GenomeNet

Database: RefSeq
Entry: NC_014121
LinkDB: NC_014121
Original site: NC_014121 
LOCUS       NC_014121            5314581 bp    DNA     circular CON 10-MAR-2020
DEFINITION  Enterobacter cloacae subsp. cloacae ATCC 13047, complete sequence.
ACCESSION   NC_014121
VERSION     NC_014121.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603901
            Assembly: GCF_000025565.1
KEYWORDS    RefSeq.
SOURCE      Enterobacter cloacae subsp. cloacae ATCC 13047
  ORGANISM  Enterobacter cloacae subsp. cloacae ATCC 13047
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
REFERENCE   1  (bases 1 to 5314581)
  AUTHORS   Ren,Y., Ren,Y., Zhou,Z., Guo,X., Li,Y., Feng,L. and Wang,L.
  TITLE     Complete genome sequence of Enterobacter cloacae subsp. cloacae
            type strain ATCC 13047
  JOURNAL   J. Bacteriol. 192 (9), 2463-2464 (2010)
   PUBMED   20207761
REFERENCE   2  (bases 1 to 5314581)
  AUTHORS   Wang,L., Ren,Y., Ren,Y., Zhou,Z., Guo,X., Feng,L. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2010) TEDA School of Biological Sciences and
            Biotechnology, Nankai University, 23 Hongda Street, TEDA, Tianjin,
            Tianjin 300457, China
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001918.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 03/10/2020 09:36:17
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,506
            CDSs (total)                      :: 5,389
            Genes (coding)                    :: 5,208
            CDSs (with protein)               :: 5,208
            Genes (RNA)                       :: 117
            rRNAs                             :: 9, 8, 8 (5S, 16S, 23S)
            complete rRNAs                    :: 9, 8, 8 (5S, 16S, 23S)
            tRNAs                             :: 85
            ncRNAs                            :: 7
            Pseudo Genes (total)              :: 181
            CDSs (without protein)            :: 181
            Pseudo Genes (ambiguous residues) :: 0 of 181
            Pseudo Genes (frameshifted)       :: 79 of 181
            Pseudo Genes (incomplete)         :: 82 of 181
            Pseudo Genes (internal stop)      :: 27 of 181
            Pseudo Genes (multiple problems)  :: 7 of 181
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5314581
                     /organism="Enterobacter cloacae subsp. cloacae ATCC 13047"
                     /mol_type="genomic DNA"
                     /strain="ATCC 13047"
                     /sub_species="cloacae"
                     /culture_collection="ATCC:13047"
                     /type_material="type strain of Enterobacter cloacae"
                     /db_xref="taxon:716541"
                     /note="type strain of Enterobacter cloacae subsp. cloacae"
     gene            13..1410
                     /gene="dnaA"
                     /locus_tag="ECL_RS00005"
                     /old_locus_tag="ECL_00001"
                     /db_xref="GeneID:9127753"
     CDS             13..1410
                     /gene="dnaA"
                     /locus_tag="ECL_RS00005"
                     /old_locus_tag="ECL_00001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_014068246.1"
                     /db_xref="GeneID:9127753"
                     /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPN
                     RFVLDWVRDKYLNNINGLLNDFCGSDAPQLRFEVGTKPVTQTVRETVNVAVPAQAAPA
                     PAPRVAPAARPGWDNVPAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPG
                     GAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIE
                     EFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGV
                     EDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVREL
                     EGALNRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADL
                     LSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESH
                     DIKEDFSNLIRTLSS"
     gene            1415..2515
                     /gene="dnaN"
                     /locus_tag="ECL_RS00010"
                     /old_locus_tag="ECL_00002"
                     /db_xref="GeneID:9122513"
     CDS             1415..2515
                     /gene="dnaN"
                     /locus_tag="ECL_RS00010"
                     /old_locus_tag="ECL_00002"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005976672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_008500170.1"
                     /db_xref="GeneID:9122513"
                     /translation="MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSL
                     TGTDLEMEMIARVTLTQPHDAGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSG
                     RSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMPIGDSLPNHSVIVPRKGVIELMRMLDGGDTPLRVQI
                     GSNNIRAHVGDFVFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDSLKQAFARAAILSNE
                     KFRGVRLYVSENQIKITANNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKCE
                     NVRILLTDSVSSVQIEDAASQSAAYVVMPMRL"
     gene            2515..3588
                     /gene="recF"
                     /locus_tag="ECL_RS00015"
                     /old_locus_tag="ECL_00003"
                     /db_xref="GeneID:9122514"
     CDS             2515..3588
                     /gene="recF"
                     /locus_tag="ECL_RS00015"
                     /old_locus_tag="ECL_00003"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005121479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication/repair protein RecF"
                     /protein_id="WP_013094779.1"
                     /db_xref="GeneID:9122514"
                     /translation="MSLTRLLIRDFRNIESADLALSPGFNFLVGANGSGKTSVLEAIY
                     TLGHGRAFRSLQIGRVIRHEQESFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGTDG
                     HKVAELALLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEAGFFNAWSNLKRLLKQ
                     RNAALRQVTRYAQLRPWDMELIPLAEQISRWRAEYSAGIAEDMADTCKQFLPEFSLTF
                     SFQRGWEKETDYAEVLERNFERDRMLTYTAHGPHKADFRIRADGAPVEDTLSRGQLKL
                     LMCALRLAQGEFLTRESGRRCLYLIDDFASELDDARRGLLASRLKATQSQVFVSAISA
                     EHVMDMSDENSKMFTVEKGKITD"
     gene            3617..6028
                     /gene="gyrB"
                     /locus_tag="ECL_RS00020"
                     /old_locus_tag="ECL_00004"
                     /db_xref="GeneID:9122515"
     CDS             3617..6028
                     /gene="gyrB"
                     /locus_tag="ECL_RS00020"
                     /old_locus_tag="ECL_00004"
                     /EC_number="5.6.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase (ATP-hydrolyzing) subunit B"
                     /protein_id="WP_013094780.1"
                     /db_xref="GeneID:9122515"
                     /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNAIDEALAGHCKDIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYQHGVPEAPLAVTGDT
                     EKTGTMVRFWPSLETFTNVTEFEYDILAKRLRELSFLNSGVSIRLRDKRDNKEDHFHY
                     EGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQR
                     DGGTHLAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSS
                     QTKDKLVSSEVKSAVEQQMNELLSDYLQENPNDAKIVVGKIIDAARAREAARKAREMT
                     RRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKI
                     LNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRT
                     LLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDDAMDQYQIAIALDGATL
                     HANSSAPALAGEPLERLVSEFNATQKMIGRMERRYPKALLKELIYQPTLTEADLSNEQ
                     AVTRWVNALVSELNEKEQHGSQWKFDVQQNAAQQFEPIIRVRTHGVDTDYPLEHEFVT
                     GPEYRRICTLGEKLRGLIEDDAFIERGERRQPVASFEQALEWLVKESRRGLSIQRYKG
                     LGEMNPDQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKA
                     ANIDI"
     gene            complement(6049..6996)
                     /locus_tag="ECL_RS00025"
                     /old_locus_tag="ECL_00005"
                     /db_xref="GeneID:9122516"
     CDS             complement(6049..6996)
                     /locus_tag="ECL_RS00025"
                     /old_locus_tag="ECL_00005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014839853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013094781.1"
                     /db_xref="GeneID:9122516"
                     /translation="MTSTLKDIPVFVAAVEAGSFAQAAIRLHLSRSAVGKSIARLEER
                     LGVRLFHRTTRSQSLTDNGALFYERCLRALEEIRGAESLLETGKQQISGRLRVAMPVL
                     FGRQCVAPLLIELAQEHPGLELEMSFSDRVVDLVEEGFDMAVRNGTLQDSSVLVVRRL
                     GEHRMVLCAAPEYLQKSGQPDTVADLPHHTAINYLRAGRVLPWQLMDNEGRSHTFTPR
                     SSLNMDDLQAICDAALAGYGIAWLPCWMARREIQQGKLIPLLKQAPDVRFDVHAVWQQ
                     TPHLPLRVRIAIDTLASRLPSVLSLDMPEPKKSRAKCAA"
     gene            7107..8132
                     /locus_tag="ECL_RS00030"
                     /old_locus_tag="ECL_00006"
                     /db_xref="GeneID:9122517"
     CDS             7107..8132
                     /locus_tag="ECL_RS00030"
                     /old_locus_tag="ECL_00006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004855699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent alcohol dehydrogenase"
                     /protein_id="WP_013094782.1"
                     /db_xref="GeneID:9122517"
                     /translation="MAETMQRWSMNALGRENLKLTQEPVPKPGPGEVRVRVNAVALNY
                     RDKMVIEGMMPIPLSFPFTPASDMAGVVDSIGEGVTRFQPGARVISTFFPEWIDGRPQ
                     ADARHLPYKTSGGYFPGMLAEYVIVNENGLVAAPETLDDVEASTLPCAGLTAWFALVE
                     RGNLRAGQSVLVQGTGGVAIFALQIAKALGAEVYVTSGSDEKLARAKKLGADRGINRL
                     KGDWAEALLTLTQDRGIDHIIETVGGENLQHSLRAVAVHGRISVIGVLAGSEITLSAG
                     ELLLKSPVIQGIGVGHRRALEEFVRAVEVTGLKPVIEQRYRFDQLEQALEHLDRGAFG
                     KIVLTRE"
     gene            8247..9059
                     /gene="yidA"
                     /locus_tag="ECL_RS00035"
                     /old_locus_tag="ECL_00007"
                     /db_xref="GeneID:9122518"
     CDS             8247..9059
                     /gene="yidA"
                     /locus_tag="ECL_RS00035"
                     /old_locus_tag="ECL_00007"
                     /EC_number="3.1.3.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar-phosphatase"
                     /protein_id="WP_013094783.1"
                     /db_xref="GeneID:9122518"
                     /translation="MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARAKGVNVVLTTG
                     RPYAGVHSYLKELHMNQPGDYCITYNGALVQKAADGSTVAQTALNYDDYLFLEKLSRE
                     VGSHFHALDRTTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEP
                     EVLDKAIARIPAEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADALGIKPEEIMAL
                     GDQENDIAMIEYAGMGVAMENAIPSVKEVANFVTKSNLEDGVAYAIEKFVLS"
     gene            9286..9975
                     /gene="dgoR"
                     /locus_tag="ECL_RS00040"
                     /old_locus_tag="ECL_00008"
                     /db_xref="GeneID:9122519"
     CDS             9286..9975
                     /gene="dgoR"
                     /locus_tag="ECL_RS00040"
                     /old_locus_tag="ECL_00008"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-galactonate utilization transcriptional
                     regulator DgoR"
                     /protein_id="WP_003861109.1"
                     /db_xref="GeneID:9122519"
                     /translation="MTLNKTDRIVITLGTQIVGGKYVPGSPLPAEAELCEEFETSRNI
                     IREVFRSLMAKRLIEMKRYRGAFVAPRNQWNYLDTDVLQWVLENDYDPRLIGAMSEVR
                     NLVEPAIARWAAERATSGDLAQIESALNDMIANNQNREAFNEADIRYHEAVLQSVHNP
                     VLQQLSVAISSLQRAVFERTWMGDEANMPKTLQEHKALFDAIRHQDGDAAEQAALTMI
                     ASSTRRLKEIT"
     gene            9972..10850
