
                     /old_locus_tag="HVO_3020"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:329539..329541,aa:Ala,seq:cgc)
                     /db_xref="GeneID:8925441"
     gene            329856..330458
                     /locus_tag="HVO_RS06450"
                     /old_locus_tag="HVO_0362"
                     /db_xref="GeneID:8926875"
     CDS             329856..330458
                     /locus_tag="HVO_RS06450"
                     /old_locus_tag="HVO_0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044562.1"
                     /db_xref="GeneID:8926875"
                     /translation="MQYLDFKRERDEATTSWERGDPVAALVERTGPTTYLVTLPGGET
                     HAVEYGKERGTRVGGCDCKGFEFRDDEDSPCAHLCVLRKAEWSHNHFGDAAGRDVTDD
                     PITAHDTAEHVAPNATEPEPDLVADGGEDFPRQNCRRCGAVSPDGEAPPPAECSEGTT
                     DDPEHEWTDAPDLVADGGDIVEAPTTGHDGRVFGRPEDQL"
     gene            330652..331095
                     /locus_tag="HVO_RS06455"
                     /old_locus_tag="HVO_0364"
                     /db_xref="GeneID:8925234"
     CDS             330652..331095
                     /locus_tag="HVO_RS06455"
                     /old_locus_tag="HVO_0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035471.1"
                     /db_xref="GeneID:8925234"
                     /translation="MKTERTESTTVTVRVDEDLKEDYTSALDGSISDDIRSHMEEVAR
                     TVRDESDNNLPDDEILRDGYLALRRTAEAYDPNGRRIDVTTAISKVAERAGIPKDAVR
                     RRVLKPLIRDDYVELDWGEIIIYQPEEVNASANRASPTKGKSTSS"
     gene            complement(331222..331422)
                     /locus_tag="HVO_RS06460"
                     /old_locus_tag="HVO_0365"
                     /db_xref="GeneID:8925262"
     CDS             complement(331222..331422)
                     /locus_tag="HVO_RS06460"
                     /old_locus_tag="HVO_0365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044559.1"
                     /db_xref="GeneID:8925262"
                     /translation="MSELTDLILQTTDPVTALLLLGVAALVLWVRQDLHEDLRIIRGR
                     VRRVEDWAVATDGGVEEDDDGR"
     gene            complement(331415..331801)
                     /locus_tag="HVO_RS06465"
                     /old_locus_tag="HVO_0366"
                     /db_xref="GeneID:8924151"
     CDS             complement(331415..331801)
                     /locus_tag="HVO_RS06465"
                     /old_locus_tag="HVO_0366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035591.1"
                     /db_xref="GeneID:8924151"
                     /translation="MPDTNGTGTFGDGSNNWLGGIDDFVSDPGQAVRDPYDTVAGAAD
                     AAALNFDEGVGGLVSLFDDEAGNTAGPGGTPWIEDPQDGQASNPTRGTGLAAKVWIVV
                     AVVVGLVLLYLLRPLLEIIAGVVGDE"
     gene            complement(331803..332225)
                     /locus_tag="HVO_RS06470"
                     /old_locus_tag="HVO_0367"
                     /db_xref="GeneID:8926300"
     CDS             complement(331803..332225)
                     /locus_tag="HVO_RS06470"
                     /old_locus_tag="HVO_0367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044557.1"
                     /db_xref="GeneID:8926300"
                     /translation="MSGPLGLDWVDNSEEWDPSDPAVLATVREHGGDTFADRIHLLGD
                     GRLRQQVLMDGDPFASTYFDIDSSLASTSESDDGETSVGGGSSPGGSSSPSADTDDST
                     ENAPGVGWLLDGDGSRRNFIALGVAAAVAIGAVVFGGG"
     gene            complement(332222..332788)
                     /locus_tag="HVO_RS06475"
                     /old_locus_tag="HVO_0368"
                     /db_xref="GeneID:8926562"
     CDS             complement(332222..332788)
                     /locus_tag="HVO_RS06475"
                     /old_locus_tag="HVO_0368"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044556.1"
                     /db_xref="GeneID:8926562"
                     /translation="MIIDPDESGGGVPGGSESIPGNSDDDDDNTIDTGDYLDDDGGTG
                     GYGSIGDDDGLDPGNSESGMPGGGDPANDAVSPDPNENSDGDEVTVNPDGSVSIDEDR
                     LSGGYESVEDVVDEVRNIVGGGSSETPQVGEITALEEQLRNLRESLTGMGESTGDSSS
                     GGLLAAGAAGVAVVVAIGAAVLAGGDDK"
     gene            complement(332943..333431)
                     /locus_tag="HVO_RS06480"
                     /old_locus_tag="HVO_0370"
                     /db_xref="GeneID:8925308"
     CDS             complement(332943..333431)
                     /locus_tag="HVO_RS06480"
                     /old_locus_tag="HVO_0370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035306.1"
                     /db_xref="GeneID:8925308"
                     /translation="MPGRAPWGQSGTKGSGETLAVNNRPTIVTKSFGQTATVAAGSKQ
                     TTNIYAPEGKVWKVIGMELEAPNPGGDGSGDHFFYVWSAGHVRMMNGGGPDDDAVYWR
                     NSTWSVNSAAPQDTAASLNALTNLKATESKSIRITYNGNNLTADQTGHREIKFVFEEV
                     SY"
     gene            complement(333431..333871)
                     /locus_tag="HVO_RS06485"
                     /old_locus_tag="HVO_0371"
                     /db_xref="GeneID:8924445"
     CDS             complement(333431..333871)
                     /locus_tag="HVO_RS06485"
                     /old_locus_tag="HVO_0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044553.1"
                     /db_xref="GeneID:8924445"
                     /translation="MGILSKLTTDERRETPHIQDEVPADTTGHEVAWVAPADCTVEQL
                     SLWAVPGSEDALQLRPVIRRIRGDPDNPESAEDTDIPSYGGGEQFVTGEPDGDRYHVN
                     AEMRKGDRIVIITDNKSTDYAYRFRALPTVDYLGGIRRVIGGVF"
     gene            complement(333882..334388)
                     /locus_tag="HVO_RS06490"
                     /old_locus_tag="HVO_0372"
                     /db_xref="GeneID:8925147"
     CDS             complement(333882..334388)
                     /locus_tag="HVO_RS06490"
                     /old_locus_tag="HVO_0372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044552.1"
                     /db_xref="GeneID:8925147"
                     /translation="MPGTLSYNEDLAELDGDVRPIRGSDLDQDTVKAGAEVTVYREKV
                     PQDKDLWFGAGGKDRESADSSPMHADIVATGNGSGTEGDTISGTLYAAITDSDGRAMF
                     TRKLGDLELLAEYASESPTERPLMYSLAPYATAGRHIEFRIDADSNSDGKEIDPANSD
                     VMLYRSSL"
     gene            complement(334392..334589)
                     /locus_tag="HVO_RS06495"
                     /old_locus_tag="HVO_0373"
                     /db_xref="GeneID:8924275"
     CDS             complement(334392..334589)
                     /locus_tag="HVO_RS06495"
                     /old_locus_tag="HVO_0373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044551.1"
                     /db_xref="GeneID:8924275"
                     /translation="MTKVPLELLGIEVDTDDPGESAQNLGLGVIGVTLTMAVVGAGAY
                     LYNTARQKAGVTDDDVNIPGV"
     gene            334719..334901
                     /locus_tag="HVO_RS06500"
                     /old_locus_tag="HVO_0374"
                     /db_xref="GeneID:8925420"
     CDS             334719..334901
                     /locus_tag="HVO_RS06500"
                     /old_locus_tag="HVO_0374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044550.1"
                     /db_xref="GeneID:8925420"
                     /translation="MIGYPTLVLGTLVAYLRASDETRPFVKGAFGIGILGECGALSGA
                     VHFTQSGVSMLGGLIA"
     gene            335021..335359
                     /locus_tag="HVO_RS06505"
                     /old_locus_tag="HVO_0375"
                     /db_xref="GeneID:8924869"
     CDS             335021..335359
                     /locus_tag="HVO_RS06505"
                     /old_locus_tag="HVO_0375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044549.1"
                     /db_xref="GeneID:8924869"
                     /translation="MIQPLDGAGEPAGERGSVPDSDPANPPESGDIEVSDTQKAMTDG
                     GNPIHGAPEPVTDGGKDTEEVDGCPDCGSDDYVDADAVLRARNPSAKNTAVLTQYDRV
                     CIECGEAYDA"
     gene            335352..335792
                     /locus_tag="HVO_RS06510"
                     /old_locus_tag="HVO_0376"
                     /db_xref="GeneID:8926722"
     CDS             335352..335792
                     /locus_tag="HVO_RS06510"
                     /old_locus_tag="HVO_0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044548.1"
                     /db_xref="GeneID:8926722"
                     /translation="MPEDGETPSPPSPGDTFVRDAGVPNMGATANHAAAEGAPAEESV
                     GSSSTLRDMVLSTEPKRSLDEIESPWAPERGGPKRVFRGFQKMGDIDGMPAGFDVVVG
                     LAETAVLILDHVEEQNDGDQSDDAGQNDEDLDDDLAPLAGVGGA"
     gene            335795..336409
                     /locus_tag="HVO_RS06515"
                     /old_locus_tag="HVO_0377"
                     /db_xref="GeneID:8926036"
     CDS             335795..336409
                     /locus_tag="HVO_RS06515"
                     /old_locus_tag="HVO_0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_004044547.1"
                     /db_xref="GeneID:8926036"
                     /translation="MQAYHTVVTGDSGGGKTTLLREMQAEFPGLSIWVNFTNTDGITG
                     RDLDDAATVRSVGEARASDATRLNWVTDSPLETARQARTVAHEYHEATGFPTQVIFDE
                     AQNVLPDGEVESDNPVKRMLHEDRDKGLKVVIATQDPSDLDYTPIKQCKFWVWVGEWA
                     VFHDGFLRYFSIPRDDLPTEPYQYVVFDKRMNVLHRAETQEAYA"
     gene            336406..336630
                     /locus_tag="HVO_RS06520"
                     /old_locus_tag="HVO_0378"
                     /db_xref="GeneID:8925909"
     CDS             336406..336630
                     /locus_tag="HVO_RS06520"
                     /old_locus_tag="HVO_0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044546.1"
                     /db_xref="GeneID:8925909"
                     /translation="MNTHFRFGGTRVYLQPVEDDETDVVDALRTLAEWLSEDVVSWWT
                     YDVPPESQIQDPLTTDAKKALVISWGESRE"
     gene            337199..337783
                     /locus_tag="HVO_RS06525"
                     /old_locus_tag="HVO_0379"
                     /db_xref="GeneID:8925297"
     CDS             337199..337783
                     /locus_tag="HVO_RS06525"
                     /old_locus_tag="HVO_0379"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_004044545.1"
                     /db_xref="GeneID:8925297"
                     /translation="MKMQDYESKDGKKVWLSRSEVDTLLDVADGTEQRVAFALGARCG
                     LRVAEVVEVTPDDVVDTEVGKFLRVWEGKGSKYRETPIPTDLAATIAAVGDYRDESSD
                     TPVVDRTTRTVRNWVTKAGDQLVEETEDVGWSFLGPHDLRRTWGTLLVGAEVEPGLVM
                     EWGGWEDWETFREHYLGAYSLEAQARGMGKIEWL"
     gene            complement(338106..338621)
                     /locus_tag="HVO_RS06530"
                     /db_xref="GeneID:25143408"
     CDS             complement(338106..338621)
                     /locus_tag="HVO_RS06530"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049941501.1"
                     /db_xref="GeneID:25143408"
                     /translation="MTHNGGPQVDEGGLGNTPSGNFRVQQDELEWEDLPPEAKQQIIE
                     MSAAEISERLAKEEVLFHAVNPLDSGLSKVQNPDFYSEVAKSFSEQQLGVIGENIQPH
                     DLVTDTEEVDMTAQSSLSRVLDIALLDHPVATLYALGIVTFMLAFYLQSILIALAGAA
                     ILIVTALHYAD"
     gene            complement(339578..339793)
                     /locus_tag="HVO_RS06535"
                     /old_locus_tag="HVO_0380"
                     /db_xref="GeneID:8924106"
     CDS             complement(339578..339793)
                     /locus_tag="HVO_RS06535"
                     /old_locus_tag="HVO_0380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044543.1"
                     /db_xref="GeneID:8924106"
                     /translation="MSTAYDTDGSGSRNISLKVGDDFVEDFDRAIKRGQLNGELPMDM
                     SRSEAIRRLMKMAIEDPSLLASEEDED"
     gene            339904..340089
                     /locus_tag="HVO_RS06540"
                     /old_locus_tag="HVO_0381"
                     /db_xref="GeneID:8926391"
     CDS             339904..340089
                     /locus_tag="HVO_RS06540"
                     /old_locus_tag="HVO_0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcriptional regulator"
                     /protein_id="WP_004044542.1"
                     /db_xref="GeneID:8926391"
                     /translation="MEVSVNVSISMPPEMLEKIDENARAHGKSRAAYVRHLIQQAPDS
                     PFETPELQLTDEPPAEA"
     gene            340199..340432
                     /locus_tag="HVO_RS06545"
                     /old_locus_tag="HVO_0382"
                     /db_xref="GeneID:8925775"
     CDS             340199..340432
                     /locus_tag="HVO_RS06545"
                     /old_locus_tag="HVO_0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044541.1"
                     /db_xref="GeneID:8925775"
                     /translation="MSDDSFDVKLVVTRGTGSQDKEKMQVEVSADSLEELDEKVNGAR
                     ERLREWADDIRTIQPDGRRRHDDAQTELGGASA"
     gene            340429..340620
                     /locus_tag="HVO_RS06550"
                     /old_locus_tag="HVO_0383"
                     /db_xref="GeneID:8925134"
     CDS             340429..340620
                     /locus_tag="HVO_RS06550"
                     /old_locus_tag="HVO_0383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044540.1"
                     /db_xref="GeneID:8925134"
                     /translation="MSAQTNLGTFTAGLSPAETDAYLAVDEGDETPTEFARRTGRDPS
                     TVRTLLYRARRKLDKRGGA"
     gene            340784..341785
                     /locus_tag="HVO_RS06555"
                     /old_locus_tag="HVO_0385"
                     /db_xref="GeneID:8926201"
     CDS             340784..341785
                     /locus_tag="HVO_RS06555"
                     /old_locus_tag="HVO_0385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_004044538.1"
                     /db_xref="GeneID:8926201"
                     /translation="MTDLEPLSPEEGVTRFLRHREPSVRDSTLQNSRTRLNHFLDWCE
                     EVGIENLNDLSGRDLADFVAWRRGDIAPITLQKQLSTVRAALGFWADIEGVEDGLRER
                     VHAPELPDGAEARDVHLSADRAESILDYLDRYQYASREHVIMALLWRTGMRRGALRAL
                     DVGDLHADDHAVELVHRPETDTALKNGTKGERWVYLGPEWFEVVDEYAATNRHDVVDD
                     HGRRPLITSKYGRPTGDTIYKWVGKLTRPCEYGDCPHDRERATCDAVGSDGYPSRCPS
                     SRSPHAVRRGHITAYLNREVSPETISERSDVSLDILYQHYDARTPREKMNVRIQNLP"
     gene            342850..343224
                     /locus_tag="HVO_RS06560"
                     /old_locus_tag="HVO_0386"
                     /db_xref="GeneID:8925566"
     CDS             342850..343224
                     /locus_tag="HVO_RS06560"
                     /old_locus_tag="HVO_0386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044537.1"
                     /db_xref="GeneID:8925566"
                     /translation="METRRGEPPSDPTALFRAIVSKLRETRRGVHQHRMAQALLQRDA
                     NGSRLVGLAADTQRAVFFNPASRTLELIPFDREGTHEERAEVLSRRLSDPSSWVEANA
                     AGLSWVHPHFRWVCGLDDAGRS"
     gene            343321..343560
                     /locus_tag="HVO_RS06565"
                     /old_locus_tag="HVO_0387"
                     /db_xref="GeneID:8924830"
     CDS             343321..343560
                     /locus_tag="HVO_RS06565"
                     /old_locus_tag="HVO_0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035451.1"
                     /db_xref="GeneID:8924830"
                     /translation="MNDEELDELRSSLTPYESNGGVTTYQNTVSIACPACEKPFDDLV
                     VCENDYNSLELSMMLDLCVTQHDGDVLLFTHKQEE"
     gene            complement(343699..345018)
                     /locus_tag="HVO_RS06570"
                     /old_locus_tag="HVO_0388"
                     /db_xref="GeneID:8925373"
     CDS             complement(343699..345018)
                     /locus_tag="HVO_RS06570"
                     /old_locus_tag="HVO_0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNB domain-containing ribonuclease"
                     /protein_id="WP_004044535.1"
                     /db_xref="GeneID:8925373"
                     /translation="MSDDAQAYAGTAEGQGPVEIDAELARHLQNKREELFEEFEIRDA
                     FPPEVLSEARARTDGVHEEIEDELEHRKDLRDLTTWTTDPVDAQDFDDALSIRENEET
                     YTLWVHIADVTHYVHPGSEMWAEAVKRGNTVYLPAYTIHMLPPALAETVCSLVPEEDR
                     LAHTVEMEIKKDTLSFESIDIYKSVIHSNERLTYTQCENRLEDPDLPLHEENALVFDL
                     ADQLHEQRKEDGSLVLNPSRDRAHTIIEECMLKANKAVTHELMWNRGVEAMYRVHPQP
                     TPDQWDKALREITELDGVSIQSTSWDEPRKAVNDALESANSRTLNKIQRAVLKVMPRA
                     KYMNDPFGGHYALNFDIYGHFTSPIRRLSDLINHWIVHENDVPEDLVELCDRASDRQK
                     DAETAERLYKQFLQEVGLDPYAVNNRGIVTVDDDGEVIDENGLPPQE"
     gene            complement(345139..345441)
                     /locus_tag="HVO_RS06575"
                     /old_locus_tag="HVO_0389"
                     /db_xref="GeneID:8925843"
     CDS             complement(345139..345441)
                     /locus_tag="HVO_RS06575"
                     /old_locus_tag="HVO_0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044534.1"
                     /db_xref="GeneID:8925843"
                     /translation="MWRSRTNRDRNRVVCIACGDAVLRSAAREYDKEGNRWERHGKRF
                     EHLCKSCYRGLCHQPREELEGLLGDIEERGISDEEFLLRYFDAVKERYESPGERGR"
     gene            345603..346082
                     /locus_tag="HVO_RS06580"
                     /old_locus_tag="HVO_0390"
                     /db_xref="GeneID:8926271"
     CDS             345603..346082
                     /locus_tag="HVO_RS06580"
                     /old_locus_tag="HVO_0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_004044533.1"
                     /db_xref="GeneID:8926271"
                     /translation="MKVKSRHHLRSDEIDALCDSIESSLGVALAGDAFEAVEFADADY
                     EVVLVDGEPAVMYVDDQPFLTVKGANQFPPTTNVVTVDAGAVSFVSSGADVMRPGITE
                     ADESIEAGDLVVIAEETHGKVLAVGRALEDGADLVGDSGKVVESIHHVGDDLFEFSV"
     gene            complement(346125..346805)
                     /locus_tag="HVO_RS06585"
                     /old_locus_tag="HVO_0391"
                     /db_xref="GeneID:8923957"
     CDS             complement(346125..346805)
                     /locus_tag="HVO_RS06585"
                     /old_locus_tag="HVO_0391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1028 domain-containing protein"
                     /protein_id="WP_004044532.1"
                     /db_xref="GeneID:8923957"
                     /translation="MTFSICVREPYVDADGDDQHRFGVAVTTRLPGVGALCPFATEHG
                     AVATQALTNVGLGGKGMDYLEDGLAVDDALQALLNADDGRAERQLHGVGSEATFAFTG
                     DDCLGWAGHREGDAYTVAGNLLTGEAVVDATADAYERTAGGDEPLAKRLIDALGSGHA
                     AGGDKRDDLAIQSAAVVVTSTEDREMEPYYNDLRVDATETPLRDLRETFSMAREGYEA
                     ALEKYAEA"
     gene            347026..347382
                     /locus_tag="HVO_RS06590"
                     /old_locus_tag="HVO_0392"
                     /db_xref="GeneID:8924204"
     CDS             347026..347382
                     /locus_tag="HVO_RS06590"
                     /old_locus_tag="HVO_0392"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF552 domain-containing protein"
                     /protein_id="WP_004044531.1"
                     /db_xref="GeneID:8924204"
                     /translation="MGIMSKILGGGGSRTTEDYVELDLDDFDTARGDAGLSVHIAEIG
                     GQQDVIAIKDAVYDGNLVIADITRHTTSDSTMEHIIDDLRQVAREVDGDIVQKGDDQI
                     VITPTGISISRQKLNG"
     gene            347502..350453
                     /locus_tag="HVO_RS06595"
                     /old_locus_tag="HVO_0393"
                     /db_xref="GeneID:8924763"
     CDS             347502..350453
                     /locus_tag="HVO_RS06595"
                     /old_locus_tag="HVO_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008847323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit UvrA"
                     /protein_id="WP_004044530.1"
                     /db_xref="GeneID:8924763"
                     /translation="MSKDYIEVRGAEEHNLKNLDVRIPRETFTVVTGLSGSGKSSLAF
                     DTVYAEGQRRYIESLSAYARNFLGQMDKPKVEAVEGLSPAISIDQKNGANNPRSTVGT
                     VTELHDYLRLLYARVGTQYDPITGAEVGEQSAQDMVDQILELPEGTRAKVVAPVVRDQ
                     KGEFKDLFSDLVSEGYARVEVDGEEFDLSFETPDLDKNYDHTIDVVVDRVKVAPEARS
                     RIADSVETALEEAGGVLKLIVPDPPADLPFASNTRSTGSLAGEGDDRLVVEFSEELGN
                     PNSSFRFSEIETRSFSFNSPHGACPECEGLGKAKEVDPDLVVTDPSKPLKHVFEPWSY
                     NRTYYRRQLDNVADHFGVSVDTPFEELSDEVQDAFLFGTSEDVVFEWTTKNGTRHKEH
                     PFEGVVGNLERRHVETDSDRTRDHIEEFMAVTTCPDCNGSRLKEQSRHVRVGGTTLPE
                     VNRMTIAGALEHFEGLEADLSERHRTIAQEILKEIRARLGFMTEVGLEYLTLDREAAT
                     LSGGESQRIRLATQVGSGLVGVLYVLDEPSIGLHQRDNDKLLNTLEGLRDLGNTLIVV
                     EHDEETMRRADEIIDMGPGPGKRGGEVVAQGDFDDIVAADDSITADYLSGRKDIDVPE
                     SRREGDGELVVRGARQHNLDDLDVPIPLETFTAVTGVSGSGKSTLMHEILYKGLARRM
                     NDNTSVDPGEHDAIEGYDDIETVRLIDQSPIGRTPRSNPATYTGVFDYVRELFAETKL
                     SKQRGYEKGRFSFNVKGGRCEACKGQGNVKIEMNFLSDVYVPCEECNGARYNAETLDV
                     TYKDKTIADVLDMEVDEALDFFEANSQIRRRLQLLHDVGLGYMQLGQPSTTLSGGEAQ
                     RVKLAEELGKKQTGDTLYLLDEPTTGLHKEDERKLIEVLQRLVDNGNTVLVVEHELDL
                     VKNADHIVDLGPEGGAGGGTIVASGTPEEIAANPDSHTGRYLRDYLPDVDEEGPRSDR
                     RKPAKVTNDDD"
     gene            350585..351007
                     /locus_tag="HVO_RS06600"
                     /old_locus_tag="HVO_0394"
                     /db_xref="GeneID:8925524"
     CDS             350585..351007
                     /locus_tag="HVO_RS06600"
                     /old_locus_tag="HVO_0394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081442883.1"
                     /db_xref="GeneID:8925524"
                     /translation="MCMSRILKTSGFLGLATMMVVGLYQYTLLESGGVPSWLVGGHAH
                     LGVLSILAVVMGFAVDAFALTGRLRAAVSGLFVVGQWLLPLTIWVGVGFGLTFLIPTT
                     FLWGVCLIVSMLIMAWQAWVSEPTTPGEMPGPASPADD"
     gene            351178..352194
                     /locus_tag="HVO_RS06605"
                     /old_locus_tag="HVO_0395"
                     /db_xref="GeneID:8926057"
     CDS             351178..352194
                     /locus_tag="HVO_RS06605"
                     /old_locus_tag="HVO_0395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044528.1"
                     /db_xref="GeneID:8926057"
                     /translation="MQLYAAANGAVLAVAGSPDDSTTRRRLGEHRIECVAADPRAPDR
                     AFCGTFDAGVFRTTDGGASWHAVGTDALPESVTSLAVSPAAPDVVYAGTEPSAVFRSR
                     DGGETWAELAPLSALDSASSWAFPPRPHTHHVRWIEPDPTDADRLFVAVEAGALVRSF
                     DGGETWQDRVASSKRDTHSMATHLDRPGRVWVAAGDGYAETDDAGETWTTPTAGLGHG
                     YCWSVAIDPADPESVLLTAASGPMRAHRVESAAAYLYRRRDSPDDEGDGDESWDRLDE
                     TGLPTGSGATRAVLAAGRTGGECYAANDRGLYRTTDFGDSWDRIEVPWDGTRRTAAGL
                     AVVA"
     gene            352270..353352
                     /locus_tag="HVO_RS06610"
                     /old_locus_tag="HVO_0396"
                     /db_xref="GeneID:8926694"
     CDS             352270..353352
                     /locus_tag="HVO_RS06610"
                     /old_locus_tag="HVO_0396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006056204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="geranylgeranyl reductase family protein"
                     /protein_id="WP_004044527.1"
                     /db_xref="GeneID:8926694"
                     /translation="MYDFAVVGVGPAGARFARRAADAGYDVLALEKGEVGTPLACSGH
                     VSTDIWEYVPDEARDRLFQNRIYGANFRVGGPNSKAYPFYKQSEVSNVIDRVELDRTL
                     ADCARDAGADVREGHTVTAVEELDDRVRLTVSVAGEAGTVQFEAKMVAGCDGPTSRVR
                     RALDLPEPSETLHGVLAFDPDPDDGDFVDVHLTVPRFFAWRIPRGDAGVEYGLAAPPG
                     AEVNEMFDALTSTYDVETEHFCSGAIPIGPPDRTTTRRAFLVGDAAAQTKPFTGGGIL
                     YGMTAADIAASTIDPDDPETLSAYESAWRDELSREIRLGHLVRRCYSFPEWLQRVGLR
                     SLSGEIGVHMDKPSSFFSREHLKKLL"
     gene            complement(353383..354480)
                     /locus_tag="HVO_RS06615"
                     /old_locus_tag="HVO_0397"
                     /db_xref="GeneID:8924419"
     CDS             complement(353383..354480)
                     /locus_tag="HVO_RS06615"
                     /old_locus_tag="HVO_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyl transferase family protein"
                     /protein_id="WP_004044526.1"
                     /db_xref="GeneID:8924419"
                     /translation="MTLVADIHEAHGATFETRGGIEVVSHYGRPGRTHRAVRNGVGVI
                     EHGYGVVVVEGEDRVDYVDNAVTDTVPDEDGEGVYALLLDPDGRIETEMYVYNAGERL
                     LIFTPRDRAEPLVEEWGSKTFLQRVKIRDASDEFGVFGVHGPQSTEKVASILSGAGAP
                     EPELSFVRGSIGGELGVTVVASDNPTGEEGYDVICRAKDAEDVLDALLFYGNPSVPVG
                     YRTWDSLTAEAGTPLFESELRGNVPNVAGVRNALDFDKGCFVGQELVSKIENRGRPSR
                     RLVGFRADALPDSGAEVSADGESVGTVTRAVESPMLDAPIGFALVDYGLDTDALKVAV
                     DGDRVEATRESLPFVEGSAVSARLPTYPGEN"
     gene            complement(354646..354945)
                     /locus_tag="HVO_RS06620"
                     /old_locus_tag="HVO_0398"
                     /db_xref="GeneID:8926664"
     CDS             complement(354646..354945)
                     /locus_tag="HVO_RS06620"
                     /old_locus_tag="HVO_0398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044525.1"
                     /db_xref="GeneID:8926664"
                     /translation="MRARREFRNRRDIEVAVLDALVDRHDEGMTVFELRAAVDADIDT
                     IEEALSALKDESLIVVEEADTGVLIHADERVVPDPSEAVEEDASLFERLRERFGL"
     gene            355050..356090
                     /locus_tag="HVO_RS06625"
                     /old_locus_tag="HVO_0399"
                     /db_xref="GeneID:8924386"
     CDS             355050..356090
                     /locus_tag="HVO_RS06625"
                     /old_locus_tag="HVO_0399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044524.1"
                     /db_xref="GeneID:8924386"
                     /translation="MGLTCRLLGHSYGDAETEREREERGDEVVVSIREIQVCSRCGHE
                     QVISENKEVTAIRTPEEVGMTEGEVETAAAGFEPADPQPGVSDAEDAAIETAPDAETR
                     AEADAATAAETDADATPGPAAKQPTEAASADTPDAQPADQPGDQPAASADAGTADAGT
                     ADAPPVTDDGIILDDDEEQSATRDRTQWPDEVDEVETDDPTPPADGDDAEFIDADAEA
                     GVETDAEAEPEGSQTRERGAWPDAPGDDEGWNAQPDDGEPVSVSFGGGLTPENNGSSS
                     QQANGQYVEAEGEDDFVRADESNVGNEAPDDAVEYYCPNCGHARGASSSSMRAGDICP
                     ECKKGYIAERES"
     gene            356161..356541
                     /locus_tag="HVO_RS06630"
                     /old_locus_tag="HVO_0400"
                     /db_xref="GeneID:8925074"
     CDS             356161..356541
                     /locus_tag="HVO_RS06630"
                     /old_locus_tag="HVO_0400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044523.1"
                     /db_xref="GeneID:8925074"
                     /translation="MKEYKMRRGETLEERIPDMEATVEDYFGPITGTEEFKGSDLYVV
                     GEPKNPVFTRIVAGAVKYSGKKDKLAVNFEEADPADLAPEDLEAAGEAVSAKNDFLLE
                     ATGRDAKSRRDSMKRAVEDDAPDV"
     gene            356734..357192
                     /locus_tag="HVO_RS06635"
                     /old_locus_tag="HVO_0401"
                     /db_xref="GeneID:8925723"
     CDS             356734..357192
                     /locus_tag="HVO_RS06635"
                     /old_locus_tag="HVO_0401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_004044522.1"
                     /db_xref="GeneID:8925723"
                     /translation="MAIETILLAVGAGDAERIDRLAEETIDVAGPTGATVVIGHVFTK
                     DEYDDALDNLDFDITAEEVSADDVARRHATVRELTRRFDDADIDYVIHGRVGHHGEKL
                     VELAGEVDADRLVVGGRKRSPTGKAVFGSVAQEVMLEASCPVTFVRADTK"
     gene            357270..357947
                     /locus_tag="HVO_RS06640"
                     /old_locus_tag="HVO_0402"
                     /db_xref="GeneID:8924895"
     CDS             357270..357947
                     /locus_tag="HVO_RS06640"
                     /old_locus_tag="HVO_0402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR00266 family protein"
                     /protein_id="WP_004044521.1"
                     /db_xref="GeneID:8924895"
                     /translation="MDHTIDYRPSFALLTVSLDEGESLRSEAGAMVSYSDGIDIETNA
                     KGGLFGSLKRSVLGGESFFQNTFSARQAGEVSFAPPLPGDIVHHGLEDETLYVQSGSY
                     IASDPALDLDTSFGGAKTFFGSEGLFLLKLTGTGDSFLSSYGAIHEVELGEGERYTVD
                     TGHIVAFDETTSFSVERVGGLKSTLFSGEGLVCTFTGPGTVWIQSRSMDSFLSWLIPK
                     LPTNNSA"
     gene            358032..359000
                     /locus_tag="HVO_RS06645"
                     /old_locus_tag="HVO_0403"
                     /db_xref="GeneID:8925027"
     CDS             358032..359000
                     /locus_tag="HVO_RS06645"
                     /old_locus_tag="HVO_0403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008322925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ROK family protein"
                     /protein_id="WP_004044520.1"
                     /db_xref="GeneID:8925027"
                     /translation="MAYYVGVDLGATNVRSVVGDDDGTVLGEARDNTPRGPTGIAVTE
                     AVLGVVREACAEAGIDPSDAVAAGIGAIGPLDLAEGAVENPANLPDTIDRIPLTGPLS
                     VLLETDEVYLHNDTNAGVIGERFHSDRNPDDMVYLTISSGIGAGVCVDGHVLAGWDGN
                     AGEVGHLTLDPHGFMTCGCGHNGHWEGYCSGNNIPKYARELHEEDPVDTALPISDPDF
                     SAVDVFEHAGDDEFADHIISQLGHWNAMGVANIVHAYAPLIIYVGGAVALNNPDLVLE
                     PIREQMSEMVMSNIPEIQLTTLGDEVVVEGALASAMTGGTGDRSRL"
     gene            359447..360927
                     /locus_tag="HVO_RS06650"
                     /old_locus_tag="HVO_0405"
                     /pseudo
                     /db_xref="GeneID:8924101"
     CDS             359447..360927
                     /locus_tag="HVO_RS06650"
                     /old_locus_tag="HVO_0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600737.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:8924101"
     gene            361088..361420
                     /locus_tag="HVO_RS20115"
                     /db_xref="GeneID:31787466"
     CDS             361088..361420
                     /locus_tag="HVO_RS20115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004058105.1"
                     /db_xref="GeneID:31787466"
                     /translation="MSDESESLKERVETWMVGQMPIIQMHGGNSVVRKADAESGEVVV
                     ELGGACAGCGISNITAQNIQSDLIMTFDEITDVQVKVPSSGDHGSSTVEGGRGGELQY
                     GDEGPGHF"
     gene            complement(361646..363052)
                     /locus_tag="HVO_RS06655"
                     /old_locus_tag="HVO_0406"
                     /db_xref="GeneID:8923929"
     CDS             complement(361646..363052)
                     /locus_tag="HVO_RS06655"
                     /old_locus_tag="HVO_0406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF402 domain-containing protein"
                     /protein_id="WP_004044518.1"
                     /db_xref="GeneID:8923929"
                     /translation="MRVRVRGIYATALTSVFLDDGHDVVQASGPIRERFDAEFDSSDH
                     DVSVETTRNRQGVGATGAPEAVATATERLSDLGIDTFAWDDPAPTGAVFDARVTDTLG
                     GGAVCDLGETEGYLSYGDIDGRVEVGDEVRVQVVESAPPWASRRAELTGEVRAVAGLA
                     TLDPDSEGVRVDTRDEAAARELAGMSDLLGGDPPEGWGIRWHRDAVDADMSALNDALD
                     RAAEVAAELDDALSEPVDAPRAVAAPTATTWVWFGRETRFELDAQRRAVETTMPGHHR
                     TKAASQKASAGVDLAEALCESVGDGEFPFGVVTAQFGPLEGDDVEIGHGKPDGRLITL
                     GSGEVTDRDPEGTVELRRGMTGGGTYDALGVDRESGDVAVTKFREGRWWYPTVYRDAD
                     GGVKGTYVNICTPVECFPDQIRYVDLHVDVVKHADGTVERVDDDELDEAVEAGHISEE
                     LAEKARSVASSLESALSG"
     gene            complement(363049..363423)
                     /locus_tag="HVO_RS06660"
                     /old_locus_tag="HVO_0407"
                     /db_xref="GeneID:8924736"
     CDS             complement(363049..363423)
                     /locus_tag="HVO_RS06660"
                     /old_locus_tag="HVO_0407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044517.1"
                     /db_xref="GeneID:8924736"
                     /translation="MHFDPREQAALREVGLDTDDLRAASDLVSDAVESDADAIAAFFG
                     DGGTVYSDMEMAHSATDVQEHVVDHVDLYTHGAELRGYLKFDSWGVPIEGGRVLSEGK
                     VELTLGPTVDARVTFARDADEL"
     gene            363561..364598
                     /locus_tag="HVO_RS06665"
                     /old_locus_tag="HVO_0408"
                     /db_xref="GeneID:8925949"
     CDS             363561..364598
                     /locus_tag="HVO_RS06665"
                     /old_locus_tag="HVO_0408"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PrsW family intramembrane metalloprotease"
                     /protein_id="WP_004044516.1"
                     /db_xref="GeneID:8925949"
                     /translation="MDQQDPVEQASDGSDDLYDIATWEERTSVDGLAVALYRLLVAST
                     RVVVILAALLILVGIGGLSALTDPQVGALTLLSALPALALAGYVYYSDVTQNEPLSML
                     VVTFLLGVLTATFAAILNSLLSNVGQTIAGEFQLALGFLGSVVFYFLVVGPVEETVKL
                     LAVRLYAYSHDSFNAVIDGAVYGAMAGLGFATIENALYITRNLSSSGLDVGSGGVGII
                     AAGGTITAVRALAGPGHVIYSAIAGYYLGLAKFNKENAGPIVIKGLILAALVHATYNS
                     TVGLGSTVIAGITGLGGLAAFLVYVIIYDGVFGLYLIGKLRRYSQAYHSAHASGPSAA
                     SFSSERTEFED"
     gene            complement(364649..365260)
                     /locus_tag="HVO_RS06670"
                     /old_locus_tag="HVO_0409"
                     /db_xref="GeneID:8926743"
     CDS             complement(364649..365260)
                     /locus_tag="HVO_RS06670"
                     /old_locus_tag="HVO_0409"
                     /EC_number="2.5.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase"
                     /protein_id="WP_004044515.1"
                     /db_xref="GeneID:8926743"
                     /translation="MFTGIVEGPGEIVAVTDTDGGRRLRIRTDLAFDDLHHGQSIAVS
                     GVCLTVEAFGDDWFEVFLAAETIEKTYLGDAVEGDRVNLERALAADDRFDGHIVQGHV
                     DGTTTVTNVERVGDDWFFEFDLPESLANYVVQKGSVCLDGISLTVADRREGTFAVAII
                     PTTYDLTTLSEKAVGDPIHVEVDVVAKYVESMLDGYAERLVVE"
     gene            365370..365955
                     /locus_tag="HVO_RS06675"
                     /pseudo
                     /db_xref="GeneID:25143409"
     CDS             365370..365955
                     /locus_tag="HVO_RS06675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607311.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:25143409"
     gene            complement(365957..367695)
                     /locus_tag="HVO_RS06680"
                     /pseudo
                     /db_xref="GeneID:25143410"
     CDS             complement(365957..367695)
                     /locus_tag="HVO_RS06680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058091.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="SLC13 family permease"
                     /db_xref="GeneID:25143410"
     gene            367843..368085
                     /locus_tag="HVO_RS06685"
                     /old_locus_tag="HVO_0413"
                     /db_xref="GeneID:8925693"
     CDS             367843..368085
                     /locus_tag="HVO_RS06685"
                     /old_locus_tag="HVO_0413"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044511.1"
                     /db_xref="GeneID:8925693"
                     /translation="MRLGIMEMVGLAATLIFAIPVGGFGLTLLADGRTAFGGAMLLLA
                     VLMVALPKFLTMPQDLPSLAAEKVVGGVAKEPDNEE"
     gene            complement(368086..369234)
                     /locus_tag="HVO_RS06690"
                     /old_locus_tag="HVO_0414"
                     /db_xref="GeneID:8925078"
     CDS             complement(368086..369234)
                     /locus_tag="HVO_RS06690"
                     /old_locus_tag="HVO_0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M24 family metallopeptidase"
                     /protein_id="WP_004044510.1"
                     /db_xref="GeneID:8925078"
                     /translation="MRWSPRGGDAIDAAVSERDAVGFVAVSRGADPTSRYLTGREFDC
                     DLVFVRVDGETHLRVPSTVEPPSLPVASVRVDDRPPGTAAAAVLAEHGASDGTVLAPR
                     TVPHDAALHLESAGYDLASTPAVEAARAVKDDAERDAIEAAQRAATRGVGRAAAILSA
                     ATVEEADDGDDNGDDEQSVLHWDGAPLSTERLRRQVNATLAAEGVDAAGATTVRAGPR
                     GDGGGGEPVELRPGEPIVVSVGPRGPTGYRGALARTFVVDPDGGWERRAHVACDAARK
                     VSLAEADPGDDAGFLGSELRAETAAFGFSMADEVTRDVGGGIGLAAREDPPLDGDREL
                     VAGNVLRVRAAVTHADHGRVELTDVLVVGDDGPRLLGGAPTGLDPSRW"
     gene            complement(369241..371091)
                     /locus_tag="HVO_RS06695"
                     /old_locus_tag="HVO_0415"
                     /db_xref="GeneID:8924397"
     CDS             complement(369241..371091)
                     /locus_tag="HVO_RS06695"
                     /old_locus_tag="HVO_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_004044509.1"
                     /db_xref="GeneID:8924397"
                     /translation="MSESDVTVTRLFGGPGSGKTTALLDKVEEILEQDGVTIRDILVV
                     SYTRAAAAEVRDRLAERLDINPRSLKGNVSTMHAKAYELLSLSRNDVVGESDKQEFCE
                     DYGVEFEDEYGGAGRRTARSTTIGNKVIATSQWLQRTRRDVSDWYDVPFQWNVEEVRL
                     PPEVDPNAQEGNKYTPTWPSDDDRIDIPEAIRAWRAYKGEHGLVGFADMLERVKQRAL
                     VPNVDYLVIDEFQDITTLQYDVYEEWKPHMRGVLIAGDDDQVVYAWQGADPNLLLDAE
                     RDNDEILPNSYRLPSNVLNVVNREIRHIDKRQEKDLKPRKEGGAVEAVESPSMLELAR
                     NVRYTVEKDEGTVMVLFRARYQMFQFIDEFLPSGIPFSTLTDQRMWTDRLTQYVRAVE
                     ALDAEEPVNGLEARRLADMLQDSAFGTNDRDDLFDAIDDRQEEVGVDDITNIEFTPKE
                     IKNFAPFAPDSSSASDMVRKVTSFQRKSVNAYFGGGYEEMDPSRVRVGTIHSAKGREA
                     DHVFMATDLTEKVVEQMAASVSDEELEARGIEEFTATTSPVPLITDNERRVFYVGMSR
                     ARERLIVLENLVTGAPTLPISVLLHNEIREEPAQGLVDDAQELPAPEPEA"
     gene            complement(371518..373026)
                     /locus_tag="HVO_RS06700"
                     /old_locus_tag="HVO_0417"
                     /db_xref="GeneID:8926043"
     CDS             complement(371518..373026)
                     /locus_tag="HVO_RS06700"
                     /old_locus_tag="HVO_0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxypeptidase M32"
                     /protein_id="WP_004044507.1"
                     /db_xref="GeneID:8926043"
                     /translation="MAQSPTEDASPYDQLLQKYKRIANVENAGGILSWDQQVMMPDEG
                     TPARSQQMSALSALSHELLTDDEFGELLDSAEADDPTDEQADVLRELRRDYERAARVP
                     NDLVEKISAASSEAIPAWKQAKAEDDFETFAPHLEKHVELKRQYAEHIDPDRDPYEVL
                     FEDYEPCLPLEQAEEILAEVREVLVPMIEDIRESDVDLAVDAFEGEFPEEDQETLVRD
                     ALSTLGYPWERGRLDTAPHPFSSGTQFDARVTTRYDESDVLGSLFSTVHEFGHALYTL
                     GLPDEHYATPLGENRNLSVHESQSRLWENHVGRSRAFWRHFLPTLEDRFPEVDATVEE
                     AYEAANQVYDDNLIRVEADELTYHLHIVIRFELERELIAGDLAVEDVPEAWNDKYEEY
                     LGIRPDTDSEGCLQDIHWAYGNFGYFPTYSLGSIMAAQLFSAAEEDIDDLDGKLADGE
                     FGDLREWLRENVHRHGRRYETNDLVKRATGEAFAADDFLDYVESKYGALYDL"
     gene            complement(373221..374717)
                     /locus_tag="HVO_RS06705"
                     /old_locus_tag="HVO_0418"
                     /db_xref="GeneID:8925423"
     CDS             complement(373221..374717)
                     /locus_tag="HVO_RS06705"
                     /old_locus_tag="HVO_0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_004044506.1"
                     /db_xref="GeneID:8925423"
                     /translation="MNETEEVLSPEYVAGLLDATGRVQFNIHSQPDNKFTVRPSLRIR
                     TYESTARRDVLGMFLDSQSYDSTRFVDGDYSISYFLLDQHSELQQLDEYLAGHSAQLA
                     NELAFVTSLSDNQFGGQLLTAEDVYQLLITRDELRHGWRPRGRNHTTPQDFSDEYDVR
                     PSRVDSLPLPDGRCRSGYSEKWFAGLFDGICRYRASIAQTDEVRIGYTMYPIARMHLT
                     GVSKQLVDYALDYCESTGIDYGNSSTRHDFQVYFTAHQNVRKIIETLLPHSIVLRQHS
                     ELMLESILPRFEEDVHTTKTGFYKLLCDCLYVGDRTGGPFRKREYNPSYFEEIWSDEL
                     LLQENRDEDTKTRQRTDPFPREDFDPVQVEPELYEDIGRYQTVLDRVRRDREVVNELK
                     RLYDDKCQVCGTTLLRNDGTRYSEVHHIVPLGEPHSGPDKRSNMLVLCPNHHTDFDNG
                     VVSVSPESLELEHTHTSALSDRQLAVDSDHHISTELLRYHNEEIVGEQ"
     gene            complement(374824..375918)
                     /locus_tag="HVO_RS06710"
                     /old_locus_tag="HVO_0419"
                     /db_xref="GeneID:8924963"
     CDS             complement(374824..375918)
                     /locus_tag="HVO_RS06710"
                     /old_locus_tag="HVO_0419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M20 family peptidase"
                     /protein_id="WP_004044505.1"
                     /db_xref="GeneID:8924963"
                     /translation="MDELRDLTETLVSVPSHEDETAAGDAIEAWLREETDADVARDDA
                     GNVVARVNPGVGESLALVGHHDVVPPADRQTTDSGDYVVETRDGRLYGRGAADMKGAV
                     AASMLAFRDAAADADSEVAFASFVGEEIGGEGVRAALDDGFELDYAVVAEGSTNYSGP
                     NRTDVAVAHRGRRASTLVASGTACHASGPERGENAVYRATDAVDVVRGLSVPDAEVLD
                     HPVSGSIAVTEIDGGSAWNVIPDRCEVTLDERTVPGGFADLARTAELEGVEWVVEQDL
                     PPMACDDADFAERVLDAARSVHEARSDAEPEQTTKPHATDAGWLAQAGTTCVVYGPSE
                     PGEAHTKDESVSLDVLARCYETYRALVANW"
     gene            376085..377716
                     /locus_tag="HVO_RS06715"
                     /old_locus_tag="HVO_0420"
                     /db_xref="GeneID:8924507"
     CDS             376085..377716
                     /locus_tag="HVO_RS06715"
                     /old_locus_tag="HVO_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_004044504.1"
                     /db_xref="GeneID:8924507"
                     /translation="MRLVSTYERLLWGSMDALGISGSVERKVVAAVAIQFVVSLAQAA
                     LPWVATGALRLELSALLLFGAGLAFVNTIIITRKDIVSPIESISSAAAGVAAGDLSVR
                     PPDVSGTDEVARLADDFGAMHDHLCVVASQAGALADQRFDDPALDENLPGEFGDALDR
                     MQRDLADYTRNLQHLVEAFAEATSRAQAGDLTATIDTDDWGVDDERYEEVAATYNDLV
                     RTLSSTIGEVQSFAQEVSEMSSTAREHVRRADAASEEVAASVTEISDGAGTQTEHLQT
                     VSDELNTLSATVEEIAASADEVATTAETASDRGEVGRAAATEAMEELDTVEARIARTA
