GenomeNet

Database: RefSeq
Entry: NC_014108
LinkDB: NC_014108
Original site: NC_014108 
LOCUS       NC_014108              84653 bp    DNA     circular CON 10-MAR-2020
DEFINITION  Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B,
            complete sequence.
ACCESSION   NC_014108
VERSION     NC_014108.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603901
            Assembly: GCF_000025565.1
KEYWORDS    RefSeq.
SOURCE      Enterobacter cloacae subsp. cloacae ATCC 13047
  ORGANISM  Enterobacter cloacae subsp. cloacae ATCC 13047
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
REFERENCE   1  (bases 1 to 84653)
  AUTHORS   Ren,Y., Ren,Y., Zhou,Z., Guo,X., Li,Y., Feng,L. and Wang,L.
  TITLE     Complete genome sequence of Enterobacter cloacae subsp. cloacae
            type strain ATCC 13047
  JOURNAL   J. Bacteriol. 192 (9), 2463-2464 (2010)
   PUBMED   20207761
REFERENCE   2  (bases 1 to 84653)
  AUTHORS   Wang,L., Ren,Y., Ren,Y., Zhou,Z., Guo,X., Feng,L. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2010) TEDA School of Biological Sciences and
            Biotechnology, Nankai University, 23 Hongda Street, TEDA, Tianjin,
            Tianjin 300457, China
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001920.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 09:36:17
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,506
            CDSs (total)                      :: 5,389
            Genes (coding)                    :: 5,208
            CDSs (with protein)               :: 5,208
            Genes (RNA)                       :: 117
            rRNAs                             :: 9, 8, 8 (5S, 16S, 23S)
            complete rRNAs                    :: 9, 8, 8 (5S, 16S, 23S)
            tRNAs                             :: 85
            ncRNAs                            :: 7
            Pseudo Genes (total)              :: 181
            CDSs (without protein)            :: 181
            Pseudo Genes (ambiguous residues) :: 0 of 181
            Pseudo Genes (frameshifted)       :: 79 of 181
            Pseudo Genes (incomplete)         :: 82 of 181
            Pseudo Genes (internal stop)      :: 27 of 181
            Pseudo Genes (multiple problems)  :: 7 of 181
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..84653
                     /organism="Enterobacter cloacae subsp. cloacae ATCC 13047"
                     /mol_type="genomic DNA"
                     /strain="ATCC 13047"
                     /sub_species="cloacae"
                     /culture_collection="ATCC:13047"
                     /type_material="type strain of Enterobacter cloacae"
                     /db_xref="taxon:716541"
                     /plasmid="pECL_B"
                     /note="type strain of Enterobacter cloacae subsp. cloacae"
     gene            1..219
                     /locus_tag="ECL_RS26940"
                     /old_locus_tag="ECL_B001"
                     /db_xref="GeneID:9111707"
     CDS             1..219
                     /locus_tag="ECL_RS26940"
                     /old_locus_tag="ECL_B001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087271.1"
                     /db_xref="GeneID:9111707"
                     /translation="MAVRPPEAMPLTWARDGSPKGRDAQRLDAQHDSPVLRLRRGTTL
                     QKIIPVTCNEKENSQQQENYDYQRNIHY"
     gene            complement(611..1369)
                     /locus_tag="ECL_RS26945"
                     /old_locus_tag="ECL_B004"
                     /db_xref="GeneID:9111586"
     CDS             complement(611..1369)
                     /locus_tag="ECL_RS26945"
                     /old_locus_tag="ECL_B004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087274.1"
                     /db_xref="GeneID:9111586"
                     /translation="MNLISRLTDALNTKIAELVDIRQKQQARILKAFSDLNNGIEPNE
                     DRNGRLHAPCDGYEHFETGELYGKGQFIVMPEYDDWYSPASYPAKSYDPNTRFKGLTA
                     DYQETVKLMESFGLRVKTGRRWHENGHEYCYFTVTGHKPLIGAIAKTVEAIQAEQREH
                     EKQYKGVAPAGKVTVKATIKGVKMVESGFGHSIRLIPKMIITLENGATAYGTMPKVLV
                     DQDAKAGHAFTLKATFKQDKNDSTHAYFTRPSVC"
     gene            complement(1532..2380)
                     /locus_tag="ECL_RS26950"
                     /old_locus_tag="ECL_B005"
                     /db_xref="GeneID:9111587"
     CDS             complement(1532..2380)
                     /locus_tag="ECL_RS26950"
                     /old_locus_tag="ECL_B005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4942 domain-containing protein"
                     /protein_id="WP_013087275.1"
                     /db_xref="GeneID:9111587"
                     /translation="MTTAINPEIVCEFASSSEVIPSISIENILTRAAYAMTTFSDGLA
                     KLREAQQLMKDTTDDKMYGYIEVVRNGLGGSSDDATIKRMKRLLDAGIWSRLMNETGM
                     KTLMSHKQIDDWEKQLDTENMPEATLDNILSSFRALNQDKGQIFEQGVTDVFKKLSWD
                     YKTNCPCKIGKKIIVNSMVGSSYSKNCYYVTDEGRNKLNDLEKMMSILDGRNVPDHRI
                     AAGALFYDFTRENMWNGENFEHEYFTVKYFKARTGHIIFKRMDLVDKLNDIISRQYGT
                     VLPSRV"
     gene            complement(2570..3250)
                     /locus_tag="ECL_RS26955"
                     /old_locus_tag="ECL_B006"
                     /db_xref="GeneID:9111588"
     CDS             complement(2570..3250)
                     /locus_tag="ECL_RS26955"
                     /old_locus_tag="ECL_B006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087276.1"
                     /db_xref="GeneID:9111588"
                     /translation="MNTSAVKFLPSLYEPGVSVREDIARNLLKIVAYGRMAYKEIDSR
                     LDYYYLDGFVEITGITDITSAVLLADHLYKNNAWQYRNPNIDYSCEFFDSEDGGPQSF
                     NFQYLEILDRHGKRVMSASHNWKKAALQWETCIISEPRKTAAIEELKAIADQASEERR
                     GDNYDSARRLDLQYEKLLTRFVTSSYNRQAICEELENSSAMTQQATSLRLSIALAKSS
                     LTCNSLPF"
     gene            complement(3347..3595)
                     /locus_tag="ECL_RS26960"
                     /old_locus_tag="ECL_B007"
                     /db_xref="GeneID:9111589"
     CDS             complement(3347..3595)
                     /locus_tag="ECL_RS26960"
                     /old_locus_tag="ECL_B007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160311.1"
                     /db_xref="GeneID:9111589"
                     /translation="MSTQNSLNTRNMLARNIYVGLQILLDGKFFTVTQVEKGEYCGQE
                     VIEIDFEWPENCDVLHAGFYTPGEVVKVHSSSNQVLCI"
     gene            complement(4105..4599)
                     /locus_tag="ECL_RS26965"
                     /old_locus_tag="ECL_B009"
                     /db_xref="GeneID:9111591"
     CDS             complement(4105..4599)
                     /locus_tag="ECL_RS26965"
                     /old_locus_tag="ECL_B009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system YhaV family
                     toxin"
                     /protein_id="WP_013087279.1"
                     /db_xref="GeneID:9111591"
                     /translation="MEYLELNGWKICFHKCFLDQIAELAQKVAELKAAKPNEYHKKKE
                     TKLLIAIERVIEEWIASDPLNPQYRQGDTLGDEYKHWFRVKFLQQFRLFYRCSQEHKT
                     IIIGWVNDFDTLRAYGSKTDAYKVFAEMLKAGTPPDDWNTLLNAAKKATATNTIPGFL
                     TRQP"
     gene            complement(4620..4964)
                     /locus_tag="ECL_RS26970"
                     /old_locus_tag="ECL_B010"
                     /db_xref="GeneID:9111592"
     CDS             complement(4620..4964)
                     /locus_tag="ECL_RS26970"
                     /old_locus_tag="ECL_B010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system PrlF family
                     antitoxin"
                     /protein_id="WP_013087280.1"
                     /db_xref="GeneID:9111592"
                     /translation="MATQMLNSADVSLRAESRLTERSQTTIPAAIRDALHLKPGESIH
                     YTLLAGGKVIMSKKEEEQDDPVVPQFLAFLENDMKKNPQNIAPVPALFWESIKALTAG
                     VEVDLDAPLTDD"
     gene            complement(5286..5504)
                     /locus_tag="ECL_RS26975"
                     /old_locus_tag="ECL_B011"
                     /db_xref="GeneID:9111593"
     CDS             complement(5286..5504)
                     /locus_tag="ECL_RS26975"
                     /old_locus_tag="ECL_B011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AbrB/MazE/SpoVT family DNA-binding
                     domain-containing protein"
                     /protein_id="WP_013087281.1"
                     /db_xref="GeneID:9111593"
                     /translation="MRKVSVFTNGNNRAIRIPRDMDFEGVRELVISREGDTITLRPVR
                     PSWESLKDVEKADPDFLVDRDPVIEDKD"
     gene            complement(5744..5974)
                     /locus_tag="ECL_RS26980"
                     /old_locus_tag="ECL_B013"
                     /db_xref="GeneID:9111595"
     CDS             complement(5744..5974)
                     /locus_tag="ECL_RS26980"
                     /old_locus_tag="ECL_B013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087283.1"
                     /db_xref="GeneID:9111595"
                     /translation="MPLTYITDLKAGERDILTPLKHYPLVIRSLDGETLHTQAAPVQG
                     WTHDTLTAVQPQGVNNGAEAYLNAHWIGSTEV"
     gene            complement(5965..6228)
                     /locus_tag="ECL_RS26985"
                     /old_locus_tag="ECL_B014"
                     /db_xref="GeneID:9111596"
     CDS             complement(5965..6228)
                     /locus_tag="ECL_RS26985"
                     /old_locus_tag="ECL_B014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1380 family protein"
                     /protein_id="WP_013087284.1"
                     /db_xref="GeneID:9111596"
                     /translation="MVGTPEEVLAYLQQVYPDTVISVIVWTRSEVRDVAERHGYTLTD
                     EEADSVLYDLAHNENHEYGENEQSAYGYICALKNVEPENFICP"
     gene            complement(6335..6616)
                     /locus_tag="ECL_RS26990"
                     /old_locus_tag="ECL_B015"
                     /db_xref="GeneID:9111597"
     CDS             complement(6335..6616)
                     /locus_tag="ECL_RS26990"
                     /old_locus_tag="ECL_B015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160304.1"
                     /db_xref="GeneID:9111597"
                     /translation="MVEARSCVAVSVFSRNGVKALHFSGIPKLSGHKGTLNFPFDENV
                     SLFTQVEKIMLANNMCHNVTRVDPLRHNETESVYSVTFNRRLLKSTVRK"
     gene            complement(6764..7282)
                     /locus_tag="ECL_RS26995"
                     /old_locus_tag="ECL_B016"
                     /db_xref="GeneID:9111598"
     CDS             complement(6764..7282)
                     /locus_tag="ECL_RS26995"
                     /old_locus_tag="ECL_B016"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087286.1"
                     /db_xref="GeneID:9111598"
                     /translation="MFTKFFPLIFPAPVLEQVRQRLAVADKQVIDETITGFTYAMQAI
                     GYTPSLHPAGCLILSECQNCKSSYATRYEMKHHFYFACPHCQTITKGIFKAAIWNQRE