                     /locus_tag="ECL_RS00045"
                     /old_locus_tag="ECL_00009"
                     /db_xref="GeneID:9122520"
     CDS             9972..10850
                     /locus_tag="ECL_RS00045"
                     /old_locus_tag="ECL_00009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxygalactonokinase"
                     /protein_id="WP_013094784.1"
                     /db_xref="GeneID:9122520"
                     /translation="MTSRYIAIDWGSTNLRAWLYQGEQCLESRQSEAGVTRLNGKSPE
                     AVLAEVTQNWRDSATPVVMAGMVGSNVGWKIAPYLPVPVSFSAIGKQLTSVGDNILIV
                     PGLCVSRDDNHNVMRGEETQLLGARTLSPSSVYVMPGTHCKWVQADAEHIHDFRTVMT
                     GELHHLLLNHSLLGAGLPEQVPSPEAFAAGLARGIAFPDVLPQLFEVRASHVLGNLPR
                     EQVSEFLSGLLIGAEVASMREFVGCEQAVTIVAGAALTSRYEQAFRAIGREVSTVSGD
                     TAFQAGIRSIAHAVAN"
     gene            10834..11451
                     /locus_tag="ECL_RS00050"
                     /old_locus_tag="ECL_00010"
                     /db_xref="GeneID:9122521"
     CDS             10834..11451
                     /locus_tag="ECL_RS00050"
                     /old_locus_tag="ECL_00010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
                     /protein_id="WP_013094785.1"
                     /db_xref="GeneID:9122521"
                     /translation="MQWQTSLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPE
                     WEKSIPTVVEAFGDKALIGAGTVLQPEQVERLAKMGCKLIVTPNINPEVIRRAVSHGM
                     TVCPGCATATEAFTALEAGAQSLKIFPSSAFGPDYIKALKAVLPASVPVFAVGGVTPE
                     NLAQWINAGCVGAGLGSDLYRAGQSVERTAQQAAAFVKAYREAVQ"
     gene            11448..12596
                     /gene="dgoD"
                     /locus_tag="ECL_RS00055"
                     /old_locus_tag="ECL_00011"
                     /db_xref="GeneID:9122522"
     CDS             11448..12596
                     /gene="dgoD"
                     /locus_tag="ECL_RS00055"
                     /old_locus_tag="ECL_00011"
                     /EC_number="4.2.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactonate dehydratase"
                     /protein_id="WP_013094786.1"
                     /db_xref="GeneID:9122522"
                     /translation="MKITKLTTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAA
                     VHELGEYLIGQDPARINDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPV
                     WQLMGGLVRDKIKAYSWVGGDRPAEVIDGITQLRNIGFDTFKLNGCEEMGVIDNSRAV
                     DRAVNTVAQIREAFGNEIEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAE
                     YYPKLAEQTHIPIAAGERMFSRFEFKRVLEAGGIAILQPDLSHAGGITECYKIAGMAE
                     AYDVALAPHCPLGPVALAACLHVDFVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFS
                     MEGGFFKPLMKPGLGVDIDEAKVIELSKNAPDWRNPLWRHEDGSVAEW"
     gene            12713..14050
                     /locus_tag="ECL_RS00060"
                     /old_locus_tag="ECL_00012"
                     /db_xref="GeneID:9122523"
     CDS             12713..14050
                     /locus_tag="ECL_RS00060"
                     /old_locus_tag="ECL_00012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_164928053.1"
                     /db_xref="GeneID:9122523"
                     /translation="MVSGFAMPKIWRQIAMDIPVTATKTGRRRYLTLIMIFITVVICY
                     VDRANLAVASAHIQEEFGITKAEMGYVFSAFAWLYTLYQIPGGWFLDRVGSRLTYFIA
                     ILGWSVATLFQGFATGLMSLIGLRAITGVFEAPAFPTNNRMVTSWFPEHERASAVGFY
                     TSGQFVGLAFLTPLLIWIQELLSWHWVFIVTGGIGIIWSLIWFKVYQPPRLTKNITKA
                     ELDYIRDGGGLVDGDAPVKKEARQPLTRADWKLVFHRKLVGVYLGQFAVTSTLWFFLT
                     WFPNYLTQEKGITALKAGFMTTVPFLAAFFGVLLSGWLADKLVKKGVSLGVARKTPII
                     CGLLISTCIMGANYTNDPVWIMTLMALAFFGNGFASITWSLVSSLAPMRLIGLTGGVF
                     NFVGGLGGITVPLVIGYLAQDYGFGPALVYISAVALIGALSYILLVGDVKRVG"
     gene            14101..15330
                     /locus_tag="ECL_RS00065"
                     /old_locus_tag="ECL_00013"
                     /db_xref="GeneID:9122524"
     CDS             14101..15330
                     /locus_tag="ECL_RS00065"
                     /old_locus_tag="ECL_00013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003861097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3748 domain-containing protein"
                     /protein_id="WP_013094788.1"
                     /db_xref="GeneID:9122524"
                     /translation="MKQITFASRNHQLTNTNTWTPDSQWLVYDVRPSGASFTGETIER
                     VNVSTGEVEVIYRAKHGAHVGVVTVHPAQDKYVFIHGPKNPDADWQYDFHHRQGVIVH
                     NGQASNLDAMDITVPYTAGALRGGSHVHVFSPNGQFVSFTYNDHVLHERDPKLDLRNV
                     GVAAPFGPVTPQGNHPHEYPGTFWSVLVSRTTPNPQPGSDEINRAYEEGWVGNGRLAF
                     IGDTLSVKGEKVPELFIVDLPKDEQGWKQAGDAPLQGTPETMPAPPAGVLQRRLTFTH
                     QKAYPGLVNVPRHWVRSNPQGTQIAFLMRDDNGIVQLWLISPEGGEPRQLTHTESGIQ
                     SAFNWHPSGDSLGFVLENRIACCDAQTGEVTFLTSDHGNPPSADAVVFSPNGRAIAWM
                     EEKEGFRQLWLTETVQD"
     gene            complement(15327..15659)
                     /locus_tag="ECL_RS00070"
                     /old_locus_tag="ECL_00014"
                     /db_xref="GeneID:9122525"
     CDS             complement(15327..15659)
                     /locus_tag="ECL_RS00070"
                     /old_locus_tag="ECL_00014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011915280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YceK/YidQ family lipoprotein"
                     /protein_id="WP_044159037.1"
                     /db_xref="GeneID:9122525"
                     /translation="MMKNVLIKLTTFSGVVLLCGCSSVMSHTGGKEGTYPGTRASAAM
                     ISDDDTNWGTKSLVILDMPFTAVADTLLLPWDMFRTDSSVRSRVEKSEQQNLATNAVI
                     PPAEMPRP"
     misc_feature    15908..15980
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01832"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="ROSE (Repression Of Heat Shock gene Expression)
                     occurs in the 5'-region of heat shock genes and acts as an
                     RNA thermometer to modulate expression; Derived by
                     automated computational analysis using gene prediction
                     method: cmsearch."
                     /db_xref="RFAM:RF01832"
     gene            15974..16384
                     /gene="ibpA"
                     /locus_tag="ECL_RS00075"
                     /old_locus_tag="ECL_00015"
                     /db_xref="GeneID:9122526"
     CDS             15974..16384
                     /gene="ibpA"
                     /locus_tag="ECL_RS00075"
                     /old_locus_tag="ECL_00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006687722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone IbpA"
                     /protein_id="WP_006177605.1"
                     /db_xref="GeneID:9122526"
                     /translation="MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGYPPYNVELVDEN
                     HYRIAIAVAGFAESELEITAQDNLLVVKGSHTAEQKERTYLYQGIAERNFERKFQLAE
                     NIHVKGANLVNGLLFIELERVIPEEKKPRRIEIN"
     gene            16521..16949
                     /gene="ibpB"
                     /locus_tag="ECL_RS00080"
                     /old_locus_tag="ECL_00016"
                     /db_xref="GeneID:9122527"
     CDS             16521..16949
                     /gene="ibpB"
                     /locus_tag="ECL_RS00080"
                     /old_locus_tag="ECL_00016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462708.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone IbpB"
                     /protein_id="WP_013094790.1"
                     /db_xref="GeneID:9122527"
                     /translation="MRNYDLSPLLRQWIGFDKLANALQSTTEHQTFPPYNIEKSDDNH
                     YRITLALAGFRQDDLDIQLEGTRLTVKGSPEKQETETKWLHQGLVTQPFSLSFTLADH
                     MEVSGATFTNGLLHIDLVRNVPEAIAPQRIAISERPALNS"
     gene            17114..18775
                     /locus_tag="ECL_RS00085"
                     /old_locus_tag="ECL_00017"
                     /db_xref="GeneID:9122528"
     CDS             17114..18775
                     /locus_tag="ECL_RS00085"
                     /old_locus_tag="ECL_00017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008500160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative transporter"
                     /protein_id="WP_013094791.1"
                     /db_xref="GeneID:9122528"
                     /translation="MSDIALTVSVLALVAVVGLWIGNIKIRGVGFGIGGVLFGGIFVG
                     HFADKLGLVLSADMLHFTQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFALGIVV
                     MGGLVTAILHKLFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGIEPGIVDQMGMSY
                     AMAYPFGICGILLSMWLVRVLFRINVDKEAKDHETTLTNGHMPIKTINIRVDNPNLNN
                     MAIQDVPILNSANIICSRLKRDEMLMVPAPGTIIRQGDLLHLVGQPGDLNNARLVIGQ
                     EVDTSLSTRGTDMRVERVVVTNEHVLGKKIRDLQVKERYDVVISRLNRAGVELVASPE
                     ASLQFGDILNLVGRPSSIDAVADMVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLYIP
                     GFPVALKLGLAGGPLIMALILGRIGCVGKLYWFMPPSANLALRELGIVLFLAVVGLKS
                     GGDFVDTLVRGEGMSWVGYGIFITAIPLLTVGILARMFAKMNYLTLCGMLAGSMTDPP
                     ALAFANSLHATSGAAALSYATVYPLVMFLRIITPQLLAVLFWGMS"
     gene            complement(18743..19489)
                     /locus_tag="ECL_RS00090"
                     /old_locus_tag="ECL_00018"
                     /db_xref="GeneID:9122529"
     CDS             complement(18743..19489)
                     /locus_tag="ECL_RS00090"
                     /old_locus_tag="ECL_00018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011915284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013094792.1"
                     /db_xref="GeneID:9122529"
                     /translation="MIYKSIADRLRLRLNSSDYNIGSPIPGEKALAQEFGVARMTIRK
                     ALDLLVSWGLVERRHGSGTFVARKDVHHETTNLTGLVEVLRQQGKEVQSKVLQFEVMP
                     APPAIASQLRIQVDERIYFSRRVRYVDGKPLMLEDSFMPVKLFRNLSLAHLEGSKFDY
                     IEKECGITISGNYESLTPVLADKQLAGYMNLPEQTPLLRITSLSYSDSGEFLNYSVMF
                     RNTSDYQVDYHLRRIHPDDLLTHPPEQHRQ"
     gene            19712..21334
                     /locus_tag="ECL_RS00095"
                     /old_locus_tag="ECL_00019"
                     /db_xref="GeneID:9122530"
     CDS             19712..21334
                     /locus_tag="ECL_RS00095"
                     /old_locus_tag="ECL_00019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS transporter subunit EIIC"
                     /protein_id="WP_013094793.1"
                     /db_xref="GeneID:9122530"
                     /translation="MLSQIQRFGGAMFTPVLLFPFAGIVVGIAIMLRNPLFVGEALTA
                     PDNLFAQIVHIIEEGGWAVFRNMPLIFAVGLPIGLAKQAQGRACLAVLISFLTWNYFI
                     NAMGMTWGHFFGVDFSAEPTAGSGLAMIAGIKTLDTSIIGAIAISGIVTAIHNRFFEK
                     PLPVFLGIFQGTSFVVIIAFFVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWV
                     YTFLERILIPTGLHHFVYGPFIFGPAAVEGGIQVYWAQHLQAFSQSTLPLKTLFPEGG
                     FALHGNAKVFGSVGIALAIWYTASPENRVKVAGLLIPATLTAVLVGITEPLEFTFLFI
                     SPLLFAIHAVLAATMATVMYTFGVVGNMGGGLLDQFLPQNWIPMFHNHASTVFTQIGI
                     GVCFTGLYFVVFKTLIERLNLKTPGREESEIKLYSKADYKAARGQTTAPAAASQQVGQ
                     AAGFLQALGGAANIESINNCATRLRIALVDMAQTQSDEVFKALGAHGVVRRGNGIQVI
                     VGLHVPQVRDQLESLMKTPLTNEQTTLTEAIS"
     gene            21331..22653
                     /locus_tag="ECL_RS00100"
                     /old_locus_tag="ECL_00020"
                     /db_xref="GeneID:9122531"
     CDS             21331..22653
                     /locus_tag="ECL_RS00100"
                     /old_locus_tag="ECL_00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-alpha-glucosidase"