                     DAVAELTESIEEIDEIAAFIDHVGSQTDLLAINAAIEAAHAGEAGDGFGVVAQEVKSL
                     AEETRDSADEVSGLIADITEHSEETLADVREMNRQVADSLETVTEAIGEFETIVDMVT
                     DIDASVAEVSAATDQQAESAADIAARVDDVANISEETAGQSRTVVETAQEQSESIGDL
                     ADQTEVLSSQAADLDHLVESFEVVDGERAVAPGDD"
     gene            377834..379714
                     /locus_tag="HVO_RS06720"
                     /old_locus_tag="HVO_0421"
                     /db_xref="GeneID:8926255"
     CDS             377834..379714
                     /locus_tag="HVO_RS06720"
                     /old_locus_tag="HVO_0421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_004044503.1"
                     /db_xref="GeneID:8926255"
                     /translation="MKIVPDTSAVIDGRVSERVDDGTYEGADVLVPEAVVSELESQAN
                     DGRDTGWEGLSELQRLAEFADDGVIDLNYVGRRPSSGETKGAGEGDIDALIRDIATER
                     SATLLTSDVVQAEVAKAKGVSVEYVEAAVRGSGGLIIERFFDDQTMSVHLKTDTRPKA
                     KRGAVGEMHYQPIADEPTDEATMKEWADDIVNSARAATDGFVELSEPGMDIVQFRDYR
                     IAVARPPFADGIEITAVRPIVKTELDDYEFADELRDRLAERQRGVLIAGSPGAGKSTF
                     AQAVAEFLNDSDYAVKTMEKPRDLQVGPDITQYTALGGDMAKTADSLLLVRPDYTIYD
                     EVRKTEDFSVFSDMRLAGVGMVGVVHATRAIDALQRLVGRVELGMIPQVVDTVVYIED
                     GEVHTVYDVRTEVKVPEGLFAEDLARPVIQIRDFESGTPEYEIYTFNRQVVTVPLGEG
                     GEEKESGVSRLAKQEIEREIRSIARGHVDVDLQGQNRAVVYVEEDDISYVIGKGGGRI
                     SDVEDRLGIDIDVRTHDEKPSSSGQHAGANAGGQSGASASAGGADEGVVVTPEVTSRH
                     VVVRMDGHVGETVEVRADGEYLFTATVGRGGDIQVSRGSAIAEELENAIDRKQQITVV
                     PA"
     STS             378903..379893
                     /standard_name="Ets2"
                     /db_xref="UniSTS:143042"
     gene            complement(379829..380122)
                     /locus_tag="HVO_RS06725"
                     /old_locus_tag="HVO_0422"
                     /db_xref="GeneID:8924482"
     CDS             complement(379829..380122)
                     /locus_tag="HVO_RS06725"
                     /old_locus_tag="HVO_0422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_004044502.1"
                     /db_xref="GeneID:8924482"
                     /translation="MAGTEEESLDDLPPSAKLVFKVLEYNGPLTQKGIVEESMLSART
                     VRYALERLEGIGIVDEDVYFADARQNLYQLTDLAPQQAQAKADGGKEKACCAE"
     gene            380247..380561
                     /locus_tag="HVO_RS06730"
                     /old_locus_tag="HVO_0423"
                     /db_xref="GeneID:8925488"
     CDS             380247..380561
                     /locus_tag="HVO_RS06730"
                     /old_locus_tag="HVO_0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044501.1"
                     /db_xref="GeneID:8925488"
                     /translation="MATETQTGLSSHIRGVTVTTLACLAGIAAAVVSGAVVGTSPEAA
                     TNQLAVGILGALVLIQFPVLRVVGVDVNGFGAKDYLYVVFMTFALWFITFAILLTSGV
                     QL"
     gene            380564..382378
                     /locus_tag="HVO_RS06735"
                     /old_locus_tag="HVO_0424"
                     /db_xref="GeneID:8924641"
     CDS             380564..382378
                     /locus_tag="HVO_RS06735"
                     /old_locus_tag="HVO_0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis/translation initiation
                     ATPase RLI"
                     /protein_id="WP_004044500.1"
                     /db_xref="GeneID:8924641"
                     /translation="MADDSIAVVDLDRCSPDRCSYECSNFCPPNRTGKECITLRGEDA
                     EQGGPDQVRISEEICLGETCGICVEKCPFDAIEIINLPSELDEEPTHRYGENAFSLYG
                     LPVPEAGSVTGILGPNGIGKTTAVRALAGEMVPNLGNYDDDPTWEAVLDRFRGTELQN
                     YVEQVRDGEVSIARKPQYVDQIPKQFDGTARELLEATDERGALDSYIDRLDIGPVVDN
                     DIETLSGGELQRVALAATLARDRDFYFLDEISPYLDIGQRVTAARLIRELAEDEDRAV
                     LVVEHDLAILDLLADTLHVAYGEPGAYGVITDPKSVRNGINEYLKGYLSNENMRIRPE
                     AITFEEHAPRETTKAEPLVEYPDLAKSYGDGEFSLEVESGTIYNGEVLGVVGPNGIGK
                     STLAQLFTGDLTPDAGDLDFALDISYKPQYIEIDQPMRVDAFLSSITDQFGSSYWNTE
                     IANPLQLNRIMERNLTDLSGGERQRVAIAACLSQDADLYLLDEPSAHLDVEQRVQATS
                     AIRRYAENHDATVMVIDHDIYMMDLLADRLMVFDGEPSIEGHASKPQEMRDGMNDFLS
                     DLDITFRRDERTQRPRINKPDSQLDREQKRAGEYYYAE"
     gene            382515..383456
                     /locus_tag="HVO_RS06740"
                     /old_locus_tag="HVO_0425"
                     /db_xref="GeneID:8924172"
     CDS             382515..383456
                     /locus_tag="HVO_RS06740"
                     /old_locus_tag="HVO_0425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_004044499.1"
                     /db_xref="GeneID:8924172"
                     /translation="MTNDSPSDGSLTDDTHLDRVALRVGSLDRVVPFYRDVVGLAVER
                     ERDGSRAVLSAGETPVVVLDEDSDAPERGRREAGLFHLAVRVPDRGALGDVLARARTR
                     ASDTGATLSGASDHLVSEALYFRDPEGNGVEVYRDRPREEWPWTDDRRVSMDTLPLDL
                     GALADDAAGDEVAPAGTDLGHVHLEVTNVPRSRDFYVDALGMRVRDEGYPGAAFVAAG
                     EYHHHVGLNSWNTRSAPAGGSRGIEWFEIVVPDAATLDAVRESLVDAGHEIEQDGSDE
                     SGSGDGDATDAADASTATESLVLSDPDGIGVRVVRSR"
     gene            383511..383993
                     /locus_tag="HVO_RS06745"
                     /old_locus_tag="HVO_0426"
                     /db_xref="GeneID:8924384"
     CDS             383511..383993
                     /locus_tag="HVO_RS06745"
                     /old_locus_tag="HVO_0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YbhB/YbcL family Raf kinase inhibitor-like
                     protein"
                     /protein_id="WP_013035599.1"
                     /db_xref="GeneID:8924384"
                     /translation="MIASDSSERRRGLTPRSPAFDDGCPIPRPHGYAAANESPPLRIG
                     GVPPGTASLALVMDDPDAVKPAGEVWDHWFVWNVAPETDAIAAGETPPGAVEGTNSYG
                     ERGYGGPNPPDGEHTYRFLLYALDAPLDLDAGATKADLKRAIAGHVVAETKLAGSYAL
                     "
     gene            complement(384018..385076)
                     /locus_tag="HVO_RS06750"
                     /old_locus_tag="HVO_0427"
                     /db_xref="GeneID:8926345"
     CDS             complement(384018..385076)
                     /locus_tag="HVO_RS06750"
                     /old_locus_tag="HVO_0427"
                     /EC_number="6.5.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA 3'-terminal phosphate cyclase"
                     /protein_id="WP_004044497.1"
                     /db_xref="GeneID:8926345"
                     /translation="MRRLDGRNGGGQPLRTALALSLVTGESFEMTNVRGNRSTPGLKA
                     QHVACVSVAAAVSNAAVEGGEVGSSTLRFSPDRVRTDPVEVAVGTAGSATLVCETVLP
                     AAVALDDPLSLTVTGGTDVRWSPPADYHRHVKRPLCSRFGVEFGVSVPRRGFYPAGGG
                     RLSLRIEPAEPTPLALDRRADPDELRVYSVESGSLAAAAVAERQVEGVRDALAEAGVD
                     LPVRAAVSSVESDSPGSVVVAVARGEDDERAGDGSESVVAGFDAYGERGTPAEAVGSR
                     AAASFLDWLGGDAPVDRHMADQLLVWVALAGGRLRIPAVTDHVRTNLDVIRAFGYDVT
                     LLVGDDGDGAVVESDGGR"
     gene            complement(385077..385526)
                     /locus_tag="HVO_RS06755"
                     /old_locus_tag="HVO_0428"
                     /db_xref="GeneID:8926077"
     CDS             complement(385077..385526)
                     /locus_tag="HVO_RS06755"
                     /old_locus_tag="HVO_0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_004044496.1"
                     /db_xref="GeneID:8926077"
                     /translation="MNFVVAVDGSAAADRALDHALSMLEPLGATVTIVHAVEPQVLVE
                     GGEGPVAGVAGTGDRIVAESLEDAESRAERVLNAAAERAADAGVDAATELLYGDPVEA
                     IPTYADEADADGIFVGHRGLSKRYEGLVGSVAKELVERASCPVTVVR"
     gene            complement(385608..386129)
                     /locus_tag="HVO_RS06760"
                     /old_locus_tag="HVO_0429"
                     /db_xref="GeneID:8925035"
     CDS             complement(385608..386129)
                     /locus_tag="HVO_RS06760"
                     /old_locus_tag="HVO_0429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969113.1"
                     /note="probable zinc-dependent endopeptidase; similar to
                     human proteins archaemetzincin-1 and -2; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M54"
                     /protein_id="WP_004044495.1"
                     /db_xref="GeneID:8925035"
                     /translation="MLVDIVPIGDISAAVKREASAGLRSVYDCDVTVQSNQAIPEGAF
                     DRSRNQYRAEQFIELASRIGRGEKNIGITEKDLYYRRRNYVFGLAYLNGNGSVISTYR
                     LQTTSDGGITNKPAEEVLSDRVRKEVVHEIGHTLGLEHCDNNKCVMSFSPTVREVDVK
                     EENLCGTCSRLVH"
     gene            386169..386621
                     /locus_tag="HVO_RS06765"
                     /old_locus_tag="HVO_0430"
                     /db_xref="GeneID:8925240"
     CDS             386169..386621
                     /locus_tag="HVO_RS06765"
                     /old_locus_tag="HVO_0430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044494.1"
                     /db_xref="GeneID:8925240"
                     /translation="MKKSLRDALVGQLSGYDRAVEVGVGREPSVAAALAARGVDVVAV
                     DVHDFPVPDGVSFVRDDVFARADAADLGPYAAAEVVYALNVPVELHRPAAEVARRADA
                     DFLFTTLGYDEPSVPVSRESLPGETLYVAERGRRDQRARRDSPGRSQE"
     gene            386653..387507
                     /locus_tag="HVO_RS06770"
                     /old_locus_tag="HVO_0431"
                     /db_xref="GeneID:8924560"
     CDS             386653..387507
                     /locus_tag="HVO_RS06770"
                     /old_locus_tag="HVO_0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR01548 family HAD-type hydrolase"
                     /protein_id="WP_004044493.1"
                     /db_xref="GeneID:8924560"
                     /translation="MHADAVVLDIDGVLVDVADSYRRAIVESVDRHYGTTISRDEVQL
                     FKDAGGFNNDWELTYAAALSVLAAREADLSVAAFTGEIEARGGGLDAAKATVEALLSE
                     PSVVFDEWDPEALRETFQALYLGSDLYRDLEDGDPPFEAPGYIHDEPVLLRPETLDAL
                     GDRELGVVTGRPAAEADIALDRVALDVADDHRFTMDDWEEGKPHPAALVTVAERLGAD
                     SVVFVGDTLDDVKTALNADAADPERVYYGVGVLSGGLTGDDGRQKFSEIGAAAVVEDV
                     NEVPDLLD"
     gene            387557..387772
                     /locus_tag="HVO_RS06775"
                     /old_locus_tag="HVO_0432"
                     /db_xref="GeneID:8925254"
     CDS             387557..387772
                     /locus_tag="HVO_RS06775"
                     /old_locus_tag="HVO_0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044492.1"
                     /db_xref="GeneID:8925254"
                     /translation="MGHLRAFVVTLLALDALVVVVGTYLLPPDPFAQLVLVGPLLLLA
                     PVVAWWLVYRDGFERVQALVESDGGGR"
     gene            387864..388532
                     /locus_tag="HVO_RS06780"
                     /old_locus_tag="HVO_0433"
                     /db_xref="GeneID:8925855"
     CDS             387864..388532
                     /locus_tag="HVO_RS06780"
                     /old_locus_tag="HVO_0433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent F420 reductase"
                     /protein_id="WP_004044491.1"
                     /db_xref="GeneID:8925855"
                     /translation="MRIALLGGTGDIGEGLALRWAYHTDHEVIVGSRDPDKARAKADE
                     YETELSSRGRDVKVNGFTNEMAADRASVVVLAVPPYHVSDTVEAVSDSLSEGDVLVTP
                     AAGMKRDDDGFHYHPPKAGSVTALVADAAPDDVPVVGAFHNLAAGRLADLDADLGIDT
                     LLVADDEDAKETVRLLAEGIDGLRALDGGGLANAPEIEGITPLLINVARNNDGLHDLG
                     IRFK"
     gene            complement(388563..389816)
                     /locus_tag="HVO_RS06785"
                     /old_locus_tag="HVO_0434"
                     /db_xref="GeneID:8924107"
     CDS             complement(388563..389816)
                     /locus_tag="HVO_RS06785"
                     /old_locus_tag="HVO_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004044490.1"
                     /db_xref="GeneID:8924107"
                     /translation="MSRLFGGDEPSVEFVAGSLIAGVFFGGVGAGVAFPTLPTLGPII
                     GITPFVVGLILSANRFTRLVVNTPAGQILDRMGTRRPMIAGFVVQGLSPFGYVLGLNP
                     GPIPLDSATVFLLSRACWGVGSAFVFVGAFSTITHVTSDGNRGKWVGYMRGGQSLGFP
                     AGLVVGGLVTDAFGYATAFAVAGYAGLFAALVAISVLPDVKTDVTAASSLREVPRLVS
                     ADIRIFTVGTVNFAVRFLFSGVLLSTAVLYATANDISLGGLSGAGVSGVVMAVGVVAS
                     SVTTLVVGRYSDRLSNRAALTLPALGVLAAGFTLLALVPTLPSTLAGVALIGVGVGGS
                     NPPLLAYLGDLSPADDVGKLGGVYNVFGDSGSTLGPLVAVPLAEVVGFRVEYLACVAL
                     VVVVGLLVARTLYGEAATVPGSELS"
     gene            complement(390051..390353)
                     /locus_tag="HVO_RS06790"
                     /old_locus_tag="HVO_0435"
                     /db_xref="GeneID:8925365"
     CDS             complement(390051..390353)
                     /locus_tag="HVO_RS06790"
                     /old_locus_tag="HVO_0435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl-ATP diphosphatase"
                     /protein_id="WP_004044489.1"
                     /db_xref="GeneID:8925365"
                     /translation="MDADTPTDEVLDELFATIESRKADLPEDSYTTTLFTHEKGENYV
                     LEKLGEETTETILAAKDDDGEELLYESADLVYHLLVLLSMKDASLDDLRDELKARF"
     gene            complement(390432..391040)
                     /locus_tag="HVO_RS06795"
                     /old_locus_tag="HVO_0436"
                     /db_xref="GeneID:8925986"
     CDS             complement(390432..391040)
                     /locus_tag="HVO_RS06795"
                     /old_locus_tag="HVO_0436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004058039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal 5'-phosphate synthase glutaminase
                     subunit PdxT"
                     /protein_id="WP_004044488.1"
                     /db_xref="GeneID:8925986"
                     /translation="MTTLRAGVVAVQGDVSEHADAVERAAEAHGVDAEIVEIRSDGLV
                     PDCDVLLMPGGESTTISRLLEREGIADEIRAHVEAEKPVLATCAGLIVASRDAKDDRV
                     TTLDLLDATVDRNAFGRQVDSFEAPLDVAGLDSPFPAVFIRAPLIDEVGEGVEVLAEW
                     DGNPVAVRDGPVVGTSFHPELTPDSRLHDLAFFDELAVEIDA"
     gene            complement(391096..391260)
                     /locus_tag="HVO_RS06800"
                     /old_locus_tag="HVO_0437"
                     /db_xref="GeneID:8925559"
     CDS             complement(391096..391260)
                     /locus_tag="HVO_RS06800"
                     /old_locus_tag="HVO_0437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit Sec61beta"
                     /protein_id="WP_004044487.1"
                     /db_xref="GeneID:8925559"
                     /translation="MSKGQNSGGLMSSAGLVRYFDAEDRNAIRVNPKTIFAAGALFGI
                     GVLVLNSLAF"
     gene            391499..391768
                     /locus_tag="HVO_RS06805"
                     /old_locus_tag="HVO_0438"
                     /db_xref="GeneID:8923899"
     CDS             391499..391768
                     /locus_tag="HVO_RS06805"
                     /old_locus_tag="HVO_0438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol reductase thioredoxin"
                     /protein_id="WP_013035354.1"
                     /db_xref="GeneID:8923899"
                     /translation="MTVRLLDFYADWCGPCKTQDPILDELEGDYETVEFVKVDVDEEQ
                     DVANQYQVRSLPTLIVENDDDGIVDRFVGVTQRDDIESALSQAGA"
     gene            391882..392028
                     /locus_tag="HVO_RS06810"
                     /old_locus_tag="HVO_0439"
                     /db_xref="GeneID:8924727"
     CDS             391882..392028
                     /locus_tag="HVO_RS06810"
                     /old_locus_tag="HVO_0439"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L40e"
                     /protein_id="WP_004044485.1"
                     /db_xref="GeneID:8924727"
                     /translation="MASDAATKRTLEKQICMRCNARNPQKAKQCRKCGYKHLRPKSKE
                     RRAA"
     gene            complement(392044..392424)
                     /locus_tag="HVO_RS06815"
                     /old_locus_tag="HVO_0440"
                     /db_xref="GeneID:8925755"
     CDS             complement(392044..392424)
                     /locus_tag="HVO_RS06815"
                     /old_locus_tag="HVO_0440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044484.1"
                     /db_xref="GeneID:8925755"
                     /translation="MATDAVTEPSDDLTRLHYVGVALAAVTGVIHLVLGAGALAANPA
                     DPLGIAFVGAAGGFAAGIVGVLRGDERRRSRVVLLGIPFTAGQVVLYVALNWPNIFGI
                     GGVADKLVQLALLAVLFALYRRDA"
     gene            complement(392426..393052)
                     /locus_tag="HVO_RS06820"
                     /old_locus_tag="HVO_0441"
                     /db_xref="GeneID:8926556"
     CDS             complement(392426..393052)
                     /locus_tag="HVO_RS06820"
                     /old_locus_tag="HVO_0441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_004044483.1"
                     /db_xref="GeneID:8926556"
                     /translation="MEVIPVTADAETFTCNAYLVLGERTVLVDAGTMSGVEDVVAEHT
                     DDLDAVVVTHQHSDHVGELGAVVERFDPDVYAYADHPLRTHELGDGDHVEMGDESFEV
                     VYTPGHADDHVSLVSGRSLFSGDVFVYNDGAFDDGSFGRTDMPGQSRERLISSLHTLL
                     DRLPSTVEALYAGHGDPFENEAGGDTVRDALERAIERAERREPKYPEA"
     gene            393182..393352
                     /locus_tag="HVO_RS06825"
                     /old_locus_tag="HVO_0442"
                     /db_xref="GeneID:8924719"
     CDS             393182..393352
                     /locus_tag="HVO_RS06825"
                     /old_locus_tag="HVO_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044482.1"
                     /db_xref="GeneID:8924719"
                     /translation="MGFGSYDESEQGDQNVDFDEEDGVTTSEEKHEGEVDFEIGASND
                     ELLDRLQEIKDE"
     gene            393349..393960
                     /locus_tag="HVO_RS06830"
                     /old_locus_tag="HVO_0443"
                     /db_xref="GeneID:8926091"
     CDS             393349..393960
                     /locus_tag="HVO_RS06830"
                     /old_locus_tag="HVO_0443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF99 family protein"
                     /protein_id="WP_004044481.1"
                     /db_xref="GeneID:8926091"
                     /translation="MKSGSRALGVAESSPGAARAPTDDADDAHFSTDPSPESVLCGAV
                     VRADRVVDGLAFETCAVGGDDATDAIASLYDSLDREDVRYLLVSGIAPAWFNLVDIDR
                     LAAALDRPVLSVSFEESEGLEPALTEQFSGAALDRRLATYRAAPPRRPVEVNGETVFV
                     RAAGCDGDEAAQVVRGFTPTGGRPEPIRVARMAARAARRFAGD"
     gene            393985..394581
                     /locus_tag="HVO_RS06835"
                     /old_locus_tag="HVO_0444"
                     /db_xref="GeneID:8926521"
     CDS             393985..394581
                     /locus_tag="HVO_RS06835"
                     /old_locus_tag="HVO_0444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_004044480.1"
                     /db_xref="GeneID:8926521"
                     /translation="MEHMEGLCVTGCERCPELVDSRSRIVNGVGPDDADLLFLGEAPG
                     AKEDEGGEPFVGRSGSVLDDALREAGLARADVRITNCVRCRPPDNRDPTSDELSNCRG
                     YLARELELVDPELVVTLGKVPSQHLLDRGVAITNESGSVVDARVGDASYRVLLSVHPA
                     ATLYDRSQREGFFETIARAADLSGLADSADGQASLGDF"
     gene            complement(394719..395684)
                     /locus_tag="HVO_RS06840"
                     /old_locus_tag="HVO_0445"
                     /db_xref="GeneID:8926546"
     CDS             complement(394719..395684)
                     /locus_tag="HVO_RS06840"
                     /old_locus_tag="HVO_0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006056248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter, permease protein
                     PhnE"
                     /protein_id="WP_004044479.1"
                     /db_xref="GeneID:8926546"
                     /translation="MSTDTDRIEDALRNIQIAKRVRLLFSIVVLVLFAWFFTNALSEV
                     GFSIGEIVEYWPEFTDALGDFFPPGTLFGVIPFVDVSQYWAFIQERNLLLQFQDGNPV
                     LGAVFVTFAMGFVGTVLGIPGALILGVLGSERVTPYPFNFIFRGTMSVIRAIPALVWA
                     LIYIPLGGVSPFTATLAIGTDTMGNLGRLFTDALEEVEDGPIEAIESTGANSPQKVVF
                     GMLSQVFTPFIAWTMYILEINVRIGVTMGLIGGGGLGQVLQTQRGLFRYTNMMATILV
                     IFMLVVSVEFVSQRVRSYIRGNEEGTSLLKLIVEFPQRMARSIWE"
     gene            complement(395674..396477)
                     /locus_tag="HVO_RS06845"
                     /old_locus_tag="HVO_0446"
                     /db_xref="GeneID:8924433"
     CDS             complement(395674..396477)
                     /locus_tag="HVO_RS06845"
                     /old_locus_tag="HVO_0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004969129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_004044478.1"
                     /db_xref="GeneID:8924433"
                     /translation="MSTIEVTNLSKSYGDVTALDDVSFTIPDGEFVVVLGQSGAGKST
                     LLRCLNGITRPTSGSITIDDANVMGPRNDVAMIFQQHYILGQMSAYSNALTGALGRTS
                     FLGSLLGLYDGDDKQEALRALETVGLLDEANQRAGKMSGGQQQRVGIARALVQNPNLL
                     LADEPVASLDPASAETVMRYIRDAADERDLTTIASLHQVNIAREFGERFIGMKDGQIV
                     FDGYREDFDVDVIDRIYGDIETKAIREEQADEPPENNAAATSGARSHEY"
     gene            complement(396573..397619)
                     /locus_tag="HVO_RS06850"
                     /old_locus_tag="HVO_0447"
                     /db_xref="GeneID:8925641"
     CDS             complement(396573..397619)
                     /locus_tag="HVO_RS06850"
                     /old_locus_tag="HVO_0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006056250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate/phosphite/phosphonate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_013035608.1"
                     /db_xref="GeneID:8925641"
                     /translation="MASRREFIRTAGITGVAGLTALSGCTGGDDSSEATTTTTESGAS
                     SETEATTTSTTTESSPESIMFALTPAESDVDVEAQYQPLFNYIESEVGVTVESTVAAD
                     YAAVLQALDSGQADIADAAPAIAIQGGNEGITEVIGIRIAYGASRYFSLITTTPDSDI
                     EELTDLEGETVAFADRLSTSGSLFPLSMLSTAGLDTGGAPDGNPVDFEAQFSDHSTAR
                     ETLINRDDVVAAGTGAFSTAPHVPEDQFPEQFLDMSAENDGDLGTASPELQLLSCSDP
                     IPRAPILGRTDMDQGLYDDIEEALLNVTEDDLINEDLEDDQQLWFTGVDQGSVDDYAP
                     VQEVLDELGVTLGQ"
     gene            397884..398543
                     /locus_tag="HVO_RS06855"
                     /old_locus_tag="HVO_0448"
                     /db_xref="GeneID:8926395"
     CDS             397884..398543
                     /locus_tag="HVO_RS06855"
                     /old_locus_tag="HVO_0448"
                     /EC_number="2.4.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006629448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="WP_004044475.1"
                     /db_xref="GeneID:8926395"
                     /translation="MSTTQPPEETLADVVMVDYGLGNLRSAMRGLERAGANVVISDDP
                     ADFDDADGIVLPGVGAFSEGMENAGPFREPLAEAAADGTPVFGICLGMQMLLTSSEEA
                     DHAGEGEVEGLDFIPGRNVRFDEGQKVPHMGWNELNVQRDHPLVEGVDGEYAYFVHSY
                     YADPDDEGAVVASTDYGVAFPAVVANEAGTVFGTQFHPEKSGETGLTILRNFVEFCAE
                     R"
     gene            398598..399404
                     /locus_tag="HVO_RS06860"
                     /old_locus_tag="HVO_0449"
                     /db_xref="GeneID:8926405"
     CDS             398598..399404
                     /locus_tag="HVO_RS06860"
                     /old_locus_tag="HVO_0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prephenate dehydratase"
                     /protein_id="WP_004044474.1"
                     /db_xref="GeneID:8926405"
                     /translation="MQAVTLGPAGTYSHRAARAVADDVAFRESVTSIVQAVADGSFER
                     GVVPIENSIEGSVTESLDAVANSDVSVVQEIVTPIRHALLAQSANFDVVASHSQALAQ
                     CRTYLEENYPDAKLEAVASTARGVERARADPTVAGIGHPDNVGDDLEIIAEDIQDQSS
                     NATRFLVIGPESARSDAGGKSSLVVYPNANYPGLLLELLEAFAERDINLSRIESRPSG
                     NRLGDYLFHIDADAGLYEERMQGALEEVEGIASNGWVRVLGSYDTRHVLY"
     gene            399548..399955
                     /locus_tag="HVO_RS06865"
                     /old_locus_tag="HVO_0450"
                     /db_xref="GeneID:8923909"
     CDS             399548..399955
                     /locus_tag="HVO_RS06865"
                     /old_locus_tag="HVO_0450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20/alpha crystallin family protein"
                     /protein_id="WP_004044473.1"
                     /db_xref="GeneID:8923909"
                     /translation="MQRNPFDEIEDLFDRMGRSFEESGIGRFQDISLDVVDDEAIEVV
                     ADLPGFEKDDLDVSVSGRRLTIAADREESSEVDDEQYVRRERSQRSVSRTITLPAEVV
                     RDEVTASYKNGVLTVTLPKAEPAGDDSTEIDIE"
     gene            400072..400515
                     /locus_tag="HVO_RS06870"
                     /old_locus_tag="HVO_0451"
                     /db_xref="GeneID:8924766"
     CDS             400072..400515
                     /locus_tag="HVO_RS06870"
                     /old_locus_tag="HVO_0451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20/alpha crystallin family protein"
                     /protein_id="WP_004044472.1"
                     /db_xref="GeneID:8924766"
                     /translation="MMRRTNPFDDFEELFERMSRQFDEMGRQFDRSGMMAQVRHEMAI
                     DVTDHDGEIVVTVDLPGYEKSDIALSVANRTLTVEATRELDAERADGEYLRRERRHES
                     ARRTIRLPETVDENGASASYHNGVLTVTLPKHDAEPDDSRRIDID"
     gene            400730..403606
                     /locus_tag="HVO_RS06875"
                     /old_locus_tag="HVO_0452"
                     /db_xref="GeneID:8924710"
     CDS             400730..403606
                     /locus_tag="HVO_RS06875"
                     /old_locus_tag="HVO_0452"
                     /EC_number="6.1.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine--tRNA ligase"
                     /protein_id="WP_004044471.1"
                     /db_xref="GeneID:8924710"
                     /translation="MDYDPQELEARWRERWSESGRYEADPDADADDATFVTVPYPYPS
                     GGMHIGHARTYTVPDVYARYRRQQGDNVLFPIAWHVTGTPIIGAVERLQNREEKQLSV
                     LTDTYNVPEDTLSDLESPMGWARYFIEEHYKKGMQSLGLSVDWRREFTTNNERYSKFV
                     EWQYRTLRDRGRLEKGLHPVKFCTNEEQPVTTHDLLEGENAEFQEYTLVRFGWERDGG
                     DVVVPMATLRPETVHGVTNAYIDPEATYVVAEVDGETWFVSDYAADKLEYQARDVEIL
                     ETVEGAELVGQTVENPVTGDDVLVLPADFVDADNATGVVMSVPAHSPDDYVALQEAKA
                     DADYLESFGIDPADVADIEPIPILDIDSEDDTYGEIPAESAVENRGIESSDDPALEKA
                     TKDLYNKEFHAGRLKEFYGDYAGGLVEEVRDDFKADGVEAGQFDVMQEFSEVVVCRCG
                     GDVVVAEQDTWFLSYDDEDWKELAHDVADGLDAIPENTRDEYHHTIDWLNGWPCIRNY
                     GLGTRLPWDDQFVIEPLSDSTIYMAYYTIAHRLQEIPTEELTQEFFDALFYGPDAVDD
                     APEKALDLREEWDYWYPVDYRFSGNDLITNHLTFYQFHHGELFDEPQWPRGIVIMGMG
                     LLEGEKMSSSKGHVVLPGEAIGEYGADTVRFFLLNSAEPWQDYDWRDDLVGSVHDQLE
                     RFWNRAQEIITDPGPDDQPDLETVDRWLLSKLQDTVRDVTTAMDEAETRSASQAAFYN
                     FEESLRWYRRRTDLDRPAAKWTLRTVLETRLRLLAPFIPFMTNELHEQLTGTPAEDAP
                     WPEPDESFEDESVELEERQVERLTEDVRDIIDVTDSDPDTIRVYVAADWKRDVFETVV
                     DNGDNVGAIMGQVMQDPDLRERGNDVNDLVQDLVDQTRGRDESTLRAQLELDEADTYE
                     RAADFLAREFDAAVEVFAEDDDDIVDPGDRASKAIPFRPAVHLE"
     gene            403730..403948
                     /locus_tag="HVO_RS06880"
                     /old_locus_tag="HVO_0453"
                     /db_xref="GeneID:8926109"
     CDS             403730..403948
                     /locus_tag="HVO_RS06880"
                     /old_locus_tag="HVO_0453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044470.1"
                     /db_xref="GeneID:8926109"
                     /translation="MSEDDSSSLARKAYHTVTPGSHMRPDSEMDSIGWTMFLILVVLL
                     VPFLPFIAIVYVLSKVFGYLNAQRGPSP"
     gene            complement(404006..405001)
                     /locus_tag="HVO_RS06885"
                     /old_locus_tag="HVO_0454"
                     /db_xref="GeneID:8926733"
     CDS             complement(404006..405001)
                     /locus_tag="HVO_RS06885"
                     /old_locus_tag="HVO_0454"
                     /EC_number="4.3.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319639.1"
                     /note="catalyzes the interconversion of alanine and
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine dehydrogenase"
                     /protein_id="WP_013035300.1"
                     /db_xref="GeneID:8926733"
                     /translation="MRKTLLLNKDDVHENVQMPELISAIEDAFAAYESGDAQMPPKSY
                     IDLPQYNGDFRSMPAYLDAGDWDAAGIKWVNVHPDNGDKYDLPTVMGTMIYSDPENAF
                     PLALLDGTELTMLRTGAAAAVATDHLAVEDASSMGIVGAGVQSYTQLRAISEVRDIEE
                     VVVSDLDEERVADFIDAFEDEFDIRAGSIEEAASCDVLSTVTPVESPIVPREAVGDHT
                     HINAMGADAEGKHELADEVLLDAKLVIDDHAQTTHSGEINVPYHDGVLTDDDIYGAIG
                     DIVLGNLDGRTDADGISVFDSTGLAIQDVAAAHVAYEHAFENDNGYAFDLLGLAE"
     gene            complement(405300..406943)
                     /locus_tag="HVO_RS06890"
                     /old_locus_tag="HVO_0455"
                     /db_xref="GeneID:8924405"
     CDS             complement(405300..406943)
                     /locus_tag="HVO_RS06890"
                     /old_locus_tag="HVO_0455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermosome subunit"
                     /protein_id="WP_004044467.1"
                     /db_xref="GeneID:8924405"
                     /translation="MIIMGEDAQRVKDRDAQEYNIRAARAVAEAVRSTLGPKGMDKML
                     VDSMGDVTITNDGVTILKEMDIDNPTAEMIVEVAETQEDEAGDGTTTAVAIAGELLKN
                     AEDLLEQDIHPTAIIRGFNLASEKAREEIDDIAERVDPDDEELLKKVAETSMTGKSSE
                     LNKELLADLIVRAVRQVTVEANDGSHVVDLENVSIETQTGRSASESELLTGAVIDKDP
                     VHDDMPVQFDEADVLLLNEPVEVEETDIDTNVSIESPDQLQKFLDQEEAQLKQKVDQI
                     VDSGADVVFCQKGIDDLAQHYLAKQGILAVRRTKKSDIRFLKNITGAAVVSDLDSIEA
                     AVLGRASVRRDEAGELFYVEGIGDDVHGVTLLLRGSTDHVVDELERGVQDALDVVAST
                     VADGRVLAGGGAIEVELASRLRNYADSVSGREQLAVEAYADALELVPRVLAENAGLDS
                     IDTLVDLRAAHEDGQVRAGLNVFTGEVEDAFDAGVVETAHAKEQAVASASEAANLVLK
                     IDDIIAAGDLSTGGDDDEEGGAPGGMGGMGGMGGMGGAM"
     gene            complement(407159..407551)
                     /locus_tag="HVO_RS06895"
                     /old_locus_tag="HVO_0456"
                     /db_xref="GeneID:8925040"
     CDS             complement(407159..407551)
                     /locus_tag="HVO_RS06895"
                     /old_locus_tag="HVO_0456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008606282.1"
                     /db_xref="GeneID:8925040"
                     /translation="MHHRANYATVFIGSHLHPEGETLDLDWADDAGDETETFEFDVPT
                     DDPREPYLGIQAFDVGEYGHEIRINGDPLSGFDIPPGDGWQYWVDTVTGASLVEGTNT
                     IRVVRDDEGNDAFAVGTVTVHWKEPVEE"
     gene            complement(407615..407797)
                     /locus_tag="HVO_RS06900"
                     /old_locus_tag="HVO_0457"
                     /db_xref="GeneID:8924865"
     CDS             complement(407615..407797)
                     /locus_tag="HVO_RS06900"
                     /old_locus_tag="HVO_0457"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044465.1"
                     /db_xref="GeneID:8924865"
                     /translation="MPDTKTGREKKGLNKRTQLTERLYERELSVLDGDDDEPPLDAAS
                     DDADGEFLADELPEDD"
     gene            complement(408343..408423)
                     /locus_tag="HVO_RS06905"
                     /old_locus_tag="HVO_3021"
                     /db_xref="GeneID:8925866"
     tRNA            complement(408343..408423)
                     /locus_tag="HVO_RS06905"
                     /old_locus_tag="HVO_3021"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(408389..408391),aa:Ser,seq:gga)
                     /db_xref="GeneID:8925866"
     gene            complement(408453..408659)
                     /locus_tag="HVO_RS06910"
                     /db_xref="GeneID:25143411"
     CDS             complement(408453..408659)
                     /locus_tag="HVO_RS06910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044464.1"
                     /db_xref="GeneID:25143411"
                     /translation="MARRVRSALAWGAASLLLVGVLAQGAVLLGLGIDASFGVVAAVA
                     VASGVAVASVTYVIEPRLERKGRA"
     gene            complement(408661..409047)
                     /locus_tag="HVO_RS06915"
                     /old_locus_tag="HVO_0459"
                     /db_xref="GeneID:8926841"
     CDS             complement(408661..409047)
                     /locus_tag="HVO_RS06915"
                     /old_locus_tag="HVO_0459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="reactive intermediate/imine deaminase"
                     /protein_id="WP_004044463.1"
                     /db_xref="GeneID:8926841"
                     /translation="MKRVIETDEAPAAVGAYSQATTNGSLLYTAGQIPLTPDGELLDD
                     EDIATQTTQSLDNVMAILAEAGADATDVLKTTVFLADIDDFDEMNETYATYFDEEPPA
                     RSAVEVGNLPKGVGVEIEAVAVVDEE"
     gene            complement(409132..409338)
                     /locus_tag="HVO_RS06920"
                     /old_locus_tag="HVO_0460"
                     /db_xref="GeneID:8926273"
     CDS             complement(409132..409338)
                     /locus_tag="HVO_RS06920"
                     /old_locus_tag="HVO_0460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044462.1"
                     /db_xref="GeneID:8926273"
                     /translation="MATLPNTEPTAESLTKPLTLLGLGLVVVSVAVAGFALRDGDVVT
                     ALGMGLLFASGVLTTGISLSGKSV"
     gene            complement(409378..410376)
                     /locus_tag="HVO_RS06925"
                     /old_locus_tag="HVO_0461"
                     /db_xref="GeneID:8924177"
     CDS             complement(409378..410376)
                     /locus_tag="HVO_RS06925"
                     /old_locus_tag="HVO_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome d ubiquinol oxidase subunit II"
                     /protein_id="WP_004044461.1"
                     /db_xref="GeneID:8924177"
                     /translation="MTDYGAFATDPLFGLPLQELWFGLVFFILGMFLFLDGFDFGVGA
                     IFATRDDDEERETLLAAIGPFWDGNEVWLVVFGGALFAAFPAVYANLFSRHYLLMFAI
                     LGALILRGLAPEMYEQRHDEAWQTWWGRAFVVGSVSAPFFLGVFAAHWLLGVESLLSL
                     PGVVVGLAVVALTVVAGVGFLAMKTRGSLQRDVADYGPRAMAAYLALVVVTLGYLIAV
                     RPDLGVLAPIPLALVVVSLAAAAGYLLALRGGRYTLAFGAVPVLVFAFVALVATLMFP
                     LADPATGLTVADAIISVLPLNIMSVASALLLPLVFTYFGILYSTFSGPIETGESYS"
     gene            complement(410369..411793)
                     /locus_tag="HVO_RS06930"
                     /old_locus_tag="HVO_0462"
                     /db_xref="GeneID:8925218"
     CDS             complement(410369..411793)
                     /locus_tag="HVO_RS06930"
                     /old_locus_tag="HVO_0462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome ubiquinol oxidase subunit I"
                     /protein_id="WP_004044460.1"
                     /db_xref="GeneID:8925218"
                     /translation="MLDPVIASRLQFALTTIVHIIFPVMSMGLAPFLIYFTWKDIRTD
                     DPVYEQLRRFWTKIFAVSFVVGTVTGIVLEFEFGTNFAAFSTAAGELFGGPLATEGMM
                     AFMLEATFLGVFVFGREKVSDALYMVSAVAVGLGTWLSAVWILVANSWMQTPRGYELA
                     RESGQLVVSLVDPIAAYANPRFPWMFVHMQNAAVLSVALFMAGVAAYHVWQRGISADD
                     DREDARFWRKTLKIALVVLLVTAPFQAIHGDAYGRHVYETQPQKFAAMEAVWETDSYV
                     PEYIFAIPTSLDGITDPRAKELFGIGIPGGASWLASGGDPQAEITGLNEFDTEAPPVA
                     IVFWSFRLMVAAGFWFILLAFWAGYRWWADELYEDDLLHKAFVGSSLLGIFAVEVGWI
                     VTEVGRQPWVIQGVLRTSEGVSPGLTSFEATLTLVGFAVVYTGLLALYTYVIRRIIRE
                     GPPSVDETEAGAEAAAPAGVTGDD"
     gene            412138..412344
                     /locus_tag="HVO_RS06935"
                     /db_xref="GeneID:25143412"
     CDS             412138..412344
                     /locus_tag="HVO_RS06935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044459.1"
                     /db_xref="GeneID:25143412"
                     /translation="MTLLWQAVHVGISVLGVAYLAFPARIHTFGFEFLRRSPSEESGA
                     SDAPVWLYRGIGALLVFIGATGLV"
     gene            complement(412389..413600)
                     /locus_tag="HVO_RS06940"
                     /old_locus_tag="HVO_0464"
                     /db_xref="GeneID:8926435"
     CDS             complement(412389..413600)
                     /locus_tag="HVO_RS06940"
                     /old_locus_tag="HVO_0464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine ammonia-lyase"
                     /protein_id="WP_004044458.1"
                     /db_xref="GeneID:8926435"
                     /translation="MLTLDDVRAARERVEAVARRTPLEYSHTFSEMTGAEVYLKLENS
                     QRTGSFKIRGATNRITTLSDEEKAAGVVTASAGNHAQGVALAASRAGVNSKIVMPEYA
                     PISKVKATERYGGDVVLYGNDYDEAQTKAHEIEESEGRTYVHAFDDEYVMAGQGTIGL
                     EIAEDCPDLDTVVVPIGGGGLISGISTAIKEQYPDARVIGVQAEQASSAADSLNKGSI
                     QTIDEVDTIADGIAVRRIGDKPFEVIRERVDEVVTVSDEEIAVALTYLLERSKTLVEG
                     AGAVALAALVFQKFDYEEGEVVVPALCGGNIDMNTLTTVVMRGLVETGRYLKIRTELK
                     DRPGSLEQLIEIIAAEKANIYAVRHDRTSRKIALNATEVEIDLEMRGPDHVESLLEEL
                     RDAGYDVEVLD"
     gene            413956..415347
                     /locus_tag="HVO_RS06945"
                     /old_locus_tag="HVO_0465"
                     /db_xref="GeneID:8926495"
     CDS             413956..415347
                     /locus_tag="HVO_RS06945"
                     /old_locus_tag="HVO_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_004044457.1"
                     /db_xref="GeneID:8926495"
                     /translation="MNLGRLRRVWKRIFSLAWPVMAEQTAQTAMRTVDVAVTAALSPA
                     AVVAIGLADLYARFPLRIGLGLGGGAIALSSQDTGSGADANRSEAISTALLLAFLAGI
                     PFLIFGFTLGGAAIDAFPASERAVALGTTYLAVIFATSPARLVSLVGSRSLQGVGDTR
                     TPMLVNVFANVVNIGLSVGLGFGLVGLPALGVLGVGLATSTANVLSAGLLLVALARPA
                     SPTSLVRPRDRTVAGQLVRIATPRVGEGIAAELAEFPFNALLLGFGDAVNAGFQIGRR
                     VYQQVASPLARGYNVAASVLVGQALGAGDSETARYQGGAVALLSVVTVGGIGLLLAAF
                     TEPIVGLVGSGGGTDLDWAVKFAVAYGLAAPGLALFVGLSGSLQGAGATRIPFVARLT
                     GVFGFFVGLSYLLVEGFGYGPLGARIGIVLSFTWMGLFALVAFSYADWAGHADSLMVE
                     RGSVGVDDVGEDD"
     gene            complement(415459..416598)
                     /locus_tag="HVO_RS06950"
                     /old_locus_tag="HVO_0466"
                     /db_xref="GeneID:8925804"
     CDS             complement(415459..416598)
                     /locus_tag="HVO_RS06950"
                     /old_locus_tag="HVO_0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319626.1"
                     /note="catalyzes the formation of citrate from acetyl-CoA
                     and oxaloacetate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate (Si)-synthase"
                     /protein_id="WP_004044456.1"
                     /db_xref="GeneID:8925804"
                     /translation="MSGELKRGLEGVLVAESKLSFIDGDAGQLVYCGYDIEDLARDAS
                     YEEVLYLLWHGALPTGEELDAFSDELAAHRDLDDGVLDVARELAEQDESPMAALRTLV
                     SAMSAYDESADFEDVTDREVNLEKAKRITAKMPSVLAAYARFRRGDDYVEPDESLNHA
                     ANFLYMLNGEEPNEVLAETFDMALVLHADHGLNASTFSAMVTSSTLSDLYSAVTSAIG
                     TLSGSLHGGANANVMRMLKDVDDSDMDPTEWVKDALDRGERVAGFGHRVYNVKDPRAK
                     ILGAKSEALGEAAGDMKWYEMSVAIEEYIGEEKGLAPNVDFYSASTYYQMGIPIDLYT
                     PIFAVSRAGGWIAHVLEQYEDNRLIRPRARYTGEKDLDFTPVDER"
     gene            416899..418107
                     /locus_tag="HVO_RS06955"
                     /old_locus_tag="HVO_0467"
                     /db_xref="GeneID:8925381"
     CDS             416899..418107
                     /locus_tag="HVO_RS06955"
                     /old_locus_tag="HVO_0467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium channel protein"
                     /protein_id="WP_004044455.1"
                     /db_xref="GeneID:8925381"
                     /translation="MNPEDIEYEPVSVKAVLAEMKDTAELLIDLSYSAVLHANDDLAA
                     EVLDLEERMDILQLQARMSLMMAARSPEDAEELAPVLGVVGAAEKISDAAGDIAKVVI
                     EDIGLPDAIRAALPEAVETTIRCELTDESPYAGRNLGDINMETETGVRVVAIHRAGEW
                     VTNPDHETTLRAGDVLLLRGRDDGLHTVHEAATGLRYDPPDVPEPTIEDLERAVDSIV
                     LMKDMSELAVDLAYGAVLFDSEGVAEEVEELEAEVDALKSRFEAWTLRAASRVEDPVS
                     LRGLVQLAGATEMISDAALEIAEGVLRGIDAHPVVAAAVKESDEVIIRLRVAPASDLA
                     EATLGDRRVKSETGMRVIAVRRAGGREWVVSPGSETRLHGGDLIIAKGTRAGAERLGE
                     LVGDEREFDE"
     gene            complement(418158..418475)
                     /locus_tag="HVO_RS06960"
                     /old_locus_tag="HVO_0468"
                     /db_xref="GeneID:8923995"
     CDS             complement(418158..418475)
                     /locus_tag="HVO_RS06960"
                     /old_locus_tag="HVO_0468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044454.1"
                     /db_xref="GeneID:8923995"
                     /translation="MVSRPQPPTVTDDVPERPPTGGLVQALDVPRNAAIGAAVGLALA
                     VVAYLFRVLELFGPFAGTREYPILGPEGWFLLLAFVLASATALLVATVLTLVSAYRLS
                     KTL"
     gene            418546..419502
                     /locus_tag="HVO_RS06965"
                     /old_locus_tag="HVO_0469"
                     /db_xref="GeneID:8926154"
     CDS             418546..419502
                     /locus_tag="HVO_RS06965"
                     /old_locus_tag="HVO_0469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinylglutamate desuccinylase/aspartoacylase
                     family protein"
                     /protein_id="WP_004044453.1"
                     /db_xref="GeneID:8926154"
                     /translation="MITLGTASAAPGEMDVGRLEVGESRDGGSVGLPVAVINGASSGK