                     ENRLLTTKGEEFWHSEGHTVYDRKHRQSYEVDERGNLTQDDIPDYVLGRIDTAQLEDA
                     ERRRLAWIESAD"
     gene            complement(7272..7646)
                     /locus_tag="ECL_RS27000"
                     /old_locus_tag="ECL_B017"
                     /db_xref="GeneID:9111599"
     CDS             complement(7272..7646)
                     /locus_tag="ECL_RS27000"
                     /old_locus_tag="ECL_B017"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160300.1"
                     /db_xref="GeneID:9111599"
                     /translation="MNGKAKKGGQIGINGQKYKGGQFLPASKHTVKGQLRTRKASFKP
                     RSALTEPGKVEQLPPGKIAIFGTIRAFVQIENGAMTITATDHSLSAYGYTRDSMQALV
                     DQYNTGERLIDAPDHKESDNVY"
     gene            complement(7658..8005)
                     /locus_tag="ECL_RS27005"
                     /old_locus_tag="ECL_B018"
                     /db_xref="GeneID:9111600"
     CDS             complement(7658..8005)
                     /locus_tag="ECL_RS27005"
                     /old_locus_tag="ECL_B018"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_079972020.1"
                     /db_xref="GeneID:9111600"
                     /translation="MPPNLKQKPGITPKRTPAVIRDGVVIMNIFPQSVVLPDPAATPL
                     TDEQVEDLYAYVCMNGKMTNNDNRFSLAIAQTEEETVLIPEVPDFYIVFINAERWPVA
                     AAAPMDNLFHLLG"
     gene            complement(8034..8465)
                     /locus_tag="ECL_RS27010"
                     /old_locus_tag="ECL_B019"
                     /db_xref="GeneID:9111601"
     CDS             complement(8034..8465)
                     /locus_tag="ECL_RS27010"
                     /old_locus_tag="ECL_B019"
                     /inference="COORDINATES: protein motif:HMM:NF015205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="WP_013087289.1"
                     /db_xref="GeneID:9111601"
                     /translation="MSEAPVVLIKQETTELGRLVFHTLLFREYCEYANLAAVSFMKRF
                     CDKYETGYWSYFKVGSNSGFMCPDAHEFYHFEMPNYFSGNVTAEAAGIIVTLYVLQSC
                     FDAAWKRQDSGLCDHFREAMDTLKDYAATTDESHSIFRAID"
     gene            8831..9019
                     /locus_tag="ECL_RS27015"
                     /old_locus_tag="ECL_B020"
                     /db_xref="GeneID:9111602"
     CDS             8831..9019
                     /locus_tag="ECL_RS27015"
                     /old_locus_tag="ECL_B020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013087271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087290.1"
                     /db_xref="GeneID:9111602"
                     /translation="MVVRPPEAMPLTWARDGSPKGRDAQRLDAQHDSPVLRLRRGTTL
                     QKIIPVTCNEKENSQQQE"
     gene            complement(9282..9719)
                     /locus_tag="ECL_RS27020"
                     /old_locus_tag="ECL_B022"
                     /db_xref="GeneID:9111604"
     CDS             complement(9282..9719)
                     /locus_tag="ECL_RS27020"
                     /old_locus_tag="ECL_B022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087292.1"
                     /db_xref="GeneID:9111604"
                     /translation="MNTKMLNNTEELTQATVSLFGIFAPHIPLAVYNYMEEYVFAYRY
                     KGFAIKEIEDGHEYFLPLHIERISMITPMDKQLLDVTPDALGVLLTLHCYSQCIKSDL
                     SALSEENKLNASNQIAVLKEKRAYLLDYAIKTFPPEYFVMLLK"
     gene            complement(9785..10270)
                     /locus_tag="ECL_RS27025"
                     /old_locus_tag="ECL_B023"
                     /db_xref="GeneID:9111605"
     CDS             complement(9785..10270)
                     /locus_tag="ECL_RS27025"
                     /old_locus_tag="ECL_B023"
                     /inference="COORDINATES: protein motif:HMM:NF018871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1419 domain-containing protein"
                     /protein_id="WP_044160353.1"
                     /db_xref="GeneID:9111605"
                     /translation="MTTTTLNPPRITNLYFYVPGRYSPMDIVCLDPNSNTPPTSDDYF
                     GLYSKKSLSDFQSEYPNIVILTGEEMSTRIYEAAKKPVSEISINRYTDMLEVLPPLRW
                     VSSSGNTTFMLSERFTNNITDIYAKIQVGDDKYRYFTFRDEDTLTHRQIVEKVMLFLN
                     R"
     gene            complement(10559..10891)
                     /locus_tag="ECL_RS27030"
                     /old_locus_tag="ECL_B024"
                     /db_xref="GeneID:9111606"
     CDS             complement(10559..10891)
                     /locus_tag="ECL_RS27030"
                     /old_locus_tag="ECL_B024"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087294.1"
                     /db_xref="GeneID:9111606"
                     /translation="MEVMLAIVSLFILLINISSVVDFVRGFISKATSKALFIAGCSFM
                     SVYIITKALVDEPNIGEGNVLSNIGVGLQSFFSAIYLYAGIVFLIGALVRKVLEKKGL
                     VKKEKSRD"
     gene            complement(11045..11539)
                     /locus_tag="ECL_RS27035"
                     /old_locus_tag="ECL_B025"
                     /db_xref="GeneID:9111607"
     CDS             complement(11045..11539)
                     /locus_tag="ECL_RS27035"
                     /old_locus_tag="ECL_B025"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087295.1"
                     /db_xref="GeneID:9111607"
                     /translation="MNKKRQIIWEIVLISIAIFFFVIMLPGLAMSAGTFGNAYLDGLN
                     ELSPYGIKAGFVAITMIILSYLICYFLKLNNEFIKNPFRATCTGIIILPLAKGALNYF
                     SEFSKDSRTVTSPYDKALGNFNIFNEGLLKFIMYALPVALCVCSIIYILIKFISLFKE
                     RYFR"
     gene            complement(11802..12470)
                     /locus_tag="ECL_RS27040"
                     /old_locus_tag="ECL_B027"
                     /db_xref="GeneID:9111609"
     CDS             complement(11802..12470)
                     /locus_tag="ECL_RS27040"
                     /old_locus_tag="ECL_B027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_109455550.1"
                     /db_xref="GeneID:9111609"
                     /translation="MRIVRKLAAVRSPREVLSVLCRITADRIDPALAGRTEDRENAEK
                     LTGDYSPVEKEMLETLIRMLPQILQDNPRDFLGECVMSLELGNSAMGQYFTPGSLASL
                     KFEILKQDYASEIRKHGFIIVQEPAVGSGGLIIKIANGLADAGFNPSAALFVSCADKD
                     VYAADMAFTQLSLLGIAAEVSTGDTLHMDFRKTRYTLAYWLNGFNERLKYRRIYETMA
                     GVGI"
     gene            complement(12593..13036)
                     /locus_tag="ECL_RS27045"
                     /old_locus_tag="ECL_B028"
                     /db_xref="GeneID:9111610"
     CDS             complement(12593..13036)
                     /locus_tag="ECL_RS27045"
                     /old_locus_tag="ECL_B028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160349.1"
                     /db_xref="GeneID:9111610"
                     /translation="MYYFYIPGSYSVLEPAQVDGNQSRGTHSGETLEQLKHQYPQIVL
                     LHMDDCFAAIRDAARMPVEVISESTFDLFYRSKIMDECHSNQGCTFKCREFNAADIVT
                     CFASVIIYDKPMFATFRDVDSLTHEQIISRVRDFIEATMTVNSGV"
     gene            complement(13086..13358)
                     /locus_tag="ECL_RS27050"
                     /old_locus_tag="ECL_B029"
                     /db_xref="GeneID:9111611"
     CDS             complement(13086..13358)
                     /locus_tag="ECL_RS27050"
                     /old_locus_tag="ECL_B029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087299.1"
                     /db_xref="GeneID:9111611"
                     /translation="MSQPKPRYSNTTEVEIRPETLRNAANWTPPTVDEISEVLNRAGI
                     KWGQLAVITGNTESIVAGWKEGKEHISYMAWRYICESAGYGRIDRA"
     gene            complement(13407..13850)
                     /gene="radC"
                     /locus_tag="ECL_RS27055"
                     /old_locus_tag="ECL_B030"
                     /db_xref="GeneID:9111612"
     CDS             complement(13407..13850)
                     /gene="radC"
                     /locus_tag="ECL_RS27055"
                     /old_locus_tag="ECL_B030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_013087300.1"
                     /db_xref="GeneID:9111612"
                     /translation="MNHEDSIINLAMAILESRLKTTSFSFTSPDAVKQYLRLHLQNKE
                     REFFGALYLNNQHQLISFELIHSGTINSCVISPREVARLALMLNAQAVIFAHNHPSGT
                     PEPSRADINMTARLKTALELFEISTLDHFIVAGNDVVSMAERGHI"
     gene            complement(13998..14366)
                     /locus_tag="ECL_RS27060"
                     /old_locus_tag="ECL_B031"
                     /db_xref="GeneID:9111613"
     CDS             complement(13998..14366)
                     /locus_tag="ECL_RS27060"
                     /old_locus_tag="ECL_B031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087301.1"
                     /db_xref="GeneID:9111613"
                     /translation="MTIQPYVCTDPEIIALREKMAALVKTHDLPVFDFNVKAEIPARN
                     VLLKACESLDKILNELIANTDITAKSAFCAKVSSYANKIDYCLSYYHRMSPPLSVAYR
                     PMQFRIAWYAEQSKNSVVTG"
     gene            complement(14889..15134)
                     /locus_tag="ECL_RS27065"
                     /old_locus_tag="ECL_B032"
                     /db_xref="GeneID:9111614"
     CDS             complement(14889..15134)
                     /locus_tag="ECL_RS27065"
                     /old_locus_tag="ECL_B032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087302.1"
                     /db_xref="GeneID:9111614"
                     /translation="MTDLVRNTVILALIFTSVIYAIGYYLGGDSTDNATDSMRVDVWH
                     CQDTRSSANFAVFVKSNNGGAENIMLRNDAGDIQCFK"
     gene            complement(15301..15606)
                     /locus_tag="ECL_RS27070"
                     /old_locus_tag="ECL_B033"
                     /db_xref="GeneID:9111615"
     CDS             complement(15301..15606)
                     /locus_tag="ECL_RS27070"
                     /old_locus_tag="ECL_B033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087303.1"
                     /db_xref="GeneID:9111615"
                     /translation="MIIALKSLLKTINGCKRMKTLFEDIVLKNTKQFIFRVQELNDGS
                     YEVIQQACRVFPDKRVVVQSEKKWHYADLTALREGEYAKSRQGRLFLDDQFWIGKLA"
     gene            complement(15651..16748)
                     /locus_tag="ECL_RS27075"
                     /old_locus_tag="ECL_B034"
                     /db_xref="GeneID:9111616"
     CDS             complement(15651..16748)
                     /locus_tag="ECL_RS27075"
                     /old_locus_tag="ECL_B034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DGQHR domain-containing protein"
                     /protein_id="WP_044160346.1"
                     /db_xref="GeneID:9111616"
                     /translation="MSEALTVPSSTSKTIGFDYPCVVGFQGNQRIIIVQVSFGALSRF
                     LTLDNEGHTLDRSQRELNRRRATAFADYVVSAVKSGTDYIIPPLIGNCDGELTLNLMN
                     ESFVGYVTIPMDARIRLFDGQHRQAGIREVLDILPDIRHHSVTVMLTENLPVETRQQF
                     FADINGNASKPSAAINIAYDQTNVIGQIVKRAIMNNPVLAEKVDFERNTVSTRNGNKW
                     VSFKSLHDATERFSTYVADGVPRKRTEQEISSVWDAWVKFTGLNDTCGFTYGEYNQEW