                     /protein_id="WP_013094794.1"
                     /db_xref="GeneID:9122531"
                     /translation="MKKFSVVIAGGGSTFTPGIVLMLLANRDRFPLRALKFYDNDGAR
                     QETIAEACKIILKEQAPEIEFSYTTDPKAAFTDVDFVMAHIRVGKYPMREKDEKIPLR
                     HGVLGQETCGPGGISYGMRSIGGVLELVDYMEQYSPNAWMLNYSNPAAIVAEATRRLR
                     PHAKILNICDMPIGIEGRMAQIVGLKDRKQMRVRYYGLNHFGWWTSIEDLNGNDLMPK
                     LREYVAKHGYVPPSEDAHTEASWNDTFAKAKDVQALDPDTMPNTYLKYYLFPDYVVAH
                     ANPERTRANEVMDHREKHVFSSCRAIIEAGKSSAGELEIDEHASYIVDLATAIAFNTQ
                     ERMLLIVPNNGAIHNFDADAMVEIPCLVGHNGPEPLTVGDIPHFQKGLMSQQVAVEKL
                     VVDAWEQRSYQKLWQAITLSKTVPSASVAKAILDDLIEANKDYWPELH"
     gene            22746..23093
                     /locus_tag="ECL_RS00105"
                     /old_locus_tag="ECL_00021"
                     /db_xref="GeneID:9122532"
     CDS             22746..23093
                     /locus_tag="ECL_RS00105"
                     /old_locus_tag="ECL_00021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF202 domain-containing protein"
                     /protein_id="WP_013094795.1"
                     /db_xref="GeneID:9122532"
                     /translation="MKISRLGEAPDYRFSLANERTYLAWIRTALGFLAAGVGLDQLAP
                     DFATPLIREVLALLLCLFAGVLAIYGYLRWLRNEKAMRLKQDLPYTRGLLIISAILLT
                     VAGVVMVLVVYGG"
     gene            23083..23430
                     /locus_tag="ECL_RS00110"
                     /old_locus_tag="ECL_00022"
                     /db_xref="GeneID:9122533"
     CDS             23083..23430
                     /locus_tag="ECL_RS00110"
                     /old_locus_tag="ECL_00022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015570122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF202 domain-containing protein"
                     /protein_id="WP_013094796.1"
                     /db_xref="GeneID:9122533"
                     /translation="MADSRKARREADPGLQPERTSLAWLRTLLGYGALIALAIKHNWH
                     RTGLPFWISLVVLALVAIILWRYTRSRNVMDVAQDDFVQPKAVRDKFLIALAVLSLSL
                     LFAVTHIQQIVHL"
     gene            complement(23463..24749)
                     /gene="dsdA"
                     /locus_tag="ECL_RS00115"
                     /old_locus_tag="ECL_00023"
                     /db_xref="GeneID:9122534"
     CDS             complement(23463..24749)
                     /gene="dsdA"
                     /locus_tag="ECL_RS00115"
                     /old_locus_tag="ECL_00023"
                     /EC_number="4.3.1.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-serine ammonia-lyase"
                     /protein_id="WP_013094797.1"
                     /db_xref="GeneID:9122534"
                     /translation="MENATITALTAQFPLVEDLMALKETTWLNPRTTSLAEGLPYVGL
                     TKADVDDAHARLNRFAPYLAKAFPETAATGGIIESELVAIPAMKKRLERESGKALPGT
                     LLLKKDSHLPISGSIKARGGIYEVLTHAEKLALEAGLLSTEDDYSILLEPRFKDFFSQ
                     YSIAVGSTGNLGMSIGIMSARIGFKVTVHMSADAREWKKAKLRSHGVTVVEYEQDYGV
                     AVEQGRKAAENDPNCFFIDDENSRTLFLGYAVAGERLKAQFAEQGRVVDAEHPLYVYL
                     PCGVGGGPGGVAFGLKLAFGDNVHCFFAEPTHSPCMLLGVYTGLHDEIAVQDLGIDNV
                     TAADGLAVGRASGFVGRAMERLLDGFYTLSDQSMYDMLGWLAQEEGIRLEPSALAGMA
                     GPLRVQADANVTHLVWATGGGMVPEDEMAKYLAKGK"
     gene            complement(24767..>24994)
                     /locus_tag="ECL_RS00120"
                     /old_locus_tag="ECL_00024"
                     /pseudo
                     /db_xref="GeneID:9122535"
     CDS             complement(24767..>24994)
                     /locus_tag="ECL_RS00120"
                     /old_locus_tag="ECL_00024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462702.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DsdX permease"
                     /db_xref="GeneID:9122535"
     gene            25289..26215
                     /gene="dsdC"
                     /locus_tag="ECL_RS00125"
                     /old_locus_tag="ECL_00025"
                     /db_xref="GeneID:9122536"
     CDS             25289..26215
                     /gene="dsdC"
                     /locus_tag="ECL_RS00125"
                     /old_locus_tag="ECL_00025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator DsdC"
                     /protein_id="WP_013094799.1"
                     /db_xref="GeneID:9122536"
                     /translation="MTDANEVRNRLLNGWQLSKMYTFEVAARHESFALAAAELSLSPS
                     AVSHRINLLEEELGIQLFVRSHRKVELTLEGKRVYWTLKSSLDTLNQEILDIKNQALS
                     GTLTVYSRPSIAQCWLVPMLGDFTRRYPSISLTILTGNEYVNMQRTGIDLAIYFDDTP
                     PNYLSHHFLMDEEILPVCSPAYAREHALLKNPDNLSHCTLLHDRQAWSNDSGTDEWLS
                     WAQHFAMNMPSSSGIGFDRSDLAIVAAMNHVGVAMGRKRLVQKRLERGELIAPFGNKT
                     LKCHQHYYISTLPGRQWPKIDAFIGWLRELAG"
     gene            26300..27388
                     /locus_tag="ECL_RS00130"
                     /old_locus_tag="ECL_00026"
                     /db_xref="GeneID:9122537"
     CDS             26300..27388
                     /locus_tag="ECL_RS00130"
                     /old_locus_tag="ECL_00026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014167981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulase family glycosylhydrolase"
                     /protein_id="WP_013094800.1"
                     /db_xref="GeneID:9122537"
                     /translation="MLKPLIATALLLSSGWAIAAEPPLTAALYAQKLGVGMDVDWART
                     ERGIREFDPLVVRDFRAKGISHVRIRVADEPTEARLIHLRKLVEACEQYGVIPIIAYQ
                     ADSYKNDPKADNEKEVTDWWIAVAHYFGKRSPLLGFDLIYEPADKLNHNAASLNRVYE
                     KTIKVIHSIDADRMIFIAPRLRAAPEDLPSLKLPAHSQNFLLAEWHIFPWGPLKNNGK
                     YPWTSGMAAEKAAIHNRIATALRWQQKTGHVSWVGGWGVGESNRFTPTASQMAFATFM
                     ACELQKAKIPYAINADFQFYDGEEGAWRPAPEPLLEAMIAPACEKPGEKPGHHAVKQA
                     ARGGEHATPAAASTAKSVAPSASSVNPN"
     gene            complement(27291..28475)
                     /gene="emrD"
                     /locus_tag="ECL_RS00135"
                     /old_locus_tag="ECL_00027"
                     /db_xref="GeneID:9122538"
     CDS             complement(27291..28475)
                     /gene="emrD"
                     /locus_tag="ECL_RS00135"
                     /old_locus_tag="ECL_00027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_115740452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter EmrD"
                     /protein_id="WP_044159577.1"
                     /db_xref="GeneID:9122538"
                     /translation="MKKQRNVNLLLMLVLLVAVGQMAQTIYIPAIADMAKELNVREGA
                     VQSVMAAYLLTYGVSQLFYGPLSDRIGRRPVILTGMCIFMVATVIAITTHSLTVLIAA
                     SALQGVGTGVGGVMARTLPCDMYQGTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWS
                     WRACYAFLLVLCVIVTFSMARWMPETRPQDAPRTKLLASYKTLFGNGALTCYLLMLIG
                     GLAGIAVFEACSGVLLGAGLGLSSMVVSILFILPIPAAFFGAWFAGRQNKRFSTLMWQ
                     SVISCLLAGLMMWIPGLFGVMTVWTLLIPAALFFFGAGMLFPLATSGAMEPFPFLAGT
                     AGALVGGLQNIGSGALAWLSAMMPQTGQASLGLLMTLMGLLILLCWLPLASRVPHHEQ
                     PV"
     gene            complement(28651..29484)
                     /locus_tag="ECL_RS00140"
                     /old_locus_tag="ECL_00028"
                     /db_xref="GeneID:9122539"
     CDS             complement(28651..29484)
                     /locus_tag="ECL_RS00140"
                     /old_locus_tag="ECL_00028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_013094802.1"
                     /db_xref="GeneID:9122539"
                     /translation="MTLSVFCILLFAALLHASWNAIVKAGTDKLYSAISVSGSATLIA
                     LVLLPFSPQPSVASWPFLVVSCALQVVYTVLVAKTYQVSDMSQTYPLMRGTAPLLVAL
                     ISVLVLGDSLSWLAWAGIGVICLSILAMAMNGRLQSRKGIWLALLNACFIAGYTLVDG
                     TGVRLSDTALGYTLWTFFMNGFCLLCWAMVARRREASSYLRLHWKKGLLGGVGTMGSY
                     GLALWAMTQAPLAVVAALRETSILFGALIAFVLLKEKVAGLRIAAALGIAAGAILLRL
                     A"
     gene            complement(29547..29993)
                     /locus_tag="ECL_RS00145"
                     /old_locus_tag="ECL_00029"
                     /db_xref="GeneID:9122540"
     CDS             complement(29547..29993)
                     /locus_tag="ECL_RS00145"
                     /old_locus_tag="ECL_00029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006808797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013094803.1"
                     /db_xref="GeneID:9122540"
                     /translation="MSRLLIEPITPEEPGYIALKAESIAANFNMLRRLEENWQRGENR
                     FNAPGEKLLGAFLNGKLVGVCGLNRDPFSQQPRAGRIRHLYVSEKCRGLGIGKQLLTV
                     VMADASIWFDFLNTHAPDTACGFYRRAGFRLVSDEPRVTHRLFCAV"
     gene            complement(30058..30147)
                     /gene="tisB"
                     /locus_tag="ECL_RS00150"
                     /db_xref="GeneID:44145301"
     CDS             complement(30058..30147)
                     /gene="tisB"
                     /locus_tag="ECL_RS00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_453107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I toxin-antitoxin system toxin TisB"
                     /protein_id="WP_020684667.1"
                     /db_xref="GeneID:44145301"
                     /translation="MSVVDMVILILKLIVAVLQLLDAVLKYLR"
     gene            30773..31477
                     /locus_tag="ECL_RS00155"
                     /old_locus_tag="ECL_00031"
                     /db_xref="GeneID:9122542"
     CDS             30773..31477
                     /locus_tag="ECL_RS00155"
                     /old_locus_tag="ECL_00031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044159045.1"
                     /db_xref="GeneID:9122542"
                     /translation="MQASDYLKMKFQSDRQLAIYGQQGVAGTWKALKGIGSDIYSGME
                     RVSWYSSCLIPSYHDVCEELLSEEKRMYLSIVSIYRYRNVIAHMLYLYFESIMTDSEN
                     GNEKNRVRKTDSNVTGLVNNIPASKAARLAIAWTLAKSLSESGLLSEIVVERLARRVP
                     NVVMALQLMGTDQKCALAARRLKVLDPNYYATLYAAQLEMLYYFFEPFLAEIIKKVQT
                     GFYKDFDAIYNDLKDK"
     gene            31479..31661
                     /locus_tag="ECL_RS00160"
                     /old_locus_tag="ECL_00032"
                     /db_xref="GeneID:9122543"
     CDS             31479..31661
                     /locus_tag="ECL_RS00160"
                     /old_locus_tag="ECL_00032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094806.1"
                     /db_xref="GeneID:9122543"
                     /translation="MFKSLLSILFTDVLFPVYIFACASLFLWLVPNHWVLLTFIAIVV
                     FIIVHPIIFGRFDKYD"
     gene            31683..32162
                     /gene="hcp"
                     /locus_tag="ECL_RS00165"
                     /old_locus_tag="ECL_00033"
                     /db_xref="GeneID:9122544"
     CDS             31683..32162
                     /gene="hcp"
                     /locus_tag="ECL_RS00165"
                     /old_locus_tag="ECL_00033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004867872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tube protein Hcp"
                     /protein_id="WP_013094807.1"
                     /db_xref="GeneID:9122544"
                     /translation="MSNPAYLFLTDENGSPMVGPCLVSGREGAIELKSFTHNVNIPVD
                     GNTGKLTGTRIHMPVMFQKEFDRVTPFLFRALSTGRTLQSATIKMYQINEAGLEQEYF
                     NIIMENVKITSITPDLYPGANTGTHLETVLIRYEKITWKHCDGNVIYSDAWNERATY"
     gene            32270..32368
                     /gene="ivbL"
                     /locus_tag="ECL_RS00170"
                     /db_xref="GeneID:44145302"
     CDS             32270..32368
                     /gene="ivbL"
                     /locus_tag="ECL_RS00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ilvB operon leader peptide IvbL"
                     /protein_id="WP_071830013.1"