                     TLYMQAASDGDELNGVGVIQRVVPQLDPADISGAILVVGIVNYHAFQVAQHRNPIDDT
                     KMNRAYPGDERGTSSERIAAATFAAARDADLIVDLHQGSTSRMIDEVRVRCGRHHRMH
                     AKCLRLAKTFGCGYVLDQKGPDGQLARAGPDAGIPTIDPELGGCVGWDEESIEKGVRG
                     VHNVLRGYDFLDGDVELKAQTRARGFDQYGSPVGGLVRFKRDLGERVSAGDVVFEVAD
                     VFGTLKARVTADHNGIFWRARRLPQVASGEYVCSVGIDLDTY"
     gene            419599..420702
                     /locus_tag="HVO_RS06970"
                     /old_locus_tag="HVO_0470"
                     /db_xref="GeneID:8925729"
     CDS             419599..420702
                     /locus_tag="HVO_RS06970"
                     /old_locus_tag="HVO_0470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal-phosphate dependent enzyme"
                     /protein_id="WP_004044452.1"
                     /db_xref="GeneID:8925729"
                     /translation="MTTPPDLPARLRLACDSCGETYDAWRWRCACGEPLDFAADPTPS
                     AATPDDADLDYRDGLWAFDDFLPTEPRASLGEGMTPLVDAAEWEASFKLEYVFPSGSF
                     KDRGATTMLSLASELGVERVVEDSSGNAGAAVATYAARAGIDAEIYVPASVKPSKVRA
                     IERAGAKPVRIEGSRQAVTDACVEAVEADDAWYASHAWNPAFFAGTATVAYEIAAQRD
                     WSVPDAVVTPLGHGTLFLGAYRGFRALYEAGWTDRMPELYGAQAAGYSPIADARHHTA
                     DETNDVADGIQILDPVREAEIHEALDATGGDAIALSADAVEDELDRLHRHGFYTEPTC
                     AVAPAALRELRLSGVLDRDADVVVPLTGSGLKS"
     gene            complement(420720..422078)
                     /locus_tag="HVO_RS06975"
                     /old_locus_tag="HVO_0471"
                     /db_xref="GeneID:8924679"
     CDS             complement(420720..422078)
                     /locus_tag="HVO_RS06975"
                     /old_locus_tag="HVO_0471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044451.1"
                     /db_xref="GeneID:8924679"
                     /translation="MTPPLPTREQLPDDLLERANWVGWRTQLCDGEETVVPRSATDGG
                     PASATDDSTWATFDEALACAREGRVDGVGFAFTDDDPFVGIELENCRDAETGATDEWA
                     RALVDRLDSYTEVTPSGTGFRVIVRGTLPSGSARAGGLELSDVTRFRPVTGDCADGAP
                     AAVAERSDALATVHGAYFETDPEPSPSVDAVAPAASIDSVNPDAPNSDRAPADARLDE
                     ISGPGNDLTDDEVVRRASNAVNGVAFTRLWRGDASGYDDRDEADAALCSMLAFWTAGD
                     ARQMCRLFRDSGLFRPTWDEVVHADGSTYGARTVRRAIRETSEFYDPSGWSSAVRRSA
                     TQSDDDRHRDRHRHPNRNRRDDDVVTDPARRPPASPGASPGDGRGGFDRLDELRARLD
                     EVVDENERLRDELDAERERRRDLEARAGDRNVRAEARAGVENAGRGWSLVGWLRSWRA
                     LR"
     gene            complement(422204..422479)
                     /locus_tag="HVO_RS06980"
                     /old_locus_tag="HVO_0472"
                     /db_xref="GeneID:8925199"
     CDS             complement(422204..422479)
                     /locus_tag="HVO_RS06980"
                     /old_locus_tag="HVO_0472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2892 domain-containing protein"
                     /protein_id="WP_004044450.1"
                     /db_xref="GeneID:8925199"
                     /translation="MEKNVGGYDRIARAVLGPVLIVVGAASLAGFLTIAAGTLGLVIA
                     VAALLVGAVLATTAVTQKCPPNDLLGVDTYEGATATETESAGKPRAQ"
     gene            422618..422818
                     /locus_tag="HVO_RS06985"
                     /old_locus_tag="HVO_0473"
                     /db_xref="GeneID:8924357"
     CDS             422618..422818
                     /locus_tag="HVO_RS06985"
                     /old_locus_tag="HVO_0473"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044449.1"
                     /db_xref="GeneID:8924357"
                     /translation="MPRLSFLLPGEDDTIGRFLTLTLVIYAVISGFEILGVLWAMCLA
                     MAVWTLATAIQGFRYGYLEGAT"
     gene            complement(422870..423604)
                     /locus_tag="HVO_RS06990"
                     /old_locus_tag="HVO_0474"
                     /db_xref="GeneID:8926730"
     CDS             complement(422870..423604)
                     /locus_tag="HVO_RS06990"
                     /old_locus_tag="HVO_0474"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate O-methyltransferase"
                     /protein_id="WP_004044448.1"
                     /db_xref="GeneID:8926730"
                     /translation="MDNSVLRDDMVDGLEHSLELLPEAVSIAMRSVPRHEFVTDSPYQ
                     NRPTEHRDTNTTILAPTTVARLLAALDPQPDDEVLVVGAGVGYTAAVLAEIVGDARVH
                     AVDITRSLVYEARENLQRAGYGGVLVDCRDGAEGLADYAPFDRILVEASAVRPPARLL
                     AQLADGGRLVMPKGVGEQTLVAVEDGEVAESFGPLSFKPLLVDGEQTGSIVRNRTRRE
                     DPEYEGRGWHAGHGWEQDWIDWGGSG"
     gene            complement(423626..424564)
                     /locus_tag="HVO_RS06995"
                     /old_locus_tag="HVO_0475"
                     /db_xref="GeneID:8924647"
     CDS             complement(423626..424564)
                     /locus_tag="HVO_RS06995"
                     /old_locus_tag="HVO_0475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_004044447.1"
                     /db_xref="GeneID:8924647"
                     /translation="MPTRDRSQSSVESLALLWAARESGVIDALTTSAGTAEAVADTAG
                     IDPRAARIAVEALAAMGFIKRVGDEYEITNRALGFLAKRDVRSIGRLPHALDRFSLYA
                     DLPETMATGEPPAFPDDWLRNRLGAHDATEESVVRACVTAAVRAAPDATRVLDLGGAS
                     GVFAREFVARGRDVTLVDDAETVEVARPLLSRAGVDLVAGDPADPPVSGVELVFAGDA
                     FAGRDPDDARALVAGAFDALEPGGAAVFVDSLHGRCSTDATAGRAVNALAAGRGDLHD
                     EETVRSWVESAGFDGCTVRDVPGTDLQAVVGERAVD"
     gene            complement(424661..425317)
                     /locus_tag="HVO_RS07000"
                     /old_locus_tag="HVO_0476"
                     /db_xref="GeneID:8925290"
     CDS             complement(424661..425317)
                     /locus_tag="HVO_RS07000"
                     /old_locus_tag="HVO_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044446.1"
                     /db_xref="GeneID:8925290"
                     /translation="MSLPDAGERVPLSCPTCSPDEPTVHEVLKPGGHSTVRCTECSHV
                     HKEKVEIPDETEMNVVVSQDGDSVSTEVPVPVGTTIEVGDEFIVDTPEAIQLVRITGI
                     EVGPEQRADEAEVADVKTVWTRVVDNVAVNVTIHPKDGKREDTRSVTVNVPGDYEFVV
                     GETEAFGDEEVEIEGLVVRSDAPEYRHGKLDHPGDMVYAKDAKRVYARDQTSTAWSAW
                     "
     gene            complement(425456..426415)
                     /locus_tag="HVO_RS07005"
                     /old_locus_tag="HVO_0477"
                     /db_xref="GeneID:8925898"
     CDS             complement(425456..426415)
                     /locus_tag="HVO_RS07005"
                     /old_locus_tag="HVO_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="WP_004044445.1"
                     /db_xref="GeneID:8925898"
                     /translation="MTEADADLRAASETAVRQCLDLQPDESLVVVTDDKRERIGEALY
                     EVAGEVTDDATIVRYPPGNQHGEEPPAPVAAAMQACDAFLAPTTKSLSHTRARGDACD
                     AGARGATLPGITEEVFVTGLDADYDAIYDHSAAMLDAVGGADELRVTTEKGTDITFVR
                     GDREWLADTGAIAEAGSFSNLPAGEIFLSPASATGTYVVDGTMMPHGLLDEGRELRFE
                     VEDGYVTEISDDDIREQVEAAAEEVGDDAYNLAEIGIGTNVGVTDLVGSVLLDEKAAG
                     TVHIAVGDDAGIGGDTDAPLHLDGIIREPAVYADGEEVDLPQP"
     gene            426605..427672
                     /locus_tag="HVO_RS07010"
                     /old_locus_tag="HVO_0478"
                     /db_xref="GeneID:8926519"
     CDS             426605..427672
                     /locus_tag="HVO_RS07010"
                     /old_locus_tag="HVO_0478"
                     /EC_number="1.2.1.59"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II glyceraldehyde-3-phosphate
                     dehydrogenase"
                     /protein_id="WP_013035627.1"
                     /db_xref="GeneID:8926519"
                     /translation="MIRVGVNGYGTIGKRVADAVHAQPDMELIGVAKTQPNFEAHTAG
                     ERGYPMYAAIPERSPLFSEAGVDLAGEVDELVAKADIIVDCTPSGIGAENRELYETHH
                     TPAIFQGGEDADVADVSFNARANFDAARDADYVRVVSCNTTGLSRIIAPLEAEYGVEK
                     VRATLVRRGGDPGQNSRGPINDILPNPIEIPSHHGPDVKTIFPGLEIDTLGLKVPATL
                     MHVHALNVTLEDDVTGAHVRQLLEGENRVYVIPEGMGIDGAGKLMDFALDAGRPRGDM
                     WENCVWGESIGVNGRDLYLFQAIHQQSDVIPENVDAIRAMFDTEDQQDSMALTDRTLG
                     IGISGDPSGFSEQARAEFADD"
     gene            complement(427742..428230)
                     /locus_tag="HVO_RS07015"
                     /old_locus_tag="HVO_0479"
                     /db_xref="GeneID:8926524"
     CDS             complement(427742..428230)
                     /locus_tag="HVO_RS07015"
                     /old_locus_tag="HVO_0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_004044443.1"
                     /db_xref="GeneID:8926524"
                     /translation="MKLGAVSDTHDNLDYVEAAVSHFESEGVDAVVHCGDIVAPFSAA
                     PFDADFDFHAVRGNNDGEWALREAVESFGTYHGDFAHLTLDGQEIAVYHGTEAGLVDA
                     LVDSGTYDFVLRGHSHERVVEHRGATTHINPGGLPIPGADDAFHVAVVDLDTGNVASR
                     SL"
     gene            428338..428637
                     /locus_tag="HVO_RS07020"
                     /db_xref="GeneID:25143413"
     CDS             428338..428637
                     /locus_tag="HVO_RS07020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044442.1"
                     /db_xref="GeneID:25143413"
                     /translation="MSDDPNRHGDDIPDDEPTAATDSDGLVLETGDHGTVFTGAVLVG
                     VTTYSAAHTLAVRAAGSFPDGGLLTAVLTLGVFATGVGLLVDGAAGLVAKRDADL"
     gene            complement(428646..429851)
                     /locus_tag="HVO_RS07025"
                     /old_locus_tag="HVO_0480"
                     /db_xref="GeneID:8924848"
     CDS             complement(428646..429851)
                     /locus_tag="HVO_RS07025"
                     /old_locus_tag="HVO_0480"
                     /EC_number="2.7.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_004044441.1"
                     /db_xref="GeneID:8924848"
                     /translation="MFKTLDDLDPEQRVLVRLDLNSPVEDGEVQDNRRFDRHAETVRE
                     LAEAGHRVVLMAHQGRPGGDDFVSLEQHADILASHIDREVGFVADTYGDDAIAAIDAL
                     EAGDVLLLENTRMCDEELPEEDPEVKADTEFVRTLAEHVDAYVNDAYSAAHRSHASLV
                     GFPLVLPAYAGRVMQTEYEANSSIATREFDGQVTMVVGGTKATDVIDVMNNLGDKVDQ
                     FLLGGIAGELFLRAAGNDVGFDLEGMDFFDDQWEANRETIESLLDERGDQIKLAVDLA
                     YEDETDDRGEIAVANITEKDRAYLDVGSMTVDEYDPIIRDSEAVFVKGALGLFEDERF
                     AVGTTGVLRAIAETDCFSVVGGGDTSRAIGMYGMDEADFGHVSIAGGAYIRALTGAPL
                     AGVEALKQD"
     gene            complement(429927..430979)
                     /locus_tag="HVO_RS07030"
                     /old_locus_tag="HVO_0481"
                     /db_xref="GeneID:8923988"
     CDS             complement(429927..430979)
                     /locus_tag="HVO_RS07030"
                     /old_locus_tag="HVO_0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_004044440.1"
                     /db_xref="GeneID:8923988"
                     /translation="MSEKSYLSAGENVDESDVVRVALNGFGRIGRNIFRAVLDNPKVE
                     LVAINDVMDFDDMAYLAKYDSVMGRLDGVERDGDSLSIGGTSVSLYNVQSPAELPWGE
                     LDVDVALECTGIFRTKEDASAHLEAGADKVVISAPPKGDEPVKQIVYGVNHDEYDGED
                     IVSNASCTTNSVTPVAKVLDEEFGIENGLLTTVHAYTGSQNLIDSPHAKQRRGRAAAE
                     NIVPTTTGAAQAATEILPQLDGKLDGMAIRVPVPNGSLTELVVRLEDKPSVEEINDAF
                     RAAADSGPLAGVLGYTDDEVTSRDILGLPFSSTVDLNTTNQVNDGGLYKILTWYDNEY
                     GFSNRMLDVAHFVTHQ"
     gene            431247..431609
                     /locus_tag="HVO_RS07035"
                     /old_locus_tag="HVO_0482"
                     /db_xref="GeneID:8924786"
     CDS             431247..431609
                     /locus_tag="HVO_RS07035"
                     /old_locus_tag="HVO_0482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20/alpha crystallin family protein"
                     /protein_id="WP_004044439.1"
                     /db_xref="GeneID:8924786"
                     /translation="MVRDDRDDPFDNIFDEIERMMNDMTGGDAGFASETHIDMYDEGS
                     TLRLVADLPGVDKDAIDLKCDGETLTISAAGDRREYDERIRLPARVDEHSASATFNNG
                     VLQVTFDRAEDSAAIDVE"
     gene            complement(431634..432506)
                     /locus_tag="HVO_RS07040"
                     /old_locus_tag="HVO_0483"
                     /db_xref="GeneID:8926803"
     CDS             complement(431634..432506)
                     /locus_tag="HVO_RS07040"
                     /old_locus_tag="HVO_0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RimK family alpha-L-glutamate ligase"
                     /protein_id="WP_004044438.1"
                     /db_xref="GeneID:8926803"
                     /translation="MLRLAVTTSSETFERMRGPLGNRGIDVGHLRAKEFALDLSTPPA
                     ESFDVGFVYPTRPMEGGVVTARHDVPWVNTREDVLTSRNKAGVIAALERAGLPVPRSV
                     CVSNPSDESDLLDAVESAGLDYPVVVKPNSTTRGVGIAKAHDPDSLSGHADVLGLVHD
                     FRATGDKSFLIQEWLPEARDYRAMVLDGEVVGAVERRLSDGARDGGRWKHNVHRGAEA
                     VGVTLPKSHRELVESVADELGIRYLGVDLLESDGRVVVSETNARPTIDDDAKYDDGFF
                     DRLAALVERVAKKS"
     gene            complement(432592..433122)
                     /locus_tag="HVO_RS07045"
                     /old_locus_tag="HVO_0484"
                     /db_xref="GeneID:8924662"
     CDS             complement(432592..433122)
                     /locus_tag="HVO_RS07045"
                     /old_locus_tag="HVO_0484"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008160956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_004044437.1"
                     /db_xref="GeneID:8924662"
                     /translation="MSDKPASMYREITNPAYTRREYITGIPGSKIAQHNMGDLQADPE
                     DYPVQISLKVEEEVQIRHGSLESARLSANRLMLKHAGEKQYKMILRKFPHHVIRENKQ
                     ATGAGADRVSDGMRQSFGKVVGTAARIPKGETVFTIYCDVEDAETAKDAFRRAYNKMS
                     PPCRIVVDRGEELLVA"
     gene            433283..433930
                     /locus_tag="HVO_RS07050"
                     /old_locus_tag="HVO_0485"
                     /db_xref="GeneID:8925183"
     CDS             433283..433930
                     /locus_tag="HVO_RS07050"
                     /old_locus_tag="HVO_0485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 glutamine amidotransferase"
                     /protein_id="WP_004044436.1"
                     /db_xref="GeneID:8925183"
                     /translation="MLLVCDCMPADGPAYFTDALADLALDGREGAVHSIPADGLPTLS
                     DVDAVVLTGSTAGVYETDGRPWLDDARLLARDLVARELPTLGVCFGHQLVNDALGGTV
                     EAGDQRRGITDVNLDDDPLFDGVSGRIPMVHGDYVVAPGDRMETVASADYYDHLATRH
                     EDAPVWTVRYHPEFTAGLLDRIADDFGWPDDDADRDFDDVTADRTLENFVAAGLD"
     gene            complement(433931..434725)
                     /locus_tag="HVO_RS07055"
                     /old_locus_tag="HVO_0486"
                     /db_xref="GeneID:8925971"
     CDS             complement(433931..434725)
                     /locus_tag="HVO_RS07055"
                     /old_locus_tag="HVO_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF91 domain-containing protein"
                     /protein_id="WP_004044435.1"
                     /db_xref="GeneID:8925971"
                     /translation="MTVNTLHRPTHRDALVHLEAAFERGDMMTIFGRCTVDYDGRATS
                     ELGPGDRLVVLKPDGSILVHTDEKRTPVNWQPPGCTHSASVRDGRLRVRSTRTSPDER
                     LDVQFERVEQCSAYAVNDRSDLELVGSEEDLRQHILSDPDVLEPGFEPLETERQSDAG
                     AIDIFGEDAAGVPVVVELKRRRVGPSAASQLRRYVDALHREFGDDEPIRGVLVAPSVT
                     ERAGDMLDREGLEFVALDPETGEPPVEEDEGEAEESEKADDADADA"
     gene            434848..435303
                     /locus_tag="HVO_RS07060"
                     /old_locus_tag="HVO_0487"
                     /db_xref="GeneID:8925191"
     CDS             434848..435303
                     /locus_tag="HVO_RS07060"
                     /old_locus_tag="HVO_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase family
                     protein"
                     /protein_id="WP_004044434.1"
                     /db_xref="GeneID:8925191"
                     /translation="MAPDFAQHNRIEMPAEEIDRLLREEGVGVLSLADDGVAYGIPLS
                     FGYDADRGRLYFVFLRPGESSKKAEFAERTARASFTVWNAPSRDQWESVVVDGELHQV
                     DDGDWDRVRDALEDNAWYPTLFSETEPMQDILGWELRIDSRSGLQRRRA"
     gene            435432..435830
                     /locus_tag="HVO_RS07065"
                     /old_locus_tag="HVO_0488"
                     /db_xref="GeneID:8926052"
     CDS             435432..435830
                     /locus_tag="HVO_RS07065"
                     /old_locus_tag="HVO_0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_004044433.1"
                     /db_xref="GeneID:8926052"
                     /translation="MNTSSASAVEQSLTRNSRRSHVLSDPSSALSALSDGDSRRILAA
                     CDEAPRTAQECAELCDVPLSTVYRKLDLLTEASLLDERLRVQTATHHPREFATNFDTL
                     SFSFDDAGVSLAFRQIATDGGEDGAEGRSR"
     gene            435901..436059
                     /locus_tag="HVO_RS07070"
                     /old_locus_tag="HVO_0489"
                     /db_xref="GeneID:8926591"
     CDS             435901..436059
                     /locus_tag="HVO_RS07070"
                     /old_locus_tag="HVO_0489"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ribbon domain-containing protein"
                     /protein_id="WP_004044432.1"
                     /db_xref="GeneID:8926591"
                     /translation="MSATTTDDYEFTCSQCGEGFAVNGGMRAAVLERGCPICGSPVSA
                     DAFDPCPA"
     gene            436448..436909
                     /locus_tag="HVO_RS07075"
                     /old_locus_tag="HVO_0491"
                     /db_xref="GeneID:8924948"
     CDS             436448..436909
                     /locus_tag="HVO_RS07075"
                     /old_locus_tag="HVO_0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_004044430.1"
                     /db_xref="GeneID:8924948"
                     /translation="MSLDQQTELSPDEIREVLSRHETGVLSLAKADEPYAIPISYGYD
                     GESGRFYLRLVSTPESEKRQFLTSSPRARLVVHESNDGSYRSIIAEGTLERVDPDELT
                     VERIVQYGKAKRPLFEIWGETKRDLDIQLFELDPETLGGRAVELDAPESDQ"
     gene            437012..437659
                     /locus_tag="HVO_RS07080"
                     /old_locus_tag="HVO_0492"
                     /db_xref="GeneID:8925556"
     CDS             437012..437659
                     /locus_tag="HVO_RS07080"
                     /old_locus_tag="HVO_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_004044429.1"
                     /db_xref="GeneID:8925556"
                     /translation="MPAGIRATVEFDSPSVCPVASVAHSTDSVVDSVSTSVVSTPGEV
                     SVSEFVLEADDPPDASALEPIFSYGSKHLYRYTHDGSADCPCECLGEFGCPVDRYFAQ
                     RGSLTLVFHAADYEQLQAVIGELRDRFPGLDIKRLVRSPTGDAPGDSVFVDRGKLTTR
                     QLEVLQTAYDMGYFERPRGANATEVAAELDINQSTFSEHLAAALTKLLGDVLEEG"
     gene            437774..438166
                     /locus_tag="HVO_RS07085"
                     /old_locus_tag="HVO_0493"
                     /db_xref="GeneID:8926616"
     CDS             437774..438166
                     /locus_tag="HVO_RS07085"
                     /old_locus_tag="HVO_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_004044428.1"
                     /db_xref="GeneID:8926616"
                     /translation="MSQASLPFDFRSATAASEPRVVDDHDEVDALFSLLEDDDCRRIL
                     DATDGIARSASELSEACDLPLSTTYRKLDPLVDAGLLSKRLRISRSGTHTAEYERTVD
                     DVTVSVTPSGVEVRVSHRDVAQSASVTA"
     gene            438284..439078
                     /locus_tag="HVO_RS07090"
                     /old_locus_tag="HVO_0494"
                     /db_xref="GeneID:8924502"
     CDS             438284..439078
                     /locus_tag="HVO_RS07090"
                     /old_locus_tag="HVO_0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044427.1"
                     /db_xref="GeneID:8924502"
                     /translation="MYSNRIPVLLIAVLVLLAGCAGGADVAPAADADDTDTPTDGGGS
                     ADTGASSDGDDFELSDPERLLRDAGSFTVSWSYTGVETAVTREFAADLDAERSYSRTT
                     STTDGQSDAGGVEQYVADGVTYVRVGGDDEATYTSYEGSTEVLAAAIALSQARAYGAD
                     DDLTFAGTETFDGASVERYELSAANEALILAGSAAAQGEPGTLEVTSFEYVVLVDEDG
                     LSRHESWSFSGRMDDGSEVSGSWEYSLTGVGSTTVEEPAWLDEARA"
     gene            complement(439239..439312)
                     /locus_tag="HVO_RS07095"
                     /old_locus_tag="HVO_3022"
                     /db_xref="GeneID:8924350"
     tRNA            complement(439239..439312)
                     /locus_tag="HVO_RS07095"
                     /old_locus_tag="HVO_3022"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(439276..439278),aa:Phe,seq:gaa)
                     /db_xref="GeneID:8924350"
     gene            complement(439362..440087)
                     /locus_tag="HVO_RS07100"
                     /old_locus_tag="HVO_0496"
                     /db_xref="GeneID:8926876"
     CDS             complement(439362..440087)
                     /locus_tag="HVO_RS07100"
                     /old_locus_tag="HVO_0496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008606036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2270 domain-containing protein"
                     /protein_id="WP_004044426.1"
                     /db_xref="GeneID:8926876"
                     /translation="MSDDGELEPPAGMDDTHIGAGVFDETMGPGSSFAHLYRGEIHRM
                     KSWRERLDRTSNWAITLMAGILTWSFSAQTHPHYLILLGVVTLSIFLSIEARRFRAYD
                     IWRSRVRLIQQNVWAYALDPDGGVLDENWREKLGEDYRTPNMKIPFEEALAHRLRRVY
                     LPLFLVMLAAWVIQLTTYTDGTTPVGSAGIGGVPGNIIVAFVAGFYATLLGISFRPRE
                     WHVNGELIPSDVTGWEESEYGGS"
     gene            complement(440257..440451)
                     /locus_tag="HVO_RS07105"
                     /old_locus_tag="HVO_0497"
                     /db_xref="GeneID:8926466"
     CDS             complement(440257..440451)
                     /locus_tag="HVO_RS07105"
                     /old_locus_tag="HVO_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006182670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_004057909.1"
                     /db_xref="GeneID:8926466"
                     /translation="MAKGKVDFFNDTGGYGFISTDDADDDVFFHMEDVGGPDLEEGQE
                     VEFDIEQAPKGPRATNVTRL"
     gene            complement(440611..440805)
                     /locus_tag="HVO_RS07110"
                     /old_locus_tag="HVO_0498"
                     /db_xref="GeneID:8925496"
     CDS             complement(440611..440805)
                     /locus_tag="HVO_RS07110"
                     /old_locus_tag="HVO_0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006182670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_004057907.1"
                     /db_xref="GeneID:8925496"
                     /translation="MAKGKVDFFNDTGGYGFISTDDADDDVFFHMEDVGGPDLEEGQE
                     IEFDIEQAPKGPRATNVTRL"
     gene            complement(441236..441309)
                     /locus_tag="HVO_RS07115"
                     /old_locus_tag="HVO_3023"
                     /db_xref="GeneID:8925331"
     tRNA            complement(441236..441309)
                     /locus_tag="HVO_RS07115"
                     /old_locus_tag="HVO_3023"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(441273..441275),aa:Phe,seq:gaa)
                     /db_xref="GeneID:8925331"
     gene            complement(441371..442039)
                     /locus_tag="HVO_RS07120"
                     /old_locus_tag="HVO_0500"
                     /db_xref="GeneID:8926865"
     CDS             complement(441371..442039)
                     /locus_tag="HVO_RS07120"
                     /old_locus_tag="HVO_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044423.1"
                     /db_xref="GeneID:8926865"
                     /translation="MGTRRLIRALGLAGIGVVGTYLLAVRPWHRRWGTTDDEATGWLP
                     GDDFAGDADVSSTRAITIMAPARAVWPWLVQLGQGRGGFYSYERLENLFGLQIHNADR
                     ILPQHQRLDVGDEIRLGPPGSGAPSFRVAFVDTERCLVLSAPGWETGESRATWSFALH
                     EVVPGATRLVVRFRGRSETLRERAVNRLVVEPVQFTMERKMLKGIRSRAERARASATG
                     GRHR"
     gene            complement(442085..442483)
                     /locus_tag="HVO_RS07125"
                     /old_locus_tag="HVO_0501"
                     /db_xref="GeneID:8925006"
     CDS             complement(442085..442483)
                     /locus_tag="HVO_RS07125"
                     /old_locus_tag="HVO_0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic resistance protein VanZ"
                     /protein_id="WP_004044422.1"
                     /db_xref="GeneID:8925006"
                     /translation="MNPITRLRENPRWAAVALGCALGVFAASVAPTPPGSLAPMGPLG
                     VVGLDKWVHAAGYAGLGFAFASAVRARGRDEVAAAVLAAGAFGAGIELVQAVLPYRSF
                     GVADAGANLAGAVLGGVVWVAAVRVADARG"
     gene            442587..442790
                     /locus_tag="HVO_RS07130"
                     /old_locus_tag="HVO_0502"
                     /db_xref="GeneID:8926560"
     CDS             442587..442790
                     /locus_tag="HVO_RS07130"
                     /old_locus_tag="HVO_0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044421.1"
                     /db_xref="GeneID:8926560"
                     /translation="MSLLPRWFTSKNFAVQLVILALVLDPVGFVGGYLLGPSLGVDPL
                     VGGAFGLVAASVPMSLLVMQRSV"
     gene            complement(443018..443091)
                     /locus_tag="HVO_RS07135"
                     /old_locus_tag="HVO_3024"
                     /db_xref="GeneID:8926261"
     tRNA            complement(443018..443091)
                     /locus_tag="HVO_RS07135"
                     /old_locus_tag="HVO_3024"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(443055..443057),aa:Val,seq:tac)
                     /db_xref="GeneID:8926261"
     gene            443185..443682
                     /locus_tag="HVO_RS07140"
                     /old_locus_tag="HVO_0504"
                     /db_xref="GeneID:8926836"
     CDS             443185..443682
                     /locus_tag="HVO_RS07140"
                     /old_locus_tag="HVO_0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF192 domain-containing protein"
                     /protein_id="WP_004044419.1"
                     /db_xref="GeneID:8926836"
                     /translation="MTSRARTALLVVAVVVAVASVAYLTNPAVVPGSTDGYERTTLTV
                     VDDETGETLATVNARVADTRAKRFTGLSDTESLAENEGMWFVHDSSGTYAYVMRDMDF
                     PLDIVFVAENGTITRIHHAELDPEGTSESDLTRYRGTGKYVLELPYGYTNETGIDAGD
                     RVEVE"
     gene            443723..443992
                     /locus_tag="HVO_RS07145"
                     /old_locus_tag="HVO_0505"
                     /db_xref="GeneID:8925685"
     CDS             443723..443992
                     /locus_tag="HVO_RS07145"
                     /old_locus_tag="HVO_0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044418.1"
                     /db_xref="GeneID:8925685"
                     /translation="MTAHVAALSELEGWRAEEFAARVHYRGADDAYSIEYYEPSDCVL
                     YWKVKGDGEVAVPVGRDTVPDPLRERVRQDLVEAGVDPEVEDRVV"
     gene            444097..446034
                     /locus_tag="HVO_RS07150"
                     /old_locus_tag="HVO_0506"
                     /db_xref="GeneID:8926489"
     CDS             444097..446034
                     /locus_tag="HVO_RS07150"
                     /old_locus_tag="HVO_0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004044417.1"
                     /db_xref="GeneID:8926489"
                     /translation="MSPETDDDPFEDQRERVDNPMRRLFAEYGRENTFEFVVGVLASV
                     AARVLDLMPPVILGLAIDAIIRQETSFAAGFPVLPEAWITPYVPATRDGQFLLAVGII
                     VFSFTAGAVFHWLRNWGWNAYAQQIQHDVRTDTYDRMQLLNMDFFADKQTGEMMSILS
                     NDVNRLERFLNDGMNSFFRLFVMVVAIAVVLLSYNWQLALVALLPVPLIALFTWKFVD
                     IIQPKYADVRSSVGKLNSRLENNLGGIQVIKTFNAESHESDRVDGVSMDYFDANWDAI
                     NTRIKFFPALRILAGIGFSLTFVVGGLWVINGQGPGPFTGDLEIGEFVTFILLTQQFV
                     WPLAQFGQIINMYQRAHASSARIFGLMDEPARLAEQPDAPDLAVSEGRVEYDDVTFGY
                     GDGETVVEDISFEVDGGETLALVGPTGGGKSTILKLLMRMYDPDEGHVNIDGQDVRDV
                     TISSLRESIAYVSQETFLFYGTVRDNITYGTFDADDEAVVAAAKAAEAHEFISNLPEG
                     YDTKVGERGVKLSGGQRQRVSIARAILKDPDILVLDEATSDVDTETEMLIQRSLDELT
                     ADRTTFSIAHRLSTIKDAEQIVVLEDGRIVERGAHDDLLSEDGLYAHLWGVQAGEIDQ
                     LPDEFVERAARRQAEVDAGDD"
     gene            446078..446800
                     /locus_tag="HVO_RS07155"
                     /old_locus_tag="HVO_0507"
                     /db_xref="GeneID:8925414"
     CDS             446078..446800
                     /locus_tag="HVO_RS07155"
                     /old_locus_tag="HVO_0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="creatininase family protein"
                     /protein_id="WP_004044416.1"
                     /db_xref="GeneID:8925414"
                     /translation="MRLSEATWTEVADLDGDLALLPVGSTEQHGPHAPLGTDALNAES
                     VAEVGADAFDGEVVVGPTIPVSVAEEHRAFDGTLWVSPDTFRAYVRETIESLAHHGFD
                     RVVVVNGHGGNIDALAELCRRVSRTGDVYAVAFTWFDAVGDHSSDMGHGGPLETALLR
                     HTHPELVREDRIDEARDGGADRWGEWVSGVNLAHDSDEFTDNGVVGDPAKGDADRGAE
                     LESLAADSLASLLDAVESRKLD"
     gene            complement(446839..447285)
                     /locus_tag="HVO_RS07160"
                     /old_locus_tag="HVO_0508"
                     /db_xref="GeneID:8924993"
     CDS             complement(446839..447285)
                     /locus_tag="HVO_RS07160"
                     /old_locus_tag="HVO_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044415.1"
                     /db_xref="GeneID:8924993"
                     /translation="MSQSTLGDDDLFGEAAAEMRADVEEHLGEARSALPDPDDVWEAD
                     ADNVLGVLNGLRSSLDVEGAAEHVRQAKKWYVIGQRAEAFDDPEDLEAAIEELEALIE
                     MVEEAHELVGELTNTMPQLRGALTDAAEAAEAASADEDEDEDEEEE"
     gene            complement(447374..447841)
                     /locus_tag="HVO_RS07165"
                     /old_locus_tag="HVO_0509"
                     /db_xref="GeneID:8924760"
     CDS             complement(447374..447841)
                     /locus_tag="HVO_RS07165"
                     /old_locus_tag="HVO_0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX domain-containing protein"
                     /protein_id="WP_004044414.1"
                     /db_xref="GeneID:8924760"
                     /translation="MTRPRSAARGLLVRDGELLAIQYRTDGEDWYVAPGGGQQRGESL
                     AETVRREVYEETGYEVAVGSLAYVRDFVPSTHYEDRDDGHQVDHFFWCERVGDEPDDP
                     TERDSVQVGVRWLPLDELGEVRFFPGPLGDRLRSGDSDEMGDARGAVYLGDVD"
     gene            complement(447838..448179)
                     /locus_tag="HVO_RS07170"
                     /old_locus_tag="HVO_0510"
                     /db_xref="GeneID:8923913"
     CDS             complement(447838..448179)
                     /locus_tag="HVO_RS07170"
                     /old_locus_tag="HVO_0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044413.1"
                     /db_xref="GeneID:8923913"
                     /translation="MVTDPQTACFEAGIKFGTLYHQFAGTPVSPDSARSLERAMAEAI
                     ENQPHCESVSVHILDDALDAELAGSTADYTELTGRFMEVEMEIDYEGVRVRTEMEMED
                     GYPLMKIVSVE"
     gene            448281..449069
                     /locus_tag="HVO_RS07175"
                     /old_locus_tag="HVO_0511"
                     /db_xref="GeneID:8925817"
     CDS             448281..449069
                     /locus_tag="HVO_RS07175"
                     /old_locus_tag="HVO_0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_004044412.1"
                     /db_xref="GeneID:8925817"
                     /translation="MDQPVLLTGAGGRVGQAILGHIGDAYDWRLLDREPLSDEKIPDS
                     VDSTEVYVADVTDETAVRNAMDGVHAVIHLAGDPRPEAPWDSVLRNNIDGTQQMFDAA
                     VDVGVEKFAFASSNHAVGAYETTDRTPDMYRPHHEFRLDGTELPRPSNLYGVSKAAGE
                     TLGRYYHDHHDISVVNVRIGNLTQHHPPKEYERGQAMWLSYRDCGHLFECCIEADYDY
                     EIVYGISDNDRKYYSIDRARAVLGYDPQDNSAEFTFEGEPLDEA"
     gene            complement(449134..449559)
                     /locus_tag="HVO_RS07180"
                     /old_locus_tag="HVO_0512"
                     /db_xref="GeneID:8925353"
     CDS             complement(449134..449559)
                     /locus_tag="HVO_RS07180"
                     /old_locus_tag="HVO_0512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044411.1"
                     /db_xref="GeneID:8925353"
                     /translation="MAATAARRIALLLTVVTLLLVSLAPWGPIETRSFEHLSPVVYWG
                     FNAFLILLGLGSFATAYRLWSGNTDALLVAVVAGVLYIAVYGLDLAGIFPTSPDAMPP
                     LLFAIEVVDTALAVVLVVYSYWVWNRANPHRGRGETRTS"
     gene            449668..450342
                     /locus_tag="HVO_RS07185"
                     /old_locus_tag="HVO_0513"
                     /db_xref="GeneID:8926406"
     CDS             449668..450342
                     /locus_tag="HVO_RS07185"
                     /old_locus_tag="HVO_0513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_004044410.1"
                     /db_xref="GeneID:8926406"
                     /translation="MRYTTLRLGWDDTELHPLTEAFTDDAGVTIESLHYVNSVDDGGY
                     TELSRLRGDLDAAREILDSISEVRAFDVSAAGIAYIHYESSPLMDRLLAVVFDHAVVL
                     TWPVTFARPNGNLSAQLTLLGTEDALSHAIATIPAEIDVSLVRTGRYEASVHDPLSSL
                     TDRQREVLDVAVRAGYYEVPREATHREIAAELAVAPGTVSEHLQRIEANLVSALVGAT
                     GADGEP"
     gene            complement(450349..450960)
                     /locus_tag="HVO_RS07190"
                     /old_locus_tag="HVO_0514"
                     /db_xref="GeneID:8925617"
     CDS             complement(450349..450960)
                     /locus_tag="HVO_RS07190"
                     /old_locus_tag="HVO_0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF309 domain-containing protein"
                     /protein_id="WP_004044409.1"
                     /db_xref="GeneID:8925617"
                     /translation="MDDSLRAGVAIYNAGAYRAAHGAWESKWLSLERDTDDERFLHGL
                     IQFTAAVHHARDGNDSGAVGLARSAREYLDGLADDYRGVDLAGVRESLARLEADPGVA
                     ADPPALRLDDRVVTYDDLDFDAVAVAAETLAEELDGYDESVVADAVGYAHEEVADGEQ
                     TQFTAMVFDFVRNEAQRGLVFQRLSEHVRRRRRREDDVSGLFD"
     gene            451105..451329
                     /locus_tag="HVO_RS07195"
                     /old_locus_tag="HVO_0515"
                     /db_xref="GeneID:8924907"
     CDS             451105..451329
                     /locus_tag="HVO_RS07195"
                     /old_locus_tag="HVO_0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044408.1"
                     /db_xref="GeneID:8924907"
                     /translation="MTQSPVCIRCGEQYLFTRAYKGNYCRDCHGSWAAKPRSEEAPRP
                     RPQRSRTTSSVRRREDDERSPGLEPPYDEA"
     gene            451494..452177
                     /locus_tag="HVO_RS07200"
                     /old_locus_tag="HVO_0516"
                     /db_xref="GeneID:8925192"
     CDS             451494..452177
                     /locus_tag="HVO_RS07200"
                     /old_locus_tag="HVO_0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhamnogalacturonan acetylesterase"
                     /protein_id="WP_004044407.1"
                     /db_xref="GeneID:8925192"
                     /translation="MSSESITVHLVGDSTMADKEAHERPETGWGMPFADRFDDAVTVA
                     NHARNGRSTRTFLEEGRWRPVARQLTETDYVFVQFGHNDEVPSKEQHTTEAAFVDNLR
                     KFVGETREQGATPVFLTPIARRQFDDGGVPKDTHRAYADLTRTVALDRDVPLIDMDER
                     TRALLAELGPDASTALYNHLEPGEHSNYPEGIADDTHFSEHGARRMADVVLGGVAELD
                     LGLAAHVES"
     gene            complement(452351..452423)
                     /locus_tag="HVO_RS07205"
                     /old_locus_tag="HVO_3065"
                     /db_xref="GeneID:9527250"
     tRNA            complement(452351..452423)
                     /locus_tag="HVO_RS07205"
                     /old_locus_tag="HVO_3065"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(452387..452389),aa:Arg,seq:gcg)
                     /db_xref="GeneID:9527250"
     gene            452571..453080
                     /locus_tag="HVO_RS07210"
                     /old_locus_tag="HVO_0518"
                     /db_xref="GeneID:8924257"
     CDS             452571..453080
                     /locus_tag="HVO_RS07210"
                     /old_locus_tag="HVO_0518"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044406.1"
                     /db_xref="GeneID:8924257"
                     /translation="MNRRALLLGTAGLCASLAGCASGGDAAEGSTASTGTETGTASPT
                     ATGTSRRPRLVGRSFTPVRADACSADGGALASETETGVSVVGCVTGATDCSIARLARA
                     DYDAASDTATLVVETVERADAENCAESPVVRGYEATLRFESGLPGRAVVVHDDADGRR
                     EVARIDMDA"
     gene            453269..454720
                     /locus_tag="HVO_RS07215"
                     /old_locus_tag="HVO_0519"
                     /db_xref="GeneID:8926823"
     CDS             453269..454720
                     /locus_tag="HVO_RS07215"
                     /old_locus_tag="HVO_0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008319566.1"
                     /note="Replication protein A protects and stabilize the
                     intermediate ssDNA that is generated by the unwinding
                     action of a DNA helicase at the replication fork. In
                     addition, SSBs prevent the formation of secondary
                     structures by single-stranded template DNA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA binding protein"
                     /protein_id="WP_004044405.1"
                     /db_xref="GeneID:8926823"
                     /translation="MGVIREVYDDLDTDVEFEEFEAAVNDKVEQMGGLADEETAAMLI
                     AHELRDEEVNGIADIEPGMEDVKFLAKVVSIGEVRTFERDGEDEDGRVVNIEVADETG
                     RIRVSLWDEMAAGAKENLEVGTVLRIGGRPKDGYNGVEVSASKVEEDLDAEVDVQVLD
                     SYRVEDLALGLSDVNLEGKILDAGTVRTFDRDDGTEGRVSNLSVGDPTGRVRVTLWDE
                     RADLAEELEPGQSVEVVDGYVRERDGSLELHVGSRGAVEPIDEDIEYVPETTDIGSLE
                     LGQTVDIAGGVIEADGKRTFDRDDGSEGQVRNIRVKDGTGDIRVALWGEKADADVDLA
                     DYVVITDAEIKEGWQEDLEASAGWRSSVAVMDEAPEGAAGTDAGGSAPTPPSDEGLGA
                     FSGDGSSDDTSAANGGSSSDASAAESTGEAVEFTGTVVQAGTPVILDDGTQTKTVDTD
                     ADLGLGDEVTVSGTETDGRISAESVEVHTGAQQ"
     gene            454913..455344
                     /locus_tag="HVO_RS07220"
                     /old_locus_tag="HVO_0520"
                     /db_xref="GeneID:8925929"
     CDS             454913..455344
                     /locus_tag="HVO_RS07220"
                     /old_locus_tag="HVO_0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013879305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldolase"
                     /protein_id="WP_004044404.1"
                     /db_xref="GeneID:8925929"
                     /translation="MSVELPFAPVDAIIRQNAGELRVSAGAAEALARRIQDRGAELAI
                     DAADRATADGRKTLMAEDFGVQQVVDRDELSLPIAPIDRIARLRIDDRYRVAMDARIA
                     LADILEDYAVNVADAAVKLAHHADRRTVQSEDIETYFSLFE"
     gene            455344..456357
                     /locus_tag="HVO_RS07225"
                     /old_locus_tag="HVO_0522"
                     /db_xref="GeneID:8926176"
     CDS             455344..456357
                     /locus_tag="HVO_RS07225"
                     /old_locus_tag="HVO_0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histone deacetylase"
                     /protein_id="WP_004044403.1"
                     /db_xref="GeneID:8926176"
                     /translation="MQFGYSETCLDHDTGPRHPETADRLRAIRRGLAKRHGVEYVDAS
                     PAEKSTVAAVHDDGYVDEFHEFCRDGGGNWDPDTVAVEASWDAALTSAGLAEWAARAA
                     LDGDDGRNTPFSLGRPPGHHAVEDDAMGFCFFNNAAVAAQAVIDDGLAERVAIFDWDV
                     HHGNGTQDIFYDRGDVFYTSIHEDGLYPGTGEVDETGEGDGEGSTLNVPLHAGAGDAD
                     YVYSFDEAIAPAVERFDPDLFIVSAGFDAHRHDPISRMRVSTEGYAMLTECVQELCEE
                     TDAAIAFVLEGGYGLDTLSEGVATVHETFDGRIAMDPEEDPDEKNVELVDDVRAAHGL
                     GAK"
     gene            complement(456336..457715)
                     /locus_tag="HVO_RS07230"
                     /old_locus_tag="HVO_0521"
                     /db_xref="GeneID:8925754"
     CDS             complement(456336..457715)
                     /locus_tag="HVO_RS07230"
                     /old_locus_tag="HVO_0521"
                     /EC_number="2.7.7.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008323031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CCA tRNA nucleotidyltransferase"
                     /protein_id="WP_004044402.1"
                     /db_xref="GeneID:8925754"
                     /translation="MTNSDLAAVVAAVRERIDPDEAERRALADAAAALESRVYDALAD
                     LPVDADALQVGSTARGTWLSGDRDIDLFVRFPADLDREELEAYGLEVGHAVLPDGHEE
                     YAEHPYVKGDYDGFDVDLVPCYDVPSASDIRSAVDRTPFHNAYLTERLDDDLAADVRV
                     FKRFLKGIDAYGSDLRTEGFSGYLAELLVVGHGGFEPLLRAAADWSPQVEFDPEDHGT
                     RRFSDPLVVIDPTDPERNVAAVCSAENVARLQHYARDLLSDPRESLFFRPDPPALDAD
                     GVRSHLDRRGTTAVAVVFDCPDLVDDQLYPQLRKSLTGVADGLDRRGFDVFRRAAFAD
                     TDGEGQGEAALFAELSVAERPAVERHEGPPVHVRQHAEGFYGAYEDREDHYGPFLDGD
                     RYVVEREREFTTAAGFLESDALFDVALGKHVESTLREDGYDVLVGGDVAALAEAFGAE
                     LGRYFAPRP"
     gene            457852..457924
                     /locus_tag="HVO_RS07235"
                     /old_locus_tag="HVO_3025"
                     /db_xref="GeneID:8924906"
     tRNA            457852..457924
                     /locus_tag="HVO_RS07235"
                     /old_locus_tag="HVO_3025"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:457885..457887,aa:Asn,seq:gtt)
                     /db_xref="GeneID:8924906"
     gene            458021..458095
                     /locus_tag="HVO_RS07240"
                     /old_locus_tag="HVO_3026"
                     /db_xref="GeneID:8926861"