                     LTFTSVMVNAFGFAVKQLLEEMTVSDLTERLECMGDKKNLAARESYFVYANWADSCVS
                     RETGKIIATTKGQRAAAEYLVKAIRSVNYNF"
     gene            complement(16891..17100)
                     /locus_tag="ECL_RS27080"
                     /old_locus_tag="ECL_B036"
                     /db_xref="GeneID:9111618"
     CDS             complement(16891..17100)
                     /locus_tag="ECL_RS27080"
                     /old_locus_tag="ECL_B036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160343.1"
                     /db_xref="GeneID:9111618"
                     /translation="MYEYSDVYDECENGGPDGGPIILSRNQVIGILKQHGHLTPQQWM
                     HFFREAGLTLVNAYPATAVFQWLNY"
     gene            complement(17124..17522)
                     /locus_tag="ECL_RS27085"
                     /old_locus_tag="ECL_B037"
                     /db_xref="GeneID:9111619"
     CDS             complement(17124..17522)
                     /locus_tag="ECL_RS27085"
                     /old_locus_tag="ECL_B037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087307.1"
                     /db_xref="GeneID:9111619"
                     /translation="MDDLRDFFSDALIGSFDDFIKSYPKFGWDNLSLLDDWNAQQIRP
                     LLNLYHKQNGIELACDRRIFVVAPNPKPTGYPVRVTHYFEHLGALCDAEVDSPEQAII
                     DCLTSYPDCQPAFGKLDSWMGDTMFANSFR"
     gene            17654..17953
                     /locus_tag="ECL_RS27090"
                     /old_locus_tag="ECL_B038"
                     /db_xref="GeneID:9111620"
     CDS             17654..17953
                     /locus_tag="ECL_RS27090"
                     /old_locus_tag="ECL_B038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087308.1"
                     /db_xref="GeneID:9111620"
                     /translation="MRILRRQVFKAAIEQYPEQKADIAALLSFLGRINIMTPQELQDL
                     FPEASLEENGLTQIGFAGSFAGGNLIFKGRFNYPGQFVLTEEIQPAQVNENKTDG"
     gene            17946..18362
                     /locus_tag="ECL_RS27095"
                     /old_locus_tag="ECL_B039"
                     /db_xref="GeneID:9111621"
     CDS             17946..18362
                     /locus_tag="ECL_RS27095"
                     /old_locus_tag="ECL_B039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_013087309.1"
                     /db_xref="GeneID:9111621"
                     /translation="MDKNKINEAVEVLSTELPWLDIIEDDASYQDALTALSELSADNS
                     TPACLLKLISSCIAEYEAHRYPEVLTGPDGKMSHGSDALMTLMRHRKIKGKDMADILE
                     LSPALMSSILSGKRALTIAHICKLADFFGVSRSVFI"
     gene            complement(18521..18724)
                     /locus_tag="ECL_RS27100"
                     /old_locus_tag="ECL_B040"
                     /db_xref="GeneID:9111622"
     CDS             complement(18521..18724)
                     /locus_tag="ECL_RS27100"
                     /old_locus_tag="ECL_B040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087310.1"
                     /db_xref="GeneID:9111622"
                     /translation="MSAKTKYDCYNVQGRKLGYVLLDDEGKGLRDIFIENKAVIKAYY
                     PGTVFIKPARKDKSQVKERRTKK"
     gene            complement(18729..19007)
                     /locus_tag="ECL_RS27105"
                     /old_locus_tag="ECL_B041"
                     /db_xref="GeneID:9111623"
     CDS             complement(18729..19007)
                     /locus_tag="ECL_RS27105"
                     /old_locus_tag="ECL_B041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087311.1"
                     /db_xref="GeneID:9111623"
                     /translation="MKVVAKYKRVEISFPHEIVSLTFDSVKDALAYTEFYKRVSLIRE
                     RANIDSKYPSELYDYLKDKGVISKELFESRQRMLRKAHLLSTISSKWM"
     gene            complement(19699..20214)
                     /locus_tag="ECL_RS27110"
                     /old_locus_tag="ECL_B044"
                     /db_xref="GeneID:9111626"
     CDS             complement(19699..20214)
                     /locus_tag="ECL_RS27110"
                     /old_locus_tag="ECL_B044"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087314.1"
                     /db_xref="GeneID:9111626"
                     /translation="MLNETTRVINYSKPQKTVERYNFITEELLTILHSSPKAFVYILK
                     LACSNAFNLSEEDAFRIIDDLSERVPQSELESALGSIDNSTLIELKKRPEISTDVIQV
                     LDEDGFQLAALLARHTYGDMSETSDDQALLNDIAVKTGSGTYVTSYKQGDFHIRVSTN
                     LPSYQTILELR"
     gene            20262..20546
                     /locus_tag="ECL_RS27115"
                     /old_locus_tag="ECL_B045"
                     /db_xref="GeneID:9111627"
     CDS             20262..20546
                     /locus_tag="ECL_RS27115"
                     /old_locus_tag="ECL_B045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087315.1"
                     /db_xref="GeneID:9111627"
                     /translation="MSKLSYSEKKQLQESLKYIPLPIMCFTDDNLWIGSKLKLLPERY
                     RHDIANLYTVIFFRKLHDRTIPVLKRKGEARKAANAFLLNIVDSVENGNK"
     gene            complement(20565..21269)
                     /locus_tag="ECL_RS27120"
                     /old_locus_tag="ECL_B046"
                     /db_xref="GeneID:9111628"
     CDS             complement(20565..21269)
                     /locus_tag="ECL_RS27120"
                     /old_locus_tag="ECL_B046"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087316.1"
                     /db_xref="GeneID:9111628"
                     /translation="MYSLLIKDRSYPIAVYMNYMTRVKGFTRTQAVDVLTTAAVKMGI
                     RDSAAAPANNTVAEWGKSIEAPLWSVVSAMTILEQFGKVPFTDQEWAFWSYAVVERGG
                     DTVSYTGKWQEWIRKAQVYKAQYEKRGDIRRKLAFATSPQMAMKVILAFRGNQRRSLS
                     IAEVFANIDNSAETVSRVTRKVNSSECFNDEDVMEVVSVNDNAKKLYAELLLTIQELA
                     DHKLIDYRSSGNITIT"
     gene            complement(21272..22651)
                     /locus_tag="ECL_RS27125"
                     /old_locus_tag="ECL_B047"
                     /db_xref="GeneID:9111629"
     CDS             complement(21272..22651)
                     /locus_tag="ECL_RS27125"
                     /old_locus_tag="ECL_B047"
                     /inference="COORDINATES: protein
                     motif:HMM:NF014273.1,HMM:NF020124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB N-terminal domain-containing protein"
                     /protein_id="WP_054442349.1"
                     /db_xref="GeneID:9111629"
                     /translation="MTNKLAGGLSKLSQAASARKDNVSGTIILVKPSDCFEEDNPRTD
                     FDENLIESYVADFLDPEIGQKEPIQLYPANKEGKYRVQHGATRLRAGLIAEKDNPAFK
                     LKAIVDNSLNNKDELENYFDRAMNNIKRDNMTLLDRANFIGNYLDKAKQSGKPVTQAE
                     IAKRLGFKGGASYVSRLLKLRDMTPEMSEVYQSGNIDDIEALATLAEIQKDKPELFKS
                     LIELPDLDRATIRKAKKTGKIKETETGTQQETAGHDTEPKSKTEPSANTILSQSEVDD
                     SVVAIPFVDYLFQTGRVNILIKTADNGFLAALETVFEHGINAEVDFKDSVLWATEDEA
                     IDFGKKQIKDWAEVVLAEKDSLSVEEYQDIVGYLNTLKNVNPQNDNSEKNKDSGSRKA
                     KTGQLTAVIFVEVNGEEGLLLLKVPKDHIGADESNVHTNGFVYVQIGSEIRAVKEGEY
                     VIKSVSYRE"
     gene            complement(22660..23520)
                     /locus_tag="ECL_RS27130"
                     /old_locus_tag="ECL_B048"
                     /db_xref="GeneID:9111630"
     CDS             complement(22660..23520)
                     /locus_tag="ECL_RS27130"
                     /old_locus_tag="ECL_B048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003400180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="WP_013087318.1"
                     /db_xref="GeneID:9111630"
                     /translation="MTKKPSNLKKTLLSQAVIKAIKSLCPVLCTGNGKGGVGKSTWAF
                     HIAAAAVEAGLKPLLIDMDEHLTLTVTGSTHPELPDYAFSCDMFTDEGITKPIMELEL
                     LPGCWFLPRDSRLDEVNSTPFESGIVLYPHSHLESLREQFDLIIIDTPPGKGNLQQAA
                     FLCADTAAMITELSNVSIHGLVTAISVIEQLVETLTDGETDSPYKVPAFIVVPNKYNS
                     RSDGEKALLSELRTNEILLTNEVNVRTPIKFATDNLVPIWKINNGNARLAAKEMRSAI
                     KTILELAVKK"
     gene            23859..24200
                     /locus_tag="ECL_RS27135"
                     /old_locus_tag="ECL_B050"
                     /db_xref="GeneID:9111632"
     CDS             23859..24200
                     /locus_tag="ECL_RS27135"
                     /old_locus_tag="ECL_B050"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087320.1"
                     /db_xref="GeneID:9111632"
                     /translation="MTTLYVRKQGKPKGSKPPATTASRVKKYRQNLRDTGGCTVTVNL
                     DSKEIEQIEIYRKTSLLPSSVSRSEVIKSMACILGGGVYFIRGHEIRASVNITEIPEY
                     PAWMKNYLMIP"
     gene            24343..25146
                     /locus_tag="ECL_RS27140"
                     /old_locus_tag="ECL_B051"
                     /db_xref="GeneID:9111633"
     CDS             24343..25146
                     /locus_tag="ECL_RS27140"
                     /old_locus_tag="ECL_B051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4225 domain-containing protein"
                     /protein_id="WP_013087321.1"
                     /db_xref="GeneID:9111633"
                     /translation="MDIALFPGQNRRQWADTMINLEARKLVNTANTVAAMHISDSLTR
                     LKFVDEIRQVIMQQFEAARRATSDEDCIACLKKLRLENSSLLEQSRMLKTGYARIYAE
                     VRYVTDQNKIVGYFISGIKVVLAGVQAVFGGVMIASMTPVGMLAGAVLVGDALNTVSR
                     EAARQLLNEPASQGILADGAMSIAEFMGFSRDVGLGVFNATTLAASVYSVFGLTGKAE
                     AWRLFRYLPGDYYRKVQTMSPGKLSMKVLGWGVSAKVVLELLTHDDQNR"
     gene            complement(25121..25450)
                     /locus_tag="ECL_RS27145"
                     /old_locus_tag="ECL_B052"
                     /db_xref="GeneID:9111634"
     CDS             complement(25121..25450)
                     /locus_tag="ECL_RS27145"
                     /old_locus_tag="ECL_B052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160339.1"
                     /db_xref="GeneID:9111634"
                     /translation="MPVEEHDLHASGFTKKEVARIKRHLETGDSLDRVLFDLSGYFRM
                     FIWVCIGMAVITILSVIFGSPSQAISCAIAVAFLLIVFLLVMPVKVGYKSWKLLRTHV
                     NDFDRRG"
     gene            complement(26235..27284)
                     /locus_tag="ECL_RS27150"
                     /old_locus_tag="ECL_B054"
                     /db_xref="GeneID:9111636"
     CDS             complement(26235..27284)
                     /locus_tag="ECL_RS27150"
                     /old_locus_tag="ECL_B054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160336.1"
                     /db_xref="GeneID:9111636"
                     /translation="MKVNENQPDTNLYHELIPEAIRYRPSRRGEFNTLRKGLSKIHRR
                     YTPTFEIKKQPKGIGAQLFACICNHDWNRNPALIALRQKGYTPFSRQFDPNFKPKPRR
                     LGVRSESREALTALHFSLAANCDYNPSSEYPFEICVPFEEIARQMGVLHRYENGRTAC
                     DVAYHALRVTEEMGHAIVVREFDKDSRQYKALRIFLTVDFFTSKGITLEHLKKMLTRF
                     QAWTRKNGLSETLKQRNERHLLRLERLDLSIEKRHSLKKLLKRIKWQITSPELIKEKE
                     KAVSSLQEAIDAKQPVKLHAAAKAKWLQYLNSGRSMPIITTRLEAELSKEQPTLRHID