                     /db_xref="GeneID:44145302"
                     /translation="MTASMNTATLLKTAQPAAVVVVRVVVVVGNAP"
     gene            32473..34161
                     /gene="ilvB"
                     /locus_tag="ECL_RS00175"
                     /old_locus_tag="ECL_00034"
                     /db_xref="GeneID:9122545"
     CDS             32473..34161
                     /gene="ilvB"
                     /locus_tag="ECL_RS00175"
                     /old_locus_tag="ECL_00034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase large subunit"
                     /protein_id="WP_013094808.1"
                     /db_xref="GeneID:9122545"
                     /translation="MASSGTTSTKTRFTGAQLIVHLLERQGITTVAGIPGGTVLPLYD
                     ALSQSTQIRHVLARHEQGAGFIAQGMARTQGKPAVCMACSGPGATNLVTAIADARLDS
                     IPLICITGQVPSSMIGTDAFQEVDTYGISIPITKHNYLVRDITELPQVISYAFRIAQS
                     GRPGPVWIDIPKDVQTAEIEIDVLPEPGERAPAPEFSAESVRDAAAMINAAKRPVLYL
                     GGGAINAADEIRQFAEKANLPTTMTLMALGMLPKAHPLSLGMLGMHGARSTNYILQEA
                     DLLIVMGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQGDVADVLAQL
                     IPQTDATDRADWRQMVADLQREFPGAIPTEGDPLSHYGLINAVAACVDDSAIITTDVG
                     QHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAVGAALANPDRKVICFSGDGSLMMN
                     IQEMATAAENQLDVKIILMNNEALGLVHQQQSLFYKQGVFAATYPGMINFMQIAAGFG
                     LHTCDLNAEEDAHAALQAAISRPGPALIHVRIDPEQKVYPMVPPGAANTEMVGE"
     gene            34165..34452
                     /gene="ilvN"
                     /locus_tag="ECL_RS00180"
                     /old_locus_tag="ECL_00035"
                     /db_xref="GeneID:9122546"
     CDS             34165..34452
                     /gene="ilvN"
                     /locus_tag="ECL_RS00180"
                     /old_locus_tag="ECL_00035"
                     /EC_number="2.2.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase small subunit"
                     /protein_id="WP_001171659.1"
                     /db_xref="GeneID:9122546"
                     /translation="MQKQHENVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQ
                     GSEHSRIWLLVNDDQRLEQMMAQIDKLEDVTRVARNQSDPTMFNKIAVFFE"
     gene            34535..35128
                     /gene="uhpA"
                     /locus_tag="ECL_RS00185"
                     /old_locus_tag="ECL_00036"
                     /db_xref="GeneID:9122547"
     CDS             34535..35128
                     /gene="uhpA"
                     /locus_tag="ECL_RS00185"
                     /old_locus_tag="ECL_00036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator UhpA"
                     /protein_id="WP_013094809.1"
                     /db_xref="GeneID:9122547"
                     /translation="MTTIALIDDHLIVRSGFAQLLNLEPDFQVVAEFGSGREALAGLP
                     GRGVQVCICDISMPDLSGLELLSQLPKGMAIIMLSVHDSPALVEQALNAGARGFLSKR
                     CSPDELIAAVRTVSTGGCYLTPDIALKLAAGRQDPLTRRERQVAEKLAQGMAVKEIAA
                     ELGLSPKTVHVHRANLMEKLGVSNDVELARRMFDSWQ"
     gene            35125..36630
                     /gene="uhpB"
                     /locus_tag="ECL_RS00190"
                     /old_locus_tag="ECL_00037"
                     /db_xref="GeneID:9122548"
     CDS             35125..36630
                     /gene="uhpB"
                     /locus_tag="ECL_RS00190"
                     /old_locus_tag="ECL_00037"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine-protein
                     kinase/phosphatase UhpB"
                     /protein_id="WP_013094810.1"
                     /db_xref="GeneID:9122548"
                     /translation="MNPLISRLIAVVASFFIFSAAWFCLWSISLHLVERPELAVLLFP
                     FGLRLGLMLQCPRGYWPVLLGAEWLMLIWLSQEVALAHLPLLMTGSLLTLLPVALISR
                     YRHQRDWRTLLRQGAALIAAALLQSLPWVGEKEMLNALLLTLTGGLTLAPTCLVFWHY
                     LTSTVWQPLGPSLVSQPVNWRARHLIWYLLLFVVSLWLQLGLPAELSRFTPFCLALPI
                     IALAWHYGWQGALIATLMNAIALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLR
                     ELNQSLQTELSRNRRLAERLLETEESVRQEVARELHDDIGQTITAIRTQAGIVQRLAA
                     DNAGVKQGGAHIEQLSLGVYDSVRRLLGRLRPRQLDDLSLEQAVRSLMREMELESRGI
                     VSHLDWRIDESLLSEGQRVTLFRVCQEGLNNIVKHANASAVTLQGWQQDESLRLVIED
                     DGCGLPPGSGQQGFGLAGMRERVKALGGTLNISCTHGTRVSVSLPLRSHHV"
     gene            36623..37942
                     /locus_tag="ECL_RS00195"
                     /old_locus_tag="ECL_00038"
                     /db_xref="GeneID:9122549"
     CDS             36623..37942
                     /locus_tag="ECL_RS00195"
                     /old_locus_tag="ECL_00038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013094811.1"
                     /db_xref="GeneID:9122549"
                     /translation="MFKTPANAAPIGNKAEIDARYRYWRRHILITIWLGYALFYFTRK
                     SFNAAAPEILASGVMTRTDIGLLATLFYITYGLSKFFSGIVSDRSNARYFMGFGLIAT
                     GVVNILFGFSTSLWAFALLWALNAFFQGWGAPVCARLLTAWYSRNERGGWWAIWNTAH
                     NVGGALIPMVVGAAALHYGWRAGMMIAGGLAILAGLFLCWRLRDRPQTVGLPAVGDWR
                     HDEMEVAQQLEGAGLTRKEILTKYVLLNPYIWLLSLCYVLVYVVRAAINDWGNLYMSE
                     TLGVDLVTANSAVTMFELGGFIGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLW
                     LMPFASYVMQAACFFTIGFFVFGPQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASL
                     SGWPLARVIDIWHWSGFFAVIAIAAGISALLLLPFLHAQAPREASVM"
     gene            38083..39474
                     /gene="uhpT"
                     /locus_tag="ECL_RS00200"
                     /old_locus_tag="ECL_00039"
                     /db_xref="GeneID:9122550"
     CDS             38083..39474
                     /gene="uhpT"
                     /locus_tag="ECL_RS00200"
                     /old_locus_tag="ECL_00039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hexose-6-phosphate:phosphate antiporter"
                     /protein_id="WP_013094812.1"
                     /db_xref="GeneID:9122550"
                     /translation="MLAFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYL
                     IRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVGKTVVSYYADGKNTKQFLPFML
                     ILSAICMLGFSASMGAGSVSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGSY
                     LGMWNISHNLGGAGAAGVALFGANYLFDGHVIGMFIFPSIIALIVGFIGLRFGSDSPE
                     SYGLGKAEELFGEAISEEDKETEENEMTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRI
                     GIDQWSTVYAFQELKLSKEVAIQGFTLFEVGALVGTLLWGWLSDLANGRRALVACVAL
                     ALIIATLGVYQHASNQYVYLASLFALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKG
                     TFAYLIGDSFAKLGLGMIADGTPIFGLTGWAGTFAALDAAAIGCIVLMAMVAVLEERK
                     IRRENRVQKLKAA"
     gene            39636..40640
                     /locus_tag="ECL_RS00205"
                     /old_locus_tag="ECL_00040"
                     /db_xref="GeneID:9122551"
     CDS             39636..40640
                     /locus_tag="ECL_RS00205"
                     /old_locus_tag="ECL_00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013094813.1"
                     /db_xref="GeneID:9122551"
                     /translation="MLTRRLSCLALLMALATHAMATDAPTYGEKLEGFDYGWPVKHFT
                     FTSQEQSLDMAYLDVKPEKPNGRTVVLMHGKNFCAGTWDGTIRALSASGYRVIAPDQI
                     GFCKSTKPEHYQYTFQQLADNTHALLKTLGLDRVTVIGHSTGGMLATRYALMWPQQVE
                     QLVMVNPIGLEDWKARGVPHITVDQWYQRELKVSADGIRQYEKNTYYAGAWKPEYERW
                     VTMLAGLNNGPGKERVAWNSALLYDMIYTQPVIYEFSELKMPVLLMIGTKDNTAIGKD
                     LAPPEIRKTLGNYAVLGKETAKRIPHATLVEFNDMGHAPQMQDPARFHEALLKGLQAR
                     "
     gene            complement(40628..41530)
                     /locus_tag="ECL_RS00210"
                     /old_locus_tag="ECL_00041"
                     /db_xref="GeneID:9122552"
     CDS             complement(40628..41530)
                     /locus_tag="ECL_RS00210"
                     /old_locus_tag="ECL_00041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013094814.1"
                     /db_xref="GeneID:9122552"
                     /translation="MKTDLRTLDLNLLKTLDALLDERSVTRAATRLALTQPAVSGMLN
                     RLRDYFDDPLFIRAPHGIVPTTRAEELAAPVKRILADIDLLLQPVAFDPRQATLTFTL
                     AATDYALRAIAVPFIAALKVRAPAIRVRVIPVDSERMMNQLERGNVDVALITPHTTPD
                     DLHSRALYDERYVCMMRADHPDAGKPLSLARFCALEHVLVSYEGDSFRGVTDGALEKM
                     GRTRHVGLSVSNFLVLPDVLAISDMIAVVPSRIAENQTGMFVCDTPVPVPGFTKCMAW
                     HTRTHRNPAQMWLRGLLLETSQRA"
     gene            41630..42082
                     /locus_tag="ECL_RS00215"
                     /old_locus_tag="ECL_00042"
                     /db_xref="GeneID:9122553"
     CDS             41630..42082
                     /locus_tag="ECL_RS00215"
                     /old_locus_tag="ECL_00042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1198 domain-containing protein"
                     /protein_id="WP_013094815.1"
                     /db_xref="GeneID:9122553"
                     /translation="MVWIMLATLAVVFVVGFRVLTSDSRRAIKRLSERLGITPMPVES
                     MIDQFGKTPGNEFIRYLERPDEAHLQNVAQVLLIWQVCIVDGSEENLHTWHRMLRKAR
                     LAAPITDAQIRLALGFMREMEPDPQELNAFQLRYNQLFLPEEGVFYLH"
     gene            42179..42706
                     /locus_tag="ECL_RS00220"
                     /old_locus_tag="ECL_00043"
                     /db_xref="GeneID:9122554"
     CDS             42179..42706
                     /locus_tag="ECL_RS00220"
                     /old_locus_tag="ECL_00043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SRPBCC domain-containing protein"
                     /protein_id="WP_013094816.1"
                     /db_xref="GeneID:9122554"
                     /translation="MKQSAIIWPDDYLPGTTDNFASNEIIVAGLSAKAIWAQLNDTTL
                     WPNYYSNAEDIRFHDGSGPELSANARFRFTTFGFPVEAQVTEYVPPVDGEAARIAWHG
                     WVEGEESARLDVIHAWLFEDLPGNRVRILTQESQKGVPAQELARTLPNPMINGHQEWI
                     VGLAKAAMQEKLSKR"
     gene            42771..43961
                     /gene="nepI"
                     /locus_tag="ECL_RS00225"
                     /old_locus_tag="ECL_00044"
                     /db_xref="GeneID:9122555"
     CDS             42771..43961
                     /gene="nepI"
                     /locus_tag="ECL_RS00225"
                     /old_locus_tag="ECL_00044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000134752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine ribonucleoside efflux pump NepI"
                     /protein_id="WP_013094817.1"
                     /db_xref="GeneID:9122555"
                     /translation="MTEHIQPTTRPQTKEVSRPNWSAVFSVAFCVACLITVEFLPVSL
                     LTPMAQDLGISEGVAGQSVTVTAFVAMFASLFITQVIGAIDRRKVVILFSVLLTLSCL
                     LVSFAESFTLLLLGRACLGLGLGGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALV
                     IAAPLGSFLGGIIGWRNVFNAAAVMGFLCILWVWKALPSLPGEAAHHKQNMFSLLKRP
                     GVLAGMTAIFMAFAGQFAFFTYIRPVFMTMAGFDVDGLTLVLLSFGIASFVGTSLSSQ
                     FLKRSLKVALAGAPLVLAVSAVVLILWGSDKWVASAIAIIWGFAFALVPVGWSTWITR
                     SLADQAEKAGSIQVAVIQLANTCGAAVGGVALDHLGLTSPLVISGTLMLLTALLVAGK
                     VKAK"
     gene            complement(44010..44915)
                     /locus_tag="ECL_RS00230"
                     /old_locus_tag="ECL_00045"
                     /db_xref="GeneID:9122556"
     CDS             complement(44010..44915)
                     /locus_tag="ECL_RS00230"
                     /old_locus_tag="ECL_00045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_013094818.1"
                     /db_xref="GeneID:9122556"
                     /translation="MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEKSQISSPYLTMVRL
                     LFTGLILLTLSFVHGDKIFSVIKHRKDALSLLFFSLAGALTVQLTFLVTIEKSNAATA
                     TVLQFLSPTIIVAWFALARKKRPGLFVLSAILTSLVGTFLLVTHGDPTSLSISPAALF
                     FGIASAFAAAFYTTYPSTLIARYGTLPIVGWSMLIAGLTLTPFYAGRGTAFVIDGSLL
                     LAFFYLVVIGTALTFSLYLKGAQMIGGPKASILSCAEPLSSALLSVILLGVAFTLPDW
                     LGTLLIVSSVVLISMDSRKRVKAPE"
     gene            complement(45060..46439)
                     /locus_tag="ECL_RS00235"
                     /old_locus_tag="ECL_00046"
                     /db_xref="GeneID:9122557"
     CDS             complement(45060..46439)
                     /locus_tag="ECL_RS00235"
                     /old_locus_tag="ECL_00046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007897766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate porin"
                     /protein_id="WP_013094819.1"
                     /db_xref="GeneID:9122557"
                     /translation="MTTLKKLPLTMAVIAALCPISVLAQEFTQEQIDAIVAKAVDKAL
                     AERQAKMDAAVAKKADVVTEPQSAAQSPDMAIPFGIKFTGYARYGAHFQAADQKYVAV
                     DGSYNGASAIGRLGNEGNGGEFQLSKAFKGDNGAIWDINVMIDHWGDEVNLKKAYAGV
                     TNIMASNPNAYFWAGRDFHQRPQQGINDYFWMNHDGQGAGVKNFDIGGVQFDVAAVAA
                     VESCSPEVMEDEANPSRITCTGGSGTGDKGNYAATSKIHGMKVGPLDLELYANYGFDS
                     KAVESDERLNAWQGGVVLSHTNDSGVNKVIARYSDNADNSVFNKTEDLTTVYASFEGL
                     YKFTQATQVEYILAFHDYDNSRDKTDNRKNYNAIVRPMHWWNDVHSTWLEAGWQHVDY
                     DNGGDNKGWKLTLSQNMSIAMGPEFRPMLRFYVTGGKVDNERTARVNNTKDETLDDFN
                     VGAMWEAWF"
     gene            complement(46574..46876)
                     /locus_tag="ECL_RS00240"
                     /old_locus_tag="ECL_00047"
                     /db_xref="GeneID:9122558"
     CDS             complement(46574..46876)
                     /locus_tag="ECL_RS00240"
                     /old_locus_tag="ECL_00047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007701793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose transporter subunit IIA"
                     /protein_id="WP_008500136.1"
                     /db_xref="GeneID:9122558"
                     /translation="MIALEEAVMEIIVNAGQSRSLCFEALHAARQGNIDEAKSLLREA
                     DGYARQAHKMQTKLIEQDAGEARQPMTLIMVHAQDHLMNSLLARELSEEIIHLYQR"
     gene            complement(46888..48261)
                     /locus_tag="ECL_RS00245"
                     /old_locus_tag="ECL_00048"
                     /db_xref="GeneID:9122559"
     CDS             complement(46888..48261)
                     /locus_tag="ECL_RS00245"
                     /old_locus_tag="ECL_00048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 1 protein"
                     /protein_id="WP_013094820.1"
                     /db_xref="GeneID:9122559"
                     /translation="MKYTFPDNFWWGSASSALQTEGTREGETTWDYWFAREPNRFHNG
                     VGPQHTSTFYQHWKTDIQLLKQLNHNSFRTSISWARLIPDGIGEVNPKAVEFYNQVID
                     ELIEQGITPFITLFHFDMPMAMQEIGGWENREVVDAYARYAQICFDLFGDRVLHWFTF
                     NEPIVPVEGGYLYDFHYPNVVDFRRAATVAYHTVLAHAKAVQAYRAGHYAGEIGIVLN
                     LTPSYPRSQNPADVKAAHIADLMFNRSFLDPVLRGEYPADLVALLKSYDQLPACKPED
                     SFLIAEGKIDLLGINYYQPRRVKCRDSAVNPQAPFMPEWFFDNYEMPGRKMNPYRGWE
                     IYEPGIYDILVNLRDNYGNPRCFISENGMGVENEQRFIENGQINDQYRIDFISGHLAW
                     LHKGISEGCHCLGYHMWTFIDNWSWCNAYKNRYGFIQLDLTTQQRTIKKSGEWFAATS
                     LHNSFEK"
     gene            complement(48279..49604)
                     /locus_tag="ECL_RS00250"
                     /old_locus_tag="ECL_00049"
                     /db_xref="GeneID:9122560"
     CDS             complement(48279..49604)
                     /locus_tag="ECL_RS00250"
                     /old_locus_tag="ECL_00049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014068298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS cellobiose transporter subunit IIC"
                     /protein_id="WP_013094821.1"
                     /db_xref="GeneID:9122560"
                     /translation="MSSLYQSMVAVIEQSITPLAAKLGQQKYVIAIRDGFTAALPFMI
                     IGSFMLVFIFPPFSADTTNSFARGWLDFSQTYREQLMLPFNLSMGVMTFFISVGIGAS
                     LGRQFNLDPVMSGLLAFMAFLLVAAPYADGKISTQYLSGQGIFTALITAIYATRVYAW
                     LKQNNVTIRLPKEVPTGVARSFEILIPVMVVIGTLHPLNLFIEAQTGMIIPQAIMHLL
                     EPLVSASDSLPAILLSVLLCQIFWFAGIHGSLIVTGIMNPFWMANLSANQAALAAGAA
                     LPHVYLQGFWDHYLLIGGVGSTLPLAFLLLRSRVTHLRTIGKMGVVPSFFNINEPILF
                     GAPIIMNPMLFIPFVCVPLVNACLAYAATKLGWLAQVVSLTPWTTPAPIGASWAANWA
                     LSPVVMCLICMVMSALMYLPFLRAYERTLMKNEEQKAQATVGTAETASN"
     gene            complement(49616..49930)
                     /locus_tag="ECL_RS00255"
                     /old_locus_tag="ECL_00050"
                     /db_xref="GeneID:9122561"
     CDS             complement(49616..49930)
                     /locus_tag="ECL_RS00255"
                     /old_locus_tag="ECL_00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003861034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="WP_013094822.1"
                     /db_xref="GeneID:9122561"
                     /translation="MFKIMLCCSAGMSTSLLVSKMVDVAKERGLAVKIDAYGVSEFDT
                     QFPQYQVVLLGPQVKYMLQTLSDKAATKGIPVQPIDMMDYGMQRGDKVLDYALSLIEA
                     AH"
     gene            50224..51174
                     /locus_tag="ECL_RS00260"
                     /old_locus_tag="ECL_00051"
                     /db_xref="GeneID:9122562"
     CDS             50224..51174
                     /locus_tag="ECL_RS00260"
                     /old_locus_tag="ECL_00051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014068300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_013094823.1"
                     /db_xref="GeneID:9122562"
                     /translation="MSTINDVSRLAGVSKATVSRVLSGSRGVKEASRQAVLKAVDELN
                     YRPNVIAQSLLSQSTGCIGVICAQENINQTTGYLYALEKQLSQHQKHLLLRFAHSKAD
                     VLHALEELSCGLCDDILVIGARFPLDIDMDNVILVDCMGSENPNSIQFDHAFAAETAC
                     NYLTSQGRRQIALIHPHGSGFADQVLLGYKHALEKNFLPFNRNLVFMDATSSSVALQE
                     LLNNASTLNFNALLVADEQEAQRVIPQLQAFNKSVPEDIMVFSLAGSLHLPGIPVIPA
                     IEYSMDAMAARIVSWLTEKTQMLGSYVLRGDLIIPDVRKR"
     gene            complement(51236..51532)
                     /locus_tag="ECL_RS00265"
                     /old_locus_tag="ECL_00052"
                     /db_xref="GeneID:9122563"
     CDS             complement(51236..51532)
                     /locus_tag="ECL_RS00265"
                     /old_locus_tag="ECL_00052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015570101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094824.1"
                     /db_xref="GeneID:9122563"
                     /translation="MKSAHLVCLLVCLLFAAFAHAQEKDDPAREAQIKQQVLKDVKKA
                     CTPQKKQSDKAWQAMILSSEANQLLIKNAITAVKRDNLEAYWDAVSQVDCMEDY"
     gene            complement(51652..53016)
                     /locus_tag="ECL_RS00270"
                     /old_locus_tag="ECL_00053"
                     /db_xref="GeneID:9122564"
     CDS             complement(51652..53016)
                     /locus_tag="ECL_RS00270"
                     /old_locus_tag="ECL_00053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family protein"
                     /protein_id="WP_013094825.1"
                     /db_xref="GeneID:9122564"
                     /translation="MFRLSVFVLALMSAGCVSLDPTYQRPAAPVPATLPGAHGEATAM
                     VSQWQQVMNDARLKGVVTMALNSNRDLQKAIADIDAARAQYGETRSSLFPTVDAELSH
                     TRSRTLASGVATSDEANGTVSSFELDLFGRNQSLSRAARETWLASEFTAQNTRLTMVS
                     ELTTAWVTLAADNSNLALAKSTMESAASSLRIVKRQQQVGVAAATDVSEAMAVYQQAR
                     ASVASYQTQVMQDKNALNLLAGDTVPDTLLPGTLESLSDNAITLIPAGVSSSALLRRP
                     DIKEAEHNLLSANANIGAARANFFPTISLTASAGVGSDSLSSLFSHGMKVWSFAPSIT
                     LPLFSGGNNLAQLRYAEAEKKGLIATYEKTIQSAFKDVADALARRETLSEQLDAQREY
                     VAAEQKTLDVATRSYQAGAGDYLTVLTAQRSLWSAQESLISLQQTDLENRITLWQSLG
                     GGIE"
     gene            complement(53016..56126)
                     /locus_tag="ECL_RS00275"
                     /old_locus_tag="ECL_00054"
                     /db_xref="GeneID:9122565"
     CDS             complement(53016..56126)
                     /locus_tag="ECL_RS00275"
                     /old_locus_tag="ECL_00054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease
                     subunit"
                     /protein_id="WP_013094826.1"
                     /db_xref="GeneID:9122565"
                     /translation="MFSRFFVRRPVFAWVIAILIMLAGILAIRTLPVAQYPDVAPPSI
                     KISATYTGASAQTLENSVTQVIEQQLTGLDNLLYFTSTSSSDGSVSITVTFEQGTDPD
                     TAQVQVQNKVQQAESRLPTEVQQSGITVEKSQSNFLLIMGVYDKTDTASSSDIADWLV
                     SNMQDPLARVDGVGSLQVFGAEYAMRIWLDPAKLASYSLMPSDVQSAIEAQNVQVSAG
                     KIGALPSSNAQQLTATVRAQSRLQTVDQFKNIIVKSQSNGAVVHISDVARVEMGSEDY
                     TSTAKLNGHPAAGMAVMLSPGANALNTATAVKEKIAEFKKSMPEGYDVAYPKDSTEFI
                     KISVEDVIQTLFEAIILVVVVMYLFLQNIRATLIPALAVPVVLLGTFGVLALFGYSIN
                     TLTLFAMVLAIGLLVDDAIVVVENVERIMRDEGLPAREATEKSMGEISGALVAIALVL
                     SAVFLPMAFFGGSTGVIYRQFSVTIISAMLLSVVVALTLTPALCGSILSHTAPHKKGF
                     FGAFNRFYSKTEHGYQNKVLRALRRSGGMLVIYVLLCGAMGFAMLKLPGSFLPTEDQG
                     EIMVQYTLPAGATSTRTAEVSRQVREWFLTKEKANTNVIFTIEGFSFSGSGQNAGMAF
                     VSLKNWSERKGDENTAQAIALRATQELSTIRDATIFAMTPPAVDGLGQSNGFTFELMA
                     SGGTDRDTLLKLRNQLIGEANQDASLHAVRANDLPQMPQLQVDIDNNKAVSLGLSLSD
                     VTDTLSSAWGGTYVNDFIDRGRVKKVYIQGDSDYRAVPSDLNKWYVRGSDSTMTPFSA
                     FATTRWEYGPESLVRYNGSAAYEIQGENASGASSGTAMSKMEQLANNLPSGSTWAWSG
                     LSLQEKLASGQAMSLYALSILVVFLCLAALYESWSVPISVILVIPLGVLGAAIAASLR
                     GLNNDVYFQVALLTTIGLSSKNAILIVEFAEAKVAEGYSLTRAALRAAQTRLRPIIMT
                     SLAFIAGVTPLAIATGAGANSRVAIGTGIIGGTLAATLLAIFFVPLFFVLVKRLFSGK
                     HSNRRS"
     gene            complement(56126..57247)
                     /locus_tag="ECL_RS00280"
                     /old_locus_tag="ECL_00055"
                     /db_xref="GeneID:9122566"
     CDS             complement(56126..57247)
                     /locus_tag="ECL_RS00280"
                     /old_locus_tag="ECL_00055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_044159051.1"
                     /db_xref="GeneID:9122566"
                     /translation="MKKITTSIAALLLLTGCDNAQTSAPQRPLPEVGIVTLMSQPVSV
                     VSELTGRTTAAMSAEVRPQVGGIIQKRLFTEGDTVKAGQALYQIDPSSYRAAFDEAAA
                     ALKQAQALVQADCQKARRYAQLVKDDGVSRQDAEDAKSTCAQDKASVESKKAAQESAR
                     INLNWTTVTAPIAGRIGISSVTPGALVTAQQDTALATIRGLDTMYVDLTRSSADLLRL
                     RKQTLASNSDTLSVTLQLEDGSTYSEKGRLALTEVAVDESTGSVTLRAVFPNPQHQLL
                     PGMFVRARVDEGIMNDAILAPQQGITRDAKGKATALVVNASNKVEQRQLETGDTYGDK
                     WLVLSGLKAGDRLIVEGTDKVTAGQQVKAEEMKSSGGNA"
     gene            complement(57396..57965)
                     /locus_tag="ECL_RS00285"
                     /old_locus_tag="ECL_00056"
                     /db_xref="GeneID:9122567"
     CDS             complement(57396..57965)
                     /locus_tag="ECL_RS00285"
                     /old_locus_tag="ECL_00056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000104919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR/AcrR family transcriptional regulator"
                     /protein_id="WP_013094828.1"
                     /db_xref="GeneID:9122567"
                     /translation="MSTKLEERQKQRQDEIITAARRCFRASGFHAASMSQIASEAKLS
                     VGQIYRYFSNKDAIIEEMIRRIIDSRIEGMQDKTVVEGMPQALAWRQTINEDDDALML
                     EMSAEATRNPQVAAMLTAAEARMFSNACAHLKKQFPHLSDEHIRCCVEITAVMIEGTI