     tRNA            458021..458095
                     /locus_tag="HVO_RS07240"
                     /old_locus_tag="HVO_3026"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:458056..458058,aa:Met,seq:cat)
                     /db_xref="GeneID:8926861"
     gene            458677..459087
                     /locus_tag="HVO_RS07245"
                     /old_locus_tag="HVO_0526"
                     /db_xref="GeneID:8924406"
     CDS             458677..459087
                     /locus_tag="HVO_RS07245"
                     /old_locus_tag="HVO_0526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044401.1"
                     /db_xref="GeneID:8924406"
                     /translation="MIDPKHAEFVESVMNGEDDSEPESFRRASLSSEWRLEAIIDRDG
                     EEHLPGGGGVDMAPLKLPVQRVLQETRLQYTLQKGEMWRCSECNVGIYQTEWMARHLV
                     EQHGLDRPESADHVLHVEDYFDKDRECMRHPGCG"
     gene            complement(460194..461360)
                     /locus_tag="HVO_RS07250"
                     /old_locus_tag="HVO_0528"
                     /db_xref="GeneID:8926758"
     CDS             complement(460194..461360)
                     /locus_tag="HVO_RS07250"
                     /old_locus_tag="HVO_0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISH3 family transposase"
                     /protein_id="WP_013035617.1"
                     /db_xref="GeneID:8926758"
                     /translation="MSNNQQTDDEIHEDQLLNFLVNSLDEEVALSLAENAELDAEDIY
                     EVLVGACADGTSVSTLCERSEDAPHENSVLYHLRTKFGLETLEQVGNMLLQKDVLDVL
                     PQQVEVCADLHLRPYYGDEDDTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVRR
                     LEDGDTASSVLAEFLGILDGLDLGVKAVYLDREFYDSKCLTLLQAHNHAYVMPIVRWG
                     RTIKQELSEGWSRVIQHSLTAKLDGHSWTVEFPVYIDCTYQNGRYDEHGVARHGYAAD
                     APFIDSPRDARYHYAKRFGIEASYRLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWRY
                     LHWEYVATPRRGGRRLWEWSFKEFINMVRRAAWTALAVRRAVPANRPPDDRFSR"
     gene            461409..461756
                     /locus_tag="HVO_RS07255"
                     /db_xref="GeneID:25143414"
     CDS             461409..461756
                     /locus_tag="HVO_RS07255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049914901.1"
                     /db_xref="GeneID:25143414"
                     /translation="MSFDDFEETQVEDDYDDGVEEIKFDVDEPVIGVIVDIEVYLYCP
                     CPFAESESRQPRRELARLSLSQRLRCPRSRQLFNFPAFVADSDDEPTVGGRRLRPGAL
                     SDSLRLLNSESRR"
     gene            462054..463211
                     /locus_tag="HVO_RS07260"
                     /old_locus_tag="HVO_0530"
                     /db_xref="GeneID:8926451"
     CDS             462054..463211
                     /locus_tag="HVO_RS07260"
                     /old_locus_tag="HVO_0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004044400.1"
                     /db_xref="GeneID:8926451"
                     /translation="MLHGWTGGDGAAAAEALEAAFNEAYPDVGLDMNPIGGGGNQNLD
                     AVVANRLQSDDPPGAFANWPGPNLLRYEGVLGSVDDVWEENNFEEVMIDEAVELHQQG
                     GSYRAVPLGSHRLNCLFYNVSVVDEAGIDVDSLNSPSALIDAFETVQSETDAVPMTHA
                     MSGTWTTTQLWGAVMLAVNGYQPYMDFLNGEGSESAVRSAFETTAEMLENYISDDAAS
                     LNLTASNQNIINGNAAFIHQGNWAAGAFRNAENFAYDEDWGFKTFPGTEGMYTLHMDS
                     FLYPADNPTPEASKTWAAFVGSPEAQIAFNQYKGSIPTRTDVSMEEFGPYLQETAEDF
                     ANAEYRPPNLQHGLGVPSETMTALNEVISSEFTGPYNVDAATQGFLDAVSN"
     gene            463243..464286
                     /locus_tag="HVO_RS07265"
                     /old_locus_tag="HVO_0531"
                     /db_xref="GeneID:8925652"
     CDS             463243..464286
                     /locus_tag="HVO_RS07265"
                     /old_locus_tag="HVO_0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004044399.1"
                     /db_xref="GeneID:8925652"
                     /translation="MRRAITPGSADDQRVNDAGGERDAVRTDGGVVNEDSRSPDSESG
                     SLDRLAAGIDGLLGSDFLESSIFWVPPFLLMGLFVYGAVIWNFLISLTDYQRFANAPD
                     YSNLDFEMYTRALADSGFIDAAVNTFILLVAFTAGTLAVGLILAILIDRGIRFENSFR
                     TIYLLPMSLSFVVTAQFWLWIYNYNNGIANRVIGLVGVGPISWLGNQTIVLWAVIFAL
                     MWQFSGYAMVVYLAGLRAIPDEHYEAAKVDGASTLKMYWRVIIPQLKGATISAAVVLM
                     VFGMKAFDFLYSLVGGYRPPNGADILATKMVREAYANLNWAYGAAIAIVLFAMALGVI
                     GPYLVYEYRRNNL"
     gene            464283..465227
                     /locus_tag="HVO_RS07270"
                     /old_locus_tag="HVO_0532"
                     /db_xref="GeneID:8924473"
     CDS             464283..465227
                     /locus_tag="HVO_RS07270"
                     /old_locus_tag="HVO_0532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008847393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate ABC transporter permease"
                     /protein_id="WP_004044398.1"
                     /db_xref="GeneID:8924473"
                     /translation="MTDDTLRTDGGTATFTARLRRNVEQMTIEDAGLYVVLLLAAGFY
                     LVPIESGLVTSIKTGTAIVETAPFAPPGPSGFTLEKWQAAVEALLRGIGNSMLYAVPA
                     TVISAFVGSITAYGLTIPDWKQSYKALVLALIIAGIFIPYQAVLVPLTQFWSQWAQLT
                     DLLSFVWALGVPNDYVGIVELVVTHVAYGIPICTLLFRTYYKTMSEEMIESARLDGAT
                     LRRVYRRIVFPLSGPMFAVVLIYQFTQIWNDLLFTLVLVSTESSPAAPVVLILAGLGT
                     SLEGQDFALRMAGAFFAALPTLAVYIFFGDEFAEGVAA"
     gene            465348..466499
                     /locus_tag="HVO_RS07275"
                     /old_locus_tag="HVO_0534"
                     /db_xref="GeneID:8926584"
     CDS             465348..466499
                     /locus_tag="HVO_RS07275"
                     /old_locus_tag="HVO_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004044397.1"
                     /db_xref="GeneID:8926584"
                     /translation="MATLELDSITKTFQDGDDEIVAVDDISMSIDDGEFLVVVGPSGC
                     GKSTTLRMIAGLETITSGTISLGDRVINDVASQDRDIAMVFQSYALYPHMTVRQNMSF
                     GLEESTDLPDDEIGRMVSETADLLDIPSLLDRKPSDLSGGQQQRVALGRAIVRDPEVF
                     LMDEPLSNLDAKLRAQMRTELQRLQDDLGVTTVYVTHDQTEAMTMGDRIAILDGGELQ
                     QIATPLECYHEPANQFVASFLGEPSMNFFDVTREGDRLVGDSFEYPVGAEIRDDIGDV
                     TDLVLGIRPESVELVEAASGDHDFEMTVDVVEPMGDENTLYLYFEPDADPETAETLVA
                     TTDGLTRISPGETVVAQIPEEAIHFFDGRTGEALHNRSMEEAAQQIDLG"
     gene            complement(466545..467234)
                     /locus_tag="HVO_RS07280"
                     /old_locus_tag="HVO_0535"
                     /db_xref="GeneID:8926771"
     CDS             complement(466545..467234)
                     /locus_tag="HVO_RS07280"
                     /old_locus_tag="HVO_0535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044396.1"
                     /db_xref="GeneID:8926771"
                     /translation="MSDVFVDALRYPFADRARVDGTATCLVALLVGGTLLRLAARLWP
                     DLTFLAPALAAVVPLVVFLGLVGGVLAGDGFPPLATTETLRLAGRVVGVASVYLFPAA
                     VTVVAVGYVTATGSIPAVLTGVTTAMLATVALLVTVVCAYLFPAATAVSVHEGLRAGL
                     RRDALRGAASGTYFFAWVGAAVLVVLAWSALAATISRSVAALLALGWCAYAHVAAAAL
                     VAEGVGRTTPW"
     gene            467702..468232
                     /locus_tag="HVO_RS07285"
                     /old_locus_tag="HVO_0536"
                     /db_xref="GeneID:8925951"
     CDS             467702..468232
                     /locus_tag="HVO_RS07285"
                     /old_locus_tag="HVO_0536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA starvation/stationary phase protection
                     protein"
                     /protein_id="WP_004044395.1"
                     /db_xref="GeneID:8925951"
                     /translation="MSTQKSVLKEAGSVGDNPVRLDTEKAEQIIEALNTDLADAYVLY
                     HQLHKHHWNVEGAEHLRIHEFLQEAYEEVEEAADEIAERLQSIGGVPHASMPALSEAA
                     TVEPEDEDVYDIRTSLSNDLEMYGDIIESYREHIELAAGLGDHTTAHMLREQLIEIEE
                     HAHVIDHYLEDDTLVQ"
     gene            complement(468630..469064)
                     /locus_tag="HVO_RS07290"
                     /old_locus_tag="HVO_0538"
                     /db_xref="GeneID:8923917"
     CDS             complement(468630..469064)
                     /locus_tag="HVO_RS07290"
                     /old_locus_tag="HVO_0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent transcriptional regulator"
                     /protein_id="WP_004044393.1"
                     /db_xref="GeneID:8923917"
                     /translation="MIGAPQYLLTLYIAEREDDEESPISPGYVADALDRSPPAATERL
                     QNLDAKGLVDYEPYEGATLTAEGRDAAADLYDTYQILSRFCRDVLGVNDHEGEAMQLV
                     GNVSPTVAERLSATLLRGDGDRDGARQAAGSESTSSPDNPAS"
     gene            complement(469061..469873)
                     /locus_tag="HVO_RS07295"
                     /old_locus_tag="HVO_0539"
                     /db_xref="GeneID:8924765"
     CDS             complement(469061..469873)
                     /locus_tag="HVO_RS07295"
                     /old_locus_tag="HVO_0539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049914900.1"
                     /db_xref="GeneID:8924765"
                     /translation="MVADCAADVRDALDRVASEREQVLAKRRAVERFERRVRKLAAQS
                     ARPPAGTTRATACGTASVAAATRRDDAADEGRRRVRELFAETIRPHSVSDVSESEPLA
                     VTIREEFGPEVATALSPDAGSRFTPAAKEAVVSAATERQRGLDGMCRALDGEERSLRA
                     ALAVLDECEDWVARADETPLSELGFDALRRRHETLAGHREACDRLVRERQRHLNGATH
                     HTAAVEVDHRFLATYLYEDRATDYPVLAAATRVDDSCADCQRAVRDHLVRRV"
     gene            complement(470089..470577)
                     /locus_tag="HVO_RS07300"
                     /old_locus_tag="HVO_0540"
                     /db_xref="GeneID:8923926"
     CDS             complement(470089..470577)
                     /locus_tag="HVO_RS07300"
                     /old_locus_tag="HVO_0540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044391.1"
                     /db_xref="GeneID:8923926"
                     /translation="MVTVTPSVRPTWTDLARRGLATAAVASVANALLLTLVLGTGLVE
                     PFAPLSYPPVVFLSAAGAVAATLVYGLLTGRVTDADRTFFRVAVAVLVASFLPDIGLL
                     YVDPGATVPGVLVLMLMHVVVAAVCVASLTELGWGVPKGTDRTGPKSDRATAVRALFR
                     MP"
     gene            complement(470736..473552)
                     /locus_tag="HVO_RS07305"
                     /old_locus_tag="HVO_0541"
                     /db_xref="GeneID:8924874"
     CDS             complement(470736..473552)
                     /locus_tag="HVO_RS07305"
                     /old_locus_tag="HVO_0541"
                     /EC_number="4.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057833.1"
                     /note="Catalyzes the conversion of citrate to isocitrate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aconitate hydratase"
                     /protein_id="WP_004044390.1"
                     /db_xref="GeneID:8924874"
                     /translation="MSDTETLDAIREFEHDGTTYKMADLTVLEEQGLCELDRLPVSIR
                     ILLESVLRNVDGDIVTEEDVRNAASWEPDVPNVEVPFTPSRVVLQDLTGVPAVVDLAA
                     LRSAADRAGEDPKLVEPEVPCDLVIDHSVQVDFFGTPDAYEKNVELEYERNAERYKAL
                     KWAQNAFDNFSVVPPGTGIVHQVNLEHLGRVVHDREWRGDRWLLPDTLVGTDSHTPMI
                     GGIGVVGWGVGGIEAEAAMLGQPITMKLPEVVGVRLDGELPEGATATDLVLHVTEQLR
                     EVGVVDRFVEFFGPGVGNLSVPDRATISNMAPEQGSTISAFPVDEATLDYLELTGREP
                     EHIELVREYLESQGLFGEQHPEYTETVDVDLSAVEPSLAGPKRPQDRVAMGDMKTHFR
                     NLLYGEFEDDVADVDEEAIVRWLGEGGGGGDDGELAGDGGTLTETPEAAPEEPDLGEL
                     TKRVEVDLGGETVEIGHGSVVVSAITSCTNTSNPSVMVAAGLLARNALEKGLDVPEYV
                     KTSLAPGSRVVTEYLKKAGLLPHLEALGYDVVGYGCTTCIGNAGPLPEPIESAIDEHG
                     LWTTSVLSGNRNFEARIHPKIRANYLASPPLVVAYGLAGRMDIDLETDPLGTDDDGNA
                     VYLADIWPDADEIRETIHDSVDPSMFREKYAEVFEGDERWEALEAPTGDVYDWDDEST
                     YIREPPFFTDFPLEKPGVSDIEDARCLLTLGDTVTTDHISPAGPFGSKLPAGQWLVDN
                     GVDPVDFNTYGSRRGNHEVMMRGTFANVRIENQMLDDVEGGYTIHHPPGEETTVFEAS
                     QRYREEGTPLVVLSGVEFGTGSSRDWAAKGTDLLGVRATIAESYERIYRDNLVGMGVL
                     PLQFEDGDSWESLGLDGSEQFDIRGLDDGLDVNDELTVVATKDDGTEIEFDVTAQVGT
                     PAAVTYVEHGGILHYVLRRLLTEN"
     gene            complement(473683..474102)
                     /locus_tag="HVO_RS07310"
                     /old_locus_tag="HVO_0542"
                     /db_xref="GeneID:8924173"
     CDS             complement(473683..474102)
                     /locus_tag="HVO_RS07310"
                     /old_locus_tag="HVO_0542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044389.1"
                     /db_xref="GeneID:8924173"
                     /translation="MEADRRLLREARERLDGWTYTARDRAYRELFAGDDAAVTAEERQ
                     LLDEVDAELAGDGDDGLWGTDEYAVVMGHPKNHPISVVCTRHPEIPSSWSRGGESLTE
                     PEREQFNDLLWDYCERVRRYVQDEVDEFVGVAGVPEE"
     gene            complement(474201..474461)
                     /locus_tag="HVO_RS07315"
                     /old_locus_tag="HVO_0543"
                     /db_xref="GeneID:8926129"
     CDS             complement(474201..474461)
                     /locus_tag="HVO_RS07315"
                     /old_locus_tag="HVO_0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin family protein"
                     /protein_id="WP_004044388.1"
                     /db_xref="GeneID:8926129"
                     /translation="MSDAVPIVIYTRTECHLCDEAEATVREVADEVDVTVDIDLVNVD
                     SDEELREKYGERVPYVYVDGRPAFKFRVDADRLGEKLTAARE"
     gene            474717..476132
                     /locus_tag="HVO_RS07320"
                     /old_locus_tag="HVO_0544"
                     /db_xref="GeneID:8925515"
     CDS             474717..476132
                     /locus_tag="HVO_RS07320"
                     /old_locus_tag="HVO_0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar porter family MFS transporter"
                     /protein_id="WP_004044387.1"
                     /db_xref="GeneID:8925515"
                     /translation="MTVDTDAPEADGRNRFVYVTAALAALNGLLFGFDTGIISGAFLY
                     IRDAFTMTPLVEGIVVSGALAGAALGAALGGYLADRWGRRRLILVSAVVFFVGSLVMA
                     IAPTVEVLVVGRLIDGVAIGFASIVGPLYLSEIAPPKIRGSLVSLNQLAVTVGILSSY
                     FVNYAFADGGQWRWMLGTGMVPAVILAVGMVFMPESPRWLVEHDRESKARDVLSRTRT
                     DDQIRAELAEINETIEAEDGGLLDLLEPWMRPALVVGVGLAVLQQVTGINTVIYYAPT
                     ILESTGFESSASILATVGIGVVNVVMTVVAVVLIDRRGRRPLLSVGLAGMTLTLVALG
                     AAFYLPGFSGFVGTVATGSLMLYVAFFAVGLGPVFWLLISEIYPLKVRGTAMGVVTVF
                     NWVANLAVSLAFPVMVAEITTAGTFWVFAALSAVALAFTYRFVPETKGRSLEAIESDL
                     RENVLGGSPDGSSAGTVSDDD"
     gene            476452..476949
                     /locus_tag="HVO_RS07325"
                     /old_locus_tag="HVO_0545"
                     /db_xref="GeneID:8924648"
     CDS             476452..476949
                     /locus_tag="HVO_RS07325"
                     /old_locus_tag="HVO_0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044386.1"
                     /db_xref="GeneID:8924648"
                     /translation="MATTSEPGLSETRIHEVLSNDRRRMAIEYLQDSDLTLRELSERI
                     AEAETGESPPPRNIRQSAYVSLQQTHIPKLAELDIVNYDEESKVVSLAEAGDVTVYME
                     VVPEGELSWSEYYAALAALGIVLMIAVAVGVPVISAVGAPGLGSLVFAVLGGSAVYQR
                     WTQED"
     gene            complement(477273..477917)
                     /locus_tag="HVO_RS07330"
                     /old_locus_tag="HVO_0547"
                     /db_xref="GeneID:8926186"
     CDS             complement(477273..477917)
                     /locus_tag="HVO_RS07330"
                     /old_locus_tag="HVO_0547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044384.1"
                     /db_xref="GeneID:8926186"
                     /translation="MEVTTAGRFRVYRSPRDGDELLLLELPDERVDWTDPAVETDADD
                     AYSPTYVPRTGYDGDLEARVSALEPGNEIEATLRWDDGDPRFEELSVRDRTRFRFVGA
                     ATGLFEAARETWRATGDGEAIGSRVTYGTDGDPNAVLYVFAKQPGARDLFDEFGDGVV
                     PVDPLLDRLDDETDAPDAPREMFVLRPLDEEFVLVAIALDREGLFARTMRDTYC"
     gene            complement(478045..479526)
                     /locus_tag="HVO_RS07335"
                     /old_locus_tag="HVO_0548"
                     /db_xref="GeneID:8924013"
     CDS             complement(478045..479526)
                     /locus_tag="HVO_RS07335"
                     /old_locus_tag="HVO_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008323055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine:ornithine antiporter"
                     /protein_id="WP_004044383.1"
                     /db_xref="GeneID:8924013"
                     /translation="MATLSFEPLTYDDIPEAERPSLAQALVPVVGMLVFLSVGVIWLG
                     LDPQLPLLWGIILTGAVGRYWLGLPWTRLSAGIRDGINMGLSALLILLVVYMLISTWT
                     AAGTIPALIYYGLDFLSPAVFLPVATLLSAVVTFAIGSSWTTAATLGVAFIGIGSGLG
                     MPDAMTAGAVLTGAYTGDKVSPFSDTTNLAAAVTNTELLTHVRTMRVGTAIALAISLV
                     AYAALGLTASGSIPAGRVAEMQAAIAGSYAVTPLVFAPLVVTFVLALRGYPALPSIVA
                     GVVAGTFTQLFVQGPVSVDTFVGAWNVAFAGTAPSTGVETVDSLLASDGLLGSAWTMT
                     VILASLSLGGILERTGCIAVLAHHLRRVLTSVASLTVGTAASSLAMNAIAADQYMSIV
                     VPGMSFRGLYDDFDLESRNLSRAIESAGTTTSALIPWGTGGAYMADVLGVPTLQYAPY
                     YFLGFLSPLILVAIGLSGWRVTEQGSDTDAGLRGAVASFGDDD"
     gene            complement(479663..480625)
                     /locus_tag="HVO_RS07340"
                     /old_locus_tag="HVO_0549"
                     /db_xref="GeneID:8924883"
     CDS             complement(479663..480625)
                     /locus_tag="HVO_RS07340"
                     /old_locus_tag="HVO_0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_004044382.1"
                     /db_xref="GeneID:8924883"
                     /translation="MTALVTFGETMLRLSPPRGERLETARELEVQAGGAESNVAVAAA
                     RLGRDAAWFSKLPDSPLGRRIVSELRSHSVDTDGVVWTDDADARQGVYYLEHGASPRP
                     TNVVYDRADAAVTTLETGEFDLDAVRDAEVCFTSGITPALSETLSETTADVLDEAQNA
                     GTTTAFDLNYRTKLWSPDEAAEVYRDLLDSVDLLFAAERDAATVLGRDGDAESVARGL
                     ADDYDIETVVVTRGEEGSLAVSDGAVSEQGVYETETYDAIGTGDAFVGGFLAKHLDGG
                     SVTESLEWASATASFKRTVEGDIAVVTPEDVERVVAEEGDGISR"
     gene            complement(480714..481016)
                     /locus_tag="HVO_RS07345"
                     /old_locus_tag="HVO_0550"
                     /db_xref="GeneID:8926448"
     CDS             complement(480714..481016)
                     /locus_tag="HVO_RS07345"
                     /old_locus_tag="HVO_0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044381.1"
                     /db_xref="GeneID:8926448"
                     /translation="MNPLVVLGVCFGPLVLVVSYLFTAATGPSVPPWADAAGQAIRLY
                     GTVAAVVVGPLALHADRLDLARESDWVPSPVYYLIAVPFLSIPIAFIYLVRRLTAA"
     gene            complement(481150..483357)
                     /locus_tag="HVO_RS07350"
                     /old_locus_tag="HVO_0551"
                     /db_xref="GeneID:8924953"
     CDS             complement(481150..483357)
                     /locus_tag="HVO_RS07350"
                     /old_locus_tag="HVO_0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutL"
                     /protein_id="WP_004044380.1"
                     /db_xref="GeneID:8924953"
                     /translation="MSDIKQLDEKTVQRIAAGEVVERPASVVKELFENSLDADATRIS
                     VAVDAGGVEGVRIRDDGVGMSEEDLELAVREHTTSKIGDIEDLEAGVGTLGFRGEALH
                     TIGAVSRLTIRSKPRGGDVGTELQYEGGEVESIRPAGCPKGTVVEVDDLFYNTPARRK
                     FLKTTATEFDHVNAVVTHYALANPDVAVSLEHDDREVFATEGRGDLQSTVLSVYGREV
                     AESMVPVDHDAPGVSVSGLVSHPETTRSTRDYLSTFVNDRYVTDRVLREAVLDAYGGQ
                     LDADRYPFAVLFVEVAPDAVDVNVHPRKMEVRWDDEAGVKREVTEAVEDALLSHGLVR
                     SSAPRGRSKADEAAIEPGSSGDDATQLDPHEVRESEPDGETDDDADPPSARDVQSARE
                     ARESGARADSTATDDADTDTTPATERNSGAGSGDPAAGDDSGASAETTESSGPTSVPS
                     SAPPTPPREYDLAPGPETTEQSSLSTDDGSESRSTPDEASSVDSGADDNAPRSPPSRI
                     AAPTTQRDLSGEEADLSPEFDSLPSMRIIGQLSDTYIVAETDEGLVLVDQHAADERVN
                     YERLRGEVEGDTPTQALAEPVDLELTAREAALFEEYREALAQVGFHAGRTGERTVSVR
                     TVPAVFDAALDPELLRDALTAFVREEVDGGRKTVDAVADELLSDLACYPSITGNTSLR
                     EGSVLDLLAALDDCENPYACPHGRPVIVEFDRDEIASRFERDYPGHGGRRREE"
     gene            complement(483354..486128)
                     /locus_tag="HVO_RS07355"
                     /old_locus_tag="HVO_0552"
                     /db_xref="GeneID:8924116"
     CDS             complement(483354..486128)
                     /locus_tag="HVO_RS07355"
                     /old_locus_tag="HVO_0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_004044379.1"
                     /db_xref="GeneID:8924116"
                     /translation="MTTQGIVGQFLSLKEETDADLLAMQCGDFYEFFADDAETVGREL
                     DLKVSQKSSHGSSYPMAGVPLNDLTPYLKALVERGYRVAVADQYETESGDLRREVKRV
                     VTPGTLLETSRADAQFLAAVVTDGDGVGLAFSDITTGQFLVTEAATVDDAAAELYRFA
                     PVEVLPGPELRSDDETLSRLREATDASFSLFATEAFAPGRARHAVREQFGASTVDSVG
                     LDSDLATRAAGGVLAYVEETGAGVLRSMTRLQVYHPSDLLELDATTQRNLELTETMHG
                     DRSGSLFDTIDHTVTSPGGRLLREWLTRPRRDRDELARRHDAVESLASAALARERVRE
                     VLDGAYDLERLASRSASGSAGASELLSVRDTLSVLPALADAIEGTELADSPLAEVVSR
                     PDRDAAADLRTDLADALAEDPPKTVTQGGLFQTGYDDELDDLIERHESAKSWLDTLAD
                     REKRDHGLSHVTVDRNKTDGYYIQVGKSVADQVPDHYRQIKTLKNSKRFVTEELEEKE
                     REILRLEEARGDLEYELFEDLRERVARHAELLQDVGRTIAEVDALASLATHAAGNGWT
                     RPELTEAGALDIEAGRHPVVETTTDFVPNDLRMDDERGFLIVTGPNMSGKSTYMRQAA
                     LITLLAQVGSFVPARSATVGVVDGIYTRVGALDELAQGRSTFMVEMQELSNILHSATE
                     DSLVILDEVGRGTATYDGISIAWAATEYLHNEVRAKTLFATHYHELTSLADHLDRVAN
                     VHVAADERDGDVTFLRTVVDGPTDRSYGIHVADLAGVPRPVVDRAGDVLDRLREEKAI
                     EAKGSGTSEPVQAVFDVGSGQMKVAEAGDSGGDGDDSAGSGAPANGATGTGAAGNGSV
                     DAAAAVEGSAEADRAGTGSDSEAEAALDPETEAVLDELQSTDVNDTSPLDLMAKVQAW
                     QSKLDGGDGE"
     gene            486398..487591
                     /locus_tag="HVO_RS07360"
                     /old_locus_tag="HVO_0553"
                     /db_xref="GeneID:8926141"
     CDS             486398..487591
                     /locus_tag="HVO_RS07360"
                     /old_locus_tag="HVO_0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_049914899.1"
                     /db_xref="GeneID:8926141"
                     /translation="MGLGSLSGCVGTFGTESGEPVRFGAMLPVSGSLEQVGTHGKRAA
                     EQAVEDINGAGGVLGRPVELTTVDTEGSASVATDGYASLADAGVVGFVGGLVSDVSLA
                     LAPKAADDAVMEMSPASTNPRLSDAGRADGRKFFGRTVPSDSLQATAMAKILDAPQYA
                     DADRVALLTVDGAFGSDLGTALGDQLDAEVVTEVSYDPSAEAFGGVIDEVFADSPDAV
                     GFVSVPGQERGVLDAYGASDHEAPWVFSAGLFDGEIPPYYEGFYSASLSSVRTDGYFH
                     LTQRLSDIAPLQPYAANAYDALFLMATAAEYAGEASGPAIADALQTVSGGTGHTVSVG
                     EFDRVRTLVDAGRELNYQGASSGVDLTEALEPLSSYLVERVRNGSVEQVELLQRQFFE
                     SGGGR"
     gene            487588..490083
                     /locus_tag="HVO_RS07365"
                     /old_locus_tag="HVO_0554"
                     /db_xref="GeneID:8926044"
     CDS             487588..490083
                     /locus_tag="HVO_RS07365"
                     /old_locus_tag="HVO_0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_004044377.1"
                     /db_xref="GeneID:8926044"
                     /translation="MNPFSRLTSLLERALPNVIRRRYAAKFGVVLLLIAVVMGGAGAY
                     IHFDTKSVVESQTESQIRGAAATGAKSVSDWVTSKESTVSFLAESLADQPAGTSAADH
                     QRWLEGKLIQLSGDVRSLHYVDADTGAVVASTTDSATGQSLDSLSAPWTDDASALASS
                     RSVTVSAPYESGGEPVVAFVAPVSGANGAVVLTASLEAGSHQFESPYATGDTKVVTES
                     GTILFDNRKASILDEYAAADGSSIEAIDAAMSGQTGYEVVSARTGMEPGEYAMAYAPI
                     TGTDWVVTYHVPAERAFALQSHVTTNVMFLVAFAVGALFLVGATIGRGTARSLSVVAR
                     NADDIANGEVDGDLPNTARIDEMGRLYDSFESMQAYLTTVAGQAEALADKRFDDPVLD
                     EDIPGSFGESMGQTHTELEALITELEATAAEFSETMADAADGDLTRRMSEDADNDAMN
                     EMARSFNDMADELEATVAEVVGFAETVAAASQEVTASSQEIERASRQVSESTQVMAEG
                     AHEQRENLRQTTSETSNLSATIEEVASSASELERTAQHTLEASEDGHEAAANAIDTIE
                     TVETQTSRTVDRIEDLEGDMAEIGDIVELITDIAEQTNILALNANIEAARAGEAGEGF
                     SVVANEVKELAGETKSSAEEIEATIEEVQAKSAASVSEMRETRDAVDSGVDAVQTARD
                     SLDTIVENVRETTDGVDEISRTTDEQAASTEEVASMMDRVSDISDETAERAESVAAAA
                     EEQTASLSEVSDGADRLATQSERLMSLVSEFTVDHDAADRDGARTGADTTPSAELDAP
                     TTDGGFDGDGPDDDGIDDDGPDRSADDRSDRLD"
     gene            490290..491960
                     /locus_tag="HVO_RS07370"
                     /old_locus_tag="HVO_0555"
                     /db_xref="GeneID:8925227"
     CDS             490290..491960
                     /locus_tag="HVO_RS07370"
                     /old_locus_tag="HVO_0555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="WP_004044376.1"
                     /db_xref="GeneID:8925227"
                     /translation="MDLLSRLAALVPGVGARTRTDGGAQADERGTVAAAAEQLHAGAL
                     LDGVGTPVFVLDADGRVIAWNDPITTLTGVPAAEALGSEHVSELFYPDGRRAKTLADK
                     VLDDPRSANVVNGLDVVDEASRLYRDTSTMTDRHGAERHIAFTAQPLFEGDELVGVVE
                     AVHDRTDAVEKQRASEALVEEVSTTIGSLTAGDLSARASFTDDRGVLEDETLAVVSDL
                     NEMATRFDRLASEVDATTADLGGAIQRAATAATDIESQVTEQADLLSTGAEEMQELSA
                     SMEEIAATSDEVASAANQARVAAENGHEAGQSIRSATDQVIDISDELLDSVTELQQRM
                     VVIEEVVEVIAEVADRTNLLALNANIEAARAGEAGEGFSVVADEVKQLANQTHEHTEE
                     IADSITEIQEQADETVLASEQSHEQIQVASGEIEDVLASLSEIADAADSAANGITEVA
                     RATDSQATNIEEVTSTIQMAQEHATAAEASTTDITDATADQTVALDALADRVDALVGG
                     DATAVEELDAMDFDDAAGSADADADADSVRAATDGGSDDEFGGFQFDR"
     gene            492257..493255
                     /locus_tag="HVO_RS07375"
                     /old_locus_tag="HVO_0556"
                     /pseudo
                     /db_xref="GeneID:8924346"
     CDS             492257..493255
                     /locus_tag="HVO_RS07375"
                     /old_locus_tag="HVO_0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035025.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS110 family transposase"
                     /db_xref="GeneID:8924346"
     gene            complement(493539..494351)
                     /locus_tag="HVO_RS07380"
                     /old_locus_tag="HVO_0558"
                     /db_xref="GeneID:8925734"
     CDS             complement(493539..494351)
                     /locus_tag="HVO_RS07380"
                     /old_locus_tag="HVO_0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-synthase adenylyltransferase MoeB"
                     /protein_id="WP_004044375.1"
                     /db_xref="GeneID:8925734"
                     /translation="MTLSLDATQLDRYSRHIIMDEVGPEGQGRLLSSRVVVVGAGGLG
                     APAIQYLAAVGVGELVVVDDDVVERSNLQRQVVHCDDDVGTPKAESAAAFVRGLNPDV
                     SVEPVEARVDKSNVHEVVAGSDVVVDASDNFPTRYLLNDVCRFEGIPLVHGAIYKFEG
                     QATTLVPDGPCYRCLFPEAPEPGTVPDCATTGVLGVLPGTVGCIQATEAMKLLLDEGE
                     ALDGRLLFYDAMDMTFETVPYRTNPDCPVCGEGGVDSIEDIDYVESCAISLD"
     gene            494488..494841
                     /locus_tag="HVO_RS07385"
                     /old_locus_tag="HVO_0559"
                     /db_xref="GeneID:8925856"
     CDS             494488..494841
                     /locus_tag="HVO_RS07385"
                     /old_locus_tag="HVO_0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="WP_004044374.1"
                     /db_xref="GeneID:8925856"
                     /translation="MVAETTPDELREKLADDDELAVVDIRDPSSYTSGHIPGSENLPA
                     ATLGPEVFDREWPAEVVVSCYVGKSSKQVASVLDSNVDADVSSLRGGFDAWDGAVEDG
                     TESEGEADLGPTSPF"
     gene            complement(494928..495119)
                     /locus_tag="HVO_RS07390"
                     /old_locus_tag="HVO_0560"
                     /db_xref="GeneID:8925250"
     CDS             complement(494928..495119)
                     /locus_tag="HVO_RS07390"
                     /old_locus_tag="HVO_0560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044373.1"
                     /db_xref="GeneID:8925250"
                     /translation="MVSIELSGPILVAAAVLGAVWIYRDAKRRAMDTADMWAVGFFVA
                     FVLLPVLGGLAVFVFYLRN"
     gene            complement(495226..495816)
                     /locus_tag="HVO_RS07395"
                     /old_locus_tag="HVO_0561"
                     /db_xref="GeneID:8924568"
     CDS             complement(495226..495816)
                     /locus_tag="HVO_RS07395"
                     /old_locus_tag="HVO_0561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006824807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15e"
                     /protein_id="WP_004044372.1"
                     /db_xref="GeneID:8924568"
                     /translation="MARSFYSHIKEAWKTPKEGKLAELQWQRKQEWRNQGAIERIERP
                     TRLDKARELGYKAKQGIIVVRVSVRKGGARKQRHKAGRRTKRQGVNRIGRRKSIPRIA
                     EERASRKHPNLRVLNSYGVGQDGSQKWQEVILVDPEHPAIQNDDDLNWICDDTHEGRA
                     FRGLTNAGKKNRGLQNRGKGTEHNRPSIRAGNGRGK"
     gene            complement(496045..497121)
                     /locus_tag="HVO_RS07400"
                     /old_locus_tag="HVO_0562"
                     /db_xref="GeneID:8926188"
     CDS             complement(496045..497121)
                     /locus_tag="HVO_RS07400"
                     /old_locus_tag="HVO_0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease subunit"
                     /protein_id="WP_004044371.1"
                     /db_xref="GeneID:8926188"
                     /translation="MSVISDIAAELAADARTAAMAPVESVKDAKYTLEGIREGRVSPA
                     TVLKTAGITLGAAVVVALLLFPLYWVAVGAFSGTGASLYSSSGIRLWPADPTIEPFLW
                     VIGDLIVPSYRISLGLGGYEVFLQTPELTFLDVSQYGVTETSEFKRFFANSLTVAIPT
                     VLLAMCLIVPSAYALSRRQFIGRSKVLYGYVLFTQIGGGLGVALLIALYALFVQFGFN
                     DSKLALSAYYAATAVPFNTWLLKTYMDGIPVSYEEAAMIDGAPSWKIVTEIILPLSKA
                     GLATVFIFTFLTGWTEFVVAQTLLSTDNYTLPVGLYSLVGRYSIPWARFSAFALTFAA
                     PIMLIYLFAQRYIEGGLSFGGMEG"
     gene            complement(497118..498053)
                     /locus_tag="HVO_RS07405"
                     /old_locus_tag="HVO_0563"
                     /db_xref="GeneID:8925560"
     CDS             complement(497118..498053)
                     /locus_tag="HVO_RS07405"
                     /old_locus_tag="HVO_0563"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004044370.1"
                     /db_xref="GeneID:8925560"
                     /translation="MSVVDSAVERVADSPVVSKDDLPLLLVLPGLFVFLAFMLFPVLY
                     LVYLSFTNAEPATLFQGKEQWVGLANYVTVLSDGQFWNSMGVTWLFVATSVALKVLVG
                     LGIGLVVTGERVRGKRFMRALIIIPLGLPGIFTITIWRGIFSSAEFGLANQFLRMAGL
                     DSIAWLSERWMAFLAYNVTEAWLAYPFMVIITVSALQDVSEELHEAAMIDGAGFFARF
                     LHVTLPSIKRPVLFASILTAAASFQQFLIPYVFNQGGPSRTNELLIVYGYREAFRFQK
                     YGEGAAIMLVAVAVIGVFMMLNVKKGQLADGVDDA"
     gene            complement(498059..499351)
                     /locus_tag="HVO_RS07410"
                     /old_locus_tag="HVO_0564"
                     /db_xref="GeneID:8924886"
     CDS             complement(498059..499351)
                     /locus_tag="HVO_RS07410"
                     /old_locus_tag="HVO_0564"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="WP_004044369.1"
                     /db_xref="GeneID:8924886"
                     /translation="MNRRTILKQLAGTTAVGALAGCVGVSETDSTQTSEQSGAEGDDG
                     SEETTAGAETESAGPSGTFTLWHQRAEAEKEALEANAETFTSETAHTAKPAEIADLRK
                     KTTSAIPAGQGAGMFDWAHDWTGEYYQNGFLSDQSDQLDVDLSVYTRPAQEAVQFDGA
                     TVALPYAAETVGLIYNREMVDEAPETIADMKAIMEEYHDPENWMYGLSYPLNAYFMSA
                     WAHAFGGYYFDESNVELGLSNEATLDGFQFILDNFVPYQPKDTGYDPQAAVFLEGNAP
                     FAINGPWFLGDVRSNDIDAGIARLPSPEGDAEPEPYTTVKQLYFTSTLEGDEATAAAS
                     RAFAEWYTTDTDVLSANAEEFGYIPVHKELASSSDLPEAVQGFSESVSLGTPIPTHPN
                     MGDVWGPLEDAFNSVKNGDAELESAFTKAEENIRSNWE"
     gene            499582..500721
                     /locus_tag="HVO_RS07415"
                     /old_locus_tag="HVO_0565"
                     /db_xref="GeneID:8924256"
     CDS             499582..500721
                     /locus_tag="HVO_RS07415"
                     /old_locus_tag="HVO_0565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_004044368.1"
                     /db_xref="GeneID:8924256"
                     /translation="MARLTLEALRKEYDRGRVVAVEDLSLDVEDGEFITVVGPSGCGK
                     STTLRMVAGLESPSGGTIRIGGEDVTDQHARKRDVAMVFQNYALYPHKTVMQNMAFGL
                     RMSTDLSKDERRERVRETAAMMGIEDLLDDKPDELSGGQKQRVALGRAIVREPDVFLF
                     DEPLSNLDAKLRTTMRTEIQRLQNELGITSLYVTHDQEEAMTMGDKIVILNDGKLQQV
                     GRPKDVYENPANEFVGGFVGSPSMNFLDVSVEREGDRLVLAGDSPFSYRLSESFSATL
                     REATDATDLRVGVRPEDVVTASSGENVVDSTVGVVEPIGSDNYLHLDIGPDFIARVDS
                     DVEPETGETVGVTFDESDLHVFHPRTGESLLSRESKRRAAPTQQA"
     gene            complement(500782..502788)
                     /locus_tag="HVO_RS07420"
                     /old_locus_tag="HVO_0566"
                     /db_xref="GeneID:8926397"
     CDS             complement(500782..502788)
                     /locus_tag="HVO_RS07420"
                     /old_locus_tag="HVO_0566"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044367.1"
                     /db_xref="GeneID:8926397"
                     /translation="MQLRDALADYKRHADHPTRFPGERRTTSGLFSGLGDRLVHVETD
                     GSLRDFGYPLSGLWGVERSRFGVRPVGDDAGVHWFDEGASQSYAGDGALVVTDHETPH
                     GDVTQYDLAIDDGHVSRFETDADVELVAFVHFQPDGRDTLVGQLTHGDAVEAYHAEEH
                     DFLASSPAFEHVEGRVPEGFDELLSEGEVELPRPRTDDCYEEGQLSGAVVGTVPFESG
                     AAAVGHLLTDDTETGREDALDRVRDLVARDLDDLRERAATEVEGAVPDHRESAAMRDD
                     IRVLSLLSGALGLRIAGPDFDPYYAYSGGYGYTWFRDDAEISTFLFESDERLDLGLDA
                     WHERSARAYCRTQREDGSWPHRVWPFDGSLAPGWANARLESGDDADYQADQTGSVIAF
                     LAAYHDRCADDDLRTDIEETLSRALDSLDDTLDDDGLPVDCQNAWENMTGRFSHTAAT
                     FLEAYAALALSGLDSALTDRAASRAREVYEGIDRLWSEGRDCYALRVADGELDDRYDS
                     AALALASAHRTYDRLEAVDDDRLDRLVRHVESVFDGLWHDPDDSEVKGLVRFEGDDWR
                     MREQSSEKVWTVSTAWGANTGVELAALLAAHDDDRAGTFADEGRALLDLVLPDGPLCT
                     DEGYLAEQFFDVGTPDSATPLGWPHALRLATLATLDADGAFDGE"
     gene            502893..505076
                     /locus_tag="HVO_RS07425"
                     /old_locus_tag="HVO_0567"
                     /db_xref="GeneID:8926010"
     CDS             502893..505076
                     /locus_tag="HVO_RS07425"
                     /old_locus_tag="HVO_0567"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_004044366.1"
                     /db_xref="GeneID:8926010"
                     /translation="MHHPGPPRVTTVGRPVELAPRAPERDATYRWRVLDAPAESAATV
                     GSGPVVHLAPDVPGTYHLELDAPDGRHEQTVRAFPDDRRPATMAVPAAALEPASPDEV
                     AVIGPFNDRLVGRDRPRRAGDDYVLDVDLPPGTHPFGFAPHDDLAEQVRGDVEVPGPG
                     RPRVRLDGRVGQENSDDLLVVADAETAPDAEEATLAVEFLFDGRDALDSSDCEVRDDR
                     LRVPVDTLRGVDSSEPVRVHAVAVQTTAESGESGEPYVRHSVLDTLVVDPGVVADEPG
                     SGLAVSRPADAPEWAHHATVYEVFVRSFAGETPDPTFDELARRVPYLESLGVDCLWLT
                     PILESHTTHGYHVTDYFDTASDLGSREDFEALVERCHDAGIRVVFDLVINHTSRDHPA
                     FQFHSTGVPGYEDHYARVPEREDPSEVDWGGPGAAEHYFNWTRIPNLDYDSPAVRSWM
                     LDVVTEWAAVVDGFRCDVAWGVPHGFWKEVRERVKADDPDFLLLDETIPRDPAYHETE
                     FDAHYDTTLYGALRAIGAGERPATALLDAVADARWHGFPDDAVQLRYIENHDEERYRS
                     AVGDDALRAAAAATFTLPGAPMIYYGQETGVADRRGTMRWYDADTDLVDFHRRLSRLR
                     DAHEALRAGDVEPVSASVAPAGDDGVEADRVVAFARDDGTDRLVVVLNFDGEPTTVEL
                     GAETAEIDLLTGERVGASGAAAGDGGVRVTVADAVVLRAIGDSSH"
     gene            505103..506152
                     /locus_tag="HVO_RS07430"
                     /old_locus_tag="HVO_0568"
                     /db_xref="GeneID:8925142"
     CDS             505103..506152
                     /locus_tag="HVO_RS07430"
                     /old_locus_tag="HVO_0568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_049914894.1"
                     /db_xref="GeneID:8925142"
                     /translation="MDDRELADLLEQFGLSEKVVDTYLTLLELGEAKASQIADAAGVS
                     KRYVYSVSKELESRGFVEVNDHVVPTTIRPLPPMEVIESLSESVESMRPALEERYTAT
                     ARDQERFEVIKSRVTVLKRIGELVGRAESEITLSLPYDVLDEVEDELRAARERGVLVS
                     LVVSGVEPHDDLALDGVASLVRVWHELMPTMLTVDSRTGLISPGEMVARSNSESQAIV
                     FAQPHLGPVIVGSFFGNYWPMAAEAYTTDPDPLPAMYHNFRHAVLQAALCERAGIDLD
                     VTVSGRMVHTDGPTELHGRVVDIRQGLLEPANNSFPVENAFVVETDEGTYSIGGQGAF
                     VEDFEADAVEFTAAE"
     gene            complement(506363..507274)
                     /locus_tag="HVO_RS07435"
                     /old_locus_tag="HVO_0569"
                     /db_xref="GeneID:8924712"
     CDS             complement(506363..507274)
                     /locus_tag="HVO_RS07435"
                     /old_locus_tag="HVO_0569"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="atypical protein kinase"
                     /protein_id="WP_004044364.1"
                     /db_xref="GeneID:8924712"
                     /translation="MVRNVAGVMAELEPEDFYLLSGVEQGMRFSEWVNREKLPKNSGL
                     TAEEVDYRIDRCMTRELVERKTIQYVGYKLTVEGYDALALRTFAQRDTIQGFGAPLGV
                     GKESDVFEVQSFKPLALKFHREGYTNFREVRRERDYTSENHHVSWLYTARKAAEREYE
                     ALETLFPEVSVPRPVDHNRHAIIMAKFDGVELAKAKLESEQVTGVLDLILSEMADAYA
                     AGYVHADMSEYNVAVGERGVTVFDWPQAVPTDHDNARELLARDAKNIVGYFRRKYPGE
                     MPDEVDIDALSDAIAGNEFESVDEFAV"
     gene            complement(507810..508865)
                     /locus_tag="HVO_RS07440"
                     /old_locus_tag="HVO_0570"
                     /db_xref="GeneID:8926822"
     CDS             complement(507810..508865)
                     /locus_tag="HVO_RS07440"
                     /old_locus_tag="HVO_0570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_049914893.1"
                     /db_xref="GeneID:8926822"
                     /translation="MNVSRLVSAGSLSLTGVALFVVVSNSVASVASDLAGLVAAAFGL
                     IISVLFVAVGPVVYRSDLKTSHVARVAGWNLLGVAVTVFVLALIGSYQQAAGGTVSEP
                     LFSAAVVVGVSAVAHVLIGLNDVRRIRTRELSEQYKRSAVINRLVRHNLRHTAQLLLG
                     WGDRLATDGGDDETVRIGQRLKATGDDLGTMSDQVKTVTQLVDNDHGGETVDLRELLD
                     PLVDDRSAANPEATITVRGDGSAAVVGGKKLQIAFREIVDNALEHAGSAPTVEIAYER
                     VGSEVVVRIADDGPGIPDHQRELIEQNVEESDLAHGNGLGLWLSKWIVEAYGGELHLP
                     PTDDGEGAVVEFHLDAA"
     gene            complement(508914..509564)
                     /locus_tag="HVO_RS07445"
                     /old_locus_tag="HVO_0571"
                     /db_xref="GeneID:8926411"
     CDS             complement(508914..509564)
                     /locus_tag="HVO_RS07445"
                     /old_locus_tag="HVO_0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008608721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family protein"
                     /protein_id="WP_004044362.1"
                     /db_xref="GeneID:8926411"
                     /translation="MKFTRVALAATDPISLCEFYVETLGFAAVPGSQRSATAGETTLW
                     FELGDTDPGHLAFTVAAAVDSVVAWLDDRAGVDVLDTDEGPSVRFDFLGCDSVYFEDP
                     EGNVIEYVCYDGDATGEFDPATDLRGATEVGMAVPDVASFVASLTEALGIEPLESFEG
                     GDLVFVGDRDARFVVSPVGRPWYPTDSEATVGPVSAQCDADGVFDPEGLPYRVNAE"
     gene            509723..510550
                     /locus_tag="HVO_RS07450"
                     /old_locus_tag="HVO_0572"
                     /db_xref="GeneID:8926318"
     CDS             509723..510550
                     /locus_tag="HVO_RS07450"
                     /old_locus_tag="HVO_0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoate--protein ligase family protein"
                     /protein_id="WP_004044361.1"
                     /db_xref="GeneID:8926318"
                     /translation="MNDSQGSIADREWRVIREEVRPGPMQMALDEVAGETAAAGGPRT
                     VRVYSWVPSCLSLGYGQDPETVDWDYCDREGIDVTRRQTGGGGIYHDRHGDVAYSIAA
                     PKSELPGDLMDCYHLLCEPILDAIRAVGVDVNFVDDDVPVIWHPACYLRALHPAHDMV
                     AAGRKVAGNAQYRRRDAVVQHGSLTYSVDAETHLGVFEGHDVTPEAFRERVVGIDELA
                     DASREAFVAALTESLSEFVDAEEGAWTDDELDRAREKVDEKYRADDWVRRRPGSRSD"
     gene            510605..511480
                     /locus_tag="HVO_RS07455"
                     /old_locus_tag="HVO_0573"
                     /db_xref="GeneID:8926690"
     CDS             510605..511480
                     /locus_tag="HVO_RS07455"
                     /old_locus_tag="HVO_0573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007982468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease IV"
                     /protein_id="WP_004044360.1"
                     /db_xref="GeneID:8926690"
                     /translation="MQVGAHVSMSSSKVSSDDETPPHGNVANAVFRQVAFGGNCGQIF
                     TTSPQVWRDPDISDEEAELFREQTADKLSGPWVIHSSYLVNLCTPKDGLRQKSLDSMQ
                     TEVDMADKLGIEYVNVHLGAHTGAGEQQGLDNAVSVLDDLDIPDGVTVLIESDAGSGT
                     KMGDDLAHLGYVLEESDQDLDVCLDTAHAFAAGYDLSTAEGVDETFAELDAEVGLEHL
                     KCVHLNDSKHECGTNKDEHALIGEGLIGEEGMRAFINHDAIVDDDVPLVLETPTEDGK
                     GFAWNIERVRELRAD"
     gene            511607..512362
                     /locus_tag="HVO_RS07460"
                     /old_locus_tag="HVO_0574"
                     /db_xref="GeneID:8924826"
     CDS             511607..512362
                     /locus_tag="HVO_RS07460"
                     /old_locus_tag="HVO_0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_049914898.1"
                     /db_xref="GeneID:8924826"