                     EEQFYRLLLARAGVE"
     gene            complement(27493..27774)
                     /locus_tag="ECL_RS27155"
                     /old_locus_tag="ECL_B056"
                     /db_xref="GeneID:9111638"
     CDS             complement(27493..27774)
                     /locus_tag="ECL_RS27155"
                     /old_locus_tag="ECL_B056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087326.1"
                     /db_xref="GeneID:9111638"
                     /translation="MYNWKLDTAVKLAKENFLSGIQIAFDNGSTRPYHLHFMTRCGDT
                     AQLVTTHTQKEKRKVRDFSTKGSVIRFLDARFPGYDNLLKDEVKVTKTV"
     gene            27891..28331
                     /locus_tag="ECL_RS27160"
                     /old_locus_tag="ECL_B057"
                     /db_xref="GeneID:9111639"
     CDS             27891..28331
                     /locus_tag="ECL_RS27160"
                     /old_locus_tag="ECL_B057"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087327.1"
                     /db_xref="GeneID:9111639"
                     /translation="MSGKREGVKGYKQIHLKKFSKTISHNLRLLALSRDLPQYELHDK
                     IITDFIEDAEMIQRPPVIDQSGENVSSADTQELTAALSARLVIQQPPLVDQCGYNVFI
                     GPEAQERAAALSAKLKIPESEIFYSALFAFADRYKLSQPLDKVG"
     gene            28408..28731
                     /locus_tag="ECL_RS27165"
                     /old_locus_tag="ECL_B058"
                     /db_xref="GeneID:9111640"
     CDS             28408..28731
                     /locus_tag="ECL_RS27165"
                     /old_locus_tag="ECL_B058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087328.1"
                     /db_xref="GeneID:9111640"
                     /translation="MSHPNGWIYKRFKIEDDLMQTIDNLADTRGEQKADIIAETVEWL
                     VKNRTEGTVSPRYFSSPDNATYKGVWLKPDTIRTIKMLSSADNQNPNRVIYTAICRFI
                     DKDKS"
     gene            29022..29454
                     /locus_tag="ECL_RS27170"
                     /old_locus_tag="ECL_B060"
                     /pseudo
                     /db_xref="GeneID:9111642"
     CDS             29022..29454
                     /locus_tag="ECL_RS27170"
                     /old_locus_tag="ECL_B060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569418.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:9111642"
     gene            29454..30320
                     /locus_tag="ECL_RS27175"
                     /old_locus_tag="ECL_B061"
                     /db_xref="GeneID:9111643"
     CDS             29454..30320
                     /locus_tag="ECL_RS27175"
                     /old_locus_tag="ECL_B061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbC family protein"
                     /protein_id="WP_013087331.1"
                     /db_xref="GeneID:9111643"
                     /translation="MNFKKAVVAIAIVLGMTSQIAHAQNATDKPVADSSSMKAAQDQL
                     AASFNGMSITGFGESPVKGIYEVKTGSNILYFHPGEDGKKGVLIFGEMYDSSGVNLTE
                     QSKMNGLTDTLKGLPLDSAITIGPKDAPVYYEFTDPDCPYCHAYDEWIKTYSKDHPVQ
                     RKLIFMVNPGHPLARAKIEHVICSDDKDAAVRYVYSSELPHNPDGADAMQMAKQKALK
                     TCKEADAVIEQHAKILQAVGVNGTPSFLFNVDTKPNLIVGFNQQKIAAAITELEKPAV
                     TKLEKPSAKPAK"
     gene            30334..30738
                     /locus_tag="ECL_RS27180"
                     /old_locus_tag="ECL_B062"
                     /db_xref="GeneID:9111644"
     CDS             30334..30738
                     /locus_tag="ECL_RS27180"
                     /old_locus_tag="ECL_B062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein TraE"
                     /protein_id="WP_013087332.1"
                     /db_xref="GeneID:9111644"
                     /translation="MQTICKNNFSALSININKSPSFVDSHMQKLRKAMESRQAKLITA
                     FFMALALLAVSQGVFAFTTPSTGSFGYNVYDIAINKIASGPIGFVGGAWLIAMGSTKM
                     NEGWTRALPFILAGSCLIKLDEITQSLGATIF"
     gene            30751..31032
                     /locus_tag="ECL_RS27185"
                     /old_locus_tag="ECL_B063"
                     /db_xref="GeneID:9111645"
     CDS             30751..31032
                     /locus_tag="ECL_RS27185"
                     /old_locus_tag="ECL_B063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087333.1"
                     /db_xref="GeneID:9111645"
                     /translation="MDYGFREGRFFRYPHQPIQIFWFDRDEWMILIACYLASMQLGGF
                     TWAVLFPVSIVIIKIKRTKGRGFFRHTLYKLGLVEIYGYPNSSAKKLEE"
     gene            31036..31668
                     /locus_tag="ECL_RS27190"
                     /old_locus_tag="ECL_B064"
                     /db_xref="GeneID:9111646"
     CDS             31036..31668
                     /locus_tag="ECL_RS27190"
                     /old_locus_tag="ECL_B064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087334.1"
                     /db_xref="GeneID:9111646"
                     /translation="MFKKPNKLPAKKVVTEALNDQQKQKSETKFFRAALIAAVVLNGL
                     TYQKVDKLEKNQTTIIVPYGAKSSDLLITGESASAEYMRMLLRLVIADYGSISKATID
                     SKFSSLLGLVYPDRNEAVRVKLNERSKYFKQFNTVSQLMELLPEQAITITENPEDIKY
                     TTAAKKKYRIQFSVETRKIIGEEAKPAETQKMYIDYTVSEGRFWILDIQG"
     gene            31672..32463
                     /locus_tag="ECL_RS27195"
                     /old_locus_tag="ECL_B065"
                     /db_xref="GeneID:9111647"
     CDS             31672..32463
                     /locus_tag="ECL_RS27195"
                     /old_locus_tag="ECL_B065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system secretin
                     TraK"
                     /protein_id="WP_013087335.1"
                     /db_xref="GeneID:9111647"
                     /translation="MKKALLVFLTVMSAQTIAADKKTFPQNTQRVLPEVSTQVVLSNR
                     DVNRLVCESGEATKPVYSKEKPVEVGVGSDRRSFWVKFKYLAQDGVNHYYSEPTELYL
                     TCGTSTFELIALPKYENPHKVLLGSDTKDRIKDNQALFGSLPLEEAAIALTTKIISDG
                     SGGKGLPESFEVVPDRGSWMQNIYDSRGRHIPIEIRKERDVLVDGTGLRGSQYTIRAL
                     NNVTLTETMFLNSNFGTNIFAITAESLSLSRGQLSSLVIVHRETM"
     gene            32463..33710
                     /locus_tag="ECL_RS27200"
                     /old_locus_tag="ECL_B066"
                     /db_xref="GeneID:9111648"
     CDS             32463..33710
                     /locus_tag="ECL_RS27200"
                     /old_locus_tag="ECL_B066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_013087336.1"
                     /db_xref="GeneID:9111648"
                     /translation="MVDNKFPLIEKARAWFHRQPSAQQKNIKKYGTIGTFVIIALGIY
                     YLTGQDKKKPVEPPKQTDVAEAKTSSYVQDDIVSTLGGQIKDLKSGIDNQVKDAVADA
                     MAKGQFSLTPPPAAVDTNTPAGSSQTAQSENAQSPASGNAADGTGMLSYPTPPAYTDP
                     SSQGGKQDSGNGEEPSVVWVGGISDGNGDIGMAAPQEDNSAKKNEIQLPVGFMKAKLL
                     VGVNALTGQYGSDNPQTVMFRVQAPAQLPNFIKMNLRGCFVIANASGNLSAERIIVLP
                     VSMHCMTMDGGYIVEGDVTGFVSDRDGKRDMSARVVSRAGRLMAATVFAKSIEGFANV
                     IGNQSIQQNVSPLGSINTIKPDEASKNAAATGVAGGFTEVSKYLLNLVQQTSPALETG
                     PGKDVTLFVQKTATLEIKQVRIK"
     gene            33710..34228
                     /locus_tag="ECL_RS27205"
                     /old_locus_tag="ECL_B067"
                     /db_xref="GeneID:9111649"
     CDS             33710..34228
                     /locus_tag="ECL_RS27205"
                     /old_locus_tag="ECL_B067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraV family lipoprotein"
                     /protein_id="WP_013087337.1"
                     /db_xref="GeneID:9111649"
                     /translation="MKLAKISLLLLGSSILSGCSLLPYHSDFACKLEDGYGKCISSDD
                     AYIEATTGVDMGHAITEDGVADDPKGSAAKTAATNQAAATKADPSYQQYRDRVYKQMA
                     QLVEAPQTPVVRQPTVVRTLILSYSPGLDDQTAYMPRYVFTMLNGPKFVLTDYKLSTD
                     DSAPSFLMGGKG"
     gene            34229..36772
                     /locus_tag="ECL_RS27210"
                     /old_locus_tag="ECL_B068"
                     /db_xref="GeneID:9111650"
     CDS             34229..36772
                     /locus_tag="ECL_RS27210"
                     /old_locus_tag="ECL_B068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraC family protein"
                     /protein_id="WP_013087338.1"
                     /db_xref="GeneID:9111650"
                     /translation="MLNTLKTVAERHLFLRNEVTKSDILNMAVRDQPSEYLPYLAFKK
                     RLPGEDVDTNAFINFDNTLGWIWELKPLAFMGNDKLDKLHGIVRSQFPKGTVCQWILY
                     PDHNLNSHIEEYCNIRDKSDPVTAMNMAQMEKFLREGADGVAKLFNIPLRNFRLFFTI
                     KHEQRISEELLVAIHESFGIAGMEPRRWEASDLIKWAGEFFSGEPNNGLYDPERQLRK
                     QMNATNIDLSDPGSLIYAGHRYGVCLYPNVVPQGKNNPLNTNELFGGYMGVEDDMRQI
                     KSPFLYTLTIVYDDLRKNITDKATQTMFQRVGAGLAHSLRQRMEEYHIMQSMMAKDSK
                     FHYMIPQLWVFGKTEKEAFEAAAQAKNLWEGFDFQMMYEQSIKNVMFYTALPFGFYNI
                     ESNIDNIDRHFYLDNENIARFLPVQTDFRGGGRPVQSLIGRKGQLISLDMYDKRANAH
                     NFVVIAETGGGKSFFLNSMIDDYASIGAKTRIMDLGKSYEKLTRIRKGRYIDFNLENP
                     ICINPLDFVANDDEDLAQNISAAQIVFSSAAYAFTGQYVNELEANLIDQACRHAYSSG
                     DGIRGTDAVTDFLTSGKFLESEYSDKHKKSIEEIQGVAFQLAYLLKAFKSDRAFGKFF
                     CGPTTFNIKDDDFVCTDLEKLRSVKQLFFPMVMNLMNAITMDLYLSDRSRPSIILVEE
                     VASMLQKTGMVSMDGLTQMINEGYRRARKYRGAMGIVLQSPLDYEVLPGLGPVVKANA
                     QWRYYLESRMYDEAVKKGLLPNITEGFPLKLLSSVRNARPRYGEVFIDCPLGMGVARL
                     CVDQWRYWVNTSDGADVAAFDRLMAEGKEPVDALKILSGVNPDVLRAGR"
     gene            36769..38799
                     /locus_tag="ECL_RS27215"
                     /old_locus_tag="ECL_B069"
                     /db_xref="GeneID:9111651"
     CDS             36769..38799
                     /locus_tag="ECL_RS27215"
                     /old_locus_tag="ECL_B069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraN"
                     /protein_id="WP_013087339.1"
                     /db_xref="GeneID:9111651"
                     /translation="MKNVNILALGAFMLPVSFAHAQIQATPDTAKITASKDIAGSISS
                     TVKGKTSNASRLNESQIRPVSGENNMRTYDGQTAFNGKAVCKGSSEFMRMLVQPTTNG
                     NLKLLNIMQDTDMNGSLDITTSPGWDISVVCSNGFQTCSDANNAATCTSWAWVADPKS
                     YQLGRKNVAMTELGGCYCINNSCGSNLAWNNLGQILNDLGGGASQALSRANPWFTLSQ
                     IKVDGVSASFVGGDTASCSIGDSEGFFGTADGKKILNYKDNYNAMKTDANSQKTTSDA
                     YRMITEGSLNPNETSDVYSCDITRNVNLDEPKLNEIIAFDGGQGSVQQCGTDCLQLVL
                     GRLGDNYWSGTCKYFEVDSNFFIKDHTRIASATLINAVFDDWMQLWAGDKVVWSGPYG
                     NWNDAGPVPGACELSKSWNQSPNTDFKKYLDKNGPVKFKIRVEVSGEGEGYALVRLKA
                     DLSCREGDEYVSNTCTAYEQDQNCQLVDETVDGVKTFTGSINTGLIPLPQTQVLQGSF
                     CSVAVKRDWFKKKRQYRCNRKTDFNFDKIIERKAYIDKTVTPGDYKDKMFNNGKVTYG
                     AGELFWPDMPKVGDCINMCKTRKPKQTPDMAVSGQVDKNNKASVIKYDNFYYECDATN
                     KCPAEPGEEVIKACQCLNEFAEASAIMQVIRQAGQDMICSSGNPKKPDGSSK"
     gene            38809..40704
                     /locus_tag="ECL_RS27220"
                     /old_locus_tag="ECL_B070"