                     YRRLTPLNVPSEQLEPIYQNILNMLFTAK"
     gene            58152..58571
                     /locus_tag="ECL_RS00290"
                     /old_locus_tag="ECL_00057"
                     /db_xref="GeneID:9122568"
     CDS             58152..58571
                     /locus_tag="ECL_RS00290"
                     /old_locus_tag="ECL_00057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003861020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013094829.1"
                     /db_xref="GeneID:9122568"
                     /translation="MHLSITEKVTPAEKEELFVGLRAYNAQFLDMTNFSGDIGVYMRD
                     EKGVMLGGLIGVRKGEWLNIDYLWVSDTVRGTGVGSQLIKTAEEEARRKGCTHALVDT
                     ASFQARPFYEKQGYQLQMSLQDYPYPGMQRHYLTKAL"
     gene            58777..59577
                     /gene="nlpA"
                     /locus_tag="ECL_RS00295"
                     /old_locus_tag="ECL_00058"
                     /db_xref="GeneID:9122569"
     CDS             58777..59577
                     /gene="nlpA"
                     /locus_tag="ECL_RS00295"
                     /old_locus_tag="ECL_00058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein NlpA"
                     /protein_id="WP_013094830.1"
                     /db_xref="GeneID:9122569"
                     /translation="MKLRLGALVLAGLLLAGCDQSGSDAKHIKVGVINGAEQDVAEVA
                     KKVAKEKHGLDVELVGFSGSLLPNDATNQGELDANVFQHRPFLAEDNKAHNYKLVAVA
                     NTFVFPMAGYSRKIKSVSDLKDGATIAIPNDPTNLGRALLLLQKEKLITLKPDVGLLP
                     TALDITANPKKLNIMELEGAQLPRVLDDPKVDVAIISTTYIQQTGLSPVHDSVFIEDK
                     NSPYVNIVVTREDNKDAENVKEFIQSYQSPEVAKAAETIFNGGAVPGW"
     gene            complement(59590..60270)
                     /locus_tag="ECL_RS00300"
                     /old_locus_tag="ECL_00059"
                     /db_xref="GeneID:9122570"
     CDS             complement(59590..60270)
                     /locus_tag="ECL_RS00300"
                     /old_locus_tag="ECL_00059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017693995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_013094831.1"
                     /db_xref="GeneID:9122570"
                     /translation="MYTVLPSPLLHAITGLRFQPLVDLHSGQAVAHEVLVEIHNVNLD
                     ALFASLPTRSALQIFFWQANTLLQMPDKGQYWLNLPADQLLDAKAIDLLLALRHQQRL
                     TIEIQDPLTVTRMSAAEQRGIHHALLQLKGAGWKIWLDDLTQELADDYARLALPVDGI
                     KLDRSELSSPARFDTLVHFVREKIARAVVVEGIETAQDLQRACASGARFGQGFLWPES
                     RIDASVTV"
     gene            complement(60340..60957)
                     /locus_tag="ECL_RS00305"
                     /old_locus_tag="ECL_00060"
                     /db_xref="GeneID:9122571"
     CDS             complement(60340..60957)
                     /locus_tag="ECL_RS00305"
                     /old_locus_tag="ECL_00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006812480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_028027982.1"
                     /db_xref="GeneID:9122571"
                     /translation="MTMKETIHVAVIDSCEFTMIGLQYLGNREPDAHRDVIFHGFSNI
                     EDFLLSERTWDIVIYDPLNIGSFMITPNEDILRIKEKQPAARIYIYSLSVGFLKFKHV
                     DGVINKRVSLGDIKAMWQILMSQTPKALNHYNVSITTRQRPARLSNEEASVLRGYSCN
                     LKTKQIARQLGCNVRLVYFYKNNAMNKLKAVRGPSFYQSIRWILN"
     gene            61429..62064
                     /locus_tag="ECL_RS00310"
                     /old_locus_tag="ECL_00062"
                     /db_xref="GeneID:9122573"
     CDS             61429..62064
                     /locus_tag="ECL_RS00310"
                     /old_locus_tag="ECL_00062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_028027981.1"
                     /db_xref="GeneID:9122573"
                     /translation="MVFYRVNILQEMISDALRKLLPEYSLQISIVESTEQLFDAISDG
                     QVDIVMAEFSYLFNHKSWSVQTSNRLNMLCHTHHVKRVLFVPELQYGLLKRVLEMKYE
                     LTLSLQDEPGELKRELQALLRAEEARPRVSSYLKGMMRAGARSRSVLSAREWEVLHLL
                     VEGYTVTEIAQLRSRSASTIATQKHNAMKKLNLTNHSELIKYLQMAGRIGS"
     gene            complement(62106..63170)
                     /locus_tag="ECL_RS00315"
                     /old_locus_tag="ECL_00063"
                     /db_xref="GeneID:9122574"
     CDS             complement(62106..63170)
                     /locus_tag="ECL_RS00315"
                     /old_locus_tag="ECL_00063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_013094835.1"
                     /db_xref="GeneID:9122574"
                     /translation="MIRLLTFLFLACVSGASYATCSGGSISYGPPISVDLSDKLTPAT
                     PTWTGSFSTQYSGSFNCSTGNSEFSYTPILSTDSKYATILGFSNDKYRVRAEITSTHP
                     NKTLSASGNHTASELNTPFTVRFTLVDQSGTTLSGDTATMSDVLFVSDMSGMSFWEII
                     TWPINQLVKIVQWLFNGFKWPYDNRDMFGQPMTIKYAPKLTTCSFDNAGLTVHLPTLG
                     IPQLSASAQPGLTPFTLNMSCQNLGTNGTSDRAIEMFLSSTQLLSTDSSVLVDTSSGA
                     AQGVGLRLIQRNNPQQPVIFSTSTTSRGNATLLFNVAAGGALSKTFTLPMAASYYVWA
                     PAKVSQGKLNTTATLNIIYP"
     gene            complement(63183..65678)
                     /locus_tag="ECL_RS00320"
                     /old_locus_tag="ECL_00064"
                     /db_xref="GeneID:9122575"
     CDS             complement(63183..65678)
                     /locus_tag="ECL_RS00320"
                     /old_locus_tag="ECL_00064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000782716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis outer membrane usher
                     protein"
                     /protein_id="WP_013094836.1"
                     /db_xref="GeneID:9122575"
                     /translation="MKMKQNRLCMLAVCSLLLSHKSGAVTFDTSLLAGASGESDLSRF
                     NENNAMPAGPQEMDIYVNGDWKGRYTVTYGEQQDDVRLAWKDALMLGINTKAIPAPAI
                     TDGQVQLHDLVQGGEVKTDTSTLSLALTVPQAAVLRTEEGYVAPQFWDEGIPALMLSW
                     NTTWYNTRTKGSAKETNDDFYAGLDSGANLLGWQFRDSSTWRKSASGDSSWQNNTRYL
                     RRPLAALKSNLTLGDFYIPGDLFDSLRVRGVSLASDMKMRPNSQQGFSPVVHGVARTN
                     ALVKVMQNGNVIYQENVPPGQFTLDSIQPTGSAGDLLVVVREADGSQQSFTVPFSAVP
                     GMLKEGVSEYSVVAGKVHQNTLEADPAFLQATLRYGFNNLMTGYTGTIVSDNYQAGLI
                     GTGWNLPFGAVSVDVTHAKTTLQDRTDSGQSFRVSYSKFIDTTATNFTLAAYRYSTKG
                     YYSFSDALYSREGYQRLKAQYDEYEDRFGVAPEMTMSTWDALRAAQPKNTFTLNLNQR
                     LPDNWGTVFVSGTQRDYWNSRQTSREYQAGYSNAIGRASYTVSASRVRNSEREEETRF
                     YLSLSLPFSLFDNNAWVTSSLTASDSHYEQSNISMSGNALASNRLSYTLSGSNARGGN
                     NTASVNTAYRANFATLGGSYSESSDYRQMGLNGRGSLVAVPWHLLASNETGSTMTIVD
                     APQAEGLMVNGDESIVTNRDGVALVPYATPYRKNAITLSETANSRGAEVLGNIANVAP
                     YDGAVNYIRFDTDQRQSWMLRATRPDGAPLPFGTEVLNERGESVGYVGQASVLYIRAE
                     QPPRELSVHLRGGNCTIAAPAWGLESPSSVCHY"
     gene            complement(65694..66386)
                     /locus_tag="ECL_RS00325"
                     /old_locus_tag="ECL_00065"
                     /db_xref="GeneID:9122576"
     CDS             complement(65694..66386)
                     /locus_tag="ECL_RS00325"
                     /old_locus_tag="ECL_00065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001223973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_013094837.1"
                     /db_xref="GeneID:9122576"
                     /translation="MRKIIMLASLLLSAGNAWANIVINGTRVLYPENNKEVIVQLINT
                     GDAPALVQSWIDDGDINSTPETANVPFLLSPPVVKVSEHNGQQLRIKKLPANLPGDRE
                     SVFFLNVLDIPPKPENIQNQNTVQLAIKSRIKMFYRPASLTGTLDNATGKLTLIASGK
                     QFRIVNDSPFHITVANISEGKTKLLQESPMVAPFGQLTVATKNAVKRGQTYQLMYVDD
                     LGAYKTRTLTSQ"
     gene            complement(66439..67023)
                     /locus_tag="ECL_RS00330"
                     /old_locus_tag="ECL_00066"
                     /db_xref="GeneID:9122577"
     CDS             complement(66439..67023)
                     /locus_tag="ECL_RS00330"
                     /old_locus_tag="ECL_00066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015377370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_013094838.1"
                     /db_xref="GeneID:9122577"
                     /translation="MFKTIMTVSVLGAAIASTHAIAADNSAGGVINFTGAITDTTCTI
                     NGGKSADMTVALSPISVKDAGTTVGLITKNKKSISLTFSGCTPAAGTTGTPLKVYFSS
                     ADNISTDGKYLLNNSVNENDASVARNVGFALVEPGKSTPVTLNQAYTTSIMGTSAAPD
                     SETLTLDVYYYKTNAAAATVGALSSNVTYTISYL"
     gene            67364..68332
                     /locus_tag="ECL_RS00335"
                     /old_locus_tag="ECL_00067"
                     /db_xref="GeneID:9122578"
     CDS             67364..68332
                     /locus_tag="ECL_RS00335"
                     /old_locus_tag="ECL_00067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5-like element IS903B family transposase"
                     /protein_id="WP_013087110.1"
                     /db_xref="GeneID:9122578"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     gene            68464..69264
                     /locus_tag="ECL_RS00340"
                     /old_locus_tag="ECL_00068"
                     /db_xref="GeneID:9122579"
     CDS             68464..69264
                     /locus_tag="ECL_RS00340"
                     /old_locus_tag="ECL_00068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix domain-containing
                     protein"
                     /protein_id="WP_013094839.1"
                     /db_xref="GeneID:9122579"
                     /translation="MKYLIDLAMLYEVDSGVIMINGEEESSIKLSNQAARLLYELIIN
                     NGKTLDRDDLIKKVWEDRGFSGSSVSLNVAISEIRKAFRSLGRDPLLIKTIRGKGFSL
                     AAHIEHHTVRPPVAAPEKMVAETVDIVTQQRDPPEGLRRRDSGFTTLFVMALVAIMGI
                     AALLFYQNMRVADRPKESDIYRLGKIDRCTVYLIDKNMYQPQQVYLNRAKDAIARQHI
                     DCEHQAADAYYSKFKKSQLENDFLAVCYLQDGADSYKNCISYRSLTGS"
     gene            69284..69754
                     /locus_tag="ECL_RS00345"
                     /old_locus_tag="ECL_00069"
                     /db_xref="GeneID:9122580"
     CDS             69284..69754
                     /locus_tag="ECL_RS00345"
                     /old_locus_tag="ECL_00069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_028027980.1"
                     /db_xref="GeneID:9122580"
                     /translation="MGILLGVVLLLSVIVIAVLYPKRTQEVGFGCQSDTVSRKNYSTG
                     ESTALSLTTLFLFNGSDIVTVIHKGVFTRGDKRYLIDRNYVLNVEKVAGSDIYYIKGK
                     KLQKSDDDIAPDGIVNELLMDSIDFFYVTRVKGHAWLIKGLVLPIMMCVAVPTS"
     gene            69984..70607
                     /locus_tag="ECL_RS00350"
                     /old_locus_tag="ECL_00070"
                     /db_xref="GeneID:9122581"
     CDS             69984..70607
                     /locus_tag="ECL_RS00350"
                     /old_locus_tag="ECL_00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006812472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094841.1"
                     /db_xref="GeneID:9122581"
                     /translation="MNKLNAIVLGSLLSLSALSVAHAAETTASATWQASATKDSDSDL
                     VVTPTRALNFVYSANTKAFNTDTGLFDVAIRGDHSSATSFKLEAIVDDSDNTLFSVGG
                     EATKLKVGARFGGTDLGSIGGTVGTKSTAWTTLVDSSNNTGVSSGLWNLTTSAGATAN
                     TEVTGQDKFVFYVDSAQDSTGAAKEFKDLTNSLWEGTVSVAFRATWG"
     gene            70653..71330
                     /locus_tag="ECL_RS00355"
                     /old_locus_tag="ECL_00071"
                     /db_xref="GeneID:9122582"
     CDS             70653..71330
                     /locus_tag="ECL_RS00355"
                     /old_locus_tag="ECL_00071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006812471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_013094842.1"
                     /db_xref="GeneID:9122582"
                     /translation="MFSLKPIFFSLLFISSSALAINVGKVTTIIPADADSTAKELKNE
                     ADSVRIISISAQRISSPMDEGVVINPEQTDELLLTPTRMVMPAGTSNIVKFYYHGKAD