                     /translation="MWDDSRAALGDLDLGGRTRILDVGCGTGEFTRVLAEASEARVVG
                     VDADTDLLSVASDRDSDIETVAGDATRLPFAAGSFDLVVCQALLVNLPDPTAALSEFA
                     RVSSDLVATVEPDNAAVGVDSTVESEAALDRRVRDAFRDGVATDVALGDRVRGLFDDA
                     GLSVVGTRRYHHRKLTEPPYDDHDVRSAAKKATGEGLDRHEADLRRGLDDDSYESVRR
                     EWREMGREVVQQIRDGEYRRAEVVPFDVTTGRV"
     gene            complement(512426..513064)
                     /locus_tag="HVO_RS07465"
                     /old_locus_tag="HVO_0575"
                     /db_xref="GeneID:8925043"
     CDS             complement(512426..513064)
                     /locus_tag="HVO_RS07465"
                     /old_locus_tag="HVO_0575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="WP_004044358.1"
                     /db_xref="GeneID:8925043"
                     /translation="MNVLLLGASGRIGTRIANELLNRGHAVTGVSRSGEIDGVDDPDF
                     SAVAGDATDADQIARLAAGHDAVASALGPSDDESPEVLVEMLDAVVDGMRRASVDRLV
                     WTGGAGILNVGPDTRLIDSPEFPEEWKPVASAAIEAYGLLEDADDLEWTYVAPAAFIE
                     PGERTGEFRTARGELVADEDGESRISMEDFAIAFADELESGDAVHEQLAVGY"
     gene            513213..513560
                     /locus_tag="HVO_RS07470"
                     /old_locus_tag="HVO_0576"
                     /db_xref="GeneID:8925872"
     CDS             513213..513560
                     /locus_tag="HVO_RS07470"
                     /old_locus_tag="HVO_0576"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004044357.1"
                     /db_xref="GeneID:8925872"
                     /translation="MSPHQNLEAKYEQCPVIKTLEEIGSRWRMTVIHVLREGDLRFNE
                     LKRATGANSQTLSRVLDDLQELGYVEREVEDGSPIAVYYSLTQKGEELLPAFDDISEW
                     GEKWMSEDGGAES"
     gene            complement(513578..513793)
                     /locus_tag="HVO_RS07475"
                     /old_locus_tag="HVO_0577"
                     /db_xref="GeneID:8926668"
     CDS             complement(513578..513793)
                     /locus_tag="HVO_RS07475"
                     /old_locus_tag="HVO_0577"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044356.1"
                     /db_xref="GeneID:8926668"
                     /translation="MSPPPSADRDGCPKCGHSETEIDSIATTGGGLSKMFDIQNRQFT
                     VVSCANCGYSELYRGQSSGNFVDLFLG"
     gene            513869..514150
                     /locus_tag="HVO_RS07480"
                     /old_locus_tag="HVO_0578"
                     /db_xref="GeneID:8924582"
     CDS             513869..514150
                     /locus_tag="HVO_RS07480"
                     /old_locus_tag="HVO_0578"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044355.1"
                     /db_xref="GeneID:8924582"
                     /translation="MSVGGLVFFLFALLSIGAAVALYAGIQAETRDPPTMSREEAERR
                     ARDEGRRYNEQRGRGTDRRPSGGGRGDEFDPDADRTDDRGRNRDGDRDW"
     gene            complement(514211..514855)
                     /locus_tag="HVO_RS07485"
                     /old_locus_tag="HVO_0579"
                     /db_xref="GeneID:8924722"
     CDS             complement(514211..514855)
                     /locus_tag="HVO_RS07485"
                     /old_locus_tag="HVO_0579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044354.1"
                     /db_xref="GeneID:8924722"
                     /translation="MDRDAALDRVDAVVDAVESETLPVPVREVWVYGDVALGLDPLDR
                     LDVYVTKDILLRGDPDAAESFERSHGVKGVGKSVRAEWAREHPDLLRANANGYAAPEK
                     CLAAHLLPDEEPVHLEVCNASFEDNVTQRLKGAVEREAYEQILDPRGVCLYADGQRSS
                     DAMSKLRNGEFAFPTLSGALEMLGLEDDDAETAVEAMRAYRAEQTGTSVRGDVV"
     gene            514996..515961
                     /locus_tag="HVO_RS07490"
                     /old_locus_tag="HVO_0580"
                     /db_xref="GeneID:8925285"
     CDS             514996..515961
                     /locus_tag="HVO_RS07490"
                     /old_locus_tag="HVO_0580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008323118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR00269 family protein"
                     /protein_id="WP_004044353.1"
                     /db_xref="GeneID:8925285"
                     /translation="MECDKCGRDAVMHAAYSGAHLCDDHFCASVEKRVRRRIREDNML
                     PRDASPENPQTWVIGLSGGKDSVVLTHILDDTFGRDPRIELVALTIHEGIEGYRDKSV
                     DACVELAEDLDIHHELVTYEDEFGVQMDDVVEKDPENMAACAYCGVFRRDLLERFADE
                     LGADKLLTGHNLDDEAQTALMNFFEGDLKQVAKHFDASIGDFEKRRDAGEFIPRAKPL
                     RDVPEKEVALYAHLKDLPAHITECPHSSEAYRGEIQQLLLKLEENHPGTRHSIMAGYE
                     ELAELTAREYRGEGRVDLNDCERCGSKTAGDVCRKCRLIESIEAV"
     gene            complement(516141..517343)
                     /locus_tag="HVO_RS07495"
                     /old_locus_tag="HVO_0581"
                     /db_xref="GeneID:8926446"
     CDS             complement(516141..517343)
                     /locus_tag="HVO_RS07495"
                     /old_locus_tag="HVO_0581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_004044352.1"
                     /db_xref="GeneID:8926446"
                     /translation="MQDIVREAMERDEAERQTQSSLEDSDDQFGDPRIVIVGAGGAGN
                     NTINRLYNIGVEGADTVAINTDKQHLKMIEADTKILVGKSLTQGLGAGGDPSMGERAT
                     EMAQGTIKDVLGDADLVFVTAGMGGGTGTGAAPVVAKIAKEQGAIVVGMVSTPFNVER
                     ARTVKAEEGLENLRNEADSIIVLDNNRLLDYVPNLPIGKAFSVMDQIIAETVKGISET
                     ITQPSLINLDYADMSTIMNQGGVAVMLVGETQDKNKTQEVVNDAMNHPLLDVDYRGAS
                     GGLVHITGGPDLTLKEAEGIASNITERLEAAANVIWGARIQDEYKGKVRVMAIMTGVQ
                     SAQVLGPSTQKQADKSRQSIQSRESQQQHSGSEFDSSERAQTAQSGTWSDGGRDEVEK
                     NNGLDVIR"
     gene            complement(517346..517531)
                     /locus_tag="HVO_RS07500"
                     /old_locus_tag="HVO_0582"
                     /db_xref="GeneID:8924276"
     CDS             complement(517346..517531)
                     /locus_tag="HVO_RS07500"
                     /old_locus_tag="HVO_0582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012659761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="WP_013035353.1"
                     /db_xref="GeneID:8924276"
                     /translation="MERVTLRIPKQQIEEVERMVETGEFPNRSEAIRSAVRDMLNEQV
                     TDKRQRESTSKRGWAKV"
     gene            complement(517744..518328)
                     /locus_tag="HVO_RS07505"
                     /old_locus_tag="HVO_0583"
                     /db_xref="GeneID:8924725"
     CDS             complement(517744..518328)
                     /locus_tag="HVO_RS07505"
                     /old_locus_tag="HVO_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribbon-helix-helix protein, CopG family"
                     /protein_id="WP_004044350.1"
                     /db_xref="GeneID:8924725"
                     /translation="MSKITFRADDALVERLDRLDTSKSEVMREALRQYLDELERDDGA
                     DDTAGLDGALSARVEELVDERLDERLPALVEEAAAARESERPTPSDLNVNINVDGSNG
                     ESRVNAGVDTESTPSTVRKTRDELESGDADDPDMTCGQCGESVGPDHVYCPNCGEKTS
                     HRVFCECGDELRSDWAFCPDCGRRTPAADVLEQA"
     gene            518441..518514
                     /locus_tag="HVO_RS07510"
                     /old_locus_tag="HVO_3027"
                     /db_xref="GeneID:8925416"
     tRNA            518441..518514
                     /locus_tag="HVO_RS07510"
                     /old_locus_tag="HVO_3027"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:518475..518477,aa:Tyr,seq:gta)
                     /db_xref="GeneID:8925416"
     gene            518847..519830
                     /locus_tag="HVO_RS07515"
                     /old_locus_tag="HVO_0585"
                     /db_xref="GeneID:8926859"
     CDS             518847..519830
                     /locus_tag="HVO_RS07515"
                     /old_locus_tag="HVO_0585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_004044349.1"
                     /db_xref="GeneID:8926859"
                     /translation="MDSRPLGTTGFDVSEIALGTWQLGGSWGSVTNDEAYDAIEAALD
                     AGIDFLDTADVYGDGDSERRIGDVLADRDDDVTVATKAGRRLDPHEADGYNRENLERF
                     VYRSRDNLGVDSLDLVQLHCPPREVYYQPEVFDALSELRDAGKIDHYGVSVEKVEEGL
                     KAIEYDGVETVQIIFNPLRQRPAELFFREAARRNVGVIVRVPLASGLLTGALSADAEF
                     AENDHRNFNRHGEAFDVGETFAGIPFEDGLEAADSIQEVVPEGVSLAQFTLRWILSFD
                     AVSTVIPGSKTPEHIRDNVAAASLPPLSADQFERVEEVYNAYAREHVHHRW"
     gene            519896..520531
                     /locus_tag="HVO_RS07520"
                     /old_locus_tag="HVO_0586"
                     /db_xref="GeneID:8925470"
     CDS             519896..520531
                     /locus_tag="HVO_RS07520"
                     /old_locus_tag="HVO_0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_004044348.1"
                     /db_xref="GeneID:8925470"
                     /translation="MAVTFDLFGTLVDAEYPSDPGSAVADALREYGVAVPDDWDDAYR
                     EVHIDAPEGAEVPLPAHVAAALRSRGVDSPDNAARRAVITAFDPEVTTRPGAVDAVAA
                     AREAGAVGLLSNCSVPELVARTLIRSDLDRRGFDDITTSVACGWRKPHRQAFEAAARG
                     LGVDAAELLHVGDDPDADGGIEAVGGRFVNLRETTLESVAARLRAGEDPCP"
     gene            520522..521430
                     /locus_tag="HVO_RS07525"
                     /old_locus_tag="HVO_0587"
                     /db_xref="GeneID:8926385"
     CDS             520522..521430
                     /locus_tag="HVO_RS07525"
                     /old_locus_tag="HVO_0587"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CobD"
                     /protein_id="WP_004044347.1"
                     /db_xref="GeneID:8926385"
                     /translation="MPVTAAAAVVAAAALDRGFAEPPARVHPVALLGRLVSPVDREWS
                     RPTLVGAVAAVALPALAAGVTAAVTWAATLVSPWLGAAVAALALFSTTSLRMLLDAAA
                     AVVSATADESDLDTARYELRALAGRDPSSLSAADIRSAAVESAAENLADGLVAPLLAF
                     MLFAAVSLPLAVGAAAWVKGVNTLDSMLGYRHKPVGRVPARLDDAVMWLPARVSAVLL
                     AVVAGAPATVARVGELARRPSSPNSGWPMATLAVLLETRLEKPGHYLLDGGPEAPDAA
                     TAARGVRLVSRAGLAAFAVAGVVAWF"
     gene            521421..522185
                     /locus_tag="HVO_RS07530"
                     /old_locus_tag="HVO_0588"
                     /db_xref="GeneID:8924146"
     CDS             521421..522185
                     /locus_tag="HVO_RS07530"
                     /old_locus_tag="HVO_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylcobinamide-GDP ribazoletransferase"
                     /protein_id="WP_004044346.1"
                     /db_xref="GeneID:8924146"
                     /translation="MVLTALRGALGFLTRLPVGGDESNWDAFRRAPVAFPLVGYVVGA
                     LAALPLLLPLPIPTAAALYLVTLYLVTGVTHADGLADLGDAAVVHGDADRRLSVLKDS
                     QTGVGGLLAFGLTLVVLALGAFGLAGAGGRVGLTAAVAIALAAEVGAKAGMATLVCLG
                     APAHEGLGSALVGENSSAGLLAVAVACLPVVALAPVTGGPAVVAALCCGPVVALLVRS
                     WGRARLGGVSGDLLGATNELARAAAVHAGVVTWTLS"
     gene            522185..522778
                     /locus_tag="HVO_RS07535"
                     /old_locus_tag="HVO_0589"
                     /db_xref="GeneID:8925851"
     CDS             522185..522778
                     /locus_tag="HVO_RS07535"
                     /old_locus_tag="HVO_0589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008612345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP--adenosylcobinamide-phosphate
                     guanylyltransferase"
                     /protein_id="WP_013035517.1"
                     /db_xref="GeneID:8925851"
                     /translation="MCGGRGTRLDAPVEKPLVDICGRPMLDRVAAALRDSSVETVRAV
                     TSPHTPNTRDRAADLGLDPIEAPGDGYVSDLGFALARVSRPVVTVVSDLPLVAPEHVD
                     AVVSAADGGAATACVPVELKRDLGASVDDALVFDHEGTAVCPTGLGVVGPAAADATID
                     TDADTDTHSTMYLSTDTRLALNVNRPTDIELAEDRCE"
     gene            522769..523836
                     /locus_tag="HVO_RS07540"
                     /old_locus_tag="HVO_0590"
                     /db_xref="GeneID:8925846"
     CDS             522769..523836
                     /locus_tag="HVO_RS07540"
                     /old_locus_tag="HVO_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="WP_004044344.1"
                     /db_xref="GeneID:8925846"
                     /translation="MRVVLVAGTTETAKIPGISAAGAEPSLVGHTPSADAEIIEYGEP
                     VRSPVTPVSPTGCPTPAAVTRAVKQLTGFDVLTVDAGLAKPSAAPTIDVGARPGRDIR
                     ESEPVPTAPGAFEAARRMGLALPEDELVIGETVPGGTTTALAVFRALGEEFPVSSSLP
                     DNPTSLKEEVVAEAFEASDVEPGFAAHKPRRAARYLGDPVLPVVAGLTVGALENGTDV
                     TLGGGTQLLAAAALARHAGANGDLTLATTSYLAEDVPELADAAEAFDLELTVTDPGFE
                     THPLDRYAAGEAKEGAGMGGALMLADRMGVLDDVEAATLDVLSTLDPEAVETGTGTAA
                     ADAGGADAGGVDADADIDDGP"
     gene            523826..524848
                     /locus_tag="HVO_RS07545"
                     /old_locus_tag="HVO_0591"
                     /db_xref="GeneID:8926507"
     CDS             523826..524848
                     /locus_tag="HVO_RS07545"
                     /old_locus_tag="HVO_0591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine-phosphate decarboxylase"
                     /protein_id="WP_004044343.1"
                     /db_xref="GeneID:8926507"
                     /translation="MDPESVRAGSRVPHGGTTDPTVLDFSANTNPERPDGVEAVYREA
                     FDASTRYPDDDYADFRAAAGDYVGCVPEAVVPTAGGLEALRLAFEVTLSPGDTALVPE
                     PSFGEYDREIRLQGAEPVAVAHDAILDADPADHAVAVVCTPNNPTGELAPADDLRAFA
                     ARCREADTVLVVDEAFLDFTDEPSLAGEPGVVVARSLTKMFGLPGIRAGFAVATGDLG
                     DRLAVARRAWSLSTPAAAVGAYCMDDAEFVSRTRARVSAERERLRETLSDAFAVSPSD
                     APFLLVDVGDRDVDAVVETARDRGVAVRDATTFPTLDSHVRVAVKRPDENDELLRALA
                     AVADDV"
     gene            524841..525578
                     /locus_tag="HVO_RS07550"
                     /old_locus_tag="HVO_0592"
                     /db_xref="GeneID:8924577"
     CDS             524841..525578
                     /locus_tag="HVO_RS07550"
                     /old_locus_tag="HVO_0592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylcobinamide amidohydrolase"
                     /protein_id="WP_004044342.1"
                     /db_xref="GeneID:8924577"
                     /translation="MFETARRDGVCRLARPGTRWLSTGYAGGDSRADAAFNITVPEGW
                     PETDLDAYVERRLSAAGFDERGPTLLTGVGQEHARRARFGPVEVVATAGVSNPAELPI
                     DDDPREWGDASDAPDAAAGDDRDDRDDPVGTVNVFVGTTRSLEPGALANLVAVAAEAK
                     AATLLARCGAPGTTTDAVVAACDPAGDPATFSGSATEVGNAARVCVRDAVLASLGSRY
                     DAGPISQGVDEANYGVVADDRATVAPI"
     gene            525678..526691
                     /locus_tag="HVO_RS07555"
                     /old_locus_tag="HVO_0593"
                     /db_xref="GeneID:8925931"
     CDS             525678..526691
                     /locus_tag="HVO_RS07555"
                     /old_locus_tag="HVO_0593"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class I/II-fold pyridoxal
                     phosphate-dependent enzyme"
                     /protein_id="WP_004044341.1"
                     /db_xref="GeneID:8925931"
                     /translation="MDPGSVSDVDHVTHGGTADHSLVDFSTGSNPEHPSGLAGVYESA
                     LATARRDSLDDYSRFRVAAAEFVGCNPDEAIPAAGVIEALRLAVGVTVSPGDSVALPA
                     PCCGEYAREIRLQGGDPVHVPHDRLLETVDPAEHAAVILSYPANPVGTAYPRDELRAF
                     IDDCRRADTPVIVDETYLGFTRLPSTAGLDGVIALHSVTNVFGVPSLRAGFAAATGDL
                     GDRLSRARCTWVLSAPAVEVATFCLEQEAFLEATRNRVERERPRVIAGLDRLGYDPHP
                     ADSALVLFRADDVDCVLRETRRRGFAVRDARDYQGLDSHVRISVRRPDENDRLLDALA
                     EAS"
     gene            527070..527843
                     /locus_tag="HVO_RS07560"
                     /old_locus_tag="HVO_0595"
                     /db_xref="GeneID:8924097"
     CDS             527070..527843
                     /locus_tag="HVO_RS07560"
                     /old_locus_tag="HVO_0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_004044339.1"
                     /db_xref="GeneID:8924097"
                     /translation="MVEAFAVASGKGGTGKTTSTLALGMALAEEYDVTVIDADTGMAN
                     LLFHAGLDDADVTLHDLLIDDHDAAVSDAVYERFGLSVVPCGTSLAAFEAADPGRLRD
                     VVAELAADTDVLLLDSPAALGSKSAVLPVVLADRIVVVLQPTVPSLSDGLKVQEYAHS
                     YGTDTAGVVFNRVRPDENVETIAEQAGRYFGGQTLASVPESDAVRAARREGKPLLAHA
                     PDDPAADAFREAAARLDVREGDGREVAERFKSAVVPERI"
     gene            527840..528424
                     /locus_tag="HVO_RS07565"
                     /old_locus_tag="HVO_0596"
                     /db_xref="GeneID:8924960"
     CDS             527840..528424
                     /locus_tag="HVO_RS07565"
                     /old_locus_tag="HVO_0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044338.1"
                     /db_xref="GeneID:8924960"
                     /translation="MRIPRGELRRSRVVDDAAAVLRTVLDEELTGYVVFEPQDALLLG
                     ETTRGVVTFEDGVPVLAYDTEREVGGRDGLEGFAVTGPTRAAVHAVDAAELADAHEVE
                     AFRVPPGEPARVLAGDERLATKTLDAAPAARREESRDQSAVEAFLADADAIEEIRSEA
                     REEARARASEWGLDDVLADDADESAAIDAGPDSR"
     gene            528489..528956
                     /locus_tag="HVO_RS07570"
                     /old_locus_tag="HVO_0597"
                     /db_xref="GeneID:8924991"
     CDS             528489..528956
                     /locus_tag="HVO_RS07570"
                     /old_locus_tag="HVO_0597"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family peroxiredoxin"
                     /protein_id="WP_004044337.1"
                     /db_xref="GeneID:8924991"
                     /translation="MSTEKSQTRNQTLTFAVAAAAESPTETRVSVRDFEFVVDEPESL
                     GGANAGPNPVEYVLGALAGCLNVTAHVVAREMDLDVRDLEIAIEGDLNPATFMGKRED
                     GRAGYQEIRVAVTADVDADAETIDAWLAAVEARCPVSDNLRNATPLALSFDRR"
     gene            529064..529795
                     /locus_tag="HVO_RS07575"
                     /old_locus_tag="HVO_0598"
                     /db_xref="GeneID:8926526"
     CDS             529064..529795
                     /locus_tag="HVO_RS07575"
                     /old_locus_tag="HVO_0598"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044336.1"
                     /db_xref="GeneID:8926526"
                     /translation="MTVLRLLRLRRPADFADWYRIGAEYVHDVAAGMGFRVGDFESRV
                     VRATDAMRAGRTDLPPDLARSVAADLLADAAFCDPFCQWMPLWYELGLAAPCAYADYR
                     LRRVAEQYADDLPHLSVPRFSRPEDVYVDGRPATACVDGFAERFVLADAVLHLEWFVY
                     VARESGIFVPPLLVERTREQTVAYYAGRREELDPDVRSFQRLLFSDDEWVRRIADVYD
                     LDSVLFDYWERILAQERRRLSTFDG"
     gene            complement(530034..530474)
                     /locus_tag="HVO_RS07580"
                     /old_locus_tag="HVO_0599"
                     /db_xref="GeneID:8924479"
     CDS             complement(530034..530474)
                     /locus_tag="HVO_RS07580"
                     /old_locus_tag="HVO_0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ester cyclase"
                     /protein_id="WP_004044335.1"
                     /db_xref="GeneID:8924479"
                     /translation="MASASAPTPTGNERIARRSPEEVASEGNVGLIDEICAEDVLDHS
                     PLGEVRGRDELKAQISGLKESFSDFSATVEDAITEGDTVAMRVTLRGTHDGAFMGIEP
                     TGKPIEVGNMVFTRIEDGVIAERWVQPDMLGMLTQLGAVEPPTA"
     gene            531046..531579
                     /locus_tag="HVO_RS07585"
                     /old_locus_tag="HVO_0600"
                     /db_xref="GeneID:8925348"
     CDS             531046..531579
                     /locus_tag="HVO_RS07585"
                     /old_locus_tag="HVO_0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044334.1"
                     /db_xref="GeneID:8925348"
                     /translation="MSEVHNDVQAYTLRLELVDEPGELLRSLQPIAERGGNLLSIFHE
                     RGNVTPRGYIPVEVDIEATPDRFDNIVEGLSDAGINVIQAGTERYSERLTIIFSGHLI
                     ETDLSDTLTQIEATRNATVTDISLSAPAGSIDVSSARFQLAAESGSTEDVLSAMRDIA
                     DEKDLQLVEPLTVGGRA"
     gene            531576..532526
                     /locus_tag="HVO_RS07590"
                     /old_locus_tag="HVO_0601"
                     /db_xref="GeneID:8925304"
     CDS             531576..532526
                     /locus_tag="HVO_RS07590"
                     /old_locus_tag="HVO_0601"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_004044333.1"
                     /db_xref="GeneID:8925304"
                     /translation="MRLCVLGAGAVGSAVVELAAEHGHVVTAFADSDSAVVDADGIDA
                     DAVLSKKREDGVVGDADPESVFDADYDVLVEATPTTLGDAEPGFSHVERALADDRHVV
                     LANKGPVAERYADVRALEADSEGTVRFGATVGGALPILSTIEDVGPSRVSAVYGVLNG
                     TANFVLSRMAAEGLDYEHVLAEAQDLGVAEADPAFDVDGTDTALKGVIVANVLAEGET
                     EFTLDDAEVEGIQELSGGMLDLAQEDGQTIRLIVEVADGSVRVGPRLVSANGAVAPSG
                     AENAVQIEADYCGRLGITGRGAGGPETASAVLTDVERLAD"
     gene            complement(532608..533282)
                     /locus_tag="HVO_RS07595"
                     /old_locus_tag="HVO_0602"
                     /db_xref="GeneID:8925405"
     CDS             complement(532608..533282)
                     /locus_tag="HVO_RS07595"
                     /old_locus_tag="HVO_0602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008578422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I 3-dehydroquinate dehydratase"
                     /protein_id="WP_004044332.1"
                     /db_xref="GeneID:8925405"
                     /translation="MADLIEFRMDQADDPLEQLAAYDGELPIIATNRARWFGGKASDT
                     GRLDDLFSASRYDAVEFVDIELETVRAKEWLAHEFRENDVQLIISHHDFDETPDREVL
                     DAIIEQCAEFGDVAKVAVYPQNQRDTLTLLEAVNDATNRGIDVAGISMGELGSHTRVI
                     GHLYGSKLGYAPLLADDNDYAPGQIPLEKLASLIELTKNERVDGQVIDTIRSEVSVPK
                     ELTLSD"
     gene            complement(533893..534561)
                     /locus_tag="HVO_RS07600"
                     /old_locus_tag="HVO_0603"
                     /db_xref="GeneID:8925313"
     CDS             complement(533893..534561)
                     /locus_tag="HVO_RS07600"
                     /old_locus_tag="HVO_0603"
                     /EC_number="4.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I 3-dehydroquinate dehydratase"
                     /protein_id="WP_013035589.1"
                     /db_xref="GeneID:8925313"
                     /translation="MAANAYALAGVTETLTEAAAAEGIADYVEFRMDGATTPLDALDE
                     YDGSVPLIVSNRPEWAGGTAAESDRLETLAAAAAFAAVEMVDVELRTIRECGWLRDEL
                     REQDVELIVSHYDRHKKPQKTELLQIVSECNNYGDVAKLVVTAEEKTDSLALLQSFNT
                     ASERGMRVTGYALGEIGRHTRVIGVFYGASIAYAPIVSDERAPNDIDLEKLSYLVEWV
                     SAAR"
     gene            534891..535787
                     /locus_tag="HVO_RS07605"
                     /old_locus_tag="HVO_0604"
                     /db_xref="GeneID:8926291"
     CDS             534891..535787
                     /locus_tag="HVO_RS07605"
                     /old_locus_tag="HVO_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007975828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_004044330.1"
                     /db_xref="GeneID:8926291"
                     /translation="MVTQQVLVTGPFGEAGEAILNHLAERDEYEFTYLDRTEHPEYET
                     FVADIADYEAIRPAFDGQDAVIHLAAQSDAGAAFEDIIEPNIMGTYNVLKAMEDAGVE
                     KLIYASSQRVMGLYEEDLAPDLYEEDYPSEYDPLRFTHETLPKPDGYYGASKMFGEHI
                     CRTHARRDGAPSQVYSIRISSVRTEQYDHPYGDAERGVDRGDEHKVEDGEVWDQSQTG
                     SWERGSDEYEEMVKRLKATWTSQRDFAHLLECCLEDDSVTYDTFYAVSGNKARWFDTD
                     HAKAVLDYEPADDGSEWDSPPE"
     gene            complement(535848..536621)
                     /locus_tag="HVO_RS07610"
                     /old_locus_tag="HVO_0605"
                     /db_xref="GeneID:8924145"
     CDS             complement(535848..536621)
                     /locus_tag="HVO_RS07610"
                     /old_locus_tag="HVO_0605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_004044329.1"
                     /db_xref="GeneID:8924145"
                     /translation="MTNSTGSGSRRIQSVEQAFDIIRYLREVDGATLSETAEDMELPV
                     STAHIHLATLVDTDYVVKVGSEYHCSLRFLEMGGAMRDGMALYRVAKPELDELKEQTG
                     EHTNVTVEQNGFAVQLYKAQSPESIDDDAPLGDHLYLHSTATGKAMLAKHSRDEVDRI
                     VDRRGLPALTDDTITDREALHEELEAIRDRGYSINRGEHYPGVCAVGTAIVSEPDDAV
                     GAISISGPMSRIEDGRIEEELGPALLNKKNIIELKIKQY"
     gene            complement(536843..537532)
                     /locus_tag="HVO_RS07615"
                     /old_locus_tag="HVO_0606"
                     /db_xref="GeneID:8925013"
     CDS             complement(536843..537532)
                     /locus_tag="HVO_RS07615"
                     /old_locus_tag="HVO_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxy-4-hydroxy-2-oxoadipate
                     aldolase/oxaloacetate decarboxylase"
                     /protein_id="WP_004044328.1"
                     /db_xref="GeneID:8925013"
                     /translation="MHTIEPDVERPDRELVEAFEEIPSTIVSDVTGNIGLTMDAGLRP
                     AYDGVEMAGTAVTVKAAPGDNLIIHKAITLTEPGDVLIIDCDGYTDTGHVGELMCTSC
                     QANGLAGLVIDGAYRDSREIAEMEFPVYGRGVNPQGPLKQDPGSVNVTVSVGGVSVDP
                     GDIVIGDDDGLAVIPRRGAEEVLERAHEKLSTEDSVREEVLKGEYLYELNGYDELFEN
                     LTIVGPEDSIH"
     gene            complement(537737..538747)
                     /locus_tag="HVO_RS07620"
                     /old_locus_tag="HVO_0607"
                     /db_xref="GeneID:8924985"
     CDS             complement(537737..538747)
                     /locus_tag="HVO_RS07620"
                     /old_locus_tag="HVO_0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter substrate
                     binding protein"
                     /protein_id="WP_004044327.1"
                     /db_xref="GeneID:8924985"
                     /translation="MGDDTISNRSGRSALNRRNFIKAAGVGGVALSAGCLGSLSGEQE
                     WPSRPVEVISPWSAGGGADRTSRAVADAAENHTDVSWNVSNQTGGSGSVGMNAAANAE
                     PDGHTIGCTAPEIALFEHLGIADLSPDDITPIMQYTEFPAALVVSEDAEFSTLDEWIS
                     YGQDNTLQMANSGFGSSWHMAAAGIASEAGVNVEHISYEGAAPAMTAVVNGEVDCTAV
                     GAAEVAPQVQDGGLSALGVAFDQQVEALPNTPTLQDQGLDISIGSWLAHFAPAGIDDE
                     LKQQLADVYSAVYEDDSFVEFMENNNFIRVERGPDELQDFLDQQYEFYGNLVDELGIE
                     EQ"
     gene            538994..540037
                     /locus_tag="HVO_RS07625"
                     /old_locus_tag="HVO_0608"
                     /db_xref="GeneID:8925803"
     CDS             538994..540037
                     /locus_tag="HVO_RS07625"
                     /old_locus_tag="HVO_0608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007258344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_004044326.1"
                     /db_xref="GeneID:8925803"
                     /translation="MRGLAKTSREPGAMELVDVETPEPASNEVLIEVDYAGLCGSDAG
                     IYKFKSAFERMEMPTIIGHEYTGRVVERGEEASRFSVGERVVERPIRGCGECFQCQIG
                     EESICQDAVLTGIDLDGAYAGYIAVPESALQSVPSNVEPKHAALVEPTAICTRAVIQN
                     SRVKAGDRVLVAGPGPIGLLCAQVAASQGAEVVVAGVGRDTNYRLPLAEELGYPAVNV
                     EEDDLSATQRELTGGVGFDVVFDTTGHPSGLPMAVEQVRKGGQIVLVGQTGETTMEFT
                     PLVRAEVDLQCTYGATFEDFERAFRLIGSGDVDHATFLDDRYRLTESEDAFEAFLAGE
                     TCKPVFDVSVLRE"
     gene            complement(540257..540904)
                     /locus_tag="HVO_RS07630"
                     /old_locus_tag="HVO_0609"
                     /db_xref="GeneID:8926618"
     CDS             complement(540257..540904)
                     /locus_tag="HVO_RS07630"
                     /old_locus_tag="HVO_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_004044325.1"
                     /db_xref="GeneID:8926618"
                     /translation="MSVSNATEGIDQIQFDHVRVLVLKDTPTGKTTLVDTGFDEDGEE
                     LVEILEREYGGVDRVIITHGDHGHHGGLPSVMEAFDPELVASANESKLHEAIDYEPDV
                     TFTDGDLLDGNIRVIEVPGHTKATSALLLEDRGILISGDALDGADRAGLPAGYLLPPP
                     ALFNDDHKAAEINLYDLLQYDFETLLVFHGSHVFEDPKGKLDDFLVEREWDPRPE"
     gene            541192..541707
                     /locus_tag="HVO_RS07635"
                     /old_locus_tag="HVO_0610"
                     /db_xref="GeneID:8924501"
     CDS             541192..541707
                     /locus_tag="HVO_RS07635"
                     /old_locus_tag="HVO_0610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite tricarboxylate transporter TctB
                     family protein"
                     /protein_id="WP_004044324.1"
                     /db_xref="GeneID:8924501"
                     /translation="MVIQKVGAVLDRIGLESVRSSPLSVFFILFSVVVVFFASQFPSG
                     DGVGPSFFPIAVSVGIIFFAGIDVLTGSETELEISEFDFKPAAVVAGFLVAYVLVMPH
                     LGFLVSTMVFMPVVLYYSNIHSKLLLAVLSIGFPIALFYIFGRIFLVRLPEGIIPVSR
                     LLPQLPLAVTF"
     gene            541707..543194
                     /locus_tag="HVO_RS07640"
                     /old_locus_tag="HVO_0611"
                     /db_xref="GeneID:8924547"
     CDS             541707..543194
                     /locus_tag="HVO_RS07640"
                     /old_locus_tag="HVO_0611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter permease"
                     /protein_id="WP_004044323.1"
                     /db_xref="GeneID:8924547"
                     /translation="MVVEYIGQALVNLADPFILLLMVGGIFLGILMGSIPGMTATMTI
                     AVLLSFTFTMEPSQGMILLLGIYGGAVYAGSIPAILIRTPGTPSAAATIFDGHPLSQK
                     GEAGRAIRVSTIASFVGGVISVFALMFFSPVIADAALRFRSPEFFALAFFGLTIIVSV
                     SGDSLTKGMVSGLLGMLVATVGIDPVTGFHRFTFDIPELLTGVEFIAVMIGLFGIAEG
                     LRKYSQGINSGNDRVDQEITGVFPSLSDLRSIAPVSVGSGILGSFIGAIPGAGGDIAA
                     FITYNEATRWLKDSVPSFGEGNVRGVAAAESGNNASTGGALIPTLTLGIPGDSVSAIL
                     IGALLVHDVNPGPGLYQEEPVLLYTIFVGFLLIYVFILIFGMLGANYWARLINIPKSH
                     IWPVILVLCVIGAIALRGNVFDAWIMLGAGVLGYAMRLRGYPLAPMVLGLILAPIAEE
                     NLRRSLVLSGGSPTIFLTSPIALVIILLGLGAIALPAVRSIRANA"
     gene            543730..544161
                     /locus_tag="HVO_RS07645"
                     /old_locus_tag="HVO_0612"
                     /db_xref="GeneID:8925393"
     CDS             543730..544161
                     /locus_tag="HVO_RS07645"
                     /old_locus_tag="HVO_0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_004044322.1"
                     /db_xref="GeneID:8925393"
                     /translation="MVVVAAVDRSGRSAHVVSEAASLAAAFDEAVHVVHALTRSEFID
                     LGLTSAQAEEPKDMDEIRSAAAEMAEDSVSGLDVPYETVGLVGNPADEVIEYADGQDA
                     SYIVVSPRRRSRTGKMLFGSVAQSILLNASCPVVSTLADEE"
     gene            544323..544943
                     /locus_tag="HVO_RS07650"
                     /old_locus_tag="HVO_0613"
                     /db_xref="GeneID:8925076"
     CDS             544323..544943
                     /locus_tag="HVO_RS07650"
                     /old_locus_tag="HVO_0613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004973096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_004044321.1"
                     /db_xref="GeneID:8925076"
                     /translation="MYTIQFDHVRVFVIEDRPAGTTTLVDAAFPDDGHELVSVLESEF
                     GGVDRLVITHGDEGHFGGTPAVLDAFDPELLVPGGAKGFYDALDIEADRHFRHDDVLD
                     GGIRIVQVPGHTVANNGLLLEDDGVFIAGDVVEGSDRRGLPPGFLVPPAAQFNDLSHE
                     EAERNLVKLFDYDIETVLVSHGTHVDDDPLGKLDDWLIDRQWTLSY"
     gene            complement(545379..545921)
                     /locus_tag="HVO_RS07655"
                     /old_locus_tag="HVO_0614"
                     /db_xref="GeneID:8926419"
     CDS             complement(545379..545921)
                     /locus_tag="HVO_RS07655"
                     /old_locus_tag="HVO_0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044320.1"
                     /db_xref="GeneID:8926419"
                     /translation="MNRFSRGSSDAAASGDDRGQLVLVSGAVVVVALLTLLVVHAQLG
                     FAGVTETAEAPPLDDIVETTEDAVELATAGVAGRYDWAERDAAVADFRSRLNPALTNV
                     ERARPGGVALTTNDSAASGWALRNCPDGPSREFGPCVADDGVVVQERAGETTVVAVLV
                     DVRIATPRSRTDLTVAARPN"
     gene            complement(545918..546391)
                     /locus_tag="HVO_RS07660"
                     /old_locus_tag="HVO_0615"
                     /db_xref="GeneID:8925588"
     CDS             complement(545918..546391)
                     /locus_tag="HVO_RS07660"
                     /old_locus_tag="HVO_0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044319.1"
                     /db_xref="GeneID:8925588"
                     /translation="MRDRRGERSRRLRRHCAAADSTRTDDRGQLSLTVVEAVVATLFV
                     LAVAAGFALAPPAPTAESDALARQATDAASLVGSVPAEGPGTLLGVACGSPAEFDDRA
                     ARLHEVAAAGLPNGAFVSLRTEVGSVGRPPPETARVRTATAVVPRCTATLEVWYP"
     gene            complement(546384..547079)
                     /locus_tag="HVO_RS07665"
                     /old_locus_tag="HVO_0616"
                     /db_xref="GeneID:8924751"
     CDS             complement(546384..547079)
                     /locus_tag="HVO_RS07665"
                     /old_locus_tag="HVO_0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044318.1"
                     /db_xref="GeneID:8924751"
                     /translation="MRSHGAARAQTTLAGLAVALVLVTAVTVGGVAAADRVLADAAGE
                     SLEQHRAESAADALLTESPITRSDNGSDAVDLTLANETNATVLAAAVPPLRGAAFRVR
                     IDGRTVAERGDPSSGYTVSRGAVGVNRRTVRRSINLSAEPNTTLTGRTNRTRLDVNPA
                     PNTTVQTIWVDDRVALHQPAGIEGQHVVGVSSRPDHEVRVETTGDEPSGSVDVSATAF
                     DATVVRIEVTVDA"
     gene            complement(547072..547644)
                     /locus_tag="HVO_RS07670"
                     /old_locus_tag="HVO_0617"
                     /db_xref="GeneID:8923891"
     CDS             complement(547072..547644)
                     /locus_tag="HVO_RS07670"
                     /old_locus_tag="HVO_0617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044317.1"
                     /db_xref="GeneID:8923891"
                     /translation="MADASEPSSVAPDDSGPVTPGTGGRAAERAVVPVVGKALEAAIV
                     VLFVGLLTTVLFGGVVPDHRAAVGHELADRTLAAATEQVETTAVVPESAVRGSRRVDA
                     ALPRAIRGSSYRIAYVPNATLATDPNVTAPALVLDHPNDAFDRRLPVTLPDSVSVSGA
                     WDSGNDCVVRVVVDDDDGTTLELANGRADA"
     gene            complement(547637..548350)
                     /locus_tag="HVO_RS07675"
                     /old_locus_tag="HVO_0618"
                     /db_xref="GeneID:8924735"
     CDS             complement(547637..548350)
                     /locus_tag="HVO_RS07675"
                     /old_locus_tag="HVO_0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044316.1"
                     /db_xref="GeneID:8924735"
                     /translation="MSATRGQANVVGVALLLGVGVVAIGLLTASVGGLVDAQIASADA
                     DAAADGFSSFRDGVVAAANDSYPVRVTDGDLSRVNRTVRITSETRPTRTYDADGYVAD
                     LGGHRVAFVGGAVVRGTGDSAALVTPVPVAFAGDAAFLTVPVLTADATDGGGLGSGAA
                     LRTQTTRTVTDRPADGYAVAVETATPDAWERAFERRGFNTTRTDFDGDGTESVVATVP
                     DERTLTVARYDVSVVIDRG"
     gene            complement(548347..550266)
                     /locus_tag="HVO_RS07680"
                     /old_locus_tag="HVO_0619"
                     /db_xref="GeneID:8923877"
     CDS             complement(548347..550266)
                     /locus_tag="HVO_RS07680"
                     /old_locus_tag="HVO_0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004044315.1"
                     /db_xref="GeneID:8923877"
                     /translation="MTEFDAGADERRVGRVRSLSVLDRALYALFARHVDAGRHDRDRR
                     RYRGTDMRMSFDLYLARAYGLAWATGLFVAFPTALVALAVPDSTVDAVLDVLRAALPL
                     FEHVPIPVVPRLPVVGAFALAVAVATRRVVLAVAGQYLGWLATARRENIERTLPGAVR
                     YLHVLSSGSDGPRGMLRRVAETDAYGETAIAFRSVLNTASLTGNVNEGLRRVARDTPS
                     EGMLAPFLLKFREHAGQGSDALRNYLRMESRMLGHRQDRARERAEGFLELLAELFIVL
                     LVLPSLLVIVLTVMSVIAPGLSAPVATPLGQTTTRGVVVYSSAAFIVGVGLGASVLVA
                     GLRPPDQSVEYDRPAGALRVLDSTLSNPASAAAVFVFSGLVVAGVAAFVGADAVGVAL
                     AGYVAYAAPVGLVGVRRARLDDAKDRELKDFVHAVSGHVNLGRPFGEAVERVGRDVDL
                     GPLDADVADLALNLRFTAPSSGTDVNLRTAALARFVDRVGTPMAEQTIGLVVGALDGG
                     SDTGTVFDTLQTEIGRLYHEKRALRSGLLVYVAVGWTTALLVVGITVAVNVHVFDGFA
                     QLSTLSTGRSFAINAGAVDLERDRYRMYVVTQATMLASGWFAGTASRGRYEALLHSAA
                     LVVACYLVYAGVGLI"
     gene            complement(550263..552629)
                     /locus_tag="HVO_RS07685"
                     /old_locus_tag="HVO_0620"
                     /db_xref="GeneID:8926831"
     CDS             complement(550263..552629)
                     /locus_tag="HVO_RS07685"
                     /old_locus_tag="HVO_0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system protein"
                     /protein_id="WP_004044314.1"
                     /db_xref="GeneID:8926831"
                     /translation="MPTQGDNAGSESPTPTLEFGASSTSGAAGAVPAPVPPDDPRAWY
                     APTVRSQYEVAPDTVVTISDADHGFDYAVREATLGARETDALETVRDHFSTVVRRRPL
                     TREGAVSRAETGLSPKYRRIFDRLLDLTPTARRRVERHALSELRLLGAVTPLALDDRI
                     EVVDAGRGDGSERLVVHTEDFAPATTTFDSDVSFADRIAAERIDHYTVPFAGYDVDVV
                     IYRDRLLGDDRFATKYAVLEPDLVPGDAELIEECKERIWEANVNDVVADRIEFVRDRA
                     REFLSRRLTARNTRAWVDATSFRVRAALSEYGLALPPVDRRFAEDRLDDLVYYVLRDY
                     VGEGVLTVPIRDPHLEDVEANRVGERIKVIPRADVTGHGGLRVPTNLVFEDETEFTNV
                     VTQLAAADGVELNASNPSAKVNLRPGAVGGDPASADTDETIRCAVALPVISEGGPHVS
                     IRKQTGDVLTPVDLVESGSVSTELVTLLWLCYEHHRVVLFSGATGVGKTTLMNAHMPF
                     VPYDHRPISIDEGSREVHLPHETGVSLTTRDHESEFKRVTMADLMTEANYLNPDVEVI
                     AEINTPESFATFAETLNTGHGVIGTTHAADIETLVNRVIEQGLPPYLLRELDLVVFPH
                     KVDGERYVSEVVELVPESEYDETWGRRGVIEKDGRTLHWNTVGRRTPDGSFDLSYEHP
                     QLGDDHRRVGVRLFHRIAEATDRDVEAVEREFHRKHRYVEYLVREQITDVDRLFGFLS
                     DLRTDEAATVERVRRRMAERDSADGDSAARGGVDDHTHHRDRDDEADP"
     gene            complement(552851..554632)
                     /locus_tag="HVO_RS07690"
                     /old_locus_tag="HVO_0621"
                     /db_xref="GeneID:8925940"
     CDS             complement(552851..554632)
                     /locus_tag="HVO_RS07690"
                     /old_locus_tag="HVO_0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008578416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="WP_004044313.1"
                     /db_xref="GeneID:8925940"
                     /translation="MTPNIEWRAVEQLVFGGAVGPQLLTQPVSLVVIIIGLMVTSGVV
                     SGYVALFAWQRRSMPGAIGLGVLALASGWWSSGYLLELIVADVALKLTLADLQWVGVL
                     VAPIAWFFFAFSYAGRDRFTARPSLCVLSVLPVIGLGAVWTNSLHHLMWTSVTVVPAV
                     GRAITILQMEWGPLYWVVLGYSYLLWLAGAVVILRTALDMPDIYRLQAITLVLGTLMP
                     VLGNFATTLLELYGAAIDMTPAAFTFAGLACTVAISRYELLESRPVPRWVARERVVET
                     MADAVVVTDTKWRVTDVNRAAARVLNDTADELKGRPVGDVIDEFSPDQRDTDQVTVRL
                     GSSQRYFELRTSAFCDHHGRDIGHALVFRDVTDRRLNLQQLEVMNRVLRHNLRTEANL
                     LEGYANLVLDDIDGGEFDDARDHAKTLQDHAKTLVNISQKARKLGVTRGSDGNGDVQL
                     HPAAVQIRAAADAVRTDFACANVRLVELPDRDVVCAPTLEPIVRELVENGVQHNGSST
                     PVVSVTAGWEDDELVIRIEDNGPGINASELAAIDAHGETQLRHASGLGLWLVKWGVDQ
                     LGGTVVFHRREEGGTEVVLRIQAVRSE"
     gene            complement(554747..555640)
                     /locus_tag="HVO_RS07695"
                     /old_locus_tag="HVO_0622"
                     /db_xref="GeneID:8925125"
     CDS             complement(554747..555640)
                     /locus_tag="HVO_RS07695"
                     /old_locus_tag="HVO_0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ubiquinone biosynthesis protein UbiA"
                     /protein_id="WP_004044312.1"
                     /db_xref="GeneID:8925125"
                     /translation="MRIVPTRLYGAVVHSSVFLGASTIAEVFVASALAGIGPNVALAV
                     GFLITVGIYNFDKLADLDADEENYAERTAFVAAHPRLYAGFSTLAVVGALWLAVRHGG
                     VYGLGLTLFPGVVAVFYSAPVVPLPSVDRLKDIFLVNTASVSLAWAVLVGFAPLAVAA
                     TAPEYAAGAAVAAVWFFLRSAISVEVHNVRDVAGDAQNGVETLPTVIGVRRTQLSLYA
                     LELVSVGLVWVAARAGVVPAWAPFALLPAVAYSTWITYALTETDRSIERLCTLRDAEG
                     VLMAVGVAVVAAAVGTGGTLA"
     gene            555767..556195
                     /locus_tag="HVO_RS07700"
                     /old_locus_tag="HVO_0623"
                     /db_xref="GeneID:8924864"
     CDS             555767..556195
                     /locus_tag="HVO_RS07700"
                     /old_locus_tag="HVO_0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035499.1"
                     /db_xref="GeneID:8924864"
                     /translation="MKIPTAERAETAATGETAATAERVETTVEVKLTGHVRSAAGTHR
                     TEFTFEGETLRAFLEAFFAAYDVRDLVIAEREADATTRGWARVDRPPGTWRKNPEGEQ
                     TQPYARVLVNGVFNENLDGFDTRLEDGDRVALMKPFLYCV"
     gene            556293..556805
                     /locus_tag="HVO_RS07705"
                     /old_locus_tag="HVO_0624"
                     /db_xref="GeneID:8925694"
     CDS             556293..556805
                     /locus_tag="HVO_RS07705"
                     /old_locus_tag="HVO_0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044310.1"
                     /db_xref="GeneID:8925694"
                     /translation="MASTPADDSTRERGPGEAFCRDCGAVIDARAEICPECGVRQRDP
                     PKSSVDSALDDLFEGGNPFVAAVLSAVFPGLGQLYNRELERGLVFAVGFLVATASVMV
                     LIGFFLAPAVWLYAVYDAYTRAELRAEELQRESGRDRETEVSVSEAAGDEAADHEEVD
                     DEETDDDREE"
     gene            complement(556841..557266)
                     /locus_tag="HVO_RS07710"
                     /old_locus_tag="HVO_0625"
                     /db_xref="GeneID:8926490"
     CDS             complement(556841..557266)
                     /locus_tag="HVO_RS07710"
                     /old_locus_tag="HVO_0625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_004044309.1"