                     /db_xref="GeneID:9111652"
     CDS             38809..40704
                     /locus_tag="ECL_RS27220"
                     /old_locus_tag="ECL_B070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraN"
                     /protein_id="WP_063840919.1"
                     /db_xref="GeneID:9111652"
                     /translation="MEMLRKFISSILILCQLVMLIGILPAKAANPIATNFVCGQDLNN
                     NGYLGDEGEYQACQTATINHSTAANSYCLPGYTMQANGACMKYEYAPLGSQCPNGYFI
                     QNGRCVQESLLQAQGYCPSGYVMVGNGCQSYTYTAPTQTCPAGSFIQNGRCITQQQIQ
                     PTVSCPNVGGKQWAYDGAGKCVMPSAIMQVPGGGRCTNVPAGYQLAECRITMQGPAQF
                     WTTVVYAQYLCSAGSMVNGSCVVNADAGAVQLTCPSGTVLEGGQCKHTSTTNLNYLCS
                     TGTLVNGNQCKVVSDAGPVQAVCQSGYVIQNGQCVKSTSSSTQYSCSQGTLSGTNCVW
                     NTSENYCPIGVNQSCLNNNGGASCSPNKCIDVSVNKPVDEGNIDGSMLVNDGKKSDDG
                     VCMDQLFIFSGRAQDCKLAGVDTAFKNCCKSEGKVFTDSVGALGNISTAASTISKVYG
                     AAQEAYTYYTVAMQATGDAAVASSMAAQGFGDAMLVAFDPTSLAISVAIYFAMQYLMK
                     ACDQTSMETAMQAGSGYCHEVGTYCKKKIPLLGCVQKATSYCCFNSKLARIIHEQGRP
                     QLKNFSGWGDSGSPQCRGFTPDEFAAINFAEIDLSEYVEDMVKKATDEIQKDVNQITQ
                     DFYEKTN"
     gene            40863..42461
                     /locus_tag="ECL_RS27225"
                     /old_locus_tag="ECL_B071"
                     /db_xref="GeneID:9111653"
     CDS             40863..42461
                     /locus_tag="ECL_RS27225"
                     /old_locus_tag="ECL_B071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraU family protein"
                     /protein_id="WP_013087341.1"
                     /db_xref="GeneID:9111653"
                     /translation="MQKIMTLLISATLSFAASAATVGNTIGQIYDIAEPDALSEIESR
                     VRSVDWSKEMNKNRESWHAFRGVPLPVAKETRTRTYVPFYTSLIDVPDKEGRILYPKG
                     YTFNPLQHVHLPQRIVVISPGQEEWLKSHVQDTDMVLYTHGDVITKGESLGRPAFILD
                     PTLQQRLDVKVTPSIVQQEGAHLVINEFAWNPEKKTSTALLKLMSDDMLSATSDVLST
                     AFNALIPAARAECKTSFLNPVTDIGWSCIFPMRIAGVQIVGGEENASHSDSPVCVCKG
                     GAVPTIGLKTSFWEPKRIIDTVSDPYCMMPLGTTLTTPKPGTLAGGLNENSTSKRAFQ
                     QAHYYIFPAWKILNMFYDIPCLDDEGYDVAMMTEILPQWNNDILSLIINPEALLFANP
                     ISTITCSADAAAASFGMPLNALFWCMGSWGNAYPLSGSITSTDYVEANAGIAARTIYM
                     MGRLGLLWNTSDDGCYRELAPIWRKDRFKLQMMRPARSTTCLPIGREGLLWTGGKHDP
                     RKDNFMWMMFEKKDCCVRYSGSVM"
     gene            42497..42892
                     /locus_tag="ECL_RS27230"
                     /old_locus_tag="ECL_B072"
                     /db_xref="GeneID:9111654"
     CDS             42497..42892
                     /locus_tag="ECL_RS27230"
                     /old_locus_tag="ECL_B072"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087342.1"
                     /db_xref="GeneID:9111654"
                     /translation="MRSLILNKNISVSAIFFFLLCFKGGDMAAWVTDKTNLITWLEAN
                     KLNNTFSGADFSVLPAIAVIAGMYAVSHLIIFVTEIAFATYAAFSSVPETTELVVSKN
                     PQTAAQAPEHKEQDASPAQSERHDNPEKH"
     gene            42892..43641
                     /locus_tag="ECL_RS27235"
                     /old_locus_tag="ECL_B073"
                     /db_xref="GeneID:9111655"
     CDS             42892..43641
                     /locus_tag="ECL_RS27235"
                     /old_locus_tag="ECL_B073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sex pilus assembly and mating pair formation
                     protein TrbC"
                     /protein_id="WP_013087343.1"
                     /db_xref="GeneID:9111655"
                     /translation="MKNSTIFLLASLATFGVCATGSEPLSVKISPEMMAAARNANAQA
                     VQTLNDDEQGVARQFASSIAEFSKSDAFKKKQEAVKSQVFASAGMQDDEKKEDGPKLA
                     GNQLVMFVSSSMPLVTLRKYAHDLSKVGGVMVMRGTVGGISKMVDTITLTRNVLNADP
                     SCEGAKCKMWGTEMLIDPMLFRIYGINKVPALIYQPDMQIQSYCDGLEKVNKASAVVY
                     GDASVRALLERMNMISPDEKVKRLITTLEKA"
     gene            43641..44138
                     /locus_tag="ECL_RS27240"
                     /old_locus_tag="ECL_B074"
                     /db_xref="GeneID:9111656"
     CDS             43641..44138
                     /locus_tag="ECL_RS27240"
                     /old_locus_tag="ECL_B074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S26 family signal peptidase"
                     /protein_id="WP_044160372.1"
                     /db_xref="GeneID:9111656"
                     /translation="MILKRLATRIQLSDESRAYLNTTTIALSLVLAYSLFTHILIPAT
                     HSVFPVVLFRTGHEATEQDQYVRFYLKDRYLPRGEANLVKRLGCIAGQYLQREGNQFY
                     CDGVEIARAMAHDHKGNALPVFNFTGIIPEGKAFAVGDTINSYDSRYWGFIDIATTEK
                     LIPVF"
     gene            44181..45008
                     /locus_tag="ECL_RS27245"
                     /old_locus_tag="ECL_B075"
                     /db_xref="GeneID:9111657"
     CDS             44181..45008
                     /locus_tag="ECL_RS27245"
                     /old_locus_tag="ECL_B075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005276900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraF"
                     /protein_id="WP_013087345.1"
                     /db_xref="GeneID:9111657"
                     /translation="MIKEMILVGATLFSFPVLATSDAAAPVKNPRHGLFWYETPKKEE
                     EKKAENKYPRPVIPSADELFKMHPKDVQDLLDKTRDYALFKLSPDVVLDYYKVQDAAR
                     RKSAAFTSLTGYVMLENPQLNAASDYPITNPGNAEKQRERQELKSKSLIKNRDEYALL
                     FFSEPNCGFCVQQSRILENFQRETSWYIKEIDITRQPAARKKFNVDRAPVTILIKRNS
                     DTDKWMPVSVGVDSLDNLRTSIYNMTRVLNGELDPRQFFTNEKQQGGFFDPLKGANK"
     gene            45005..45484
                     /locus_tag="ECL_RS27250"
                     /old_locus_tag="ECL_B076"
                     /db_xref="GeneID:9111658"
     CDS             45005..45484
                     /locus_tag="ECL_RS27250"
                     /old_locus_tag="ECL_B076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraF"
                     /protein_id="WP_013087346.1"
                     /db_xref="GeneID:9111658"
                     /translation="MKPLLHFMFLMFCLLSHAQAETSSPQAQAQAENAMVTDLLFKNR
                     KNFALLYFVQPGCVYCQHQLPVMEEFQKETNWYVKTIDIIQNPEVRSKFNINGTPVIV
                     LIKKNAGANNWQAVSIGYSPLNTLREDVFNLVRLFNGQVPQSKYFVRTQRNESTPIR"
     gene            45500..46888
                     /locus_tag="ECL_RS27255"
                     /old_locus_tag="ECL_B077"
                     /db_xref="GeneID:9111659"
     CDS             45500..46888
                     /locus_tag="ECL_RS27255"
                     /old_locus_tag="ECL_B077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraH"
                     /protein_id="WP_013087347.1"
                     /db_xref="GeneID:9111659"
                     /translation="MKLTNLLLLAVSALSPIHCFAAGNWADKWFDNAVYDSPSSFDSQ
                     KRGYYTMGGFTARTTTSTDYPITISPPRLSVGCGGIDGFLGGFSFLDPDFLVEKAQRA
                     MQAAPYVAFDMALKTMCKECADTLGKIEQITNFLNGIQLNECALAKPIATTLVERDPT
                     ALKGLWTEATGTKNLDEAVDRMWSDTTSKIKAADDKPIADLKSMISGCPADFRDLMQH
                     GSIVERAAKKVGMGDYADTIRGYMGDVWIESKTNDKIPVAKSITSCPQNKKFSLDDML
                     NGRAYVKTIDQQCVPSGSRPVRTVVYQKMESIVSRIKNNQPLTSDNQAFINQTNIPVY
                     TILKQAVVTGQDTVTLNVLSELVGLYYTYFIFTDLYRNTENTFDKVNEMVSTPLADPS
                     AGSKPCRMDLFKPAIAKFDDLITQARDASTKVEAAYNSRLQSYTLNQGFIKSFETQER
                     QDQSDRAAGGLR"
     gene            46888..50838
                     /locus_tag="ECL_RS27260"
                     /old_locus_tag="ECL_B078"
                     /db_xref="GeneID:9111660"
     CDS             46888..50838
                     /locus_tag="ECL_RS27260"
                     /old_locus_tag="ECL_B078"
                     /inference="COORDINATES: protein motif:HMM:NF019530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG N-terminal
                     domain-containing protein"
                     /protein_id="WP_013087348.1"
                     /db_xref="GeneID:9111660"
                     /translation="MKRHLFLLAGLMAVSPFALAMDAEYVVMGGFSTIVNAFTRVKLI
                     FNDNQYASMVTAFVVMGMLSALLLKSAKGGYEYLETGKAQMGMGWLGLTMLGTIVYFG
                     LVQPKGTIHIYDQSRNQYQAVSGIPDFLILTAGVTNQAYQAFVDMSNRNTATTTRFTG
                     EGTPIKMLLGILNRNGAQFDPYLTANVKAMWNQCSPVAETRGFDPRSLKSGSSVLDVV
                     SALAPLRNQAVYTSWVSPSNPQGATVTCDQAYVSLKSDLGNPAAYGARIADICTKNGY
                     TSGNATQLAECKSRMENGLQTIFGASGLSLNTAMSNVLVSQAITDAMLQNNPDVATTM
                     LTNRAMINGGMADAITNPEWLSFIMAGVIAIILSVTPLLLLLVFTPLMGKALTLLFGL
                     WIFITSWQIADALLLQAGTDEILTAMNDLKSMGLGIDAVQMGPSSTMKAMSVMASARE
                     TALQIAMLIAGLFGVSAYGLSAFGQKAMSRLDRVTEETSDKAFTPEGKGAQIDAMNRG
                     HATLQTAADIGNIELMSSATSFNQSSAIESGLTQISALGGTPGVAAQRSGAVEGGRAS
                     GTTRGYENGNMGGGFLAASETSMVQAQSSIGEAQGIQHAASASNMSVTEQSELSSGVS
                     HTMQTADAQSNLKNGGGQLSTLSDQQGKLHSTERETQLGHAAGTRQAASATGKSVTDF
                     TQEKTATSAINEHASGQGQLQASGGTLGGLHSRSQYTAAAESDERQGRADALHNAYDA
                     EGGIASGVSESQTEHLTQNLHDMREQKANIQEISKATGTTESQSREILSAARSAEQMG
                     TLEGNNFSPKQMQENSAWSTSKGANIIQGEKTAFKERDVAMPEYARRHGETDMHQALS
                     GQDKFDTLSDALKGDKPAADALAGANTTLAINQNDARNLEDSGLINQTQADAVPDNGV
                     GTVHMSMRDTPDGKNASTSTVKTGSSTVSDDSFTTNSEQTFGSAPSAQQNLQHAPAIE
                     RFVASAERTNAGSSSRLLGAEIAKSLSPFISQSGDGRTQQAIDGGASVGKSGFLREVG
                     KAVGVDLSAGVNMSNINGRSTTTDQIAAAAGHKIQQFRDSATEQADAAHLSGRDREEF
                     INQNVALQSEAFYRPLLKAAQETAEAHSTGSIVSDISTPQTTQPTPEKSESGFTRGGI
                     SSPLEYAARKQAETESAQPQRAEYVPQHQEQQQPAASERANPSGNTLVERPAVTEAQQ
                     SGTLPSARQDAVISETTAPALPTPGAEPSPAAQQVMVNESAQYQGPQPSPLPSQPALS
                     GGSRNGPAEAATPNEAADESTHSSSAHPPVASGNSDSGIPLQTSTGGNNKNIPR"
     gene            50963..51214
                     /locus_tag="ECL_RS27265"
                     /old_locus_tag="ECL_B079"
                     /db_xref="GeneID:9111661"
     CDS             50963..51214
                     /locus_tag="ECL_RS27265"
                     /old_locus_tag="ECL_B079"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087349.1"
                     /db_xref="GeneID:9111661"
                     /translation="MKNWTKNFIEDMKHIWREFRRDIAETNAKKSHCDDDMAGISHSV
                     NWNNVPDLDPRKPVNNLDNFYSRQLRGTDNPGTRYQHRN"
     gene            51295..51630
                     /locus_tag="ECL_RS27270"
                     /old_locus_tag="ECL_B080"
                     /db_xref="GeneID:9111662"
     CDS             51295..51630
                     /locus_tag="ECL_RS27270"
                     /old_locus_tag="ECL_B080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087350.1"
                     /db_xref="GeneID:9111662"
                     /translation="MLTRRLIPFLLLLPLTSQAISMPASDMQESEKIKYMQKMSGTDH