                     DRERYYRITFIDEGVSEDLDNGTKKNGKGMTRAVVSTILVVQPRKKNVDFVYVAGKIT
                     NKGNTAFRVNASGTCLKPNPESPTTPCVKNFYLMPGTSRAIDDINVTDSHFHLGIWDL
                     KQFIPVK"
     gene            71337..73931
                     /locus_tag="ECL_RS00360"
                     /old_locus_tag="ECL_00072"
                     /db_xref="GeneID:9122583"
     CDS             71337..73931
                     /locus_tag="ECL_RS00360"
                     /old_locus_tag="ECL_00072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CS1-pili formation C-terminal domain-containing
                     protein"
                     /protein_id="WP_013094843.1"
                     /db_xref="GeneID:9122583"
                     /translation="MVKNKLVLPVMMACTSGLLPAYAHAASSSVVIANYRFPDSLYAL
                     LEQGIKIPVYLVNTRPGAAQQAGSTGDVSEYVRIGDVTIYAEDRQLGLRDVQVQESDN
                     GIRLSKEMRTLLQSINGKQFDDHMRIPVSAGSAFELDQKKMRLLLNLSQRDYGVNIRP
                     REVDIDAPESDDLSGTLSYNLGAYHTESGYGDSWSSGYLNAKSWVSMGVDHLLVDGSG
                     YVNENSSDTQMNAVMWERDYQGMRYAAGMLNGWAMQSLASVSGISGGEVYGVSVGNQA
                     NSRKRDNTLSLTPIVVYFPTAGEARIRRDGQLIGIQRFDVGNHEIDTSALPYGIYSVE
                     VEVVSGSRTVSRSMYTVNKPFTNNVSESLRWQTWGGIYSRDKSVVNYKKYAKRKNEQD
                     NSYYYDYDTKHKDTMSLVGASFSKRSGMVDWNASGYMMREHVVSELWASLNLTGYFSV
                     NTQTMAASDGTYRANYGANVSLPWNIGSVWYSHEQLSSGKFLDIYENKGNTWGASFSL
                     PSFGLPSAGNLSLMRQEDDVYRYKRYQVDYSQGLYAGRYGTARLRVGMSRNKYEGYYE
                     EKDRYVMLDFSIPLGNTVSVGVSHNRDTGTALNVSASRQFEGDYLKSVTANVSRAFSS
                     NQDRTVSGGGSVSFDTPWNSNILSVQSGTSKGWNSTLTSDGSVGWSKEAVAAGKGTHS
                     AGVIVSTGLKSDESLTLKLNGRTERIKGDKTWLSLPAYQAYDLEVMNSETGTESYDIG
                     ANARRHITVYPGNTVVMKPQVKKIVTLFGRLVDANGNPVSATQIKNHVGLTRTENDGR
                     FVIDVDKNNPVLSIATPDDSVCEVRLDIASNRGALWLGDISCDKGDFVWQEAKGTRER
                     DDEKDIRS"
     gene            73909..75507
                     /locus_tag="ECL_RS00365"
                     /old_locus_tag="ECL_00073"
                     /db_xref="GeneID:9122584"
     CDS             73909..75507
                     /locus_tag="ECL_RS00365"
                     /old_locus_tag="ECL_00073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000717908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044159053.1"
                     /db_xref="GeneID:9122584"
                     /translation="MKKIFALNLLLISAAAQAQQMPYFAINNPDNNGTGNTAALFSLN
                     STSTAFLHGSREWPTLSAKTNNGIATYIPDNSFNGPAGSPLTINFSVTGSSASPFFKG
                     TACSSSCGTTGYTATTSYTDTSMVVKPPVIEPGTAYGRWVLGDPFFDYLLNAAPGNEV
                     TITSTPQISSIGKVITTNTLHKVGTLTMTNSRALDLGIDPISGEVTIVDGSTGATCTK
                     YTRNTVSGVLCELLEYTFVGEDITGYNPGLALTSSRVNGVLQSHMNGGTGLAAEITFD
                     ESNWYSISGGILSDTRVLANTFLAAPQKNGGKAYLKIFLPKALILSVAQAGDGNNIGN
                     IVSLCLTPGNSSLAADFCFQPGGGLVIDPIQPGLAIVPDNPDYTLDPNGLGGSGKGTI
                     GEGPIEIPYTITYSGAQKDAAIAVTVKVTGPTQSLNGVDYCAFSGNGFTVPVPGNVLL
                     GKSQTLKAHNCKGEALSIPAPATHAEEWDKISSGVTDMWLWKTPLVLQFVMNNPVSKT
                     TYDGNTWFGEVTAQGRIDVSASWN"
     gene            75514..76167
                     /locus_tag="ECL_RS00370"
                     /old_locus_tag="ECL_00074"
                     /db_xref="GeneID:9122585"
     CDS             75514..76167
                     /locus_tag="ECL_RS00370"
                     /old_locus_tag="ECL_00074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006812468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094845.1"
                     /db_xref="GeneID:9122585"
                     /translation="MTGKFLAIFAINCFISASANALIIENLNIDFLPEKEVVFQPIKN
                     DTSVRQNYTVSLIQVDVPKEHGKETEIKDGEVMFSPKQLTLESGERAGFKFYYTGPHD
                     SKERYYRVKFTETPLQARVVMSKGQRIQSDVVVSLEAILIVRPWTRHFDYTFSNGVVS
                     NTGNTWFKYVSSQGCSSQYNDSKYLPPGQRLEIDNYAQPARRMIIYGNKIIPLTRCP"
     gene            76240..76434
                     /locus_tag="ECL_RS00375"
                     /old_locus_tag="ECL_00075"
                     /db_xref="GeneID:9122586"
     CDS             76240..76434
                     /locus_tag="ECL_RS00375"
                     /old_locus_tag="ECL_00075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006177667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094846.1"
                     /db_xref="GeneID:9122586"
                     /translation="MKAISFVEAKDIIGGALNPFAGLVKGAQLGYDTGASIMGMVGGV
                     VGGILGGAMGFLGALVGSYN"
     gene            76457..76642
                     /locus_tag="ECL_RS00380"
                     /old_locus_tag="ECL_00076"
                     /db_xref="GeneID:9122587"
     CDS             76457..76642
                     /locus_tag="ECL_RS00380"
                     /old_locus_tag="ECL_00076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094847.1"
                     /db_xref="GeneID:9122587"
                     /translation="MQVIDFKKAQAIIGGWDPFAAALQGASAGYNAGSQMLGALGGTI
                     GGVFGLVGGFIGGFFSA"
     gene            76707..78803
                     /locus_tag="ECL_RS00385"
                     /old_locus_tag="ECL_00077"
                     /db_xref="GeneID:9122588"
     CDS             76707..78803
                     /locus_tag="ECL_RS00385"
                     /old_locus_tag="ECL_00077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase domain-containing ABC transporter"
                     /protein_id="WP_013094848.1"
                     /db_xref="GeneID:9122588"
                     /translation="MFSLFQYKKKGKTPVIRQHEYTECGLACLAMVLGHYEHHVSVSQ
                     LRRELTVSADAGTSMAELMTLASDKNMTGRVLKGEITEIESAELPLIAFWRGNHFVVI
                     VKVDGRSVTVHDPASGVRRYSLKEAQKLFSGYVLELKPTPRFDKKSPDETLTLGRLAN
                     KSPSLFQRQVLLFVLSIFTLITMLASPTYVQLIMEEAISRNDNDLVILLTAIFAIVFI
                     FEVIGKFLKQLLEILMRNIAYDDLSQSVRRYMLRTQTGWFRSRPPGIVLAIEKSLHAC
                     AEFISNGYVQILFSSLIAFTSLLFMLLYNVKIAVLTMLLMGVFFLIRFSLIGPYQRAV
                     DDSIERTAKYESLLVETQKGIITLKANNMEQARDAVMDKSQREHIAGLMRKERLLARF
                     DVASLLVINAEQLLVVCFGAWLILEGQMSIGMLYAYISYKRYFSDAMVQVAQKLLDKN
                     ALKGPLDRVGDLLFAPSEASQFGRKIVTSPVSLAFEDVSFAYPGREATLQHINMTLKQ
                     GEEAVIVGQSGSGKTTLLRLISGMLLSTSGSLRINAIPITECDLSSLRQHIRIVHADD
                     ILFTGSILDNLSCFDSAPDKERVIAACRLAEIDHVVARLPHGYETELLPGNTFFSAGE
                     MQRLVLARALYSQPKLLLCDEVTANLDKTTAQKVLANLRGLGIGLVFVTHSPEVVGCH
                     GRLYTMENGTLRESEQ"
     gene            78800..79549
                     /locus_tag="ECL_RS00390"
                     /old_locus_tag="ECL_00078"
                     /db_xref="GeneID:9122589"
     CDS             78800..79549
                     /locus_tag="ECL_RS00390"
                     /old_locus_tag="ECL_00078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094849.1"
                     /db_xref="GeneID:9122589"
                     /translation="MMFLPRLYARLCARQAGRTLLASRITQNYSQFMRCPEADVPPDF
                     LRQNALEMSGFHFVEQIFPPALWRRNVRFDLHARVAAFTREQEFYSQPRTLLLGMRWA
                     GFGLIADALLATAPDDVRFQFVTRLPALHKLMAAHEERRAGAFFSPHRLVTVLLVDER
                     LPDAPLFITQAGDQKAWLTDVSTRFLTRYGYVIRTLLPGCSLHSAEFALESQTYAPAE
                     YRQAATATLNALRKTPTLWSAWDDLSVIYHG"
     gene            79556..80806
                     /locus_tag="ECL_RS00395"
                     /old_locus_tag="ECL_00079"
                     /db_xref="GeneID:9122590"
     CDS             79556..80806
                     /locus_tag="ECL_RS00395"
                     /old_locus_tag="ECL_00079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006177670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family efflux transporter periplasmic
                     adaptor subunit"
                     /protein_id="WP_013094850.1"
                     /db_xref="GeneID:9122590"
                     /translation="MKLRNRNRQRRALIPHHFSKSYEINAPRLKGVLTLFISFFLCLL
                     VFSIVFNFSETTLARGVLIPAQGDVEVRARESGTIVDFAVRPGQYVKENDPLFTVSQD
                     YGGKQGSVVQFDRQQMEAEKKRSEQRVQTIEDSIATYRKNLAQQLDIADRQIVVSRDK
                     VKKLRALLKNSTDTYEAWKAISGKGYVSKVDLDKSHNDVLNAQLNLTLEESSILDLEA
                     RKTSLTDSTQSQIDSLSQELLYVKNRISEIDRNLSSRGSSTMAMLAPADGYVVAINFP
                     PGRAITQNSEVVVVIRKNTAASMEGYLYVPATGVGRVAKGDKVKLRFDSWPVDKYGSV
                     EATLSDFYEVNIDAHSALIPLQEGQNYYLAKVRVPSWFTDPDNKKRLLMGGMTVNADI
                     VIDRKPLINLLIAPLERVRKRFID"
     gene            80896..81675
                     /locus_tag="ECL_RS00400"
                     /old_locus_tag="ECL_00080"
                     /db_xref="GeneID:9122591"
     CDS             80896..81675
                     /locus_tag="ECL_RS00400"
                     /old_locus_tag="ECL_00080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006812464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_013094851.1"
                     /db_xref="GeneID:9122591"
                     /translation="MNITHIRNATQLITYAGKRFLIDPMLAAKDAYPGFPGTARAEIR
                     NPMVELPVDVSTLLDADAVIVTHTHDDHWDRAAVELIAKDKPIYVQNDRDAALLRSQG
                     FHNLTVMTDETTFGDIRIAKTHGGQHGTDRAYAVPELAERLGEACGVVLRHPDEKTLY
                     IAGDTVWRDAVAADLQKHQPDVVVLNAGYAHVIGFGPIIMGEQDLLNVHFLLPQAKIV
                     AVHMEAINHCLLSRRALREYVEANQIGDAVSIPQDGETVIF"
     gene            81701..82678
                     /locus_tag="ECL_RS00405"
                     /old_locus_tag="ECL_00081"
                     /db_xref="GeneID:9122592"
     CDS             81701..82678
                     /locus_tag="ECL_RS00405"
                     /old_locus_tag="ECL_00081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_013094852.1"
                     /db_xref="GeneID:9122592"
                     /translation="MPLINVAIVAVDGFSPFHYSVPCILFGDAVSGEKRFNVTICAEK
                     PGVLTSKEGFALNATQDFSAIAQADIVVVPYWQHVLDRPPQVLLDSLVQARDNGAEIV
                     GLCLGSFVLAYAGILDGKRAATHWEFEHHFQSLFPRVQLDINALYVDDDNIITSAGTA
                     AALDCCLYIIRQRFGSVVANQIARRMIVPPHREGGQAQFIAQPVPKDTRDARINCLID
                     YLQQHITEPHNLDSLAKVVSMSRRTLTRHFVNATGMTVADWLTAERLRRSQILLEAGN
                     MPVERVAELVGFNSAVTWRQQFKARFGVSPTEWRKTFRIQPSVARHDAT"
     gene            complement(82739..83470)
                     /locus_tag="ECL_RS00410"
                     /old_locus_tag="ECL_00082"
                     /db_xref="GeneID:9122593"
     CDS             complement(82739..83470)
                     /locus_tag="ECL_RS00410"
                     /old_locus_tag="ECL_00082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase family protein"
                     /protein_id="WP_013094853.1"
                     /db_xref="GeneID:9122593"
                     /translation="MKHILTASLFALSASVFAGSAPHWTYEGKSGPENWGELSDEFAT
                     CKTGKFQSPIDIRNAYNATLPPLEMNFHTAAEKLVNNGHTLQVTASDEDEFRLDDQIF
                     TLRQYHFHTPSENRINGKSFPLEAHFVHASKEGDVAVLAVMFEVGPENSALNPLLARL
                     PKEKDHEISIDKHLDLRPLFPADLHYYRFSGSLTTPPCTEGLRWLVMKNTVTLSEKQL
                     EMFKQALEHSNNRPLQPLNGRVIVQ"
     gene            complement(83586..84674)
                     /locus_tag="ECL_RS00415"
                     /old_locus_tag="ECL_00083"
                     /db_xref="GeneID:9122594"
     CDS             complement(83586..84674)
                     /locus_tag="ECL_RS00415"
                     /old_locus_tag="ECL_00083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_013094854.1"
                     /db_xref="GeneID:9122594"
                     /translation="MINTLHIQNYRSIRDMSLELEQLNIVFGPNGTGKSNIYKAIHLM
                     HSAAQGQFSQALANEGGILKVFWAGKTRSDQLRRMNLAVETETYEYELQVGFVEKLPY
                     PSQFQLDPVIKEESLWLSGQHRRPSAQLMKRRNQAVFLNNVHHEKVTHSGTLYENESV