                     /db_xref="GeneID:8926490"
                     /translation="MELAEVDSAALFGLITMVTWGIWIVVGNAASESMDPRTAAAISY
                     LVAALLAFGFIVVSDASLVVTARGGLLAGVAGLCTGVGLISMYIGFTHGSTTVVSTLG
                     AMYFVVAAVIGVVVLGENLTVTKLTGIAFAVLGIVLVTR"
     gene            complement(557375..557884)
                     /locus_tag="HVO_RS07715"
                     /old_locus_tag="HVO_0626"
                     /db_xref="GeneID:8924497"
     CDS             complement(557375..557884)
                     /locus_tag="HVO_RS07715"
                     /old_locus_tag="HVO_0626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044308.1"
                     /db_xref="GeneID:8924497"
                     /translation="MEEHPLSDEPGTWETVVAECESLADDYRERDWTVVVALPGDVVP
                     VPAAGDEVVEHVGLDVVVGDDVYPDLEAAVEGATFDEYEAFRAVSGGLVYLALVVRAT
                     DDEVAVCLPLYYRLAESERMFSLLDGGETMRTKVHPLDPDKGVEFIHEDPNPLLPPDW
                     DADLSDEFA"
     gene            558052..560748
                     /locus_tag="HVO_RS07720"
                     /old_locus_tag="HVO_0627"
                     /db_xref="GeneID:8925303"
     CDS             558052..560748
                     /locus_tag="HVO_RS07720"
                     /old_locus_tag="HVO_0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007544984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_013035311.1"
                     /db_xref="GeneID:8925303"
                     /translation="MRNLLSLSDLRTQFSTGRGQVKAVDGLDLTVGEGETVGLVGESG
                     SGKSVTALSAMGLVDDPGEIVSGSVELESGRLAEEFREEYNNPAFVDGDVVNLVDAPE
                     EALRAVRGRELGMIFQDPMTSLNPSLTVGEQVAESLRLHQYGGRRKDSWFNAVRELLP
                     RISRDIDDEIVERTIEVLESVGIPEPGARVDEFPHEFSGGMRQRVLIAIALACQPRVL
                     VADEPTTALDVTIQAQILDLIDDLQEDLGMSVLMITHDLGVVAETCDRVAVMYAGEIV
                     EEGPVEEIFHNPSHPYTYTLIESLPSEDKERLTPIEGNVPDLIDMPEGCHFAPRCPWA
                     QPECTSGEIPYKQHGDDEVDHRSKCVLDDFDTSEYGGDAIEASTGTEPSDTPLLEVDG
                     MQKYYEQADGILDRFFGADDRSVKAVDGVDFTVYEGETLGLVGESGCGKSTAGRSLLH
                     LTPPTGGRVVFSGTDLSGLDSDELRAMRRDMQMIFQDPMSSLDPRMTVGQAIREPLDV
                     HDLPESDPNVRGEADVTVTGIDAERVSVTASDEIDAIVGSSNGVATAAVTVTVADGEV
                     DVAVEERLRTEVEVEREGDVVSGVTVRVTPGDSTSERRRRRVRQLLDAVGLEPGQYDR
                     YPHELSGGQRQRVGIARALAVDPDFIVADEPVSALDVSVQAQILNLLEDLQERFGLTY
                     LFIAHDLSVVRHISDRVAVMYLGEIVEVAATDELFDDPRHPYTQALLSAIPEPDPAAE
                     TDDRIILEGDVPSPINPPSGCHFRTRCPQVIPPADLDIEQAAYREVMDLRQRVEREAL
                     DVETARDAALDAGDPSAEAAVSADGGTADAVVDELRESHLSHSLSPELRGVVDRALER
                     VVADDWDEAGEILRERFESVCERDAPELGEQTHPAACHLVDE"
     gene            560896..562620
                     /locus_tag="HVO_RS07725"
                     /old_locus_tag="HVO_0628"
                     /db_xref="GeneID:8924465"
     CDS             560896..562620
                     /locus_tag="HVO_RS07725"
                     /old_locus_tag="HVO_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004044307.1"
                     /db_xref="GeneID:8924465"
                     /translation="MSQDGNDVSRRRFLTAAGAAAATAGLAGCSGGGGEDTTTESDET
                     TGEGETDQTETETEDGGSTPVLRYGRGSHSPTLDFQNSTSGEVAKVTEQLYDTLINFE
                     PGQSTLTQGLATEYSLEGQSASITLREGVMFHNGEEFTAEDFVATYRRFVDSDYEYYA
                     GDDYVSAYGPFTLGSWIDEIQVDGDYSMTIQLTQSYAPFLRNLAMFAASVHSLAAIEE
                     YGTELSSNPVGTGPFQLSNLDDANERVRLEANSEYWGEGPNVDEVVFVTIGQNSTRAQ
                     ALASGELDIIDGLGAQSSVQVENASNANLVRTEGINIGYMAFNMASREEFRDRRVRQA
                     VSHAINTEAIVNEIYSGFATQASQPLPPNVLGHNDDIDPYPYDPEEAQRLLEEAGYGD
                     GFSFELATFQNPRGYNPSPIQTAETVASNLGEIGIEVDINQQSFGPFLEYTAQGRHDA
                     CFLGWYTDNADPDNFMYVLLHPQVEEGELTEGQDWVSFDAEGYNTSNRSAWANRDYMD
                     LVEQGQSTYDEAERESLYNEANQIAHDEAPWVYLDYADELRGVSNRVSGFQIAAISGP
                     YLNLVSLN"
     gene            562646..563665
                     /locus_tag="HVO_RS07730"
                     /old_locus_tag="HVO_0629"
                     /db_xref="GeneID:8925387"
     CDS             562646..563665
                     /locus_tag="HVO_RS07730"
                     /old_locus_tag="HVO_0629"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004044306.1"
                     /db_xref="GeneID:8925387"
                     /translation="MISTRFVLKRLLLLVPVLVGVASLVFSILHLSPGDPALTIAGER
                     ASEEFVRQVEESLGLNDPIWVQYGRFLADAAQFQFGESFIIQRNTTVREVLANKLPVT
                     LELALYGQLIGISLGIPLGILSAVKQDSITDHLTRIGALAGISVPIFWSGPLLILLFA
                     QVLGWLPTSGRISVLYNVEAIRVTGLVTVDTFLAGNWDMFVSAVRHMILPASVIGVYS
                     MALISRMMRSSMLEVIRQDYMRTARAKGQGAKITVLKHGFRNAMIPVITVIGIQFGGL
                     LGGAVLTETVFAIGGIGTLLVEAIKVGDYPIVQGTVLTFAFLFTLVNLGVDITYSILD
                     PRIEQ"
     gene            563662..564597
                     /locus_tag="HVO_RS07735"
                     /old_locus_tag="HVO_0630"
                     /db_xref="GeneID:8924676"
     CDS             563662..564597
                     /locus_tag="HVO_RS07735"
                     /old_locus_tag="HVO_0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004044305.1"
                     /db_xref="GeneID:8924676"
                     /translation="MSTESTTTNETATDVDQRGLVDRLTASPFVSRLLSNRLALAGIA
                     IIVAMVVIALYARLFLDLEVITQSQLGTNPNRAPPSLDYPFGTDGQARSLLPRVAYGA
                     WYAMLFGTVTVAASTVLGVGLGIVAAYYGDVTDNVIMRTMDVLLAFPSLLLALALVAI
                     FPDDLGLWRAVAALTLVYTPRFARVVRGAALTVLENEYIDATVALGAADPRVLVRHVL
                     PNCLAPITVQSTLNFGLAIIDLAALSFLGFGAAAGTPSWGLMLSNGVSQGLLTGVWWW
                     SFFPGFFLALTVLGFNLLGDGMRDALDPRMREAVD"
     gene            564604..564999
                     /locus_tag="HVO_RS07740"
                     /old_locus_tag="HVO_0631"
                     /db_xref="GeneID:8925589"
     CDS             564604..564999
                     /locus_tag="HVO_RS07740"
                     /old_locus_tag="HVO_0631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044304.1"
                     /db_xref="GeneID:8925589"
                     /translation="MSAPPDPTDAASPPVLERAATRLRLVGTAALAGALAVAVWLVAR
                     LVVGDFSASVETTFAVGSLAFGFGLLGWSGAVALGRGIESMQAHLDTGAGWTEADARR
                     AMARVLGFGLGVMLGATAVGSVASVFVAA"
     gene            complement(565023..567599)
                     /locus_tag="HVO_RS07745"
                     /old_locus_tag="HVO_0632"
                     /db_xref="GeneID:8926454"
     CDS             complement(565023..567599)
                     /locus_tag="HVO_RS07745"
                     /old_locus_tag="HVO_0632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain S-box protein"
                     /protein_id="WP_004044303.1"
                     /db_xref="GeneID:8926454"
                     /translation="MTVSEDASRNGARSARDASDEERILLAVRGARDRELLAGLLDAH
                     EVVVWERGREDEPQLPEFDLCIVDMATYSAVADALDERKADAGDRFVPVLLTVTQDEQ
                     RVAARRLDDVPDDVLAVPAPSAVIRSRVESLLQTRRQSLQLALYRRAMDSATVGITIT
                     EADDDQPLTYVNDAFEEMTGYDRSEVIGRNCRFLQGDDTDPEAVETLHEAVDAGESAA
                     VGLTNYRKDGTPFWNDLKISPVYDDGELTHFVGFQTDATVRHALRNQLVNETQTLKQL
                     FETSPVGIVVLNEDEIIMRANESAQEILGLGRSVVLGQPYDAPEWELVGERGEPLDRG
                     GLPFERAREAGETVKGFEHGIEVGGDRRWVVVNAASLTGSGGECIGVIAVIEDVTEVK
                     RQQRDRERLLDLFDQSQKIASVGAWEFNTRTGEVLFTSGLAELVGVDSRETFDLEEAF
                     AFYHPEDEPEARAAFGRLVATGEEQSVECRLETMDGETRWVNVRGVAARETDAAVYRG
                     TVQDITERKARSEELERYERIVETTADPIHTLDDNLRFVLANSATADLLDCDPGELTG
                     EHVSAVFGERHAQALLEAIASLLSGDSAEETIETVVVDRGGAERQFQTTIAAKSSGGE
                     FDGIVCVGRDVTELRERERRLSVLDRVIRHNLRNKMNIAQAHAAMLLEAADDADVRES
                     AAAIERAADELLSIAETARKFSSALDPDVTERVQPQNVADRVRSVVEGAQLSYPGVTI
                     TVDAPENVRALAHATFELAVNELVDNAVAYGGDDVEIELSVAEADGAEQVTVRIADNG
                     PGLPALERESLMSGRESPLRHTNGLGLWFVRWTVTNSNGTMEIRDNEPSGTIIELRLP
                     KA"
     gene            complement(567596..569050)
                     /locus_tag="HVO_RS07750"
                     /old_locus_tag="HVO_0633"
                     /db_xref="GeneID:8924791"
     CDS             complement(567596..569050)
                     /locus_tag="HVO_RS07750"
                     /old_locus_tag="HVO_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_013035296.1"
                     /db_xref="GeneID:8924791"
                     /translation="MTNLPPRLSTGVSGLDAVLDGGLVPNRTYMVRGESGAGKAIAGY
                     HFLTAGRENDEDVLFISFEESNADLRANAGTLGFDLSEVPVLDLSPSPEAFLDDEAYT
                     MLSPSEVEGKSTTTELKEVIEEHHPDRVVIDPLSQLGRLSSDEYQFRRLVSSLLSYLK
                     RSGATTLFTSQPSSGGTDETLAYLCDGSISLSRSDWGRSVRIEKFRGSDSQTGPHAMR
                     IDGGHGMRVFPRLVPDSHHHEFTIEPLSSGIDDLDALLGGGIERGSITLVSGPSGVGK
                     STTGAAFARATAERGERAAVYLFEESKRSFRHRSESVGIPIDDLVDSGNLRVDAVEPL
                     SLSTDEFAQRVRAEVEANDTKFVLIDGTAGYQLSLTDERSDIRRELHALARYLKNMGV
                     TVVLTEEVQQVTGAFHASDNHVSYLADNILFIRYIEVRGEIRKAVGVLKKRFGGFEPT
                     LRSFEIGRDGITVGEPLDELRGILTGTPTWNEAE"
     gene            complement(569203..570429)
                     /locus_tag="HVO_RS07755"
                     /old_locus_tag="HVO_0634"
                     /db_xref="GeneID:8924378"
     CDS             complement(569203..570429)
                     /locus_tag="HVO_RS07755"
                     /old_locus_tag="HVO_0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_004044301.1"
                     /db_xref="GeneID:8924378"
                     /translation="MRRFERKQNVFTNKDALGESYKPERIEERDDEISEYMDALQPVV
                     DGWEPNNVFLYGNTGVGKTAVTEFLLEMLLEDVSQYDDVDLSVISINCKTLNSSYQVA
                     VELVNELRPPGAVISSTGYPQQTVFKKLFQELDDVGGTVLIVLDEVDSIGDRDELLYE
                     LPRARSNGKLEDAKVGLIGISNDFKFHDQLDPRVQDTLCERELHFPPYQAPELQNILE
                     SRAEVAIAEDACEEGVLNLCAALAARDSGSARQALDLLRLAGEHAENKDDERITLDHV
                     DIARQKLEQERVVEGMRELTENGHFALLAVVSKAAHDETPCRMRDLYQEYLRLCNSAG
                     IDPLAQRSVHNHLSDLRMLGILSAEENRTGSRGNYYSYALDVPFSSAMEALSDVLALD
                     SVLDEIRKTATQAEAA"
     gene            571195..572157
                     /locus_tag="HVO_RS07760"
                     /old_locus_tag="HVO_0635"
                     /db_xref="GeneID:8926510"
     CDS             571195..572157
                     /locus_tag="HVO_RS07760"
                     /old_locus_tag="HVO_0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4129 domain-containing protein"
                     /protein_id="WP_004044300.1"
                     /db_xref="GeneID:8926510"
                     /translation="MDRSALRALALALLAVVALSVVAATIDSTVVSSGGPVGFGGGET
                     GGAVAGDTDETGTQPSGDSSGSLSIPTPCFPWLLSPGVLAVVALVFVLLGAYAYRETG
                     SLLPPLAIFAAVGPPVVLLFALLTGCRREFSFSSRAAAAARNVSFLPAGGGGSLGQGG
                     NAAQSVSPPTVLFGLLLAVALAVAAFMLVTGTGDSPAADDEVTPADEDEGSNVAAVGR
                     AAGAAAQRIEDGDADVENEVFRAWGEMTALLDVPNRRAATPAEFAHSAVDAGMDRDDV
                     DDLTTLFEEVRYGGFEATPERERRAVDALRSIERAYADSPEGDR"
     gene            572154..572726
                     /locus_tag="HVO_RS07765"
                     /old_locus_tag="HVO_0636"
                     /db_xref="GeneID:8924945"
     CDS             572154..572726
                     /locus_tag="HVO_RS07765"
                     /old_locus_tag="HVO_0636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044299.1"
                     /db_xref="GeneID:8924945"
                     /translation="MTLTRRLFLLVGVVATTAGLAVVAGVSFGLELTDIFLGLVAALA
                     ALQGLRYVQRRRDTPSNTTVTDDPEARISVPVPGADFDDDLVSAMGQGTRWAARERVV
                     DRLETRAKEALVASGGHAPEEAAALLKTGGWTDDPVAARFLGASVSIPLRQRVRLFLS
                     GRSSLTDRAERAVAAIEQVGTTDGPAGERR"
     gene            572723..573991
                     /locus_tag="HVO_RS07770"
                     /old_locus_tag="HVO_0637"
                     /db_xref="GeneID:8924089"
     CDS             572723..573991
                     /locus_tag="HVO_RS07770"
                     /old_locus_tag="HVO_0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF58 domain-containing protein"
                     /protein_id="WP_004044298.1"
                     /db_xref="GeneID:8924089"
                     /translation="MSRGFDTERWTGLDGLVLVAAAAGVFTRESSLLLAAGLGVVVLG
                     YVRVAAIPEVSLRIERDLSDATPDPDDEVEVTLRVTNEGSSTLFDLRVVDGVPPALGV
                     VDGSARLGTALRPGATTTATYTVTAVRGEHSWDETVVVVRDPSGAVESRETVDAETTL
                     RCEPELAATADLPLRGLTSKYAGRVETDVPGSGLEFASIREYRHGDPIRRIDWNRRAR
                     TGELATVEFREERAASVVLVVDTRSEAHVAPDDEGETAAERSVDAASVAFSALLDGGD
                     SVGVAAFGPDECWLAPSSGVDHRARARRLFATHPAFAPTPPDGAFFTSVAVRRLRRRL
                     ASDAQVIFCSPLVDDYGVSVARRLEAYGHAVTVVSPDPTTTSTVGARLARIERDLRLR
                     ELRRSGLRVVDWGDESLGVALARAEAGWSR"
     gene            573979..574485
                     /locus_tag="HVO_RS07775"
                     /old_locus_tag="HVO_0638"
                     /db_xref="GeneID:8924651"
     CDS             573979..574485
                     /locus_tag="HVO_RS07775"
                     /old_locus_tag="HVO_0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044297.1"
                     /db_xref="GeneID:8924651"
                     /translation="MVAVSEITRQPTRTGTALALSAAGFAILALGFTTSTAAVGGLAA
                     TVALAAGLVRGSRRIVDAAGGLFFLSLLFAGASGAGTEALLLAAVGSILAWDLADNAR
                     SVGAHLGRETDTLRLELVHAAATLVVLAVGAAVVYGADRAAAGGQPITAVVLLLVGVV
                     ALVAVVAR"
     gene            complement(574519..575469)
                     /locus_tag="HVO_RS07780"
                     /old_locus_tag="HVO_0639"
                     /db_xref="GeneID:8924193"
     CDS             complement(574519..575469)
                     /locus_tag="HVO_RS07780"
                     /old_locus_tag="HVO_0639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_004044296.1"
                     /db_xref="GeneID:8924193"
                     /translation="MDIDTASETCSEVLDAISEAVIADRAFLETVLTGVLARGHVLLE
                     DVPGTGKTLTARSVATALGLSFSRVQFTPDLLPADVTGTNIYDERERTFEFSPGPIFA
                     NVVLADEINRAPPKTQAALLEAMEEGQVTVDGETHQLPSPFFVIATQNPVEQEGTFTL
                     PEAQVDRFVVKSAIGYPDLDGEVELLHRRAGRSDQSPSVERVLDRDAVAAIRRAPESV
                     RVEDDLLEYMAKLARETRTDRRVRIGVSPRGTQRLFEATRARAVIEGREFVTPDDVKR
                     VAQSVLAHRLVLTPDARVEDVRKSDVVDDVLGRVTVPTLE"
     gene            575668..575752
                     /locus_tag="HVO_RS07785"
                     /old_locus_tag="HVO_3028"
                     /db_xref="GeneID:8926677"
     tRNA            575668..575752
                     /locus_tag="HVO_RS07785"
                     /old_locus_tag="HVO_3028"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:575703..575705,aa:Ser,seq:cga)
                     /db_xref="GeneID:8926677"
     gene            complement(575944..576600)
                     /locus_tag="HVO_RS07790"
                     /old_locus_tag="HVO_0641"
                     /db_xref="GeneID:8926868"
     CDS             complement(575944..576600)
                     /locus_tag="HVO_RS07790"
                     /old_locus_tag="HVO_0641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004065082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5,6-dimethylbenzimidazole synthase"
                     /protein_id="WP_004044295.1"
                     /db_xref="GeneID:8926868"
                     /translation="MVGFTERERSGVYKSIYARRDIRRFSDDPVSEETLARLLDAAHH
                     APSVGFSQPWDFVVVEDDETKAAVASIAERAIAAAREGYREPRKSEFGRLKLEGITDA
                     PVNVCVTCDPTRDAPHVLGRNTMQAMDAYSTCLAVQNLWLAARAEGVGVGWVSFLYPH
                     EVREVLGIPHHVEPIAYLCVGYPEDGFPEEPVLQREGWRERIDTSELVHWGEWESTSD
                     "
     gene            576993..577172
                     /locus_tag="HVO_RS07795"
                     /old_locus_tag="HVO_0643"
                     /db_xref="GeneID:8925086"
     CDS             576993..577172
                     /locus_tag="HVO_RS07795"
                     /old_locus_tag="HVO_0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007545009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044293.1"
                     /db_xref="GeneID:8925086"
                     /translation="MSANAASADTSERDGTRRIDVTTVRTGRVADFAETELGDDAIGF
                     ERRGGWTYLVAKGTR"
     gene            complement(577242..578780)
                     /locus_tag="HVO_RS07800"
                     /old_locus_tag="HVO_0644"
                     /db_xref="GeneID:8924933"
     CDS             complement(577242..578780)
                     /locus_tag="HVO_RS07800"
                     /old_locus_tag="HVO_0644"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_004044292.1"
                     /db_xref="GeneID:8924933"
                     /translation="MNERFGKTPELRTSDSVQLLDTTLRDGEQAPGVSLTPTQKADIA
                     RALDRAEVDYIEAGSACTGPGERETIKRVTSLGLDATVTSFARGVKNDVDLALDCDVD
                     GVTLVVPASDRHVESKVGTTREDVVETTDELVAYAKDHGLWVEVIGEDGSRAAPEFLE
                     SLARASHDAGADRFCFADTVGHTSPEHTYEVVSRLSELGPTSTHTHDDLGLAMANVHA
                     SLAAGADLVHTTVNGIGERAGNVALEEVAIALDHCYDVESVKLDELYALAQKVAQATG
                     VSLPPNKAVVGQNAFTHESGIHTDGTLKDDAMYEPYPPETVGRERRLVLGKHAGRAGV
                     KAALDEHGVDATDEEVAAVVERVKELGDRGKRVTDADLLAFAEDVQGRERARQVELLD
                     LTAASGGGTPTASVRLRVEGEERVASGTGSGPVDAAVKAVREALGPDADAQLDEYHVD
                     AITGGTDAVVTVEVTMSLGDRSVSVAASHADITRASVQAMVDALDRLLAPNHTSPTPA
                     SADD"
     gene            complement(578988..579335)
                     /locus_tag="HVO_RS07805"
                     /old_locus_tag="HVO_0645"
                     /db_xref="GeneID:8926587"
     CDS             complement(578988..579335)
                     /locus_tag="HVO_RS07805"
                     /old_locus_tag="HVO_0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF192 domain-containing protein"
                     /protein_id="WP_004044291.1"
                     /db_xref="GeneID:8926587"
                     /translation="MRLVHRQNGAQSTLASNVETADSFLSQARGLMFRGSVPDDYALV
                     FRFDDADRHSLHMVFVPFDIDALWLVGDEVTKKKRLSAWTGIGFGMADTVVELPAGAA
                     DGVEPGDLVEIAE"
     gene            579438..579980
                     /locus_tag="HVO_RS07810"
                     /old_locus_tag="HVO_0646"
                     /db_xref="GeneID:8925834"
     CDS             579438..579980
                     /locus_tag="HVO_RS07810"
                     /old_locus_tag="HVO_0646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044290.1"
                     /db_xref="GeneID:8925834"
                     /translation="MERTPTGTPVGVDDPYDHAGRCDHLTSDAACRLAREYADRDPAF
                     ARERARADYDCVAAAEGCDFRDCPHYASTTSGRECVRCGLEEVRMAHDSTARPLLEAH
                     HLSYGGRGGDGSGDGDEPSHEITVALCRWCHTKVHKSFARIDDDAAPDVEAIAEREGR
                     RTKELDELGFQTARDRAGDE"
     gene            580081..580632
                     /locus_tag="HVO_RS07815"
                     /old_locus_tag="HVO_0647"
                     /db_xref="GeneID:8925319"
     CDS             580081..580632
                     /locus_tag="HVO_RS07815"
                     /old_locus_tag="HVO_0647"
                     /EC_number="6.3.5.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007545016.1"
                     /note="type-1 glutamine amidotransferase domain; functions
                     to produce GMP from XMP in the IMP pathway; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase subunit A"
                     /protein_id="WP_004044289.1"
                     /db_xref="GeneID:8925319"
                     /translation="MTRIVVIDNHGQFTHLERRALRDLGVDTELVDNDTDPADIDADG
                     IVLSGGPDMDRIGRCPDYLDLDVPVLGICLGMQILAEELDGRVGSGDYGGYADVDVEI
                     LDEDDPLIGSLAPETRVWASHADEVKEVPEGFTHTATSDVCTIEAMSDADRDLYGVQW
                     HPEVAHTAEGEEVFENFIDICER"
     gene            580809..582722
                     /locus_tag="HVO_RS07820"
                     /old_locus_tag="HVO_0648"
                     /db_xref="GeneID:8924466"
     CDS             580809..582722
                     /locus_tag="HVO_RS07820"
                     /old_locus_tag="HVO_0648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2070 family protein"
                     /protein_id="WP_004044288.1"
                     /db_xref="GeneID:8924466"
                     /translation="MTSTQSDLAGLSRFIFRAPSWYTSLGFALLVAAMAGIGAFDSGD
                     LAGSWRGIFFIGRDAWEGIFFIGIPTVVAAFGTTGVDRFVGGKLTHNRSSLLALAGEV
                     IIVTFLTGAAIVSVFTGLGQTFIFDALVIALASVFAFRLLIVMAVSRSSLLIAAVPAS
                     IQTLTSAALLFVYSGTLRFFEVGGPILDAYLMPYLARPDRAPPELSAIALSHFQLLAI
                     TCVMYALGVYVFLRIIDRPWRRGLGVSVLDFIRGFIGHIAEGTRELEDFFEQLGQEAI
                     VPVTVLSFERDDGTEKARFVLPMIHPGPMGEIGGGNFPERVARRAEGLVFPPHATAGH
                     DFNLVTEREVDVVLDAADDAYERIEYSPDVTESVRVQSGDAKMLGQRFGDDALLVSTY
                     APQFADDVEYAVGLSASAEARTTGLRDVLLVDAHNCNNGLQGPDLGHVTPGSKRSFDM
                     ITAAGLAGEELSASSRGSLSLGTAFDPTDWTPREGIGPLGIRVAATTVGDQTTAYVLI
                     DGNNMEPGLRDRIVEGLTTGPNAKADVAEVMTTDTHIVNTVEAENQVGAAIDHDELRE
                     TIDRLVDEALADTEPVVAGMATERAEVTIFGNDRTETLASHANVVVSMGGALALALIL
                     AAMAVSLLVFFLA"
     gene            complement(583221..583484)
                     /locus_tag="HVO_RS07825"
                     /old_locus_tag="HVO_0650"
                     /db_xref="GeneID:8924062"
     CDS             complement(583221..583484)
                     /locus_tag="HVO_RS07825"
                     /old_locus_tag="HVO_0650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3194 domain-containing protein"
                     /protein_id="WP_004044286.1"
                     /db_xref="GeneID:8924062"
                     /translation="MSQPTDEEVVETAAEAAEGLIFARFKQSRVKDFDVTVTFEDGVL
                     DVDVYVNAPDDADDADDAEAVAEEAALTAQEAVDELFAAADEE"
     gene            complement(583485..583868)
                     /locus_tag="HVO_RS07830"
                     /old_locus_tag="HVO_0651"
                     /db_xref="GeneID:8926515"
     CDS             complement(583485..583868)
                     /locus_tag="HVO_RS07830"
                     /old_locus_tag="HVO_0651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007545020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prefoldin subunit beta"
                     /protein_id="WP_004044285.1"
                     /db_xref="GeneID:8926515"
                     /translation="MQGSLPPEAQEKLEELQNLQETAQNVSEQKQSSESALNEAQTAL
                     TTLEEIDGDSQMYREVGELLIETDYESAKDDLEEKVESLEVRVEQLTKQETRVQEKFE
                     SLQEELQQMLQGGAGGAGPMGPGGA"
     gene            complement(583912..584181)
                     /locus_tag="HVO_RS07835"
                     /old_locus_tag="HVO_0652"
                     /db_xref="GeneID:8925795"
     CDS             complement(583912..584181)
                     /locus_tag="HVO_RS07835"
                     /old_locus_tag="HVO_0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="KEOPS complex Pcc1 subunit"
                     /protein_id="WP_004044284.1"
                     /db_xref="GeneID:8925795"
                     /translation="MRPAHSASLEFDYPDERRARVVERSVAVEEGEIDDARSGAHVAR
                     EGRTVVVTVEADDLVALRAGVNSWIRLVETAERVASAGSALSESA"
     gene            complement(584183..584317)
                     /gene="rpoP"
                     /locus_tag="HVO_RS07840"
                     /old_locus_tag="HVO_0653"
                     /db_xref="GeneID:8924461"
     CDS             complement(584183..584317)
                     /gene="rpoP"
                     /locus_tag="HVO_RS07840"
                     /old_locus_tag="HVO_0653"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044283.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit P"
                     /protein_id="WP_004044283.1"
                     /db_xref="GeneID:8924461"
                     /translation="MSYKCSRCKRDVELDEFGGVRCPYCGHRVLLKERSPNVKEVAVE
                     "
     gene            complement(584352..584621)
                     /locus_tag="HVO_RS07845"
                     /old_locus_tag="HVO_0654"
                     /db_xref="GeneID:8926809"
     CDS             complement(584352..584621)
                     /locus_tag="HVO_RS07845"
                     /old_locus_tag="HVO_0654"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044282.1"
                     /db_xref="GeneID:8926809"
                     /translation="MADKKARSVGSSGRFGARYGRVARRRVKEIEAEMRNSKVDGDDV
                     TRVETGVWKNEETGEIFTGGTYRPQTPAGKQVRRSIRAALTGEDE"
     gene            584724..585749
                     /locus_tag="HVO_RS07850"
                     /old_locus_tag="HVO_0655"
                     /db_xref="GeneID:8926773"
     CDS             584724..585749
                     /locus_tag="HVO_RS07850"
                     /old_locus_tag="HVO_0655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="WP_004044281.1"
                     /db_xref="GeneID:8926773"
                     /translation="MTQHVVVGAGPVGLAVMEQLRERGADVAAVTRHDPDFLPEGVES
                     RLADVLYPDRAVAAFADADVVYHCAKPPYDQWPELFPDLTRGIVAGVEAAGARFVVAE
                     NLYMYGPVQARLSEDLPYAATGPKGQTRAECADIVLDAHEAGRIEATIGRASDFFGPR
                     VRESVVGEQVFGAAVAGKRAKVFGDPRLAHTYTYVPDFARALVLLGERDEALGEVWHV
                     PNPETVSTRRFVNLVYEAADVDPGFPHIIAAPGVALTLGGYLSAPLNYLSAPLKVLTE
                     MRYAFEEPYVVRDAKFRETFGDAVEPTPLEDATAETVAWFESQREADETEPIHIETAP
                     EGATESA"
     gene            complement(585788..586513)
                     /locus_tag="HVO_RS07855"
                     /old_locus_tag="HVO_0656"
                     /db_xref="GeneID:8925967"
     CDS             complement(585788..586513)
                     /locus_tag="HVO_RS07855"
                     /old_locus_tag="HVO_0656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044280.1"
                     /db_xref="GeneID:8925967"
                     /translation="MHCRRCGNPLEKPGDYCLTCNTANCDAVVAVFAADRATLTFLDD
                     EDVLGETTVTTIPESDDETKVVQLRNFAGLVADEIRRKRPETVYAAGERAPLRETRAQ
                     LHHEFYRVSDDDPVQRVLDTRGERTLEVVDIPPAEKLGGSHSTLIGGRRGRRAIGVVA
                     GHPHVKKVIPGPIDAGGTGSRAGLRAKVTRADGNGNVRLLLRDGSSVQENRIVTTAMN
                     RETGERVRDDLNEALREDGLQDE"
     gene            586639..587451
                     /locus_tag="HVO_RS07860"
                     /old_locus_tag="HVO_0657"
                     /db_xref="GeneID:8923949"
     CDS             586639..587451
                     /locus_tag="HVO_RS07860"
                     /old_locus_tag="HVO_0657"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035613.1"
                     /db_xref="GeneID:8923949"
                     /translation="MRRRALLASLSPLALAGLAGLVALALDPETTARLATQLGQSALD
                     TGRGVASYLGRAAPLSTALFAALAWVAAGGFRAFVAHRDPSDTRTTAEHAFALVASAT
                     VPLVAIFARDRLVVVAGVGVALLAGAGAVFAGRSNARGVVTGSLYAVAPVVGGGVVAS
                     LVAGPAVARTATLALPLAVGYALGVASARGRLRLGAAVSALAFAVPAWTYFPPAAEAA
                     GFDPETVGLALGFAVAAALLSLPFAAIGYATTRTADAERQAGASPAASAVEQ"
     gene            complement(587495..588886)
                     /locus_tag="HVO_RS07865"
                     /old_locus_tag="HVO_0658"
                     /db_xref="GeneID:8926426"
     CDS             complement(587495..588886)
                     /locus_tag="HVO_RS07865"
                     /old_locus_tag="HVO_0658"
                     /EC_number="5.4.99.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(13) synthase TruD"
                     /protein_id="WP_004044277.1"
                     /db_xref="GeneID:8926426"
                     /translation="MREAHPLERAVGIDSYVSDADGVGGRLRVAPEDFRVRELELDSL
                     NVRPPDAPTGDFPNLVLRVTLRGWDTNDFAGRLSDELGASRERVSWAGTKDKHAVTTQ
                     LFTVNGGDAADVPEVPNADIEVVGRLGRTLDFGDLAGNGFRIRVRDPETPDNAAAVTD
                     ALTEFGGREGRVGVPNFFGHQRFGSIRPITHTVGLHVVRGEWREAVLAYCGGPTEDEP
                     EETQAGRAVVDEEAASADPDWHRALDRIPGYLGYERGMLHRLAEDGAETDEDWRNALE
                     SVPSNLQRLFVNAAQSYAFNRMLSERRDRGLPFDEPVEGDVVCFADRDAPGGLELPDV
                     SRLQTATGRRVDVMSRHIERGRAFVTAPLVGTDTELAEGEQGDIERAVLDDLDLEPGD
                     FDLPGNFRSTGTRRAILVRTDLDVERESGDDDADTDAAGGADDLVFDFALPHGSYATA
                     VMREYLKAGPLDL"
     gene            complement(588886..589224)
                     /locus_tag="HVO_RS07870"
                     /old_locus_tag="HVO_0659"
                     /db_xref="GeneID:8925117"
     CDS             complement(588886..589224)
                     /locus_tag="HVO_RS07870"
                     /old_locus_tag="HVO_0659"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_004044276.1"
                     /db_xref="GeneID:8925117"
                     /translation="MKQAIVARADLGMGRGKLAAQVAHASLSAYEDTDSQTRKRWKGG
                     GQKKVVLKANGESELFKLADEAERAGIPHAIIRDAGHTQLDPGTVTALAVGPAEDDEI
                     DRVTGDLSLY"
     gene            589320..590060
                     /locus_tag="HVO_RS07875"
                     /old_locus_tag="HVO_0660"
                     /db_xref="GeneID:8924255"
     CDS             589320..590060
                     /locus_tag="HVO_RS07875"
                     /old_locus_tag="HVO_0660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YIP1 family protein"
                     /protein_id="WP_004044275.1"
                     /db_xref="GeneID:8924255"
                     /translation="MAGPRTPLRKPREYFASRPRPLGTKRALAVVALVTLVVAAATGG
                     ILVTFTQQLDQRVSVDNPEHAPEFMCENYVEGGPFDDMDAPAGCDPSVPEQLDERLGD
                     LVWDEISWVPWAMLLGVPLFWLFEGAMLHLGTSLVGGEGGFAESLTVAAWGMVPSAAR
                     ALALAGYLAYVLPRIDLPSTPDAAVAAMQSALSGFGLVSGAVVVVTVAWATYVRTYGM
                     ARARDLDVESAAVVTVGLSLVGLLFELL"
     gene            590190..590777
                     /locus_tag="HVO_RS07880"
                     /old_locus_tag="HVO_0661"
                     /db_xref="GeneID:8926791"
     CDS             590190..590777
                     /locus_tag="HVO_RS07880"
                     /old_locus_tag="HVO_0661"
                     /EC_number="3.5.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004972933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dCTP deaminase"
                     /protein_id="WP_004044274.1"
                     /db_xref="GeneID:8926791"
                     /translation="MILSDSDILSRLAEGDLVVDPIDDVDMQVQPASVDLRLGTEFLE
                     FQRTNISCIHPNRESEVSEYVRETHVPEGDDFILHPGDFVLGTTKERVEIPTDLLATV
                     EGRSSLGRLAVVIHATAGIVDPGYEGQITLELSNLGTAPVALTPGMRISQLVFTEMKS
                     PADRPYGVERGSKYQGQRGPQASRLSSDPEFGGDE"
     gene            590774..591673
                     /locus_tag="HVO_RS07885"
                     /old_locus_tag="HVO_0662"
                     /db_xref="GeneID:8925786"
     CDS             590774..591673
                     /locus_tag="HVO_RS07885"
                     /old_locus_tag="HVO_0662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_004044273.1"
                     /db_xref="GeneID:8925786"
                     /translation="MKFIEEIVVDAFLPTFRALLAEDLRDRGFTQSEVAEALGISQSA
                     VSKYAHGEVATNERVATDPRVVDLVSRVGDGLATGDMTPVQALVEAEVLIRQLEEGDL
                     LSDLHEDEMPELASHDGFRSIHDPEGRLRTVEQVRSSVRRGLRMLTNTSGFAGLIPNV
                     GSNLVESLPDADSVDDVAAIPGRIFDVKGQATVPGEPEFGVSGHVAGVLLSARAAGAD
                     VNAALNIVYDAGVIEDLEAAGYECIEFDPDAPTDPVRELLTARDLPETFVVYQSGGYG
                     IEPITYILGPDAPAVADVVRVLL"
     gene            591686..592441
                     /locus_tag="HVO_RS07890"
                     /old_locus_tag="HVO_0663"
                     /db_xref="GeneID:8924743"
     CDS             591686..592441
                     /locus_tag="HVO_RS07890"
                     /old_locus_tag="HVO_0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase domain-containing protein"
                     /protein_id="WP_004044272.1"
                     /db_xref="GeneID:8924743"
                     /translation="MTAEQSNSRSRSRSGSRSRGRSRSRSRSPSAVAQSFYTRWATLY
                     DALARRAPGVGSVRTEAADALALDPGETVVEMGCGTGANLPYLAERVGPEGSVVVVDF
                     SPGVLDVARERTREFPQVHLVRGDATRPPVARDLDASPAAVLATFVSGMFDDPAAVIS
                     SWADLVGPDGRLCLVDLAETTDSRWRPLNPAFRVLVRVTAPPEPRTMRASPTKLLNRR
                     LVAAHRALESRCRVTHETTHALGFARVRAGVVE"
     gene            592508..592975
                     /locus_tag="HVO_RS07895"
                     /old_locus_tag="HVO_0664"
                     /db_xref="GeneID:8925509"
     CDS             592508..592975
                     /locus_tag="HVO_RS07895"
                     /old_locus_tag="HVO_0664"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044271.1"
                     /db_xref="GeneID:8925509"
                     /translation="MASFLAALLGAPFNAFHLLFLGLVGYWVSLDAAERGSNASLLWA
                     LGCVVFQPLVAGYLLYRSRIGGRPDPAGVQERLVGTFVIGHFVAAQLWFAVRLTDVIA
                     SVTYPPVVELQYYLALLAVGVLPGTLLVWNRGWARIRRTLGWVHEQEREAVQR"
     gene            complement(593079..594002)
                     /locus_tag="HVO_RS07900"
                     /old_locus_tag="HVO_0665"
                     /db_xref="GeneID:8924004"
     CDS             complement(593079..594002)
                     /locus_tag="HVO_RS07900"
                     /old_locus_tag="HVO_0665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein"
                     /protein_id="WP_004044270.1"
                     /db_xref="GeneID:8924004"
                     /translation="MSFDGFTDATEAQVTRAISDSWMEEFRERTDTEVIVVGGGPSGL
                     VAAKELAERGVDVTIVEKNNYLGGGFWLGGFLMNKVTVRDPAQRVLDELGVPYEESDE
                     AEGLYVADGPHACSALIKAACDAGAKIQNMTEFTDVVLREDDRVGGIVMNWTPVHALP
                     RELTCVDPIAVESDLVLDATGHDAVVLSKLSERGVLDVNGIEHAKEHNTGMDKTADGE
                     YGAPGHDSPGHDSMWVSESEDSIVDATGVVHPGVVASGMAVATAHHLPRMGPTFGAML
                     LSGRQAAQSCLDELGRDAPDVSISGPAPADD"
     gene            594094..595581
                     /locus_tag="HVO_RS07905"
                     /old_locus_tag="HVO_0666"
                     /db_xref="GeneID:8926723"
     CDS             594094..595581
                     /locus_tag="HVO_RS07905"
                     /old_locus_tag="HVO_0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin/lipoyl-binding protein"
                     /protein_id="WP_004044269.1"
                     /db_xref="GeneID:8926723"
                     /translation="MAYVVKMPKLGLEMKSGELSAWLVSEGDEVTEGDPIAEIESEKT
                     TAEIDAKEDGVLRRVVLAEGESTAPGGALAIVAGADEDISGLEADAGVGEGGSEPVAT
                     DDSAGDSSPTEVTETTETAATGGGDASSVAQSRSRGSDGASENGEVRASPRAKRLADD
                     LGVDLTTVEGTGPQGAITESDVETAAESATATAAEKRVFAPPSARRLARELGVDIEAV
                     EGTGQNGRITESDVRAAGGATAAATDSSAAGAATTAATDATAASEPAETERPLSGMRR
                     TIADRLGESYREAVHVTVDRRADAEELLAAANAAADALGVDVSITDVLLLALSASLDE
                     HPEFNATFEDGVHRLHGEHNVCIAVDVDEGLIAPVVRDVASLSLSELAETRAETTQRA
                     LSGDFTMDDLSGGTFTVSNLGVLGVESFDPIINPPQVAILGVNTIRREAVPTDDGDVA
                     VRRVISFSLSFDHRIVDGADAARMLGTLVEHVENPWPLVIAAGGR"
     gene            complement(595636..596685)
                     /locus_tag="HVO_RS07910"
                     /old_locus_tag="HVO_0667"
                     /db_xref="GeneID:8926116"
     CDS             complement(595636..596685)
                     /locus_tag="HVO_RS07910"
                     /old_locus_tag="HVO_0667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-NAD kinase"
                     /protein_id="WP_004044268.1"
                     /db_xref="GeneID:8926116"
                     /translation="MTTTIGLVVNPAAGRDIRRLTGGASVSNNYAKRRTAGCVLAGLT
                     LVDDVEVLVMPDSTGLADRIVDDAPDDLGVEFVDMTVTASGQDSRTAAAHFAEHADAV
                     VVLGGDGTTRDVAQTIDDVPVVSISTGTNNVVPTPVDGTVAGAAAALVGSGAIPAAEA
                     TTRHGTIEVDVVRSEETTVIRGLATVGVLDRPFVGTRAILDPSDIVGGVVSRSSPAEI
                     GLSGIAGGLVTHRPDEPGGVGFRLARGGDDGGDGTDAAGAADATTNPATTVRAITVPG
                     RLSTVDVAEHRVLDDGEGYAFEVDRGVISVDGEREREVRNGTVRLRPVSDGPRLVDVE
                     AVLERAADDGRFRLG"
     gene            complement(596686..597696)
                     /locus_tag="HVO_RS07915"
                     /old_locus_tag="HVO_0668"
                     /db_xref="GeneID:8925116"
     CDS             complement(596686..597696)
                     /locus_tag="HVO_RS07915"
                     /old_locus_tag="HVO_0668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004972922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoacid dehydrogenase subunit beta"
                     /protein_id="WP_004044267.1"
                     /db_xref="GeneID:8925116"
                     /translation="MSTETSSGTGPDQTKEMTIREAIRLALREELERDDDVFVMGEDV
                     GKFGGVYEVTGDLVEQFGETRVRDTPISEAGFMGAAVGAAATGTRPVVEIMFSDFIGV
                     CSEQIINQMAKNRYMFGGKTEMPVTVRTTEGGGSGAASQHSGTIHTWFAHFPGVMAVA
                     PATPASAKGLLKSAIRSDDPVIVFENKQIYEQKGEVPLDEDFTIPIGTASVEREGEDV
                     TVVATQRMVGESLELAEELAGQTSVEVIDLRSLYPMDTDTLVESVGKTGRLVIADESP
                     LSYGTHAEVATRVMENAFYSLDAPIQRVGVADVHIPFSPALEEEVLPSGSDVEAAINR
                     IV"
     gene            complement(597693..598727)
                     /locus_tag="HVO_RS07920"
                     /old_locus_tag="HVO_0669"
                     /db_xref="GeneID:8926533"
     CDS             complement(597693..598727)
                     /locus_tag="HVO_RS07920"
                     /old_locus_tag="HVO_0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007981035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate-dependent dehydrogenase
                     E1 component subunit alpha"
                     /protein_id="WP_004044266.1"
                     /db_xref="GeneID:8926533"
                     /translation="MVVLDIETEDGQREALRRMLTIRAFDTKAADLFSDGELPGFVHL
                     YVGEEAVGVGACSALESDDYITSTHRGHGHCIAKGLDPDLMMAELFGKADGYCNGKGG
                     SMHIADVDAGMLGANGIVGAGPPLATGAALTSHLKGEDTVALAFFGDGAVAQGQVHEA
                     VNLAATWSLPAVFLVENNQYGEATPVEKQHNVQNLSETAEAYNIPGFTVDGMDITAVY
                     EAVKEARKRAADGEGPTFIEAETYRYHGHFEGDQQPYRTEEDVAIWKDRDAIETFKRR
                     LVDAGTITEAEFDEMKAEIDQQIEDAVGKAKDAAYPDPSEAYEDMFNAAVPEISDFSS
                     GMRADGGENR"
     gene            598977..599957
                     /locus_tag="HVO_RS07925"
                     /old_locus_tag="HVO_0670"
                     /db_xref="GeneID:8925886"
     CDS             598977..599957
                     /locus_tag="HVO_RS07925"
                     /old_locus_tag="HVO_0670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase family protein"
                     /protein_id="WP_004044265.1"
                     /db_xref="GeneID:8925886"
                     /translation="MNMLYEGEWRTDKFVANNEDGEFERQTTDFRNWVGEDERFPVEA
                     GRYHLYICRACPWAHRTAMTRALKGLEDAISLSLVEPVRIDDGWEFSEDLPDPLYGEE
                     FLRDIYLRADDEFTGRVTVPVLWDKQRETIVNNESREIMRMLDEAFDPLAERDVDLNP
                     DGYEEEVDRLVDEIYEPVNNGVYRAGFATTQEAYEEAVEELFDALDHWDEVLDDQRFL
                     AGDVVTEADIAMFATLIRFDHVYHTHFKCNKKAIHEYDNLWNYTKELYQLPGVAKTVN
                     MDHIVRHYFVSHGDINPKRIYGVGPDLDFDAEHDRDRLPADLPAALTADD"
     gene            600054..601019
                     /locus_tag="HVO_RS07930"
                     /old_locus_tag="HVO_0671"
                     /db_xref="GeneID:8925603"
     CDS             600054..601019
                     /locus_tag="HVO_RS07930"
                     /old_locus_tag="HVO_0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite oxidase"
                     /protein_id="WP_004044264.1"
                     /db_xref="GeneID:8925603"
                     /translation="MASRATRLTRALRRVEPPPRAVDWSIFALVVFETLSGVLSLGAG
                     HPANGLLFVVHGVAGLSLVVLVGFKLYRVRRRVLDARLRDRHTALSVLLAVVALASLG
                     TGIAWVLGVEVRIGFWTLLNVHIGFGLLVVPVLFFHLWARFRPPRRVDFAERRRALQY
                     GAILVFSAATYRATETVGALRGVGRRFTGSRPLPPGEGNDAFPVTSWVADDPDPVDPD
                     SWSLSVTGLVDRSLELDRADLAPGETRSVLLDCTSGWYTEQHWTGVRLGDALDAAGVH
                     SSARWVTVRSVTGFRWSFPIAEAREMLLATHVGGDPLSHGHGAPL"
     gene            complement(601359..601818)
                     /locus_tag="HVO_RS07935"
                     /old_locus_tag="HVO_0673"
                     /pseudo
                     /db_xref="GeneID:8923925"
     CDS             complement(601359..601818)
                     /locus_tag="HVO_RS07935"
                     /old_locus_tag="HVO_0673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577469.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:8923925"
     gene            complement(601895..602647)
                     /locus_tag="HVO_RS07940"
                     /old_locus_tag="HVO_0674"
                     /db_xref="GeneID:8924567"
     CDS             complement(601895..602647)
                     /locus_tag="HVO_RS07940"
                     /old_locus_tag="HVO_0674"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenate/pantothenate synthetase"
                     /protein_id="WP_004044261.1"
                     /db_xref="GeneID:8924567"
                     /translation="MSDIEIPESHPRYQSLLTRHRIEEGVEKGITSRQGLIAQGRGEA
                     FDYLLGERTLPSSDEATRAAAAHLLLADQPVISVNGNVAALCPGEVVDLAAAVDADIE
                     VNLFNRTDERMRAIAAHLRDHGADEVKGLTGDGRIPGIDHERAKVDADGIGSADVVVV
                     PLEDGDRAEALGAMDKVEIVVDLNPMSRSAQVATVPIVDNIMRAVPNIAAHARDLRGS
                     GATREELETIVADFDADAALDAAERAIRAGDE"
     gene            complement(602703..603536)
                     /locus_tag="HVO_RS07945"
                     /old_locus_tag="HVO_0675"
                     /db_xref="GeneID:8925608"
     CDS             complement(602703..603536)