                     SRLAAFVQADQSFTQWCGRSATVSDLKRISLQDGFAMLYERLSSGQAQGMTQTKTLLV
                     KDNPKFCKG"
     gene            51634..52143
                     /locus_tag="ECL_RS27275"
                     /old_locus_tag="ECL_B081"
                     /db_xref="GeneID:9111663"
     CDS             51634..52143
                     /locus_tag="ECL_RS27275"
                     /old_locus_tag="ECL_B081"
                     /inference="COORDINATES: protein motif:HMM:NF022337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2726 domain-containing protein"
                     /protein_id="WP_013087351.1"
                     /db_xref="GeneID:9111663"
                     /translation="MTDEQINYVGFAILAALFWYVQIYRPRKKMRNPGELSVKAVMNP
                     EEQQMYNAINFVFPSPYILKSNVSLDDLLFSPDMDKKAHFHKSMRQHQVAWLVLDEKR
                     TPLLAVDFLAAGEDLKMNYLSQAGVGCCIFTPGTSAEQMIQHLQEAADSLNEMQNGQY
                     AESEQPATA"
     gene            52188..52586
                     /locus_tag="ECL_RS27280"
                     /old_locus_tag="ECL_B082"
                     /db_xref="GeneID:9111664"
     CDS             52188..52586
                     /locus_tag="ECL_RS27280"
                     /old_locus_tag="ECL_B082"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087352.1"
                     /db_xref="GeneID:9111664"
                     /translation="MLKNEVPLALSPTCFIHHVFIDAWHHSLSTMIRKASRQFGEQII
                     SHYRSDDISGEYRVFSGFGDGYWMIGVGIEIPVDLCKQFPSLIVSNRLIERRHCPDNI
                     TMIIEYELGKMPVGRINGHLTRKLTVTCNV"
     gene            complement(52817..53080)
                     /locus_tag="ECL_RS27285"
                     /old_locus_tag="ECL_B083"
                     /db_xref="GeneID:9111665"
     CDS             complement(52817..53080)
                     /locus_tag="ECL_RS27285"
                     /old_locus_tag="ECL_B083"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087353.1"
                     /db_xref="GeneID:9111665"
                     /translation="MKKLLLLGVFLVSGCAGFGGNMKTVDCEAKIKIHTWGGKQEEPV
                     HVNAMRSDRFGREFVRVQNRPGYAFLLGRWQPKDTFSDYTCKS"
     gene            complement(53342..53545)
                     /locus_tag="ECL_RS27290"
                     /old_locus_tag="ECL_B084"
                     /db_xref="GeneID:9111666"
     CDS             complement(53342..53545)
                     /locus_tag="ECL_RS27290"
                     /old_locus_tag="ECL_B084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548819.1"
                     /note="with Hns involved in transcriptional regulation of
                     hemolysin; non-specific DNA-binding protein which affects
                     the production of multiple proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013087354.1"
                     /db_xref="GeneID:9111666"
                     /translation="MQKQDWLLKLRKVSEISTLEKIIQRKEDTLSKEDLIVFYSASDH
                     RLAEIIAGKYFDKVPSHMWRYVR"
     gene            complement(53558..54928)
                     /gene="dnaB"
                     /locus_tag="ECL_RS27295"
                     /old_locus_tag="ECL_B085"
                     /db_xref="GeneID:9111667"
     CDS             complement(53558..54928)
                     /gene="dnaB"
                     /locus_tag="ECL_RS27295"
                     /old_locus_tag="ECL_B085"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019843470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_013087355.1"
                     /db_xref="GeneID:9111667"
                     /translation="MKNESQDQNLAALPRSHEAEQAVLGGLMLANDEWDNIAEILSEA
                     DFYLKVHRVIYREMGVLVKQNFPIDLITLTDSLRGKGLEQACGGFGYIAELSKNTPSA
                     ANIHAYANLVRETAIKREILAVVNEVASETMQPRGRTAKELLDLAESRVMGISEVRAK
                     SQTGPSPISAILGSTIERLDQLFHTPHDGITGLDTGYNDLNKKTAGLQNSDLIVIAAR
                     PSMGKTTFAMNICENVANSQDKPVLIFSLEMPKEQLMMRMLASLGRVDQTHIRTGMLD
                     DDEWQRIAATSGVLLERDNIHIDDTSGLTPTELRSRARRLHRECGGLSLIMVDYLQLM
                     RVPEIDSNRTLEIAEITRSLKSLAKELQLPVIALSQLNRSLEARADKRPLNSDLRESG
                     SIEQDADVIMFIYRDEVYNERSEDKGIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYA
                     GIGSDD"
     gene            complement(55113..57188)
                     /locus_tag="ECL_RS27300"
                     /old_locus_tag="ECL_B086"
                     /db_xref="GeneID:9111668"
     CDS             complement(55113..57188)
                     /locus_tag="ECL_RS27300"
                     /old_locus_tag="ECL_B086"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087356.1"
                     /db_xref="GeneID:9111668"
                     /translation="MNTEKYHEFMTGNMTSSDKLFQALNVWVELTGIDPDAKSFTVRM
                     GAGLSDLTIKRMHEELQESQTLDPSGITTYLLLIAFSETYFNNRSFTVGQLLNEPKNT
                     QHYLQKSGDFLKMINSDEVSFSYKCFTEKLTAALKQYGLYSDSREKVVADISTMAMIR
                     RDALKSFQELSVNQFTRGEQAGTDHFSWLNTVHQFWNINSLLDEAVSARDGITLNLVR
                     DPSDFYSYFAFTVKNGGNLFVLSDHPQHTHPMQRGMSRRPDREFDERAGRHWFPYQLL
                     KFKYDEDARTLYRDRSTDTNLVPRQQRVQSVCQLQDLEAKQIIWIALMFELIADKYWQ
                     QGWQAKSLSYTAEMIASPALLAEQAARAGMPVVQSQLLTLPELTVEEICAEDFHQTID
                     AADGGKPHNWLVARYGQKVSPDVLNLVKNDEHVHYLPSVKSGNSRSRSALSTVTDVHQ
                     IASMPRREYAALASWEKEGRYELTPLSAVQFGDAGKLDSDRRYIARYNFAKAITQLAD
                     EEYELTHEEIEAWWRASLERNAERLCAMAIEETIWLDDIRRNSASPVLSVDSVLGRCA
                     FMNRYASQEDANRNSHYFAENYLTAGYDKGHLCYLMGSRASWFIHFMPRASYDLAVLA
                     GCRVDELPEVLQHWSNDKDYRGNAILDRIDPAAWAIRDPWSRKFCGTVTLALSKRAMN
                     RLMKEHGKA"
     gene            complement(57238..57720)
                     /locus_tag="ECL_RS27305"
                     /old_locus_tag="ECL_B087"
                     /db_xref="GeneID:9111669"
     CDS             complement(57238..57720)
                     /locus_tag="ECL_RS27305"
                     /old_locus_tag="ECL_B087"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087357.1"
                     /db_xref="GeneID:9111669"
                     /translation="MNKLIAFILLLFMAPALGVAGGVIFSFWNTGNELQPVWGRLLVY
                     MVVLVFIFNLRNILTEPTTRATRKHRERMLMAIFGIIIYPLMAGFCLFVIEDFSFNPG
                     TDSAQQTLDMANEKLKVILLTMLKYMPFAINCGYIWLEGIVPLWTKLRPAPSVNNGEY
                     "
     gene            complement(57713..58144)
                     /locus_tag="ECL_RS27310"
                     /old_locus_tag="ECL_B088"
                     /db_xref="GeneID:9111670"
     CDS             complement(57713..58144)
                     /locus_tag="ECL_RS27310"
                     /old_locus_tag="ECL_B088"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087358.1"
                     /db_xref="GeneID:9111670"
                     /translation="MTEQIDLVKEAEGKGFLRGVIFAVAELMRGHGDTVISKDVLDTL
                     GGQLHEACRESSEYDVRALREVFSDLPFGNDADYDNLRLVSLDLDGRDCDQDDAYSFE
                     VRGDYGAETLVIARFEELEAAQAFISMNASLMMSGEEVDDE"
     gene            complement(58281..59795)
                     /locus_tag="ECL_RS27315"
                     /old_locus_tag="ECL_B089"
                     /db_xref="GeneID:9111671"
     CDS             complement(58281..59795)
                     /locus_tag="ECL_RS27315"
                     /old_locus_tag="ECL_B089"
                     /inference="COORDINATES: protein motif:HMM:NF020387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RES domain-containing protein"
                     /protein_id="WP_013087359.1"
                     /db_xref="GeneID:9111671"
                     /translation="MTIPVHDYAWQRTEKAVNHYRANQGADILEKYFRSKTVMNDEKY
                     ICHACIGEKYVKAEIKNFGSAGQECSYCHKRFKNVPVSHIAGLMNQVFEDYYEPREAD
                     YYFGTTSGSTAQEVICDELKVDDEDIITDIYDCLCDEFNDYQDTDPPNYNEDYVYTGR
                     GFSSENLSRAWKKMIRSLNEEARFFNRTVKVFLDDLFVDLKEFKTEKDESPIQIIDGD
                     TALYRARVFETLEEVEEALTHPERNFGPPPPDKARSGRMNAQGISVFYGATTQDVAIS
                     EVRPPVGSRVVVAAFRPLKEMRILDISALDTLIFSRESVFNPKTIRSLERTAFLKTFS
                     RKMTLPVFGKRQDSEYLITQAIAEYLSVSEKYQLDGISFRSTQVKREAKGSRRRHKAP
                     GGYNIVLFSKSAGVKHSDKHMREYQVRFMHDFEDEPGHFHPSIHQVVDAEPERDNDWE
                     FRSDFMLSQRKHSLEMIPDGLTYYHIQGVSYQKTSTEIEQGMPVIRPTEKRNPI"
     gene            60290..60502
                     /locus_tag="ECL_RS27320"
                     /old_locus_tag="ECL_B091"
                     /db_xref="GeneID:9111673"
     CDS             60290..60502
                     /locus_tag="ECL_RS27320"
                     /old_locus_tag="ECL_B091"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087361.1"
                     /db_xref="GeneID:9111673"
                     /translation="MDKAKINDEPAAAPQRKPGTISPRVFFGGFLLGGIVGLGLSLMY
                     DYKAMQAVSVAAMCIGFYYLVTKRAK"
     gene            60595..60885
                     /locus_tag="ECL_RS27325"
                     /old_locus_tag="ECL_B092"
                     /db_xref="GeneID:9111674"
     CDS             60595..60885
                     /locus_tag="ECL_RS27325"
                     /old_locus_tag="ECL_B092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087362.1"
                     /db_xref="GeneID:9111674"
                     /translation="MTSSVPPLSSRDRYRLMLQTFPLLANYWNTDDDCLRYDELKEAI
                     GVLSRGEQIMARFYLSVWTGENHDFDFLDAAALLSSDGKKIILTWFADPFWP"
     gene            61024..61647
                     /locus_tag="ECL_RS27330"
                     /old_locus_tag="ECL_B093"
                     /db_xref="GeneID:9111675"
     CDS             61024..61647
                     /locus_tag="ECL_RS27330"
                     /old_locus_tag="ECL_B093"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087363.1"
                     /db_xref="GeneID:9111675"
                     /translation="METAFFDNDEYCMQMVCAICSRYRYIDSVNQRKSIVEDIRPLVY
                     VHPRPDSFVSFLTDELSRRGRKYLWDQQNWQNDLNLLIRDLKELLIIRRISEEVHLTL
                     DEKFRQESQAQTDGRFLEMLLTYSPALPTECVALQLVRYISAFPQETRSAVAGVVTMI
                     FRHLPYPETLKESFLLDPELRERYCHPDQDPRLSYALYLADELQLHL"
     gene            61677..62453
                     /locus_tag="ECL_RS27335"
                     /old_locus_tag="ECL_B094"
                     /db_xref="GeneID:9111676"
     CDS             61677..62453
                     /locus_tag="ECL_RS27335"
                     /old_locus_tag="ECL_B094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_013087364.1"
                     /db_xref="GeneID:9111676"
                     /translation="MLERSHYPSAMLMPVTDLDWSRIFAMRQLAISSSDAPAYMLAPE
                     VALLFSYMHDLRERCYFETLWNTGARPNEALALTPQDFSFDAVMPFVTLKTLKQRNRG
                     RGRPEKNAPPVRSVALWDADYRARMQSLITTFGIRKTDLIWPGRSSSSATQPVSVSAD
                     TVSRWLNRALAAAESDGVTFSVSPIVPKTFRHSFAMHILFNRIHPKVLQSLMGHKSFK
                     STEVYTRLFLFDVAGQHEVSFGFDVEQARQALRLGVMKQD"
     gene            complement(62468..62674)
                     /locus_tag="ECL_RS27340"
                     /db_xref="GeneID:44145578"
     CDS             complement(62468..62674)
                     /locus_tag="ECL_RS27340"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160324.1"
                     /db_xref="GeneID:44145578"
                     /translation="MQFLELFLSTIMNPPSFNDWQAMNDVSDMIVTGIAMLIRLSTVP
                     ALIFLAIGLATLIVTSLWPKCSGL"
     gene            complement(62693..62908)
                     /locus_tag="ECL_RS27345"
                     /old_locus_tag="ECL_B095"
                     /db_xref="GeneID:9111677"
     CDS             complement(62693..62908)
                     /locus_tag="ECL_RS27345"
                     /old_locus_tag="ECL_B095"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087365.1"
                     /db_xref="GeneID:9111677"
                     /translation="MKKIRGGIQKCPYCGYDEFYVRATVSGSTSVFYRFDGGSGDNTH
                     MWDYVRTKEKKTAYCGSCQKRIGTVEE"
     gene            complement(62927..63172)
                     /locus_tag="ECL_RS27350"
                     /old_locus_tag="ECL_B096"
                     /db_xref="GeneID:9111678"
     CDS             complement(62927..63172)
                     /locus_tag="ECL_RS27350"
                     /old_locus_tag="ECL_B096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000134171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044160366.1"
                     /db_xref="GeneID:9111678"
                     /translation="MVTQSPDNLRCFPPPDEQQRIERAIELASRFGGSDEVHHLRWVI
                     DQMVRELAGERYDQVVASACAGEDGPDTWRWDTGIAP"
     gene            complement(63410..63916)
                     /locus_tag="ECL_RS27355"
                     /old_locus_tag="ECL_B097"
                     /db_xref="GeneID:9111679"
     CDS             complement(63410..63916)
                     /locus_tag="ECL_RS27355"
                     /old_locus_tag="ECL_B097"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087367.1"
                     /db_xref="GeneID:9111679"
                     /translation="MGTGIATQVQILTEHGWENVHDDIFTRYDEKTHHPFSEQNYGVF
                     AFLADVRNYACVPVLSEPRGLPAVEKAAAQIESLWEFNGTTEWPDHENNTSATWYLVS
                     ELLEFDYDVEFENRRNDANRDNPHPPGRGKRMTIREYLKPKFFEDLLILKRLGDPDKT
                     RVVISFAS"
     gene            complement(63942..64415)
                     /locus_tag="ECL_RS27360"
                     /old_locus_tag="ECL_B098"
                     /db_xref="GeneID:9111680"
     CDS             complement(63942..64415)
                     /locus_tag="ECL_RS27360"
                     /old_locus_tag="ECL_B098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011998898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermonuclease family protein"
                     /protein_id="WP_013087368.1"
                     /db_xref="GeneID:9111680"
                     /translation="MNNALKVLPLIMLSIPVVAEADITGKIVRVLDGDTVEILAGNVA
                     TRVRLNGIDAPEKAQPFGQRSRQALTAIVGGKTVLAVGEKRDRYGRLLATLILDGRDI
                     NATQVYSGMAWVYRYKGLATEPEYLRYERDARTARRGLWSEKEPVEPSIWRQRHR"
     gene            64506..64916
                     /locus_tag="ECL_RS27365"
                     /old_locus_tag="ECL_B099"
                     /db_xref="GeneID:9111681"
     CDS             64506..64916
                     /locus_tag="ECL_RS27365"
                     /old_locus_tag="ECL_B099"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087369.1"
                     /db_xref="GeneID:9111681"
                     /translation="MLKSISKIFRGGFKAEATGVILLIIFYYLLLSRTGETLSTYEFV
                     TSLLWMNFITAISLWLQSIRFYKNALRRNDKEDLKLSAAASMCLAVMFMAGSITMQSI
                     PPLSGQYLIIALASFYGLAIGLFSVATLYRAAQQ"
     gene            65010..65678
                     /locus_tag="ECL_RS27370"
                     /old_locus_tag="ECL_B100"
                     /db_xref="GeneID:9111682"
     CDS             65010..65678
                     /locus_tag="ECL_RS27370"
                     /old_locus_tag="ECL_B100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014334143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_109455538.1"
                     /db_xref="GeneID:9111682"
                     /translation="MHIQPRTHLLTSCAKGKNHFTSTSPVLEIMPNTTPKLLIETWLS
                     KLRSYPPERAVSVIDLYRGAHWSCAKEILKTTPNLDLWVISAGMGLLHCSEEVIPYEA
                     TFNKLPFAPSSWWETLTEATQGVRRSSSIAQLMQTYPGDNYVISGSPVYVAAVERDIT
                     AGMASLINPLAQLTVITSGGYKGMLEPYLVRSHAGMLNSLNANMVCLNIKLARSIIQN
                     IGCS"
     gene            complement(66010..66447)
                     /locus_tag="ECL_RS27375"
                     /old_locus_tag="ECL_B102"
                     /db_xref="GeneID:9111684"
     CDS             complement(66010..66447)
                     /locus_tag="ECL_RS27375"
                     /old_locus_tag="ECL_B102"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087372.1"
                     /db_xref="GeneID:9111684"
                     /translation="MRINKEDNLENCPNCGEDMPGGKIRCTRCQRQHDIENMTEAEHR
                     AHEALFPTGSAMPQLPLITYTVGVKAVFDMLTQQEQQRYSNAIREAIKTAYPAYDVVV
                     TLDNTIGGADCEVSNDPYGETDIAEHAHSIAHGVWIGAAWLDK"
     gene            complement(66444..66983)
                     /locus_tag="ECL_RS27380"
                     /old_locus_tag="ECL_B103"
                     /db_xref="GeneID:9111685"
     CDS             complement(66444..66983)
                     /locus_tag="ECL_RS27380"
                     /old_locus_tag="ECL_B103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001706551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelB/DinJ family
                     antitoxin"
                     /protein_id="WP_013087373.1"
                     /db_xref="GeneID:9111685"
                     /translation="MATINARIDDDIKNQADEVLKLLNISQTQAIAAFYQYVAEQKKL
                     PFVITSVVKTPHDLLRESSDMLAEALAVISNLQAWTEQPDGIEKAKLMEYYRRLDALY
                     RCAKDKISLIPDNRDAELALNAFNKALSILVDTRNFGYGYEKVTFSTLEQTSFAFAVH
                     EFESKVAGLVHCVRKGELE"
     gene            67310..67747
                     /gene="umuD"
                     /locus_tag="ECL_RS27385"
                     /old_locus_tag="ECL_B104"
                     /db_xref="GeneID:9111686"
     CDS             67310..67747
                     /gene="umuD"
                     /locus_tag="ECL_RS27385"
                     /old_locus_tag="ECL_B104"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011988549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translesion error-prone DNA polymerase V
                     autoproteolytic subunit"
                     /protein_id="WP_013087374.1"
                     /db_xref="GeneID:9111686"
                     /translation="MKHISLVQPDIQRVSSKQPFFGDLIPCGFPLPSEGIEDQPLDLH
                     NYCVKRPSSTFFIRCDGLSMIDAGIAPRDLLVVDCSIRPEHGAIVVARVDGEFTVKKL
                     QLRPFPALIPMNPDFPVIEVEPELLEIFGVVTFSIRDCLHVSA"
     gene            67734..68996
                     /gene="umuC"
                     /locus_tag="ECL_RS27390"
                     /old_locus_tag="ECL_B105"
                     /db_xref="GeneID:9111687"
     CDS             67734..68996
                     /gene="umuC"
                     /locus_tag="ECL_RS27390"
                     /old_locus_tag="ECL_B105"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translesion error-prone DNA polymerase V subunit
                     UmuC"
                     /protein_id="WP_013087375.1"
                     /db_xref="GeneID:9111687"
                     /translation="MFLHSDANAFYVSCQTAMEPSLIGKPVIVTTNNDGAIAALNTEA
                     KSLGLKRGQPLFEIQQVIRDNHVRVFSSNFVLYGDFSARFHTTIGESVPRHEIYSCDE
                     VFASLHGMDKLVSFEDFGRELREKVYRHTSLKCGIGIAETKTLCKAATWAAKKYPQTK
                     GVVVISDPARRDRLLALIPVREVWGIGSRLAKRLNEMGIVTALELARMDTRLVRKLMG
                     VVVERTVRELRGEACFGLDTNPPSRKQIIVSRSFGQRTTDLEDVRQAICAFSCQAAEK
                     LRRDRSFAGAVTVFIQNSRHSQAEPYFSAVALEPLPVTQDSRDLIQAAQTALLRIWKP
                     GVHYAKAGVMLSDIGDGREQLDLFSNKQPGRNSKALMQIIDKLNLAERGTIFMAGEGV
                     HRKYKGKQQWLSPCYTTRWKDIPVAWLK"
     gene            complement(69039..69461)
                     /locus_tag="ECL_RS27395"
                     /old_locus_tag="ECL_B106"
                     /db_xref="GeneID:9111688"
     CDS             complement(69039..69461)
                     /locus_tag="ECL_RS27395"
                     /old_locus_tag="ECL_B106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="H-NS histone family protein"
                     /protein_id="WP_013087376.1"
                     /db_xref="GeneID:9111688"
                     /translation="MNKKTPLTVNAVAEYLSSITRRTAVFKKMDLRLLGIVRADLNRI
                     IETREAQLEEERLRQKEKQDKIREHLSLLRQDGIEPDELLDNTRPRKRPSIGQMRTFR
                     IHGKLVHYKGVGVYPRALREIIESEGEEALKRYEVSGE"
     gene            complement(69474..69908)
                     /locus_tag="ECL_RS27400"
                     /old_locus_tag="ECL_B107"
                     /db_xref="GeneID:9111689"
     CDS             complement(69474..69908)
                     /locus_tag="ECL_RS27400"
                     /old_locus_tag="ECL_B107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087377.1"
                     /db_xref="GeneID:9111689"
                     /translation="MTDKFNLQNKRLMDSIEQTLLLLSKSGGELIKAVAKSLVLKIKP
                     YDFVEFKHSAIYRAIRTYNEKRDSVIRLSGLYSPLFGREKEALEEEPFSLIVNVDEQT
                     FKRGYIWYSPEKDRAFRMEDLSYFVLEQDNYIPFDLSVSNKP"
     gene            70040..70750
                     /locus_tag="ECL_RS27405"
                     /old_locus_tag="ECL_B108"
                     /db_xref="GeneID:9111690"
     CDS             70040..70750
                     /locus_tag="ECL_RS27405"
                     /old_locus_tag="ECL_B108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase SLT domain-containing protein"
                     /protein_id="WP_013087378.1"
                     /db_xref="GeneID:9111690"
                     /translation="MKFTKLTFIALLILGSSPVLGSSNTQQQLTGFLAGQENGVSAKQ
                     VLTSDDLFNKLIHQESRGNQFSKNGQPLTSPKGAVGIAQVMPETAPEAARLAGLEWSA
                     WRYRNDETYNKALGRAYLDSQLERYDGNHVLALAAYNAGPGSVDKWLKRFGDPRSGEI
                     SNKQFMQLIPFIETQAYVASILNDTPGVFRFTPSRKKAPVGEGHKIEFRDTHPGITFN
                     LAVNQTFSYGNGKLVGGL"
     gene            71076..71366
                     /locus_tag="ECL_RS27410"
                     /old_locus_tag="ECL_B110"
                     /db_xref="GeneID:9111692"
     CDS             71076..71366
                     /locus_tag="ECL_RS27410"
                     /old_locus_tag="ECL_B110"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087380.1"
                     /db_xref="GeneID:9111692"
                     /translation="MSAKLFGALLVVCGIAGAVVLWILSKTSSQTSESNQVRRFKLDH
                     EYENKGFTEKGQSEGLLDIPTEISTDKSNAFESKQAFTSPDKHYDSLPGDKF"
     gene            71366..71896