                     /locus_tag="HVO_RS07945"
                     /old_locus_tag="HVO_0675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_004044260.1"
                     /db_xref="GeneID:8925608"
                     /translation="MSDDATAFVPGHVTGFFSAHPDDDPAVAGSRGAGLTLSHGVSVT
                     VEPAPVTAITLDGEAVEMPPVVGVLRALGVTAAVDAESELPLGAGFGVSGAMALGTAL
                     AANAVFACGRSENELITLAHVAEVRAGTGLGDVVAQARGGMPLRIDPGAPRHGYMDGI
                     PARPHIEYVTFGGLSTADIIGGDTSTLTAAGEAALDALAEEPTVERFLAESRQFARDA
                     GLLTDRVETAIADVRDAGGDAAMAMLGETVFAVGTGLSDAGYDTERCRIHPAGSTLDS
                     A"
     gene            complement(603591..604046)
                     /locus_tag="HVO_RS07950"
                     /old_locus_tag="HVO_0676"
                     /db_xref="GeneID:8926239"
     CDS             complement(603591..604046)
                     /locus_tag="HVO_RS07950"
                     /old_locus_tag="HVO_0676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044259.1"
                     /db_xref="GeneID:8926239"
                     /translation="MTDAERVVDDAVEDASDDDDDSPLQELVAGVVVALIFLVGFGLL
                     ALGEWWFWIVFPVGFAGVLPAALALVRIYESRRGYDASESMTTETEDALETLRRRYAT
                     GELSEEEFEAKVERLLETETVADARESAASRRREGKAGETERETAFDRD"
     gene            complement(604398..605702)
                     /locus_tag="HVO_RS07955"
                     /old_locus_tag="HVO_0677"
                     /db_xref="GeneID:8924281"
     CDS             complement(604398..605702)
                     /locus_tag="HVO_RS07955"
                     /old_locus_tag="HVO_0677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate--tRNA(Asn) ligase"
                     /protein_id="WP_004044258.1"
                     /db_xref="GeneID:8924281"
                     /translation="MRNRTYTADAEPGDTVTVAGWVHEVRDLGGIAFLILRDTSGKIQ
                     VKFEKDEMDDDLVETGLGVHRESVISVTGEVDEEPRAPTGVEVTPESLDVIAEAEAQL
                     PLDPSGKVDAELSTRLDNRTLDLRKDEVKAIFEIRAEVQRAVRDKFRDLRATEINTPK
                     IVATGTEGGTELFPITYFGQEAFMNQSPQLFKQLMVGSGLERVFEVGPIFRAEEHNTP
                     RHLNEATSIDFESAFIDHTEAMDVCEAVVTAAYEAVEENCQDELEALGLEEEFEAPSG
                     EFPRLTYEEAIERINATGELDEQLVWGDDLPTEGEKALGEDVGEHYFITDWPSEIKPF
                     YIKDHDDDETLSTGFDMMHPNMELVSGGQREHRFDHLVAGFEQQGLDPDAFEYYTKMF
                     KYGMPPHAGFGLGGERLIMTMLGLENIREAVLFPRDRQRLSP"
     gene            605936..606410
                     /locus_tag="HVO_RS07960"
                     /pseudo
                     /db_xref="GeneID:25143415"
     CDS             605936..606410
                     /locus_tag="HVO_RS07960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008418964.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /db_xref="GeneID:25143415"
     gene            606457..607254
                     /locus_tag="HVO_RS07965"
                     /old_locus_tag="HVO_0679"
                     /db_xref="GeneID:8924404"
     CDS             606457..607254
                     /locus_tag="HVO_RS07965"
                     /old_locus_tag="HVO_0679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4013 domain-containing protein"
                     /protein_id="WP_013035430.1"
                     /db_xref="GeneID:8924404"
                     /translation="MRTRDHLASDMDVSDLEAAFALPLAEDTSVDTTLLGVVSTLASL
                     ATPLAGILLAGYVVRLVRAGDREAAALPSFDDLTGMAVDGARLSAALVALQLPAVGLA
                     TVSLPGSRPSIAMLSYATNPVMLGSFGVTALDTAGLVAAGLASLLGSYLSLVATVALA
                     REASLAAAIPATRDLASDRSFVRVASAVALVVFVARLFVALCAAVPVAGTLLAATASF
                     LLLVVSATLLGRGAPDASSPGADATRESHADGVNAESVESAESVPSA"
     gene            complement(607278..608000)
                     /locus_tag="HVO_RS07970"
                     /old_locus_tag="HVO_0680"
                     /db_xref="GeneID:8925269"
     CDS             complement(607278..608000)
                     /locus_tag="HVO_RS07970"
                     /old_locus_tag="HVO_0680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphoglycerol
                     geranylgeranyltransferase"
                     /protein_id="WP_004044255.1"
                     /db_xref="GeneID:8925269"
                     /translation="MSYPWEDWDHITKIDPDKDLVDGETFEDVCETGTDALEIGGTLD
                     ITEEKMERVIEATSKYDVPIYQEPSNPGVVIDDDALDGYLIPTVFNASDSFWITGAHK
                     EWVRIEDGLDWDRTHTEAYIVLNPESSVAEYTDADTDQSAEDVASFARVAEKMFGQKI
                     IYVEYSGTYGDPEKVGAAHDALDDATLFYGGGIHDYESAYEMGQHADAVVVGNLLHDE
                     GVDAVRETVEGAKDATAELVAE"
     gene            608106..609110
                     /locus_tag="HVO_RS07975"
                     /old_locus_tag="HVO_0682"
                     /db_xref="GeneID:8926089"
     CDS             608106..609110
                     /locus_tag="HVO_RS07975"
                     /old_locus_tag="HVO_0682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_013035233.1"
                     /db_xref="GeneID:8926089"
                     /translation="MDAAAATEYVESRAMTLSPEEFELLCESVLSESLPSARFSVTAF
                     RQDGGIDIDGRIRNSLLDVSLGVQAKQYGSSNTVGSPEIQRFQGALADTGCDTGTVIT
                     ASSFTTPAVESAERAGIHLVNGSELFDSMINLRVGVRRQSTRFEPDEEFWSLFGEPGE
                     AGVIPSKRVPLANSFETLDAVLSAIGDTRGEKDDIVESAGASPRHADLYAIAGWVLGF
                     VHQEWPDEESHRQRRWSLTRSGARYVAYRAAGLDDEAEILLLDGIRNAEIIERLVNSL
                     SESGSLGHSDLVDFVASESELSRSSAKRRGSSVGIWLARLPEVSVENGREKRYVWNGS
                     "
     gene            complement(609107..611629)
                     /locus_tag="HVO_RS07980"
                     /old_locus_tag="HVO_0681"
                     /db_xref="GeneID:8923941"
     CDS             complement(609107..611629)
                     /locus_tag="HVO_RS07980"
                     /old_locus_tag="HVO_0681"
                     /EC_number="5.99.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321710.1"
                     /note="catalyzes the ATP-dependent breakage of
                     single-stranded DNA followed by passage and rejoining,
                     maintains net negative superhelicity; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_004044253.1"
                     /db_xref="GeneID:8923941"
                     /translation="MSRGPELIITEKDNAARRIADILSGETASAERMNGVNVYKWGGK
                     RCIGLSGHVVGVDFPPEYNDWRDVEPVELIGAPVEKHPTQENIVAALRRLARRAGKVT
                     IATDYDREGELIGKEAYELVRDVNEDVPVDRVRFSSITNREVTEAFENPDDLDFDLAA
                     AGEARQIIDLVWGAALTRFLSLSARQLGNDFISVGRVQGPTLKLIVDREREIDAFDPE
                     DYWELFSKLTKDADGDAESFEAQYFYLDDDGTEAERIWDEDDAEEAYQTLLGVEAAEV
                     SSVNRRTRTDTPPAPFNTTQFIRAAGSIGYSAQRAMSIAEDLYTAGYITYPRTDNTVY
                     PDDLDPRELLGAFEGDRRFKEDAESLLEQEEIEPTEGDNETTDHPPIHPTGELPSASD
                     LSDDEWDVYELVVRRFFATVAEDAVWEHLRVVAEVEGLSLKANGKRLLEAGYHDVYPY
                     FNSSESFVPDVEEGESLVLSDTHLDAKQTQPPRRYGQSRLIETMEQMGIGTKATRHDV
                     IQKLYDRGYIESDPPRPTRLARAVVEASEDFAKLIVSEEMTSQLESDMLAIARGEATL
                     EDVTEESKEMLGEVFEGLMESREELGKQLQDSLKADKTVGTCPDCGGDLVVRKSRRGS
                     YFIGCDSYPDCTYTLPLPSTGKPLIMEESCEDHDLHHIKMLAGRKTFVHGCPLCKAEE
                     ADEEDDLVIGTCPECGEEHDGELAIKRLRSGSRLVGCTRYPDCDYSLPLPRRGDIEVT
                     DESCEEHDLPELRITYEGDREPWELGCPICNYREYQAQQNGEGGSELESINGIGAKTA
                     EKLKDAGIEDVKTLKASEPDDIAAKVEGVGADTVRKWQTAAD"
     gene            611926..612621
                     /locus_tag="HVO_RS07985"
                     /old_locus_tag="HVO_0683"
                     /db_xref="GeneID:8924781"
     CDS             611926..612621
                     /locus_tag="HVO_RS07985"
                     /old_locus_tag="HVO_0683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044252.1"
                     /db_xref="GeneID:8924781"
                     /translation="MRQPSTEHLRLGLAVLLIFTPLWGPALGLTGPTYTYESAEIGVE
                     DNRLVVPDRDARSELWHGIDGFACSVGSSVTRYCALEAATLNGTLAVDHPDVQSSSSG
                     HLDVEERYLAYYDGRVFERESTWEDGRYVLSTARVPAAAALDEVARPPDRYPTAWTAI
                     ENGSGTADRELWPTDAGARVFEVDGDYYLVYRTGVDRPLPSSPAAEEALTWFAVVLGS
                     AMLFGRDDDDDWS"
     gene            complement(612687..614177)
                     /locus_tag="HVO_RS07990"
                     /old_locus_tag="HVO_0684"
                     /db_xref="GeneID:8924335"
     CDS             complement(612687..614177)
                     /locus_tag="HVO_RS07990"
                     /old_locus_tag="HVO_0684"
                     /EC_number="6.3.5.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase
                     subunit GatB"
                     /protein_id="WP_004044251.1"
                     /db_xref="GeneID:8924335"
                     /translation="MTAQALEQRELAVVIGLEVHVQLETATKIFCSCSTEPAEDEEPN
                     TRVCPVCLGLPGALPVLNEAAVESAVKIGKALNADIAEDTRFHRKNYYYPDLPKNFQI
                     TQYDAPICADGTLEVSVEGTRRDIGITRAHLEEDPGSLQHKGGSIDTADYTLVNYNRA
                     GTPLVEIVTEPDFRSPQETRAFLAKLEEVLEYLGVFDATRDGSLRIDANISLVPADEV
                     DDDGAISDDALEAANRTEVKNISSHKGAEKALAYEVTRQKNAIQRGRAVEQETRHWDE
                     SRGITVSMRSKEEEKDYRYFREADLPPLQVAHWKEEIPIPELPDARRERFRTEYGIDE
                     ESASKLTSTKEVADFFEDVAAEFDADLAATWVADNLLGELNYRDMHITDVSDRLDEFT
                     RLVELVAADEVTTKNAEEIVLREMLDEGKDPDTIVNEAGLGKADDDEIGGFVQEAIDE
                     NPDAVEDYHNGEGGALNFLVGQVMQKSQGSADPGTVNQLLRERLDE"
     gene            614347..615231
                     /locus_tag="HVO_RS07995"
                     /old_locus_tag="HVO_0685"
                     /db_xref="GeneID:8926341"
     CDS             614347..615231
                     /locus_tag="HVO_RS07995"
                     /old_locus_tag="HVO_0685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3100 domain-containing protein"
                     /protein_id="WP_004044250.1"
                     /db_xref="GeneID:8926341"
                     /translation="MTNDTTSDRWAPIRTAGRLSAHLRTHLTVLLIVVVAELIGTITF
                     PLGPGQVVLLPLLYAVVLGLALSYSVLGSVIEPLRSVVDEDVSRIASPLLVVALMPLG
                     VKYGTLVAPSFYDLVAAGPAFVLQEFGNLGTILIALPLALLLGLKRESIGAAVSIARE
                     PTLGVITDKYGIESPEGRGVLGTYMTGTVLGTVFFGLLGGFAPATGLHPLALSMACGM
                     GSASMMTACSTSLATAVGGAGVAEDQILSFAATSNLLTGITGLYMVILVGLPVITRLY
                     AVLAPVFGRDTAAADGGE"
     gene            615233..615697
                     /locus_tag="HVO_RS08000"
                     /old_locus_tag="HVO_0686"
                     /db_xref="GeneID:8925711"
     CDS             615233..615697
                     /locus_tag="HVO_RS08000"
                     /old_locus_tag="HVO_0686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044249.1"
                     /db_xref="GeneID:8925711"
                     /translation="MSMSTPEFSVESLKMLLVVAFLTLTANFIATGTGFVAALPGTAL
                     IVVLGLVALLMGRLIPLDLPAFAYAMVLAFALALPFSPVQAPFLAAVGEIDFLATTTP
                     ILAYAGLSIGLQTGKMKEVSWKLVLVAVFVFFGTFFGSALISQAVLSAQGII"
     gene            615744..617078
                     /locus_tag="HVO_RS08005"
                     /old_locus_tag="HVO_0687"
                     /db_xref="GeneID:8925335"
     CDS             615744..617078
                     /locus_tag="HVO_RS08005"
                     /old_locus_tag="HVO_0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_004044248.1"
                     /db_xref="GeneID:8925335"
                     /translation="MTDDRVAALKARVCDAIDDRADEIIDFAKDVQAEPELGYKEVKT
                     TEKVVSLFEDLDLDVETELAITGARARAGSGDFVAAVLGELDALVNPDHPMADPETGA
                     VHACGHNAQLANLVGTAFGLVGSGVVDDLDGAVEFVAVPAEEYLDLDYRRGLLDAGDI
                     EFFGGKQELIRRGYVDDWDAAAMMHAGSDTPERTITSDFSTNGFVGKFVTYRGTEAHA
                     GAAPEEGVNALNAAMLGMNAVHAQRERFRDEDHVRVHPIITRGGDGVNVVPAEVTMES
                     YVRAASVEAVADANESVNRALASGAMGVGGDVEIEDYPGYMPLRTDETIVAFYDENAR
                     DIVGPDAVTPGTPHLSGSTDMGDITQLVPGIHPWTGGFEGAVHARDFRVVDEEMAYVI
                     PAKLTACTLVDLLTSPEAMAAVREAKAEKRSREEYLDAVRSLRATTTESYRD"
     gene            617184..617507
                     /locus_tag="HVO_RS08010"
                     /old_locus_tag="HVO_0688"
                     /db_xref="GeneID:8923887"
     CDS             617184..617507
                     /locus_tag="HVO_RS08010"
                     /old_locus_tag="HVO_0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013035285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035285.1"
                     /db_xref="GeneID:8923887"
                     /translation="MSNRVEELESKVAELQAAVNGLTEELVETKERLRQLEDANDVQV
                     PSRAATRRGDWETEDQADAEAAAAEPADADETSPADADETKPDEADETDEGDGEAPDD
                     DIIVA"
     gene            617591..621313
                     /locus_tag="HVO_RS08015"
                     /old_locus_tag="HVO_0689"
                     /db_xref="GeneID:8924317"
     CDS             617591..621313
                     /locus_tag="HVO_RS08015"
                     /old_locus_tag="HVO_0689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome segregation protein SMC"
                     /protein_id="WP_004044246.1"
                     /db_xref="GeneID:8924317"
                     /translation="MHIKELVLDGFKSFGRPTRIPFYEDFTVVTGPNGSGKSNIIDGV
                     LFALGLARTRGIRAEKLTDLIYNPGHADGSDEAPDKPKEASVTVVLDNSEGTLDRSQV
                     VNAAGTDKVGGVEEITIKRRVKETPDNYYSYYYLNERSVNLSDIKDLLAQAGITPEGY
                     NVVMQGDVTEIINMTPYQRRGIIDEIAGVAEFDEKKDAAFEELEAVEERVDEADLRIE
                     EKEARLDQLADERETALTYKGLREEKEEYEGYLKAAELEDKRDDLSRTESRIESTEAD
                     LEDLQAELDERQGKVTRLEADLEDLTREIERKGEDEQLRIKSEMEEIKGDISRLENAI
                     DAAEEKRDDAEAERRKAFVDIDRKQEQIDDLEDDIREVKVEKASVKSDIQSKRVELSE
                     VQAEIDSVDTEFDELKSELAERKETLDELKDEKNDRQRAKDRLLDDARRRSNQISETR
                     DELERARERIPELKATVSDLHSELDTAEKNEAKIDGVIEDLQAEKADLNDELSEVTDE
                     LQTKQSEYARLEARAGKDGDNSWPRAVTTILNAGISGVHGAVGQLGSVDGEYAKACET
                     AAGGRLANVVVDDDGVGSSCIGHLKSRKAGRATFLPITKMDNRSLPREPDNPGVVDFA
                     RNLVDYDSQYESIFSYVLGSTLVVEDMETARDLMGDYRMVTLDGDLVERSGAMTGGSG
                     GGSRYSFSKSGEGKLDRLAKEITKLEDRRRSLNEEIRDIDDDLDDARGRASDAADRVR
                     TIEREIEDAEEDIEEAEAEIDRLEDRLDELQSERESVDEQMSDLDDEIADLDDEIETV
                     EAEIEDIEAELADSEIPELTARADDIRADIDDLEDRMSTLDGRLNEIQLEKQYAEDAV
                     DDLHDTIEAAQNRKAEARESISEAESTIEEREDDLEAKREAVAELEEELVDLKEDRTE
                     LQDDLREARSARDEKKDRVNAVESKLESMRSAAERLEWEIDELQSQVGDYDPDEIPDH
                     DTVESEIERLTEEMEELEPVNMLAIDEYDDVKADLEALQERRDVLVEERDAIADRIDQ
                     YESQKKATFMESFDAIAENFTDIFERLSNGTGHLQLENPDDPFEEGLTMKAQPGDKPI
                     QRLDAMSGGEKSLTALAFIFAIQRHNPAPFYALDEVDAFLDAANAERVGQMVDDLAGD
                     AQFVVVSHRSALLERAERAIGVTMQGDNVSAVTGIQFGGDGEAGSDGGDGRDADGPGG
                     DDGGSGDGSDDDGDDADGGDGGEADADVEAEVPADD"
     gene            621306..622433
                     /locus_tag="HVO_RS08020"
                     /old_locus_tag="HVO_0690"
                     /db_xref="GeneID:8924225"
     CDS             621306..622433
                     /locus_tag="HVO_RS08020"
                     /old_locus_tag="HVO_0690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="segregation/condensation protein A"
                     /protein_id="WP_013035540.1"
                     /db_xref="GeneID:8924225"
                     /translation="MTDDIPELNLSRGRGERDGSDGDDDDDGVFSFAGDDAAPDSEAD
                     AAPAEPDAMDEVLPEDVSESDDDEVEPVELLVQLAKEGTIDPWDIDIVEVTDAFLNRL
                     DAMDLRTTGRALFYASVLLRMKSDELLAPDEPDEEELEPWELALESGGDEGHPGDDGE
                     GPPGFDPIDALEDEMDRRLERKHARGSPETLDELVRELREVERGSWWKRRREYDTSES
                     PRGFSRGTQTLDYHTPGEMRGAGEPTEDDVTGTAHNEDIEAVVEAVGDVLATHYEKGR
                     DEVLFAEIRDVADTVMTTYLALLFLSHRSTVYLKQDDLFGDLWIRNPEVFDADPGAGS
                     DADADAEVADDADAEVADGGDDADDADSDDPELEAEAIADD"
     gene            622466..622942
                     /locus_tag="HVO_RS08025"
                     /old_locus_tag="HVO_0691"
                     /db_xref="GeneID:8926005"
     CDS             622466..622942
                     /locus_tag="HVO_RS08025"
                     /old_locus_tag="HVO_0691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044244.1"
                     /db_xref="GeneID:8926005"
                     /translation="MPHPTLLSSTLRRLTVAVSLVTSTLFAALAAAILFPQSAIWTWA
                     LLFFVPIFWLHCYFPGYVSYSPTAFGRVREVVTSPRAVRECVVCGEADDRGVARAFST
                     QFVVAGIPLSTTDRGENEYCTRCHGVEFSPTDEAARGEREAGESEGDSGKSAELND"
     gene            complement(622950..623810)
                     /locus_tag="HVO_RS08030"
                     /old_locus_tag="HVO_0692"
                     /db_xref="GeneID:8925201"
     CDS             complement(622950..623810)
                     /locus_tag="HVO_RS08030"
                     /old_locus_tag="HVO_0692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008323223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-methyl-5'-thioadenosine phosphorylase"
                     /protein_id="WP_004044243.1"
                     /db_xref="GeneID:8925201"
                     /translation="MKIGFIGGSGIYEALPLENTREEPVETPFGEPSTTPVVGEFGDT
                     GREVVFLPRHGPDHQHSPTTLPYRANIFALKQLGVTHVLASNAVGSLKEDLPPQTLVV
                     PDQIYDRTKHRPLTFFDEGIVVHQPFAMPYDEELVSILAEAAEEATDAQVQEGGTYVC
                     IEGPSYSTKAESEHYRAQGWDVIGMTTIPEAKLAREAEMAYATITGVTDYDVWKDDSE
                     VTLDEVLKNAAANEEAIKETVEAAIHKIPDGHETDSHSALEGTINTPDEAIPAETKAK
                     LAPLIDEYVD"
     gene            complement(623856..624851)
                     /locus_tag="HVO_RS08035"
                     /old_locus_tag="HVO_0693"
                     /db_xref="GeneID:8923910"
     CDS             complement(623856..624851)
                     /locus_tag="HVO_RS08035"
                     /old_locus_tag="HVO_0693"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="auxin efflux carrier (AEC) family transporter"
                     /protein_id="WP_004044242.1"
                     /db_xref="GeneID:8923910"
                     /translation="MTRFGTRMSLFSIFAGALLPILAIGAVGFLLGRVRDVDPEPLNT
                     VTVYVLAPVLVFYSLATTELAGETLAALTAGVVAYHVAMLLVAGGVARLAGISDPLLG
                     ALVLVAAFPNSGNYGIPVSSFAFGDTGRSTAVVYLAVQSVLIYTLGVYIAGRGDDRDD
                     APPGWRVGLERIVRIPLVYAVVAALAARWLGVVPPTGVPAMETLRLVGDSSIPMMLLI
                     LGIQLAGADLGSTLSEVGVVAALKMVVAPAVAVGVALVAGFGDPTVARTFVLESAMPA
                     AVTPLILVAEFGDASGAGSATSLAEFVSAAVFATTLLSVPALSVLIYLLNHGFVV"
     gene            complement(624993..625706)
                     /locus_tag="HVO_RS08040"
                     /old_locus_tag="HVO_0694"
                     /db_xref="GeneID:8924580"
     CDS             complement(624993..625706)
                     /locus_tag="HVO_RS08040"
                     /old_locus_tag="HVO_0694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="WP_004044241.1"
                     /db_xref="GeneID:8924580"
                     /translation="MGDLPDEFNCTITNWEYIYGLCRDVSDEVKTSEFEPDVIVALAR
                     GGWFAGRCICDFLGLDDLTSLKMEHYVGTAQKSNEPEVRYPMPEGSVEGKDVLIIDDI
                     ADTGGSIKRAHEYVNERNAGEVRTATLQLLQTSEFEPDYVGERLEEWAWVVYPWNFIE
                     DMIDLTSGVMAKADDDTFELEDIRHYLAEFHDVDRIEMEIAQPDRMPEVMSEMERRGY
                     VESTGDGAWRLLENDGVGA"
     gene            626195..627094
                     /locus_tag="HVO_RS08045"
                     /old_locus_tag="HVO_0696"
                     /db_xref="GeneID:8925838"
     CDS             626195..627094
                     /locus_tag="HVO_RS08045"
                     /old_locus_tag="HVO_0696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhzF family phenazine biosynthesis protein"
                     /protein_id="WP_004044239.1"
                     /db_xref="GeneID:8925838"
                     /translation="MDSRRALLVDAFTTEPLSGNAAGVVPDADGLDAEQMRALAAELG
                     ASETAFVCSSAAADRRIRYFTPQQEVDLCGHATIAAHAHLAAERDLEPGTHTLETNVG
                     TLDIELGDLGEVWMTQDAPTVRPLEVDYDRLAAALGVDDAALRDVGADLPVAVASTGL
                     PFLVVPVNFLEHLSAADPDDAAIADLAAEHDAAGFYAYTFDAIDGDSTLHARCFAPGI
                     GISEDPATGTAAGACGAYLRQVGAFDSMPDELRFEQGHFVDRPGTVRVQVGAEIRVGG
                     RAVQSFDGEIVVPEFADDDIIEA"
     gene            complement(627140..627907)
                     /locus_tag="HVO_RS08050"
                     /old_locus_tag="HVO_0697"
                     /db_xref="GeneID:8926436"
     CDS             complement(627140..627907)
                     /locus_tag="HVO_RS08050"
                     /old_locus_tag="HVO_0697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proteasome assembly chaperone family protein"
                     /protein_id="WP_004044238.1"
                     /db_xref="GeneID:8926436"
                     /translation="MDDIEIEAVEEVDLTDPVLIEGLPGVGNVGKLAVEHLLEEFEEA
                     TLVRRVYADAFPPQVSIDEGVAELTHVAIHAVETPGEGPDLLLLTGDHQAQSNEGHYH
                     LTDTFLDIGEEFGVERLFALGGVPTGELVDEPSVLGAVADESRLDELDEAGIEFREGE
                     PAGGVVGVSGLLLGLGGRRGLDATCLMGETSGYLVDPQSAQVVIEVLQDLLQFSVDFE
                     SLEERAEEMKEVAAKIQEMQQQQQGSIASDDDLRYIG"
     gene            complement(627962..628153)
                     /locus_tag="HVO_RS08055"
                     /old_locus_tag="HVO_0698"
                     /db_xref="GeneID:8924277"
     CDS             complement(627962..628153)
                     /locus_tag="HVO_RS08055"
                     /old_locus_tag="HVO_0698"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008605428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-protein complex protein Nop10"
                     /protein_id="WP_004044237.1"
                     /db_xref="GeneID:8924277"
                     /translation="MKSDIRVCSAWRDRHDRPVYSLSETCPECGAATENSAPAPYNPE
                     DPHGEYRRARKRRLAEEPE"
     gene            complement(628158..628958)
                     /locus_tag="HVO_RS08060"
                     /old_locus_tag="HVO_0699"
                     /db_xref="GeneID:8924733"
     CDS             complement(628158..628958)
                     /locus_tag="HVO_RS08060"
                     /old_locus_tag="HVO_0699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044236.1"
                     /note="eIF-2A; functions in the early steps of protein
                     synthesis by forming a ternary complex with GTP and
                     initiator tRNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2 subunit
                     alpha"
                     /protein_id="WP_004044236.1"
                     /db_xref="GeneID:8924733"
                     /translation="MKYSGWPDPGELVVGKVDDIADFGVFVDLEEYEDKRGLCHISEV
                     ASGWIKNVRDHVREGQTVVAKVLEVNESSQQIDLSIKDVNEHQRKEKIQEWKNEQKAD
                     KWMALAFGEDIADDRYQSIANALLAEFESLYDGFEQAAIHGIEALDGVELDDDELETI
                     VETARQNVSVPYVNVTGYVDLRSPAGDGVDDVKEALKAAEGDGEIGDEIELSVTYVGA
                     PEYRVKVKAPDYKTAETELESSVARAREAIEAAGGTAEYHRERSGDEE"
     gene            complement(628977..629171)
                     /locus_tag="HVO_RS08065"
                     /old_locus_tag="HVO_0700"
                     /db_xref="GeneID:8925653"
     CDS             complement(628977..629171)
                     /locus_tag="HVO_RS08065"
                     /old_locus_tag="HVO_0700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007545080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S27e"
                     /protein_id="WP_004044235.1"
                     /db_xref="GeneID:8925653"
                     /translation="MAGNFYKVACSDCENEQVVFGKASSVVNCAVCGTTLATPTGGNA
                     EFHGEVVETVERRDSDELEA"
     gene            complement(629175..629456)
                     /locus_tag="HVO_RS08070"
                     /old_locus_tag="HVO_0701"
                     /db_xref="GeneID:8926106"
     CDS             complement(629175..629456)
                     /locus_tag="HVO_RS08070"
                     /old_locus_tag="HVO_0701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L44e"
                     /protein_id="WP_004044234.1"
                     /db_xref="GeneID:8926106"
                     /translation="MQMPRRFNTYCPNCKGHHEHEVEKVRTGRPTGMKWNARQTRRGK
                     ATIGNAGKFSKVPGGDKPTKKTHLKYICSDCGKAHMREGWRAGRLEFQE"
     gene            629659..629919
                     /locus_tag="HVO_RS08075"
                     /old_locus_tag="HVO_0703"
                     /db_xref="GeneID:8923956"
     CDS             629659..629919
                     /locus_tag="HVO_RS08075"
                     /old_locus_tag="HVO_0703"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044233.1"
                     /db_xref="GeneID:8923956"
                     /translation="MKKLIIHGDPGVRRDGVIEYDGEEYVLFSVDRQGDWHGPDRVQL
                     WCTAGTEDERETFEKREFVPHWLETEGVDAEAVEVVRERGAA"
     gene            complement(629916..632279)
                     /locus_tag="HVO_RS08080"
                     /old_locus_tag="HVO_0702"
                     /db_xref="GeneID:8924390"
     CDS             complement(629916..632279)
                     /locus_tag="HVO_RS08080"
                     /old_locus_tag="HVO_0702"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044232.1"
                     /db_xref="GeneID:8924390"
                     /translation="MEYALVVRWLLLFAALWAVGLPLSARLFCRLPGRGAGLALPVSL
                     VALTLPAYYVGHLSFGPVALVAGVGTLLVASAVAGLDFGALRRGDRRLAPGLDIDRRA
                     VADAAAVFLVAFLFAVALRALDPAVHAGGGEKFLDFGLLQSLARASVLPPEDMWFAGE
                     PVRYYYGGHLASILLARLTATDPSFAYNLALAGFFGVLVTAAFELGRGVATAAGANGR
                     LGGLLSAFFVGFASNLVTAGRFLLAALPEGLRRPVARAVAERSQYTVEQVLAGASNFS
                     YWSASRVIPGTINEFPLFAWLNGDLHAHMMGTPFLLLAAGLAFAYFRTPEEAVGERRR
                     LVAATTLVGAFQVVVDTWSFPSVFGVLFLGIVFAPARPWTLFSGRERVRSAVGGSAVA
                     GELARLGGTVAAVGLAGVAATVLASPFLLGAVAGGGSARTVELLSPDQRSGFGALALV
                     HGAFLAAFAGYYVRRLGAQDGLGGREWAVLVGSFAALTVVAAAQSFAALALVAPLVAV
                     GWVLLRFADDPRFETVLVVAGAGLVMLVELVYVNEQAGPGRMNTVFKTYMQVWVLWGS
                     VMGAVLAGFVGDAVAASDVSLPRVDLGVRGGAVSAVGVGFVALLVASTSVYGGLAVVE
                     HTGSAREEATLDATAFADWRHENESTAIAWLDETVEGNPTMLTAPGTKWSEAVTDKRE
                     DVMYDWRGNPESSLTGVPTVAGWAHEVGYRGPDAYYDRVRDVDAMYVGNESTRARLVE
                     RYDVQYVWVGPGERARYGEIETDVAWLTPVHRSGSVAVYEVEEARLP"
     gene            632375..633160
                     /locus_tag="HVO_RS08085"
                     /old_locus_tag="HVO_0704"
                     /db_xref="GeneID:8925451"
     CDS             632375..633160
                     /locus_tag="HVO_RS08085"
                     /old_locus_tag="HVO_0704"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007545084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_004044231.1"
                     /db_xref="GeneID:8925451"
                     /translation="MSQSVGVVVPAYRPDPERLVPYVHALVESLDPDAVRVELDAPRP
                     ETLDALDALPAVARVNDVDARRGKGAAITAGFESLRTDILAFADADGSTPAASMADVV
                     AAVRDGADLAVGSRRHPNATVASHQTVARRYLGDGFAWLARHLTEVPLYDYQCGAKAV
                     TAAAWNDVRTHLYEPGFAWDIELIAVSGAFGHRVAEVPVVWEDQPNSTVSPVDTTVKM
                     ARGLLRSRHRARTIREDRLHELIDARSDERTLVEQFSTEVADD"
     gene            633153..633620
                     /locus_tag="HVO_RS08090"
                     /old_locus_tag="HVO_0705"
                     /db_xref="GeneID:8924925"
     CDS             633153..633620
                     /locus_tag="HVO_RS08090"
                     /old_locus_tag="HVO_0705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GtrA family protein"
                     /protein_id="WP_004044230.1"
                     /db_xref="GeneID:8924925"
                     /translation="MTDRLSALVSGTRFGKFASVGAVGAVFDLSLSSLLIVFFGVANE
                     LAKLAGAELAIVVMFVINDRWTFAGAGSDLLTAKIRRFVKSNLVRSGGLLVQVLVVRA
                     LGEVSLSIPVAGIDLWELIPLPLAIGASMLLNYVAESLFTWRIATRSSQRDSR"
     gene            633681..633755
                     /locus_tag="HVO_RS08095"
                     /old_locus_tag="HVO_3029"
                     /db_xref="GeneID:8924105"
     tRNA            633681..633755
                     /locus_tag="HVO_RS08095"
                     /old_locus_tag="HVO_3029"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:633716..633718,aa:Met,seq:cat)
                     /db_xref="GeneID:8924105"
     gene            633967..634392
                     /locus_tag="HVO_RS08100"
                     /old_locus_tag="HVO_0707"
                     /db_xref="GeneID:8926866"
     CDS             633967..634392
                     /locus_tag="HVO_RS08100"
                     /old_locus_tag="HVO_0707"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008323237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_004044229.1"
                     /db_xref="GeneID:8926866"
                     /translation="MSDLERICAVGDVPDDTTFLFRVRAADDADAEELEAILVRTDDG
                     IQGWLNYCMHLTHIKLDKGSGAPMRNDEVICQNHGAYFEADTGYCNYGPCEGAVLDDL
                     DITVDGDHVFLSDDEFDYVGQGEIETDPADRSSSSNVEF"
     gene            complement(634430..635422)
                     /locus_tag="HVO_RS08105"
                     /old_locus_tag="HVO_0708"
                     /db_xref="GeneID:8925810"
     CDS             complement(634430..635422)
                     /locus_tag="HVO_RS08105"
                     /old_locus_tag="HVO_0708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008608098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched chain amino acid aminotransferase"
                     /protein_id="WP_004044228.1"
                     /db_xref="GeneID:8925810"
                     /translation="MSDDGVGDGDGDADADTGGRSLRYHVDGDLVPAESASVPVTDRG
                     FLYGDAAFETLRAYGGEVFHWDAHADRLAETCDALGMDHGLSDDDLRARIDETLAAND
                     LDEAYVRLSVTRGSQGGRLTPAEAVDPRVVVIVEPLSRGGRGSDPVWDGPATVQTVKT
                     RRIPDRSLPARAKTHNYLNGILARVELRVTGADEALMLDADGYVTEGATSNLFFVDDN
                     ALCTPSLDGPVLPGITRRVVLDLARQEGIPIRERRFTPDDVRDANEAFLTNSTWELRP
                     VETVDGIEVGDGPVTKLLSRLYDDYVERRHYGGDGGSDDADNGGDADSVGGDEN"
     gene            complement(635419..636138)
                     /locus_tag="HVO_RS08110"
                     /old_locus_tag="HVO_0709"
                     /db_xref="GeneID:8926506"
     CDS             complement(635419..636138)
                     /locus_tag="HVO_RS08110"
                     /old_locus_tag="HVO_0709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044227.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate/anthranilate synthase
                     component II"
                     /protein_id="WP_004044227.1"
                     /db_xref="GeneID:8926506"
                     /translation="MTRILVVDNYDSFAYNLVQYVGEAVSEARGGDESADGSSSDGSD
                     DVLVYRNDALSTDDVRDIDPDGIVVSPGPGTPAEAGVSVSVFRDLDYPTLGVCLGHQS
                     LCAALGSRVGHAPHVVHGKPSLVEHDGAGVFSGLPDRIEVGRYHSLAVEHEDVPPELA
                     VTAYTVAEGSEAENSDGDTGTEGDEPAVVMGVRHREKPHVGVQFHPESILTDSGKDIV
                     RNFVALAVGDGPAAAAWEGER"
     gene            complement(636135..637649)
                     /locus_tag="HVO_RS08115"
                     /old_locus_tag="HVO_0710"
                     /db_xref="GeneID:8925848"
     CDS             complement(636135..637649)
                     /locus_tag="HVO_RS08115"
                     /old_locus_tag="HVO_0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate synthase, component I"
                     /protein_id="WP_004044226.1"
                     /db_xref="GeneID:8925848"
                     /translation="MTAPTVVTDRDDFRATAAVASPGARVPVEVRVAVSDPFDAYRRA
                     RRDAGGFFYETTGGQPGWGAFGVDPAERLTADAPTDDDWGDPGVDTAPSLAALESFVD
                     SETLVRGDCDAPYPCGLFGWLSYDAARELESLPEQTTDDRGLPHLQLGLYDLVASWAE
                     PRPDDGETTLRVTCCPVVEADEDLDAVYDEARTRATDFATEAVEGEPEPVSAPVESDE
                     ATFESACGREAFADRVRAAKRYVRDGDTFQANLSQRLVAPAAVHPVDAYAALREVNPA
                     PYSGLLELPGVDLVSASPELLLRVEGDRLVTEPIAGTRPRGATTEEDEALEADLTTDE
                     KERAEHAMLVDLERNDLGKVSEYGSVEVTEYRRVDRYSEVMHLVSLVEGTRREGTSLA
                     DAVAAVFPGGTITGAPKPRTMEIIDELEATRRGPYTGSMFAVGFDDRAVLNIVIRTLV
                     RFGDEYHLRVGAGIVHDSDPQREYDETLAKARALITAIDEALGERANMTVGTER"
     gene            complement(637764..638414)
                     /locus_tag="HVO_RS08120"
                     /old_locus_tag="HVO_0711"
                     /db_xref="GeneID:8925658"
     CDS             complement(637764..638414)
                     /locus_tag="HVO_RS08120"
                     /old_locus_tag="HVO_0711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-hairpin-helix domain-containing protein"
                     /protein_id="WP_004044225.1"
                     /db_xref="GeneID:8925658"
                     /translation="MGLLDTISSLWKSLVGGDSSSSSKEGRDDTATVTVERDTRTERE
                     EANVETEAAVKEPVEETESADETAGEEADAESHADDEDTRDDAEVAADAIEEAEPEDE
                     AVEPEPESESEVEVEVEVDGEPEVEGEPELEDEDEESDGAEVEDEESDDETADNADAP
                     TVDRIRGIGPAYAERLSGIGIETIADLAAADADEVGDEIDVSPKRVQRWIDRAGDA"
     gene            complement(638458..639269)
                     /locus_tag="HVO_RS08125"
                     /pseudo
                     /db_xref="GeneID:25143416"
     CDS             complement(638458..639269)
                     /locus_tag="HVO_RS08125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044224.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /db_xref="GeneID:25143416"
     gene            639441..640412
                     /locus_tag="HVO_RS08130"
                     /old_locus_tag="HVO_0714"
                     /db_xref="GeneID:8926220"
     CDS             639441..640412
                     /locus_tag="HVO_RS08130"
                     /old_locus_tag="HVO_0714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium/sodium antiporter"
                     /protein_id="WP_004044223.1"
                     /db_xref="GeneID:8926220"
                     /translation="MSALATLISFDTALLVAGIVALYLGAEALVEGASRLAIGLGLRA
                     AIVGVTIVAFATTTPELFVAVLSGLGYSSDLGLGAIVGSNIANIGLVLGISALIEPMG
                     VSTATLRRHVPFMIAAAVVLVALGMDGNLSAVDGGVLLLILVAFTGYLLYRARSATAD
                     AIGADEIDIEDEDEVSAQFKDVVYLALGLLLLFVGSNWLIQGGQGLLESFGFGPRFIG
                     LTVLAFGTSLPELAASVISAVRGESELSIGNVVGSNIYNVVAVLGILAIMVPVNVPPS
                     TISLDFPALLVFTFGVIALMLRNRDVSRLDGGILVVGYLVFFWLILP"
     gene            640546..641862
                     /locus_tag="HVO_RS08135"
                     /old_locus_tag="HVO_0715"
                     /db_xref="GeneID:8924428"
     CDS             640546..641862
                     /locus_tag="HVO_RS08135"
                     /old_locus_tag="HVO_0715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007274366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:calcium antiporter"
                     /protein_id="WP_004044222.1"
                     /db_xref="GeneID:8924428"
                     /translation="MFGAALLTVPWLGLHTVFGVDLATGVTVALSGIAVLGASFLLAW
                     GAETAEADVPRAFALAILAVLAVAPEYAVDALYAWEAGINPGTPESAEAASLAVANMT
                     GANRILIGIGWSAIALFTVYRARDTGDEAVESRPGFLADVVRLDHGIATEILFLFAAT
                     VFAFFVPLGAGIGAVDMFVLVGLYVAYIFVAMNSPHEDEEQIGVPAYLQSYRKPKRIA
                     TTLSLFVFSGIVILVAVEPFAHGLEALGKSVGIPSFLMIQWVAPLASESPELIVVAYL
                     VNKARSTAGFNALISSKLNQWTLLIGTLVLVYSLSLGYYGPLPLDTHQMGELWLTAAQ
                     SYFAIAILITFSISLREAVALLGLFLAQFVYSVTGLALTLPIPGLGAVTFDGATSLIG
                     FSVVYLVVGTTLFVRRREQLAAVAKLSVRRVRGDYGANEIPAAVED"
     gene            641920..643239
                     /locus_tag="HVO_RS08140"
                     /old_locus_tag="HVO_0716"
                     /db_xref="GeneID:8926734"
     CDS             641920..643239
                     /locus_tag="HVO_RS08140"
                     /old_locus_tag="HVO_0716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044221.1"
                     /db_xref="GeneID:8926734"
                     /translation="MIGIVVSRADSASVHIGEHLLELADWDERTDGDRPDADGGGTVF
                     SRDGFELREFDDLHIDLDDPAEAFDADLDLVVVVSRHAGETGALLTAHFTGNFGPADY
                     GGEPGRFARACPNAQRAVIEALRERAPDDYEVGIEATHHGPTEPTVPSMFVELGSDEE
                     QWGDPEGARAVAAAVLDIEGVAPDADRQLVGFGGGHYAPRFERVLNETDWRVGHIAAD
                     WQLKAMGAPENNRDVLRRAFEASAADLALVDGDRDDLAAALEAEGFRVVSETWVRETA
                     GVPLDRVAALEADVTTVEEGLRFGARVDAGDYEVVSLPDGLLGEAQGIDLDAALSAVR
                     ETTVAFHTTEGGTRAVGRAAVAGDGYDELASRLCDVLREKHDSVVRDDGAVTATTRAF
                     DPAAAREFGVPEGPAFGKLSAGQSVEVDGETVAPEDVSKERLVEFSV"
     gene            643397..644536
                     /locus_tag="HVO_RS08145"
                     /old_locus_tag="HVO_0717"
                     /db_xref="GeneID:8925073"
     CDS             643397..644536
                     /locus_tag="HVO_RS08145"
                     /old_locus_tag="HVO_0717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006628862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_004044220.1"
                     /db_xref="GeneID:8925073"
                     /translation="MDSIVGDAIDEAEAEDMGDESAQVDGAANINRSGTMTDDELKAV
                     LKDLQTNITVVGCGGAGGNTVNRMHEEGIKGAKLVAANTDVQHLVEIGADTKILMGEQ
                     KTQGRGAGSLPQVGEEAALESQEEIYDAIEGSDMVFVTAGLGGGTGTGSAPVVAKAAR
                     ESGALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVSDTVIVVPNDRLLDAVGKLPVRQ
                     AFKVSDEVLMRSVKGITELITKPGLVNLDFADVKTVMERGGVAMIGLGESDSESKAQE
                     SVKSALRSPLLDVDISGANSALVNVTGGSDMSIEEAEGVVEEIYDRIDPDARIIWGTS
                     VDDELEGMMRTMIVVTGVESPQIYGRNGEAQAHAEERLEDIDYVE"
     gene            644717..644890
                     /locus_tag="HVO_RS08150"
                     /old_locus_tag="HVO_0718"
                     /db_xref="GeneID:8924344"
     CDS             644717..644890
                     /locus_tag="HVO_RS08150"
                     /old_locus_tag="HVO_0718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_004044219.1"
                     /db_xref="GeneID:8924344"
                     /translation="MDVKYDLNSYVRVLKLASTPSWQEFSQISKIAGAGIFLVGLLGF
                     IIFAVMSFLPGGV"
     gene            644892..645344
                     /locus_tag="HVO_RS08155"
                     /old_locus_tag="HVO_0719"
                     /db_xref="GeneID:8926747"
     CDS             644892..645344
                     /locus_tag="HVO_RS08155"
                     /old_locus_tag="HVO_0719"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004972823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor Spt5"
                     /protein_id="WP_004044218.1"
                     /db_xref="GeneID:8926747"
                     /translation="MPIFAVKTTARQEQTVADMIATKEFEQIHAVLAPDSLTSYVMVE
                     ADDDGIVTRVLEEIPHARGLVESGGAVGTSSMAEVEHFLSPTPDVEGIAEGDIVELIA
                     GPFKGEKARVQRIDETKDQVTVELYEATVPIPVTVRGDQIRVLDSEER"
     gene            complement(645525..645827)
                     /locus_tag="HVO_RS08160"
                     /old_locus_tag="HVO_0720"
                     /db_xref="GeneID:8924628"
     CDS             complement(645525..645827)
                     /locus_tag="HVO_RS08160"
                     /old_locus_tag="HVO_0720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007545106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044217.1"
                     /db_xref="GeneID:8924628"
                     /translation="MSRWKCGIEGCDGRFEDVESAVIHQTVDHERHECKVCGTVVPEG
                     YFAIRHAFDEHTRAEFVRAYDADSSAVRIREDVKDAVEADADLNSVVETLRERGAL"
     gene            645956..646690
                     /locus_tag="HVO_RS08165"
                     /old_locus_tag="HVO_0721"
                     /db_xref="GeneID:8924818"
     CDS             645956..646690
                     /locus_tag="HVO_RS08165"
                     /old_locus_tag="HVO_0721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PHP domain-containing protein"
                     /protein_id="WP_049914892.1"
                     /db_xref="GeneID:8924818"
                     /translation="MHVKILDERVVSRAKARGIDVLVYAPHFVRLPDARARAERFSDD
                     DLLVVPAREVFAGSWRDRKHVLAVGLSDPVPDFITLDGAFAEFDRQGAATLVPHPTFL
                     TVSLTAEDVAARRDDIDAVETYNTKALPRDNRRGRDIARETGLPGFASSYAHLRGTVG
                     EAWTEFDRDIDSEADLVAALREGAERRVVRRTGVSHGFRGAAEFAHLGYENSWGKIDR
                     LLLSGMEPTHPDHIAYDGRFDDVSVY"
     gene            complement(646747..647271)
                     /locus_tag="HVO_RS08170"
                     /old_locus_tag="HVO_0722"
                     /db_xref="GeneID:8924147"
     CDS             complement(646747..647271)
                     /locus_tag="HVO_RS08170"
                     /old_locus_tag="HVO_0722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_004044215.1"
                     /db_xref="GeneID:8924147"
                     /translation="MNKKGHVLNAILLALGLGVILTVDPQSFEPTMDSAFLLAQKIGQ
                     LSLPVVLGALFPDVDTAFGKHRKTLHNLPVLVIFLAFPLVFDNLQFVWIGVATHYVLD
                     MVGSKRGIALFYPLSPQEYDLPTGVATSSKHADAVTVVVTVAELGVLAGVHYFLFSLD
                     VSLADAAASFTAVV"
     gene            complement(647342..647872)
                     /locus_tag="HVO_RS08175"
                     /old_locus_tag="HVO_0723"
                     /db_xref="GeneID:8926310"
     CDS             complement(647342..647872)
                     /locus_tag="HVO_RS08175"
                     /old_locus_tag="HVO_0723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CinA family protein"
                     /protein_id="WP_004044214.1"
                     /db_xref="GeneID:8926310"
                     /translation="MREFASDPPEEVRAGDALREAGHTVAVAESCTGGLIGSLLTDVP
                     GSSDYFDRSLVTYSYDAKRHELAVSRESLDEHGAVSEAVAREMAAGVRDVADATWGLA
                     TTGIAGPEGGLPGKPVGTVFVGVAFAAPWGSGDSYARVERFEYDGSRTQVKERIARGA
                     LALLREEIESESVTTG"
     gene            648022..649251
                     /locus_tag="HVO_RS08180"
                     /old_locus_tag="HVO_0724"
                     /db_xref="GeneID:8925674"
     CDS             648022..649251
                     /locus_tag="HVO_RS08180"
                     /old_locus_tag="HVO_0724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic-transporting ATPase"
                     /protein_id="WP_004044213.1"
                     /db_xref="GeneID:8925674"
                     /translation="MDIDVEPTERPDADEDDDAGDDGPAEIEVEVTDPDEVTSTDTEG
                     LPDGIDAPDYVLYGGKGGVGKTTMAAATALASAADGTATLVVSTDPAHSLSDTLGVPV
                     PNKPSRIREEIPLYAAEIDPDAVMEGPFAGGDGADEGFDDETDFETGEYDDDNPFAGG
                     GSGDADSPFGGMGGGMGGLEDLLGGDGPMGMGGPMPGADEAAAMQQLLEYMDDPRFDR
                     VVVDTAPTGHTLRLLELPELMDSMLGRIARMRQRFSGMMDNLKGMFGGAPDDPQAGMA
                     DLDDLRERIERLRAVLRDPTRTDFRVVMIPEEMSVVESKRLVSRLDEFDIPVQTLVVN
                     RVMESVEDVANVDPEWIESPDLENCGFCQRRWQVQQDALRSATNLFRGRDVKRVPLLA
                     EQVQGEDALRVVATCLD"
     gene            complement(649318..650163)
                     /locus_tag="HVO_RS08185"
                     /old_locus_tag="HVO_0725"
                     /db_xref="GeneID:8924621"
     CDS             complement(649318..650163)
                     /locus_tag="HVO_RS08185"
                     /old_locus_tag="HVO_0725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_004044212.1"
                     /db_xref="GeneID:8924621"
                     /translation="MHQKTVLITGCSSGIGRSTALDFLDEEWEVYATARNPADIETLG
                     ERGANIATLDVTDQGDVDRVVDRIVDEQGRIDCLVNNAGYGQMGPVEDVPTEKVHDQF
                     DVNVYGPHRLVRAVLPHMRSQGDGTIVNVSSVVGRVAFPGTGVYAGSKFALEAMTDAL
                     RTEVEEYGIDAVLIEPGPVETQFSNRVEAEVNGNGDEADGLDRSGAYEKLYKLFDDSQ
                     ALGGSGPGAIPPERVAEDIVNAASSTKPRARYQPGTVARVGVLARFLPDAWRDALYGF
                     ARKLP"
     gene            complement(650251..651075)
                     /locus_tag="HVO_RS08190"
                     /old_locus_tag="HVO_0726"
                     /db_xref="GeneID:8925251"
     CDS             complement(650251..651075)
                     /locus_tag="HVO_RS08190"
                     /old_locus_tag="HVO_0726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="WP_004044211.1"
                     /db_xref="GeneID:8925251"
                     /translation="MRPARPDLAPRPGLSRDEMESLQRRVAETAVFADDLPFDSAAVS
                     LASPETEHQTLAEATALDADADSPPLVAGIDQSFLDDRALSAVVVLRGGEVVERAHVV
                     SDLELPYIPGLLSFREGGPILDALAELDCDPDLLVFDGSGRIHFRQAGLATHLGVVCD
                     APSIGVAKSLLCGTPDEDVDGRPEGWRTPIRADDSVDAVGGHPAGSETTIGYAFQSRQ
                     YDSRPVVNPLYVSPGHRLSAATTVDLVSRLSGSYKLPEPTRLADAYADEAKAQYED"
     gene            complement(651077..651967)
                     /locus_tag="HVO_RS08195"
                     /old_locus_tag="HVO_0727"
                     /db_xref="GeneID:8926663"
     CDS             complement(651077..651967)
                     /locus_tag="HVO_RS08195"
                     /old_locus_tag="HVO_0727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004972808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family intramembrane serine protease"
                     /protein_id="WP_004044210.1"
                     /db_xref="GeneID:8926663"
                     /translation="MPICDVCGKDESLPYRCSRCGGTFCSEHRLPENHDCTGLSDWDD
                     PAGVFDSSFDDSVNNEGGRGGGLLSSLTGAGGVFGYFRGNVTYLFLALMWLTFFSQLV
                     LEQFLGLSDLSISAFYLTSIHPEYVWTWVTSIFAHGGFYHIVGNSIVLFFFGPLVERY
                     VGSRKFAALFLVSGMLAGLAQVGSSMLLSPGSLSAVVGASGAIMAVLGVLTVLNPGLR
                     IYLYFIIPVPLWLFTLGFAGISVFFFVSQSADGIAHFAHLIGLVIGLAYGQRVKGRRS
                     VPSQMSLGGRGPGGPGRGRF"
     gene            complement(652485..653018)
                     /locus_tag="HVO_RS08200"
                     /old_locus_tag="HVO_0729"
                     /db_xref="GeneID:8925075"
     CDS             complement(652485..653018)
                     /locus_tag="HVO_RS08200"
                     /old_locus_tag="HVO_0729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic diphosphatase"
                     /protein_id="WP_004044208.1"
                     /db_xref="GeneID:8925075"
                     /translation="MVNLWEDMETGPNAPDEIYAVVECLKGERNKYEYDKDIPGVVLD
                     RVLHSNVHYPSDYGFIPQTYYDDEDPFDVLVLVEDQTFPGCVIEARPVALMKMDDDGE
                     QDDKVIAVPVEDPRYDHIEDLDDIPQQTLDEIDEFFATYKNLEAGKEVETLGWEDKQA
                     AKDAIEHAMDLYEENFA"
     gene            653354..653713
                     /locus_tag="HVO_RS08205"
                     /old_locus_tag="HVO_0730"
                     /db_xref="GeneID:8925011"
     CDS             653354..653713
                     /locus_tag="HVO_RS08205"
                     /old_locus_tag="HVO_0730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_004044207.1"
                     /db_xref="GeneID:8925011"
                     /translation="MSEAQTIGNESGAARDLTAFQQNILVILAEEPMYGLAIKRHLES
                     YYDTEVNHGRLYPNLDDLVEMGLVEKSELDKRTNQYELTDDGLQAVLDRFDWMLAKFV
                     TDDERAEMVSELVENKL"
     gene            complement(653749..654309)
                     /locus_tag="HVO_RS08210"
                     /old_locus_tag="HVO_0731"
                     /db_xref="GeneID:8926299"
     CDS             complement(653749..654309)
                     /locus_tag="HVO_RS08210"
                     /old_locus_tag="HVO_0731"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035240.1"
                     /db_xref="GeneID:8926299"
                     /translation="MPESELPEDVLSEAERLTRLARDAVDPDEAEAYRSARDDVVGEY
                     EFRARHREEDDVLVLHPDEWVDDDGIVDPAEIDDVDRGIERPLSGTGEDHEWSAVEEH
                     NAACVAAVAEEHGAAHAANARAFADFLGNHYVRRIETAGAPEVLEFVEEYYPRNAWPT
                     AEQRSLLPESLELLFDAADAEVPEYN"
     gene            complement(654302..654895)
                     /locus_tag="HVO_RS08215"
                     /old_locus_tag="HVO_0732"
                     /db_xref="GeneID:8923969"
     CDS             complement(654302..654895)
                     /locus_tag="HVO_RS08215"
                     /old_locus_tag="HVO_0732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004598166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI family protein"
                     /protein_id="WP_004044205.1"
                     /db_xref="GeneID:8923969"
                     /translation="MPTVECDPDEARRRLEAAGVSVSPGNTDHERWRAERGDASAVAY
                     GGKVVVQGSRPTDLLALIRPKGGRAHVYFDGASRGNPGPAAIGWAIVTSDGIVAEGSK
                     RIGETTNNRAEYEALVEALSVAEEYGYDEVDVRGDSQLIVKQVRGEWNTNDPGLKERR
                     VKARELLSAFERWSLEHVPREINDRADSLANEALDDA"
     gene            655014..655994
                     /locus_tag="HVO_RS08220"
                     /old_locus_tag="HVO_0733"
                     /db_xref="GeneID:8924642"
     CDS             655014..655994
                     /locus_tag="HVO_RS08220"
                     /old_locus_tag="HVO_0733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription initiation factor IIB"
                     /protein_id="WP_013035638.1"
                     /db_xref="GeneID:8924642"
                     /translation="MKRPTRQREREHDRTRWGDESQDDETSEEELDLDNLDPEEVVRT
                     GDGELIHEETGIIIEEERIDPGPEWRAFNHSERQSKSRVGAPTTQTMHDKGLTTTIDW
                     KDKDAYGRSISSKKRSQMHRLRKWQERIRTKDAGERNLQFALSEIDRMASALGVPRSV
                     REVASVIYRRALSEDLIRGRSIEGVATSALYAACRKEGIPRSLEEISEVSRVERKEIG
                     RTYRYISQELGLEMRPVDPKKYVPRFSSELDLSKEVQSKANEIIETTAEQGLLSGKSP
                     TGFAAAAIYAASLLCNEKKTQREVAEVAQVTEVTIRNRYQEQIEAMGIHT"
     gene            656079..657341
                     /locus_tag="HVO_RS08225"
                     /old_locus_tag="HVO_0734"
                     /db_xref="GeneID:8926669"
     CDS             656079..657341
                     /locus_tag="HVO_RS08225"
                     /old_locus_tag="HVO_0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044203.1"
                     /db_xref="GeneID:8926669"
                     /translation="MRLDEYMDIERDERAERRRLAEEKSYGILDHLETFQDRFEETVQ
                     GDSLYGGVSPSIFVGRSNYPNVSTGILSPVGHDEDAASFETSAAWYDEGVSIDDVFQR
                     RTSLLNSNRGTKVTNVADSWDGFLGTQREVAIADRPVTVEIGLDGKPSLDLDASADDV
                     ATPVGPRARARSADLAENPHVPKLVKKTLEDDDWNAEGAMTYLYRRGFDVYDINTILS
                     AGALGQTEQRRLVPTRWSITAVDDTLGQYLRGQVKHAESVDGVEIYRNEFIGNAFWVI
                     LAPGRWEFELIELKAPGSVWNPDPEAGMYLAADREGYEGRTGYVNETAGAYHASRLGV
                     LEHLQERGRQAKALVIRHVSDDYWGPVGVWQIRESIRHAFEGEMADAETFGDAVRDVT
                     EYLPVSLADLRRKSTMAAGLQTDIFDFA"
     gene            complement(657583..658038)
                     /locus_tag="HVO_RS08230"
                     /old_locus_tag="HVO_0736"
                     /db_xref="GeneID:8926199"
     CDS             complement(657583..658038)
                     /locus_tag="HVO_RS08230"
                     /old_locus_tag="HVO_0736"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF302 domain-containing protein"
                     /protein_id="WP_004044201.1"
                     /db_xref="GeneID:8926199"
                     /translation="MALPIDPSAIKPEDIGEERVVLEMEHEAAIERVREAFTDAGFGV
                     ATEFSPSEMLNEKVDAGRDPYYVLGACNPNMADRALDATDKKMGGLFPCNVVIWEEEP
                     GKQVVYHLSIMRVARLIGIAPDDDEMADIIADTGELVEQALANLDAADA"
     gene            complement(658118..658789)
                     /locus_tag="HVO_RS08235"
                     /old_locus_tag="HVO_0737"
                     /db_xref="GeneID:8924974"
     CDS             complement(658118..658789)
                     /locus_tag="HVO_RS08235"
                     /old_locus_tag="HVO_0737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CPBP family intramembrane metalloprotease"
                     /protein_id="WP_004044200.1"
                     /db_xref="GeneID:8924974"
                     /translation="MLRRRLARLPWLYRALIVGGVVGAAWSLWPLPAGDLTYRAVHDA
                     LLFILVPGALALAHGRNLGWNVDRAALRNTLLLALFVLPFYLVGSSLPSIRAYYPMWH
                     TSTALADFLPHAAQQLLVVVAAETYYRGLLCVGVREIGRKSALISPILYAFHHVGKPP
                     IEILLSAPTDVLFGLVDYESDSILPSIVAHGGGLILLDWLVLHPPLFPPERVATALQW
                     LPIPL"
     gene            complement(658792..659073)
                     /locus_tag="HVO_RS08240"
                     /old_locus_tag="HVO_0738"
                     /db_xref="GeneID:8925794"
     CDS             complement(658792..659073)
                     /locus_tag="HVO_RS08240"
                     /old_locus_tag="HVO_0738"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044199.1"
                     /db_xref="GeneID:8925794"
                     /translation="MADEEADEAPAVELGTGASVEGAPLARVASRLTWPQEKSSILNK
                     EGDAVIRTPDGPQSLEDVLAEADETYFDTRQAFVDDVFDIVGRDSVQTD"
     gene            659245..660234
                     /locus_tag="HVO_RS08245"
                     /old_locus_tag="HVO_0739"
                     /db_xref="GeneID:8926232"
     CDS             659245..660234
                     /locus_tag="HVO_RS08245"
                     /old_locus_tag="HVO_0739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044198.1"
                     /db_xref="GeneID:8926232"
                     /translation="MTSLSEAYHGGRGGPSLRRLSLGFGGFLLGVLLVVAGIVVATTD
                     VYTSGGATLGEARELGGILGGIGVPAVFLGVLAVLPASRRTRAASLIGASIAVLGVAL
                     FSHAYPCQWTGATCGAGLPDLTLETVAVYFFGTVTTFWCLFVGVANFKTRNDPGGTAT
                     VQVTKKGETRVVEVEKSGGGLGGIGFLGGTPDGDVQTQTNQSTSTASAGATDGGASTQ
                     DITPLDVEPSASPSSDGADATQSAGSAGAATNRSGVDTVQSTESARSPAGAADHPDAD
                     RPANATVGDRYCGNCTYFEYVRTSDGLKPYCAAHDEMMQDMEACDEWFPRRRE"
     gene            complement(660288..660854)
                     /locus_tag="HVO_RS08250"
                     /old_locus_tag="HVO_0740"
                     /db_xref="GeneID:8924083"
     CDS             complement(660288..660854)
                     /locus_tag="HVO_RS08250"
                     /old_locus_tag="HVO_0740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044197.1"
                     /db_xref="GeneID:8924083"
                     /translation="MTDDVGAGHPGTVASGVERAAPGDTALLLDVMLGKLATYLRMCG
                     YDAEYALDGGDETEDGADGARDPRTDPGDDSLLARADAEGRVLLTRDVRLAERAPRNV
                     LLAEREPLAQLRELESVGFAVSLDEEPSRCGVCNGRVEAVGRDEPVPDYAPDPGETAL
                     WRCRDCGQVFWRGSHWRDVETRLDGGEE"
     gene            complement(660851..662599)
                     /locus_tag="HVO_RS08255"
                     /old_locus_tag="HVO_0741"
                     /db_xref="GeneID:8924447"
     CDS             complement(660851..662599)
                     /locus_tag="HVO_RS08255"
                     /old_locus_tag="HVO_0741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase/3'-5' exonuclease PolX"
                     /protein_id="WP_004044196.1"
                     /db_xref="GeneID:8924447"
                     /translation="MSRNDEIATLLEEFADLLEAKDVAYKPSSYRRAAENVREHPTPV
                     EELAEAGEDAVQEIDRVGDAIAAKIVEYVETGRIEELEDLREDLPVDMAGLTSVEGVG
                     PKTVGKLYEALGVSDLDDLEAAARDGEIQEVKGFGAKTETNILDGIEFAREATGRELL
                     GRARPVADDLLTYLGDYDAVGRVEPAGSMRRWRETVGDIDVLAESADAEAVIDRFLAW
                     DLVGDTIEAGEQKASVRVNGMRVDLRVVEPSEYGAALQYFTGSKDHNVHLRNIAIDRG
                     LKMNEYGMFDTSDVDDPDDGPRAGTRVAGDTEASMYAALDLPLVPPELREDTGEIERA
                     ADGDLPDLLAEGDLRGDLHTHTDRSDGDNSIAEMVAAAAERGYDYHAVTDHATGPGMV
                     GGVGVADDDLLDQIAEVRAVADDADITVFTGVEANIDAEGGISVADDVLDQLDVVVAS
                     PHSALDQDRETATERLVTAMEHPAVNVLGHPTGRLINQRPGLPLDYERLAEAAVEHGV
                     ALELNASPYRLDLNGEALKIAVEAGATVAIDTDAHRPGELDHARYGVHTARRGWVETA
                     DVLNARSVEELSDFLA"
     gene            complement(662596..663036)
                     /locus_tag="HVO_RS08260"
                     /old_locus_tag="HVO_0742"
                     /db_xref="GeneID:8925301"
     CDS             complement(662596..663036)
                     /locus_tag="HVO_RS08260"
                     /old_locus_tag="HVO_0742"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044195.1"
                     /db_xref="GeneID:8925301"
                     /translation="MKEFERKQLLERVNREGATVGTQIPDRIEVQGEEIDLRQFVFEI
                     KRRDTIPSGEKERVDRAKRNLRRERLERLQRIEDNEVSYDEGRRLAEDIVGIDRALNA
                     LEQLRPVDLEQEEHRQNAADQKRWMNFLKKALGRDGGKGKRGGR"
     gene            663290..664639
                     /locus_tag="HVO_RS08265"
                     /old_locus_tag="HVO_0743"
                     /db_xref="GeneID:8925768"
     CDS             663290..664639
                     /locus_tag="HVO_RS08265"
                     /old_locus_tag="HVO_0743"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004970071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide pyrophosphatase"
                     /protein_id="WP_004044194.1"
                     /db_xref="GeneID:8925768"
                     /translation="MGLFDRLRGKDHPRVAFIGIDGVPFTLLSEHPDEFPNFAALADA
                     GSAGDIDSIVPPESSACWPALTTGVNPGETGVYGFQDREVGSYDTYVPMGRDVQATRV
                     WDRVTDAGRKATVMNVPVTFPPQRNVQRMVSGFLSPGVDKAAYPDDFRDALSEMNYKI
                     DVNAKLGHDEDKTAFMEDARKTLDRRYEAFERYIDQDDWDLFFGVFMTTDRVNHFLFK
                     DYERDGKNKDAFMEFYRTVDDYLGRIRDALPEDVTLIVASDHGFTSLDYEVHCNTWLE
                     ENGWLSYEDDDHDALSDIDEDSKAYSLIPGRFFINLEGREPRGSVPQSEYEDVRDELK
                     AELEALEGPDGNKVADRVVVKEDAFRGDHDDIAPDLVVIPNHGFDLKSGFKGHDDVFG
                     VGPRNGMHSFDNATLYVDDPGAVIEDADLYDIAPTILDLMDVEYSRTELDGASLIQQ"
     gene            complement(664655..665764)
                     /locus_tag="HVO_RS08270"
                     /old_locus_tag="HVO_0744"
                     /db_xref="GeneID:8926582"
     CDS             complement(664655..665764)
                     /locus_tag="HVO_RS08270"
                     /old_locus_tag="HVO_0744"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008611715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_004044193.1"
                     /db_xref="GeneID:8926582"
                     /translation="MSESASDPLRRSIEVEYWVVEEDGSFTDPGGLVDASPGAEREFV
                     EPVLEVKTTPCGSAAELRQELYERLGDVLSRAEEVGKRLVPLATPVSDETVTELESDR
                     TRIQNRVVGSDFQYARHCVGTHVHVEQRPGREIDQYNALVALDPALALVNSSPYYDGK
                     RLAAGARSKLYRRMTYDDVPHQGRLWRYADDTREWSRRLERRFEEFLVRAEEEGVDRA
                     TIEANFDPESAIWTPVQLRAEFGTVEWRSPDCSLPSDALRLANSVADVVKRLDDATLR
                     IDGDSGRVTDDRVVLPEFDAVLRYVNAAIEDGLDSETVRSYLDRMGFDVGAYSPVSHE
                     IDGRETVTAAEARELRLTHADRLERDVRNAVRQRE"
     gene            complement(665970..667052)
                     /locus_tag="HVO_RS08275"
                     /old_locus_tag="HVO_0745"
                     /db_xref="GeneID:8925085"
     CDS             complement(665970..667052)
                     /locus_tag="HVO_RS08275"
                     /old_locus_tag="HVO_0745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="WP_004044192.1"
                     /db_xref="GeneID:8925085"
                     /translation="MKTVLIGVGQAGGKLASALQSFDRQTGFGAVLDAVAVNTAKADL
                     QSLPVETVLIGQDRVNGHGVGGDNELGAAVMESDQTEVMSALDGRVTAEAESIFVVAG
                     LGGGSGSGGAPVLAKALAGVYDVPVYVLGILPGADEGALYQVNAGRSLKTVAREADAV
                     LLVDNDAFRSAGESMSEGYDAINEAIARRVGLLLAAGEATEGVGESVVDTSEVINTLR
                     SGGIAALGYASAEASPNAEDNINAVMSTTRRAVLTGTSLPDASDADAALVVIAGEPDT
                     IPRKGVERARRWVEDETGSMQVRGGDFPLESGRLASLVLLGGVERSERVESFMERARE
                     AIDKAETEPREDPKGMWHSDDLDDLL"
     gene            667174..667800
                     /locus_tag="HVO_RS08280"
                     /old_locus_tag="HVO_0746"
                     /db_xref="GeneID:8926450"
     CDS             667174..667800
                     /locus_tag="HVO_RS08280"
                     /old_locus_tag="HVO_0746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044191.1"
                     /db_xref="GeneID:8926450"
                     /translation="MTTDPTRSDAAVDTELGSPASSASPTADRTADRTADLAARLDAV
                     ERTITDGDADFSSLEDLAAIERRVTELESAVESLTDRLDEMDAATQAMRGYLGGVRAV
                     NEDVERRANAALAKAESLESELVDETASPAPSRSTDAPASEAASHAGRTTDGGDGSGS
                     QRAAETGLGTGTAAPSPESRTAPDSGAPTDSRGDSADRGLAARLRDAL"
     gene            667797..668258
                     /locus_tag="HVO_RS08285"
                     /old_locus_tag="HVO_0747"
                     /db_xref="GeneID:8926439"
     CDS             667797..668258
                     /locus_tag="HVO_RS08285"
                     /old_locus_tag="HVO_0747"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044190.1"
                     /db_xref="GeneID:8926439"
                     /translation="MIRVVLTCLLAVAIAGVVFPAADAARADATTVKIGSLADDIAHA
                     ATTLSAAEDPTPAGVAGAQRHVVLDVPSGSWRAAGVSNLTVRGGDGVELSASVTAGST
                     VVRRVGGPRTRVAGDRLALGPGEHRLRLTLEAAAGGSVVVIAPATANQSAA"
     gene            668291..670273
                     /locus_tag="HVO_RS08290"
                     /old_locus_tag="HVO_0748"
                     /db_xref="GeneID:8925657"
     CDS             668291..670273
                     /locus_tag="HVO_RS08290"
                     /old_locus_tag="HVO_0748"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II/IV secretion system ATPase"
                     /protein_id="WP_004044189.1"
                     /db_xref="GeneID:8925657"
                     /translation="MPLGSPSIDSLSETVAAALPDALGDRLADATGSQRDSRDSAGDC
                     GCEPAFSTPTDRPDDDTVTLAVDAGDCPHRGSLSTSAPCRAAVVEALETRDADRLVVR
                     ADGLERRYDADATGLLVAAGRFAERVRFRDDRLADRARDDPLGAAHEATGRAGPVRRA
                     AVETGLAEGASRSADYGDALRAVVGPTLARSRVDPRPPADGRLVEATDLDTGAVARRY
                     ECPRDPVYHLTPPESTLDQRAARTLEAAHDRLARGIVDAGPRAPGRAVRLAADADAPV
                     ETLAAILAKHTTGNGVLDDLFSDPAVSDVYVSTPADENPIRVVADGVSMPTNVRLAPG
                     GAESLASRLRRVSGASFSRADPTLDTVVEAGGANVRVAGVTAPASDGLGFAFRRHDET
                     PLTLPALVANGTLSADAATLCSLAVERGASVLVAGSRGAGKTTFLGSLLWELPRDVRT
                     VLIEDTPELPASSLLDADRDVQSLRTDTTGGPEPTPQEALHAALRLGDGALALGEVRG
                     EEAAVLYEAMRVGANANAVLGTIHGDGAADVRERVVSDLGVPASSFAATDLVVTCEHA
                     DEHRVARVEEVRPVGDDAAFETLFEHDGRALEPTGSVARGDSLAVESLARPGESYADV
                     LDALDARATHLASLAETERTAPDDLAAARAERGSGC"
     gene            670267..672030
                     /locus_tag="HVO_RS08295"
                     /old_locus_tag="HVO_0749"
                     /db_xref="GeneID:8924821"
     CDS             670267..672030
                     /locus_tag="HVO_RS08295"
                     /old_locus_tag="HVO_0749"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044188.1"
                     /db_xref="GeneID:8924821"
                     /translation="MLNPDTDAPADPDSNPAVRTAVTTLARLSPDSIDAEPSDELRRS
                     LAFLDAGFDPETVVAAGYGAALPAGLLGGLVALVARLPTVTVVFVALAAALGATHAVH
                     TLPVWLATLRRTRALGNAPELVGRIALRMRIEPSVERASAFAARGGDDPLSTSLAAHT
                     DRARGTPTAGLSAFADAWRAWFPALDRSTALLQTAADVPAGERDRALDRAHEVVREGT
                     RDRLADFVGSVRGPVTAVYAFGVLLPLALVGALPAARVAGVGVTAAHVAFVYDVALPA
                     CLLAAVGWVLVRRPVAFAPLSVDASHPAVDDHRLLGVAGGAVAGIVGFVAADALVAPW
                     LAPLAAAGLGTGTALFVAARPVVVLRARVRAVEDGLPDALYLVGRAVSEGEAVESALA
                     RAATSVPGETGDLLDEAVGVQRRLRVGVVESFRGEYGVLESTPGPRVAGVATLLGLAA
                     SEGRPAGRAIVSMADQLSALARLDAEARRELASVTETLSNTAAVFGPLVAGATVALAD
                     GMAPAKTLDQTAVATPLSTADLGLAVGAYVLLSAVILTTLSVGVEHGLDRHLVASRVG
                     RALVSATATFAVAFAAAGTLV"
     gene            672085..672555
                     /locus_tag="HVO_RS08300"
                     /old_locus_tag="HVO_0750"
                     /db_xref="GeneID:8924554"
     CDS             672085..672555
                     /locus_tag="HVO_RS08300"
                     /old_locus_tag="HVO_0750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044187.1"
                     /db_xref="GeneID:8924554"
                     /translation="MLDAPLDTLYTWTALSVAATVLIGTVAGLPVTPAPDASGVADAV
                     DTVAVADYDATAEHDLDADAVRIGPHRIGLRNDGGAAHATFGFGPVTPVTPDSRLGSV
                     ARGAPPSAVFDTAAEFDAAAETARDRDASWRPASELLVVRHVSWEGTDVTVVSA"
     gene            672533..672925
                     /locus_tag="HVO_RS08305"
                     /old_locus_tag="HVO_0751"
                     /db_xref="GeneID:8925874"
     CDS             672533..672925
                     /locus_tag="HVO_RS08305"
                     /old_locus_tag="HVO_0751"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013035432.1"
                     /db_xref="GeneID:8925874"
                     /translation="MSPSSRRRAQASPVAALTALLVVCAAISGYATVLDESMPTADRD
                     LASATLSNVESALEDDSGVVVLSRLSDARDACPDGFSCRVVVAVDDDRRAVGPDAPAD
                     ADTDSTRVTVRAEPGRVGFGTLRVEVWR"
     gene            672922..673806
                     /locus_tag="HVO_RS08310"
                     /old_locus_tag="HVO_0752"
                     /db_xref="GeneID:8925284"
     CDS             672922..673806
                     /locus_tag="HVO_RS08310"
                     /old_locus_tag="HVO_0752"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044185.1"
                     /db_xref="GeneID:8925284"
                     /translation="MTDLVFDVTVCLLLVSASIGLVVTADAGADTGLNGDAAVDADGV
                     ASSLATSTATVNYSLSPGVDAADPSLLDADDIDARELERTAHGSLAGLLARSTLGAVT
                     VDGVRLTRARDDFRKRAAARVASELPTRGVSVAVSWTPFPGSSVRANDTLGPEPPSSA
                     TVHSATLDVPSGFPAAREDAIAASDDGFDAVARLVADRTVAGLFPPTLARLALRGDEP
                     VSTLMAHRYERAGALAGASVAPEVAREETRAANADLAAALNPRFAKTMRARYDTPRAA
                     AEAVSVGRVTVVVRTWSP"
     gene            673794..676859
                     /locus_tag="HVO_RS08315"
                     /old_locus_tag="HVO_0753"
                     /db_xref="GeneID:8926314"
     CDS             673794..676859
                     /locus_tag="HVO_RS08315"
                     /old_locus_tag="HVO_0753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006600595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044184.1"
                     /db_xref="GeneID:8926314"
                     /translation="MVAVRLAADDRGRVPFALLGVLLLVGSATFSGALSAHDPVADRR
                     VDDAMDRATAQADAAVRAAVGDAAREAAANPVTSPANTTAGRLLSDEHTFRDYLRLRI
                     ALAATERLRAVSVGRGDVNATATLPRPTNESSLRDAMDRVSISSRENGTVLVATVENV
                     SVEVARGGRTVAADSVTTTVGVRTPVLALHDRTESFERRLDANALDGGTLDATVTTAL
                     WASAWTRGWSQYAGAPVDNVVSNDHAALATNAGVLLAEQQAFGATDADARGATGRDAV
                     RVGAQSLLSQTGAPAAPELANALPAPNPDAESPASEVPTNRTINASVGSAADHALVGL
                     LDGRGDAPAYDDVVADAHRAGVEIDAETDVLSRTEDPSENSGRGWTLVSISTDTSSSA
                     ETVPTRTPAVDADTVVVDAGSRIVTTVETTTRTFRRGNETLQTEARTETRTRVDLAAV
                     VDPAAVSAPVRPIDPAATSGGALDGENFAAAADAAADMVVTRGGFDDIACDVVTGIPP
                     EPRQTTAPMAAGLDRWVRSDLIALADRVRDRRVTVSARRVAAGEVNPAAELASDLRAD
                     RSDLVDAPAAYDGVADRARVTVRATYLDRVLATLDRRANQTAAASDAANNESKDAEFG
                     SLSEAVRAEEVARAALGDSRADGANGTANESGVRFVPDADPMYLSLGGLDGAAVPTVA
                     RGGTYHPLVARNTNLFTLPYGDAADTVLEPLFGANRRVPLRVAARTLLAADSTLENTN
                     ATNETLADRRDRLETAVDRSVVPAEEAARHTLRDHTNHSVTERQRILERSLGAWDDPA
                     RRALAITNGSAARAIAVEAAAPGTVEADLLELRLDDAFRAVRSDRSTTVPQRLTNRTV
                     ETTRTARQQAVSDTATDAAMSATEDAVADRLNDTLDSRFDTSFKRIPAGMPVAPVPGS
                     WYATVNVWDVAVAGEFAQFRVHARGDAESLTYARDGSTVALDWDDDGTAETVGRGDRV
                     SFDVETTIVVAVPPSGVGVGDIDGNADERSEGWQGGPGCTVAADCPLDE"
     gene            676918..677337
                     /locus_tag="HVO_RS08320"
                     /old_locus_tag="HVO_0754"
                     /db_xref="GeneID:8925704"
     CDS             676918..677337
                     /locus_tag="HVO_RS08320"
                     /old_locus_tag="HVO_0754"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044183.1"
                     /db_xref="GeneID:8925704"
                     /translation="MLHDAAAEPGTLSADELRAAYGDEIRRAVDAAGTEPAAEAAGVS
                     EAALSNGVLDLTLEQAAAVLELADGNPDADAIIWEFRDHLLMGMTSGILDVDTLASEV
                     DLDLSGQEIQQAIEGRTAATLNELAAIHHVIAVRNER"
     gene            677334..678230
                     /locus_tag="HVO_RS08325"
                     /old_locus_tag="HVO_0755"
                     /db_xref="GeneID:8926737"
     CDS             677334..678230
                     /locus_tag="HVO_RS08325"
                     /old_locus_tag="HVO_0755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_004044182.1"
                     /db_xref="GeneID:8926737"
                     /translation="MRVAVLGCGYVGLELARTLVADGHDVWGVRRSDDGLDAVEATGA
                     EAVRADVTDADSLGAVPDVDHVVFAASSGGRGADAARAVFVEGLRTAIDQFAARDSPP
                     ERLVYTSSTGVYGDHGGDFVDESTPLDPTTDKTRVLAEAERVAREYAAERGVEGTVTR
                     FAGLYGPDRYRLERYLNGPVTAGYLNMVHRDDAAGVVASLLETDRARDDTVLVVDDEP
                     VSKHEFADWLADECGVPRPEKRTKEERLDAGDLSAAARRRILTSKRCSNDYLRELGYS
                     FAYPTYREGYRAAIDAYRADGD"
     gene            678332..679516
                     /locus_tag="HVO_RS08330"
                     /old_locus_tag="HVO_0756"
                     /db_xref="GeneID:8925894"
     CDS             678332..679516
                     /locus_tag="HVO_RS08330"
                     /old_locus_tag="HVO_0756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004972741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_004044181.1"
                     /db_xref="GeneID:8925894"
                     /translation="MFGPVGQFDTGAIFESLDSFVRTHPEIAAALVVALGALALVVYA
                     AIRFKRPMGTRFAEALEGVDEIAVLMHPNPDPDAMAAAIGVACLAEQVGTTPTIQFAG
                     QIRHQENRAFRTVLDLDLDPIDHVSDLAAEAVVLVDHNEPRGFAGAEGILPYAVVDHH
                     PGDGTGEAFTDVRTDYGACSSIVAEYFRDVGAKPVPPDMHASEVNASYTVPSQVATGL
                     VYGILTDTKHLTAGCSAADFDAAGFLFPGVNEDHLDRIANPEVSREVLEAKARAIAGR
                     DVRGPFAVADIGTISNVDAIPQAADELIQLEGVTAAVVCGERESNVYLSGRSRDDRVH
                     MGRTLEAALDHYRGSSAGGHARMGGGQIIRPDAVTDGGNGESVPRDELVEHIFEALSG
                     DI"
     gene            679608..680699
                     /locus_tag="HVO_RS08335"
                     /old_locus_tag="HVO_0757"
                     /db_xref="GeneID:8926062"
     CDS             679608..680699
                     /locus_tag="HVO_RS08335"
                     /old_locus_tag="HVO_0757"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase"
                     /protein_id="WP_004044180.1"
                     /db_xref="GeneID:8926062"
                     /translation="MATGRATWAYRDRFGDSFGRTFYRRFGPGVVSSIGIGTYLGEPT
                     DAVDDRYRESLVSALEHGVNLVDTASNYRHGRAERVVGDAVRGADVDRDAVVVASKAG
                     FVPFDRERPDDPGAYVRETVLDAGLADPDELAHGSHTIAPAFVDEMVDRSLDLTGLDH
                     VDCYYLHNPETQLAVTDRETVYDRVEAAFEVLERRVAADDIGRYGVATWEALRVAPDH
                     DAYLSLPELVRRAERAAETVGNDDHSLEAIQLPFNVVMADAFTVEAHDTDAGEAMSAL
                     WYAHEHGLHAFTSASLAQGDLAAEIPASVNSVLAGDTAAQRALNFSRSAPGVTAALVG
                     ASSVEHVAENVAAGTFDPLGARTFDSVFE"
     gene            681073..682233
                     /locus_tag="HVO_RS08340"
                     /old_locus_tag="HVO_0759"
                     /db_xref="GeneID:8924400"
     CDS             681073..682233
                     /locus_tag="HVO_RS08340"
                     /old_locus_tag="HVO_0759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008607023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004044178.1"
                     /db_xref="GeneID:8924400"
                     /translation="MVLLVNLARVVFAPLLGEFILFFEVDRATVGIVATLVWLGSAAL
                     RVPTGWLLTRVPRHRVVLGTGVVLVVASGVTASATTIEALMVGAVSMGLASGAYFVAA
                     NPLVSELFPDRVGRAMGIHGTASQLAAVGVAPFVTLVLAVGPDLVDRLPFVSAAWQLV
                     FVCVGLAAAVVTLALFVTARSTDLPDAGAADRDLLGAARTEWRVVLTGIVILGFTGFV
                     WQGLFNFYELYMVSKGLPATTARNMLTVVFGAGVPAFFLSGRLADKLPRIPYILGVLV
                     SFVVSVFVLTMTSSLVGLIVVTAVVGYVIHSLFPALDAYLLDTLPDESRGSAYSVYSF
                     GMMIFQASGSGVVGTLTDFGYAFDEVFFWFSVGLAVVVTGLIVFQRAGRIPN"
     gene            682316..683422
                     /locus_tag="HVO_RS08345"
                     /old_locus_tag="HVO_0760"
                     /db_xref="GeneID:8925091"
     CDS             682316..683422
                     /locus_tag="HVO_RS08345"
                     /old_locus_tag="HVO_0760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044177.1"
                     /db_xref="GeneID:8925091"
                     /translation="MEYVQERVTTLHDLSGSVPDAPTDRAAVVVPMTEREYAGLAADR
                     VLSTLESLSPARVVVPLRAPADRVAPFADWLDEYDLPLDVLWCDGPRVADLLDSHGLD
                     GERGKGRDVWLALGCAAREEYVVVHDADTKTYDERYVPRLLFPLAHGHDFSKGYYARV
                     EEERLYGRLFRLFYAPLVRALEAETDAPIVRYLDSFRYALAGEFAATSDLAVRMRSPR
                     KWGLEVGTLGDAFAHAGFDRSAQVDLGEYEHDHRSVSGPTGLSDMSESVGRTLLRAVV
                     EHGGSVEFDTLAERYREAGHRLVEQYAVDAAFNGFDYDRGDEREQVATYADAISKPGE
                     DTRLPAWNDTSLSPDEVLAAAGDDLDDVREGAGR"
     gene            683419..683907
                     /locus_tag="HVO_RS08350"
                     /old_locus_tag="HVO_0761"
                     /db_xref="GeneID:8925406"
     CDS             683419..683907
                     /locus_tag="HVO_RS08350"
                     /old_locus_tag="HVO_0761"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007275160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044176.1"
                     /db_xref="GeneID:8925406"
                     /translation="MSEATYDDLAGVVDLFGALTREELETALDELAFKQGRETDGDAL
                     SGAISDAVDAYYLVPYEDDETDAELLTVGPMAFPTLPDRAEDLPHILDYPTREVPRDE
                     LATQVESRLRAAAASAVQTGDADEIERLLDVTYDLEAWADTDVGSIRERLDAALDAEG
                     QA"
     gene            683937..684533
                     /locus_tag="HVO_RS08355"
                     /old_locus_tag="HVO_0762"
                     /db_xref="GeneID:8926371"
     CDS             683937..684533
                     /locus_tag="HVO_RS08355"
                     /old_locus_tag="HVO_0762"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA pyrophosphatase"
                     /protein_id="WP_004044175.1"
                     /db_xref="GeneID:8926371"
                     /translation="MDLAGVTRHEPVTVDAGRRAAVIAPVVFRDERPHILFTKRADHL
                     GEHPGQMSFPGGGREPSDADLRATALRESNEEIGLRPEEAAFHGRLDDIRTVTDYAVS
                     PFVATVPDRAYEPDQREVAEIAVLAVGDLIDRANYESERRDHPQYGEIRLHFFHVDGY
                     TVWGATGRMLVQLLELTTDWRVPEEVDRVVDPDADYPV"
     gene            complement(684671..685159)
                     /locus_tag="HVO_RS08360"
                     /old_locus_tag="HVO_0763"
                     /db_xref="GeneID:8924155"
     CDS             complement(684671..685159)
                     /locus_tag="HVO_RS08360"
                     /old_locus_tag="HVO_0763"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004972722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="WP_049941502.1"
                     /db_xref="GeneID:8924155"
                     /translation="MDFDYSRGVTGYVLVLTRLITGYWFLHAGLGKITGEPFSAAGYL
                     ANAPAASPLQGFFAWAAATPWLLDLTNVMIPWGEFLIGLGLIVGALVRLAAFFGGVLM
                     VFFYLGNAEWGHGVVNGDLFGLMMFVIVGTLAAGRILGLDAIIEKMEFVRQRPALKYL
                     LG"
     gene            685589..686371
                     /locus_tag="HVO_RS08365"
                     /old_locus_tag="HVO_0764"
                     /db_xref="GeneID:8924658"
     CDS             685589..686371
                     /locus_tag="HVO_RS08365"
                     /old_locus_tag="HVO_0764"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004044173.1"
                     /db_xref="GeneID:8924658"
                     /translation="MLTAERAVSKAGLDAVALKPAECDVREALSVPLDVVAIDYEGRE
                     RLPDEDVLRDLAAEKEVRLTTPVRTDGFDPLGDDSLYEWLPDGVRQVLVAGHGAYLTD
                     DEARRAVAPRLRAARERAPDAWVGTEGIERIALAAGGTQYELLSRSTRRDVRALRAAG
                     FGGEVALYAPTALTDDDDEILDAVGAYVSRRRPVARALPDDAATDASAEGRAREVLLK
                     ASRDYALIGSVDDIRRRIDDLRDAGIDLVVGYPARGVDEFAE"
     gene            686654..687820
                     /locus_tag="HVO_RS08370"
                     /old_locus_tag="HVO_0765"
                     /db_xref="GeneID:8925437"
     CDS             686654..687820
                     /locus_tag="HVO_RS08370"
                     /old_locus_tag="HVO_0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004064373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding oxidoreductase"
                     /protein_id="WP_004044172.1"
                     /db_xref="GeneID:8925437"
                     /translation="MNESARVAVVGAGAVGLTTAFDLAERGARVTLFERDVPGRGSTG
                     RAAGICYDAYAEDIDAAVAGSAMDRFRSLSGEGGFAFHETPYVFLAREGDDAAAAALE
                     ESVERMRVHDRAVSLVGADELGDRFPIRTDDVLLAGVAENAGWADPAAYVDLFVEQCE
                     SAGVAFRVGDAVTLRTDPPAVAVDDVVTARFDAVVVAAGVHSRRLLADAGHPIALKPY
                     RAQALVADCDYRGPTVYDATDESYLRPHPGGVLAGDGVEPVEPDPDDWDPTADDWFVA
                     DALDGVRHRTGIDGFDEAGEAAAEADQSDSAWAGLCGATPDRNPLVGAVAEGVYVAAG
                     WHGHGFMWAPAIGERLAEAVLGDGRERIPAAFDPRRFDGDEEFAVVEGMTLDGD"
     gene            complement(687866..688354)
                     /locus_tag="HVO_RS08375"
                     /old_locus_tag="HVO_0766"
                     /db_xref="GeneID:8926238"
     CDS             complement(687866..688354)
                     /locus_tag="HVO_RS08375"
                     /old_locus_tag="HVO_0766"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp20/alpha crystallin family protein"
                     /protein_id="WP_004044171.1"
                     /db_xref="GeneID:8926238"
                     /translation="MSDLRKYGESAANAVLERVGRGVSQMQERKPLAHDLLESEDAYL
                     VVFDAPGARAEDVQVRFLDGEVEIRIDRFRDFHEGYEMRFPGRGLTLSGTATIPSDAS
                     VEAAEGTATVGKHGTLQIRIPKDERASDIAVTEEEDEADGEADTESDDEVDFGDVDDQ
                     DA"
     gene            688631..690328
                     /locus_tag="HVO_RS08380"
                     /old_locus_tag="HVO_0768"
                     /db_xref="GeneID:8923915"
     CDS             688631..690328
                     /locus_tag="HVO_RS08380"
                     /old_locus_tag="HVO_0768"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_004044169.1"
                     /db_xref="GeneID:8923915"
                     /translation="MTDPADLTVTIVDGYVDEPAHFGVPPYISTYPRFTAGAVVDAGV
                     PESNVVYHTIDELREDRQKWRDVADADLMIYIGGMTVPGKYVGGTPAEPDEVRELAWV
                     AEGTALMGGPIRFGVGDENAGGQDMERKNLDYDFVAKGDIEAAAYDLVDSGLEGFGNR
                     MRDNEELDRWAAMGAFVVEQHPSHPDHLICEMETSRGCAYRCSFCTEPLYGNPAFRTA
                     DSVVKEVENLYDRGARHFRLGRQADILAFGGDGEAPNPDALRRLYGGIREVAPDLGTL
                     HLDNVNPITIVGWPEKSREALRIIAEHNTAGDTAAFGLESADPVVQEENNLNVTADEC
                     FEAVKIVNEVAGWRPGDDPADAPTHGSDAANRLPKLLPGINLLHGLKGEREETFEHNK
                     RFLQRVYDEGLMVRRINIRQVMAFDGTDMSDTGADIARDHKQLFKTYKTEVREEIDRP
                     MLRRVAPAGTVLPNVHLEYHQDGRTFGRQLGTYPLLVGIPGERELGKTIDVAVVDHGY
                     RSVTGVPYPLDFNEASMDELTAIPGIGRSTAGDIVVNRPYADAADVGVDADVTKYVQ"
     gene            complement(690496..690900)
                     /locus_tag="HVO_RS08385"
                     /old_locus_tag="HVO_0769"
                     /db_xref="GeneID:8925828"
     CDS             complement(690496..690900)
                     /locus_tag="HVO_RS08385"
                     /old_locus_tag="HVO_0769"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAM domain-containing protein"
                     /protein_id="WP_004044168.1"
                     /db_xref="GeneID:8925828"
                     /translation="MEISDKLLCLFNADVRTEDDRYVVEIPRREVETGTVEPGETYRV
                     ALISRESNEPAESEPNAGPTPTNEPQPPVEAGELRYVEIEDIGKQGDGIARVERGYVI
                     IVPGTEVGERVKVEITEVKSNFAVGEVVEDDF"
     gene            complement(690965..691660)
                     /locus_tag="HVO_RS08390"
                     /old_locus_tag="HVO_0770"
                     /db_xref="GeneID:8926561"
     CDS             complement(690965..691660)
                     /locus_tag="HVO_RS08390"
                     /old_locus_tag="HVO_0770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YkgJ family cysteine cluster protein"
                     /protein_id="WP_004044167.1"
                     /db_xref="GeneID:8926561"
                     /translation="MDLDAELDRARDLDVSELADAIESIGFECTRCGACCKGYEGDDG
                     PEPHTATVFPDEVRALQEAGGDDSKGESGTPMEWRDVARPMPYGLVEGDDGPEGETFE
                     WALQTTACGDCRFYEGDDSGRGACQVHEDRPLICETYPFSVALGGTSQPMGEAVDEEG
                     VVRAHECEGLGRDISRADAEELARALKERAVRELREARGVTDAYESVETGPGEVVVHD
                     SEGAKRPDGTRVQ"
     gene            complement(691757..692545)
                     /locus_tag="HVO_RS08395"
                     /old_locus_tag="HVO_0771"
                     /db_xref="GeneID:8926604"
     CDS             complement(691757..692545)
                     /locus_tag="HVO_RS08395"
                     /old_locus_tag="HVO_0771"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008577615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_004044166.1"
                     /db_xref="GeneID:8926604"
                     /translation="MHATRVSVLVATATRAPTGATNAYLVAGGGDTLLVDPAARTDRL
                     DDLVAREGVDHLAVTHTHADHVGAVAAYARETGATVWCRRGRERAFSAATGVDPDRTF
                     AEGTTVPVGAGVEVLDTPGHARDHVSFVAGDDVLCGDLAVAEGSVVVGAPEGDVRAYL
                     VALRRLHARGPERLRPGHGPEITDPRATLARLVAHRNDRERAVLDAVRAGNATPDAVT
                     DAAYDKDVSAVRDLARATVVAHIEKLAAERRVRWDPEAERVEPR"
     gene            complement(692660..692932)
                     /locus_tag="HVO_RS08400"
                     /old_locus_tag="HVO_0772"
                     /db_xref="GeneID:8924600"
     CDS             complement(692660..692932)
                     /locus_tag="HVO_RS08400"
                     /old_locus_tag="HVO_0772"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004044165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_004044165.1"
                     /db_xref="GeneID:8924600"
                     /translation="MSTTTAEPDTEDLLSEAEFRERLRELPPSAKLVAKVLESDAPLS
                     QGQLAEESLLPDRTVRYALNRLEESDLVGSRYSFKDARKQVYFLNT"
     gene            693320..694084
                     /locus_tag="HVO_RS08405"
                     /old_locus_tag="HVO_0773"
                     /db_xref="GeneID:8925255"
     CDS             693320..694084
                     /locus_tag="HVO_RS08405"
                     /old_locus_tag="HVO_0773"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_004044164.1"
                     /db_xref="GeneID:8925255"
                     /translation="MRSVKGKEWYQADEVAQEYDSKRFSKGGRLIDRREKEAVLAALG
                     PVEDKNILEIACGTGRFTVMLAQEGANVVGLDISRAMMVQGREKARRAGVADRIEFLR
                     GDAARLPFPDDHFDAVFAMRFFHLADAPAKFLAEMARVSKGQVFFDTFNDGSLRVAYN
                     WLLPMGSRLYSERDVRRLLGDAGLDLAGAKHDFVIPFGFYRKVPNGIAQAFRSLDLAV
                     GDSPLGDDLASVSYWNARVESADESSRAATRASDAE"
     gene            694155..695057
                     /locus_tag="HVO_RS08410"
                     /old_locus_tag="HVO_0774"
                     /db_xref="GeneID:8925510"
     CDS             694155..695057
                     /locus_tag="HVO_RS08410"
                     /old_locus_tag="HVO_0774"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004057495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_004044163.1"
                     /db_xref="GeneID:8925510"
                     /translation="MDLSVVLPTLNGRDRLATSLDALAEHAPDAEVVVVNGPSADGTT
                     GMVRERDDVDVLVEISDRNLNVARNAGLEVAGGDVVALLRYDLSVES