                     /locus_tag="ECL_RS27415"
                     /old_locus_tag="ECL_B111"
                     /db_xref="GeneID:9111693"
     CDS             71366..71896
                     /locus_tag="ECL_RS27415"
                     /old_locus_tag="ECL_B111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_013087381.1"
                     /db_xref="GeneID:9111693"
                     /translation="MSKNLMIGLALLLMVFIYALCFRKKNNHDRKRLSAEKIIEVINS
                     IDLPAQKIAYLRKVDPYAFEELIMTLLQRKGFVIGRNKRYSGDGGLDGRFEHNRQLWL
                     IQAKRYSNRIKQEHVSAFASLLKENNCSGGIFVHTGKTPASVREYVKARSSPQIEIIS
                     GDRLLNLFDSTVKLKF"
     gene            71933..72688
                     /locus_tag="ECL_RS27420"
                     /old_locus_tag="ECL_B112"
                     /db_xref="GeneID:9111694"
     CDS             71933..72688
                     /locus_tag="ECL_RS27420"
                     /old_locus_tag="ECL_B112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001579148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087382.1"
                     /db_xref="GeneID:9111694"
                     /translation="MTKNFIRIAIYGWTWCSWAIRNLIFFPAATLTLIIAFLMVLDHS
                     SPGQIMVRIMQSADKVTDGVNWTWRECPSVSSNSNVFPPEPSIRPSALEANCPEMVSD
                     ARGYAEHIDRNFMPLVWIWWTIMAAISVTVERFPVFKHRTRLQMRTITTREQLLVNGK
                     VRERLATHIVTGAHGYETLCTSGCNVSYNDKRVLIENCEKLAENALPVTCRTCFTIWN
                     DVHSYQPGDFDMESGKGNFTEKDLTEITIPTAH"
     gene            72755..73033
                     /locus_tag="ECL_RS27425"
                     /old_locus_tag="ECL_B113"
                     /db_xref="GeneID:9111695"
     CDS             72755..73033
                     /locus_tag="ECL_RS27425"
                     /old_locus_tag="ECL_B113"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087383.1"
                     /db_xref="GeneID:9111695"
                     /translation="MTLELAVASERAPNRLCKAAKAMLNVVYDPLKRRFVDGISSSGK
                     ALEKLEELKTYRENPVTKMINEFTEAEKFGDVGEYRRQRAERMMQNAA"
     gene            complement(73058..73915)
                     /locus_tag="ECL_RS27430"
                     /old_locus_tag="ECL_B114"
                     /db_xref="GeneID:9111696"
     CDS             complement(73058..73915)
                     /locus_tag="ECL_RS27430"
                     /old_locus_tag="ECL_B114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016248777.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4365 domain-containing protein"
                     /protein_id="WP_013087384.1"
                     /db_xref="GeneID:9111696"
                     /translation="MKKYKKNGATGKAGEYYFAYWMVRNFKWPCRLLDIDVGIDAQVE
                     IFEDEISTGDFFAVQIKSTVENDPDMSIDLSDFMYWQQLESQVILVRILMGDNHSEPV
                     MYWKSFSKEYLDEIVMEMGTTGFQSKKVLFSESDKLTSESKDSWKEAILSDTDKRLIR
                     VARSLLKSLKEHDLDNFVEEDYNLQNENKDFISFNSEIDTFNHHFIDYEELIDAVCLD
                     RRLIIRAPFIGEVIDYFEENESILLYMFNNAFNGIKVGRTPNQILPRNLSREIKRQTE
                     DWVYHMTGF"
     gene            complement(74139..79145)
                     /locus_tag="ECL_RS27435"
                     /old_locus_tag="ECL_B116"
                     /db_xref="GeneID:9111698"
     CDS             complement(74139..79145)
                     /locus_tag="ECL_RS27435"
                     /old_locus_tag="ECL_B116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001569432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative relaxase"
                     /protein_id="WP_013087386.1"
                     /db_xref="GeneID:9111698"
                     /translation="MLSVAKVTNVAQASSYYNSPDQYYDKDSGDITSRWGGAGAEILG
                     LEGPVESEDFVRMLEGRISPEIHLGKNGGDGTISHVPAWDFTLSAPKSVSVLALAGND
                     KRLVDAHIKATAETMKFLEKEYALTRISNGGNTEYTKVNNLVYASYVHTESRKHDPQL
                     HSHNVVMNAVMDESGQWRSLETLKMFENQLGIGLVYRSHLAKLVKQLGYDLEIDHETG
                     LWDIKGVPHSLLDAFSKRRKEVLEAAKQYGLFDAKSMEKAALYSRESKTHMEYDELKA
                     SWEETVKESGVSLDEVINRSYDNAKTFKRLDDPQPSFDSENSSEAVTGVSGPKENSHS
                     VAPEHLVGNETDFSTPSNDTNMNHIERGEGVEVSPGNPLTNAGLLSGIANINGTERAT
                     EKYAREYISHQDLSASELAAILHDVRLAYKVKAADEAVFTHSSVMSEAMGLAIGEALP
                     GDIEQILRAMVNSGELLPRTSRSGNGEAAYTTPKAFEKEREMVLTMLSGKESRQAAGD
                     VSSIAAYIDQFEAEKTVEFGSQFAFSPDQRQAIIDAATNKDLVSGIQGFAGTGKTTLL
                     QCLIGYGQSKGFSFKGLAPTGSATETLAKETGIPASTVDSFLYRRMKGTVSTREIWLV
                     DEASLVGADNQHALIMEAERSNAKLLLLGDKKQMESVDWGRPFAVLQGFGMQTSNVQT
                     IIRQKDEQLRAAVYDSISGNFSQAFSRLKDSVYDMEKHSILDDYLALSQADREKTLVI
                     IPDNEGRQDFNASVHEKRVNDGELSANEVAVRSLLSENLNEAERTDSRYYRFGQIIEF
                     QLDHGEFKKGEFWKVAEVSGKELLLKSGDGQERKFNPSEITGKSKFAIDVFREDKILF
                     SEQEKVVFTKSRKDLNVRNGDEFKVSRIDSTSGTFILTDEKGKELSLDSSKLHNISHS
                     YAMTSYKAQGKTVDRVMAQIESWRRNLVNERSFYVNLSRARYEARLYVDNVGKVIKAL
                     SEHDANKTTSLTGFSTKSMKRAAEHLQAESTDTRQLYADLNIATQKLANKQGVFSHSA
                     LVAETLKNTLGTYDVRDIETAIYAMRMRGEVGLSHINHEKVNSENYYTMPQNIRNEAQ
                     IVRHMLQGKDRYAPIAGKSVVSRYLSAREDKARQGIAEPVSAATQAALTTVMTSRDEA
                     ILITGSDLSGHRDVMREIGKDIAKERGYRVKGFSTTAEGVKQMRESMKFSANIYQHLD
                     QMEAKIAAGQIVRPGKELWVVENVSQMGAENVLRLQQAARYVGARMVLVADRQENSIA
                     WGNMPSLLAEQGIATIDFDKANRSLNPEINLATDKLTQGKIEDALAHVSPMMSEVRDL
                     DNQNNDRTIRLNVIANSWLNLSPEDRAKTAIVIPDYLSRNKVDVQIRRGLQSEGVLQG
                     TPLTTALYRNANLDPFEKKVATNYKPGQVVQFESQRPGIEKGAYYTVEAVNKAGNELI
                     LVSLEAGHRVTINAADIAGSRNNSVQVFHVEQKQIQKGETLRFTRTVPADKLESADGK
                     GVSSKMTGSVVSLDGTKVTLRLANNRQVTVDAASWKHMEWGYSNNMFNIKDKQFDNVI
                     TLMESWKKQFATQEALHNALTKTAVNLRIITDDKEKLLDSLRTNPGFRQTALQDRKVS
                     ITKSDMAAFDKQFGTGLGFGMRSLMKLEAAVDKAVTSTVSKVVEKTREVAQKTRQKSL
                     "
     gene            complement(79145..81418)
                     /locus_tag="ECL_RS27440"
                     /old_locus_tag="ECL_B117"
                     /db_xref="GeneID:9111699"
     CDS             complement(79145..81418)
                     /locus_tag="ECL_RS27440"
                     /old_locus_tag="ECL_B117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001548797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system DNA-binding
                     domain-containing protein"
                     /protein_id="WP_044160319.1"
                     /db_xref="GeneID:9111699"
                     /translation="MLDQKQEKSTVSDLNRGGQVLMHFIRMLHQTLTRYFKIVLCVFV
                     IATTAVTYQITDKTDWYMGLKYGYSYTLVELIGLKKGKTTLELPDGRKVMVRDAQIVS
                     SPTMQNHADALISNLIISLVISSIVALIAAWYLFRFILNKGKQESKDEHRRGAELATV
                     KELIEAANDRVKEDGRLSRISIANVPLVRYQENSGIALLGSPGVGKSTIIRELLRQLR
                     AQQRKAVLYDISGEFVKRFYRPGKDVILNVFDTRSHSWDFWAEGKNPAMYDRMAKAAI
                     PDNNGGGDPFWIEAPRLLFSALLEQLGKRYDVPSVEHLMNIILRMPNDKIANVVATTD
                     ARNVMNLDLDKLAGSVRAVITAYTRNFKHLALPTGPRFSFKNWAQDEDSDAWVFITVR
                     DDMKDTLKPMITMMIESALSAILTLEPSQDRLIGTSIDEAGTLQEIPSLPDFMSTCRK
                     FGGFPILGFQSNAQTDVVYGEKKSQILMDGIGAIAAFRINGSKGAAWLADQLGDQETE
                     KSSENTSYGANDVRDATSINRQDKEGNLILRSQITALPDNTCYLKLGRGLPVAKIKFP
                     YDYMKELHPGIIENEALNDTSFLSQLSKENEISPEHVVSIVNKENSREKREPQKFKQG
                     SKPNPDAGKTQEQVLDEVIDNSAPPDGSKTTSNADVSNPVAQAMSSVKSKTQMNAVAQ
                     AMNAANKKQSDADDQDDEGDFSNLQFDTQVAHDFLAEYESSFSTEQSNTEKNSNNDVT
                     NRNNEKSFDQHEYPGGM"
     gene            complement(81421..81771)
                     /locus_tag="ECL_RS27445"
                     /old_locus_tag="ECL_B118"
                     /db_xref="GeneID:9111700"
     CDS             complement(81421..81771)
                     /locus_tag="ECL_RS27445"
                     /old_locus_tag="ECL_B118"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087388.1"
                     /db_xref="GeneID:9111700"
                     /translation="MGNVKTKQQIQFRLSGALDLALQKEAARRGMSVNELAKKIVINE
                     LTNAGTSTFKADVSLKHVLSSSYNIIHLAVFIIMSANPELSEDAATEIASKFIFSKSN
                     ARVSNIMKQLGVED"
     gene            82202..82411
                     /locus_tag="ECL_RS27450"
                     /old_locus_tag="ECL_B119"
                     /db_xref="GeneID:9111701"
     CDS             82202..82411
                     /locus_tag="ECL_RS27450"
                     /old_locus_tag="ECL_B119"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164928073.1"
                     /db_xref="GeneID:9111701"
                     /translation="MTLVTRGHLRSSAPGHHHGGNLLRGAGTVTRLRVTCRHDLPPAG
                     TLARRSGCAGHQGASAQQCARLSLR"
     gene            82583..82834
                     /locus_tag="ECL_RS27455"
                     /old_locus_tag="ECL_B120"
                     /db_xref="GeneID:9111702"
     CDS             82583..82834
                     /locus_tag="ECL_RS27455"
                     /old_locus_tag="ECL_B120"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087390.1"
                     /db_xref="GeneID:9111702"
                     /translation="MAVIQPRGKATNKRFQFTAPAELIDEFNQKKELLERTDLSIDMT
                     DDFIKVIKDAIKTIDKRLAEVKETPEHTDRTGVNTQQQA"
     gene            complement(82865..83062)
                     /locus_tag="ECL_RS27460"
                     /old_locus_tag="ECL_B121"
                     /db_xref="GeneID:9111703"
     CDS             complement(82865..83062)
                     /locus_tag="ECL_RS27460"
                     /old_locus_tag="ECL_B121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087391.1"
                     /db_xref="GeneID:9111703"
                     /translation="MNEQTLAIIALYPNLKEGVTVAPDVVAHGSARVEIREKGHLHWR
                     AFDFEPGFYEALEKNLKYVSK"
     gene            complement(83409..84287)
                     /locus_tag="ECL_RS27465"
                     /old_locus_tag="ECL_B123"
                     /db_xref="GeneID:9111705"
     CDS             complement(83409..84287)
                     /locus_tag="ECL_RS27465"
                     /old_locus_tag="ECL_B123"
                     /inference="COORDINATES: protein
                     motif:HMM:NF037428.1,HMM:NF037528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013087393.1"
                     /db_xref="GeneID:9111705"
                     /translation="MTSQTFDPKTVIVQVGQVVYTGLYGLGNGVVSAIYGEQSPATSR
                     VHFGGVMVSGGKAEFDILFESGSETKRLPECILRGVQWRIFDEVKSHEEIERIREVVI
                     ATQKKAAEDKAEADAAYALKKVQLTGDPKYSGLEKIGSSSRSHAAVVAKNMRTELKAA
                     YPGTKFSVRKTGYDSISVKWIDGPTKDQVQDIIGKYKTGHYDMYADIHESNSTPFTDI
                     YGGVDYLHYSRDYSEELTQKAIDNVRKKYGQEIVPESCTVAAYISGDLWKVSRDFFFN
                     HGVDGEIGKELRELQG"
CONTIG      join(CP001920.1:1..84653)
//
DBGET integrated database retrieval system