                     FGQLGEPHLYPEVSQMRESLRNWRFYHEFSVASGSMMRAPQVGFRSPVLASDGANLAA
                     AFQTIVEIGDELLLMRILDQAFPGCVFYSDNTGGRFRMMMQREGLSRPLEPAEFSDGT
                     LRFLCLAVALLSPRPPAFIALNEPENSLHPQMLPALASLIAEASRYSQIWLTSHSPEL
                     ATLIEKHRSFSLYQLSMTEGETKMEKLG"
     gene            complement(84820..85779)
                     /locus_tag="ECL_RS00420"
                     /old_locus_tag="ECL_00084"
                     /db_xref="GeneID:9122595"
     CDS             complement(84820..85779)
                     /locus_tag="ECL_RS00420"
                     /old_locus_tag="ECL_00084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014881953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF523 and DUF1722 domain-containing protein"
                     /protein_id="WP_044159055.1"
                     /db_xref="GeneID:9122595"
                     /translation="MTTKPVLGISGCLTGSAVRFDGGHKRMDFVMDELAQWVNFRPVC
                     PEMAIGLPTPRPALRLIMTTGGDTQMRFSHPPHDDVTQKMADFTASYLPKIGDLAGFI
                     VCAKSPSCGMERVRVYDENGNRGRKEGVGLFTAALLETWPWLPVEEDGRLHDPVLREN
                     FVERVFALHELNTLRKNGLTRRALLDFHSRYKLQLLAHHQAGYREIGPFVASLHEWDD
                     LDAFFEAYREKLMTILKKPASRKNHTNVLMHIQGYFRNQLNSRQRGELRDVILHYREG
                     LLPILAPITLLKHYLAEYPDQYLMTQNYFDPYPDDLGLRLAVK"
     gene            complement(85882..86292)
                     /gene="uraH"
                     /locus_tag="ECL_RS00425"
                     /old_locus_tag="ECL_00086"
                     /db_xref="GeneID:9122597"
     CDS             complement(85882..86292)
                     /gene="uraH"
                     /locus_tag="ECL_RS00425"
                     /old_locus_tag="ECL_00086"
                     /EC_number="3.5.2.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000750474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyisourate hydrolase"
                     /protein_id="WP_013094857.1"
                     /db_xref="GeneID:9122597"
                     /translation="MKKTAPLLILASMAFAPAAFSAPAGTLSVHVLDQQTGMPPSDVT
                     VTLEKQQQDKWIPVASGKTDHDGRIKSLYPQEQDMQPGVYKVTFKTADYFHAKKLETF
                     FPEVPVLFTVTRTNEKLHIPLLLSQYGYSTYKGS"
     gene            complement(86392..87117)
                     /locus_tag="ECL_RS00430"
                     /old_locus_tag="ECL_00087"
                     /db_xref="GeneID:9122598"
     CDS             complement(86392..87117)
                     /locus_tag="ECL_RS00430"
                     /old_locus_tag="ECL_00087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_044159057.1"
                     /db_xref="GeneID:9122598"
                     /translation="MAYSIGEFARLSGITATTLRAWQRRYGLLKPQRTEGGHRQYSDE
                     DVQQALKILDWVKKGVPIGQVKPLLERPVPRRTNNWQTLQQNMLERLQGGKIESLRQM
                     IYDAGREYPRPELVTNVLRPLRSQVSANVAAAMTLRAILDGILIAYTSFCLEGDKKAP
                     GDNILLSGWYLNDPCEIWLEALSRTGQGHRIDVLPTPPATLAPEIFPDRKWLLVTSGK
                     MTAARKKQVAQWQQQLSLEVIIL"
     gene            87235..87759
                     /locus_tag="ECL_RS00435"
                     /old_locus_tag="ECL_00088"
                     /db_xref="GeneID:9122599"
     CDS             87235..87759
                     /locus_tag="ECL_RS00435"
                     /old_locus_tag="ECL_00088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipocalin family protein"
                     /protein_id="WP_013094859.1"
                     /db_xref="GeneID:9122599"
                     /translation="MKLWPVVTGVAIALTLVACKSPTPPKGVQPISGFDASRYLGKWY
                     EVARLENRFERGLEQVTATYGQRSDGGISVLNRGYDPVKNKWNESEGKAYFTGASTTA
                     ALKVSFFGPFYGGYNVIKLDDKYQYALVSGPNRDYLWILSRTPTVPDAVKQDYLNTAR
                     SLGFRVDQLVWVKH"
     gene            complement(87763..88773)
                     /locus_tag="ECL_RS00440"
                     /old_locus_tag="ECL_00089"
                     /db_xref="GeneID:9122600"
     CDS             complement(87763..88773)
                     /locus_tag="ECL_RS00440"
                     /old_locus_tag="ECL_00089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_052429251.1"
                     /db_xref="GeneID:9122600"
                     /translation="MRLFLFISGLLLCASAQAMEWKSDITLSPQPMTYSGPADSVMPG
                     SIIGSTWSASVSVQQVFWCGFVFHCTKSTLEPSSSAISSGMTVTVDGVNYTIFETGVP
                     GVGYIIGLKDFNGTKYIPLQTGVTQSYPAEGTSTSTQDLGWSAKVTFIKTGVALKSGV
                     YQIPTINAAVLTAYNNEVKTAKVIINPTTITVTASGCTVGTKSANVDLGTIDIRTLTT
                     VGSTSPSGAFNVSLTCDANVAVSAVMTDQTTPSNTSSVVTLTGDSTASGVGVQFFYNG
                     TGPLMMGPDSSAAGTTNQFFIQSTTAAQTLSLPFQAQYIRTGELVPGSANALASITFS
                     YQ"
     gene            complement(88773..89288)
                     /locus_tag="ECL_RS00445"
                     /old_locus_tag="ECL_00090"
                     /db_xref="GeneID:9122601"
     CDS             complement(88773..89288)
                     /locus_tag="ECL_RS00445"
                     /old_locus_tag="ECL_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_013094861.1"
                     /db_xref="GeneID:9122601"
                     /translation="MSVTLRTFSIALLIFTFPVRSYDVLVSVTGNLIGNTCVVAADSK
                     EQDVPLGTIGIKQFPRAGAVSNIKTPFTIRLEACGPTFAGVKIRFSGTPDNDNPQLVK
                     IADGGATGVAVQILDKDGGLIPLDTQTTARGTPGDDSVEMTFYARLAATGAPVNAGDV
                     SAFATWTTEYQ"
     gene            complement(89279..91801)
                     /locus_tag="ECL_RS00450"
                     /old_locus_tag="ECL_00091"
                     /db_xref="GeneID:9122602"
     CDS             complement(89279..91801)
                     /locus_tag="ECL_RS00450"
                     /old_locus_tag="ECL_00091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015570070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis outer membrane usher
                     protein"
                     /protein_id="WP_013094862.1"
                     /db_xref="GeneID:9122602"
                     /translation="MKRKILCATVISLVIRQAMAAESALQFNPAFLNGESANSADLAW
                     INAGSALPPGDHNLNVYINNNYAFTGNITFRTAENTGEALPCLTPEQIAALGIDSQQA
                     KGGALPLAQRCIFLTEAFADTRFDFDQQTLSLSFTVPQSAMRNLPRGYVSPESWEAGI
                     PAAWLNYVVNGSNNDYQGETRTRDQQLFASLNSGINLGAWRLRDFTTWTKDTNELTHV
                     QTWLQRDIPALNAQVYAGETYTSAQVFDAVGLRGIALKTDDNMLPASLSGYAPEVHGI
                     ARSNATVTVRQNGNIIYQTSVPPGAFVLKDLYPTSSGGDLAVTIQENDGSQTQYTLPY
                     ASVPNLVRNGQLKYALGAGKYRPMGHQDAPSFAQGELFYGWRYGLTFYGGAQFADRYN
                     GLAFGIGQNLGRFGAYSIDLTHARSQLADDQHYTGDSVRLRYSKLLNDIGTRVNFFSL
                     RYSTKRFYTLSDTTYKGMAGGSPKQIVEDDGTVTTHYDTVYNLRMSRKAKNQLLLSQP
                     MGQYGSLSLSWDQQTYWNTSKTTQSLQFAWNATFRHVSLGVSVQRSSSLYDDKKDNVL
                     AMSLSVPLGNPALSTRARFTTTHADSTGTTASTGVSGYLPGQENLFYSVNQRYSAQQH
                     YGGDATLQYEGAKGDYNLGYSYTRDSRNLSYGMSGGAVLHEDGLTLSQPLGNTNILVK
                     APGASDVAVLNHKGIKTDSRGYAVIPYATPYRVNQVALDVTTAGNDVELENAIVNKTP
                     TDGALVRATLVTRQGKKAMFVVRRGNDVLPFGTLISLNDDKTSGIVGDGGSLYLSGLT
                     EQGTLSAVWGRNSDQRCTINYALNKQSYNARTGLYSQEVVCQ"
     gene            complement(91825..92502)
                     /locus_tag="ECL_RS00455"
                     /old_locus_tag="ECL_00092"
                     /db_xref="GeneID:9122603"
     CDS             complement(91825..92502)
                     /locus_tag="ECL_RS00455"
                     /old_locus_tag="ECL_00092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_013094863.1"
                     /db_xref="GeneID:9122603"
                     /translation="MRAKAGICLAISLCSSAAYAGGVGLGATRMVYSSTTNQSMLQVR
                     NTHPDATFLIQSWMENEEGQKTNDFVITPPLFVMKPASESAVKIMFNGKALPEDRETL
                     YWMTVKAIPQQTKSGSGNSLQFASANRIKVFYRPESLGQGAGDAWKSLTGAYRGGKVT
                     LSNPTPYYLTTINLKIDGMPVQPVMVPPKSSVTLGETFSHASSVSYQTINDYGAWTPA
                     TRAALSQ"
     gene            complement(92556..93140)
                     /locus_tag="ECL_RS00460"
                     /old_locus_tag="ECL_00093"
                     /db_xref="GeneID:9122604"
     CDS             complement(92556..93140)
                     /locus_tag="ECL_RS00460"
                     /old_locus_tag="ECL_00093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_013094864.1"
                     /db_xref="GeneID:9122604"
                     /translation="MKAQFKTKTLLAVAVAAVLPAGSAFAATTSGGTVNFSGKVVTSA
                     CAISAGSANIDVDMGEVRTATLAAAGSEASTAKAFSITLEDCEIADTSASTEDNPIAA
                     TTVAVTFTGTPDAADANSLAVGANGGANSAQHVAIRLYDEQGKVVKLGEPAAAIPLRA
                     GANTLNFSAKYYSPQGNATAGDASAVATYTVTYS"
     gene            complement(93193..93795)
                     /locus_tag="ECL_RS00465"
                     /old_locus_tag="ECL_00094"
                     /db_xref="GeneID:9122605"
     CDS             complement(93193..93795)
                     /locus_tag="ECL_RS00465"
                     /old_locus_tag="ECL_00094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_013094865.1"
                     /db_xref="GeneID:9122605"
                     /translation="MANKTGNKRHLTTALLGGDHFSRQGIAAVLKNMVPEMQVIASSD
                     DYSLMETVFLTTPVDVIFLSGTEKYHAGFDCLKYIKNIKSRQPDVLICMYSAPANSWL
                     WIRGDIDAYISLQEPLYHWRASLLKMVDSRYRPKKKPTALSLTPGEWRVLKDLRKGLD
                     MRYIAETEQLSYRRVSALKSSAIRKLGLRNKTDLLVFLTS"
     gene            94506..95297
                     /locus_tag="ECL_RS00470"
                     /old_locus_tag="ECL_00095"
                     /db_xref="GeneID:9122606"
     CDS             94506..95297
                     /locus_tag="ECL_RS00470"
                     /old_locus_tag="ECL_00095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix domain-containing
                     protein"
                     /protein_id="WP_013094866.1"
                     /db_xref="GeneID:9122606"
                     /translation="MHKYYIINGIVEFHPAASTLRDLNNPEQVVVLNSPAGRCLLLLI
                     ERAGSIVTQQECMDIVWQRRGMMVSPNTYYQNISILRKGLKKAGFETDPIVTIPRIGL
                     TLASDTQITIKEAQLPLAEPEAPVQTVQEEAGVPQPVASVTPVAPVAKRRFWLVGALL
                     ALLLIVSVSVISYSRPHDSYFVDGYRFTTMMGECRLYFARDIETPQDREKALAYAAPF
                     KDECSSYPWIYISGYSLLPRASVIRCDRAMTEPNRCMSDYFIQDH"
     gene            95299..95781
                     /locus_tag="ECL_RS00475"
                     /old_locus_tag="ECL_00096"
                     /db_xref="GeneID:9122607"
     CDS             95299..95781
                     /locus_tag="ECL_RS00475"
                     /old_locus_tag="ECL_00096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094867.1"
                     /db_xref="GeneID:9122607"
                     /translation="MARYRQTLLTLCLCLLVGALAAGYYLWQRYYIHPFACQVNFIQH
                     HPEETLTLWLNYTVDGNNGTLSMNGRVKSDPGKTFNRKIFFQVERKDNVYYMRSVRNI
                     KFPDDDVSDSWLEKYEPLFFIYPNESIYMRIKKQQNDNYLFILGTLPTYVCHPSKTEG
                     "
     gene            96020..96907
                     /locus_tag="ECL_RS00480"
                     /old_locus_tag="ECL_00097"
                     /db_xref="GeneID:9122608"
     CDS             96020..96907
                     /locus_tag="ECL_RS00480"
                     /old_locus_tag="ECL_00097"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_013094868.1"
                     /db_xref="GeneID:9122608"
                     /translation="MEALRTASCVQKTRQKIAFKLSLISTRAELPITSNAGISVQPEA
                     AHLTPGEYDYIAVIGGSLEDLDKGLPDDRAFLAEAHHNAIPLIGIGTGSFILAEEGIL
                     NERRASIHPYHHDVFTQRFPQVYAEQGLDFIDEGDVLTCPGGISTLTLTTALIRAHAG
                     DDIAATTSRRLSLSPHAVTTPRPANIALIPDSRLRRAVMIIEQYLTRPLSAAGLAQDV
                     KLSERQLNRLFHAEFGKTAREFIRSARLRYACWLLKNSQQSVTDIARRMGFSDCAHFI
                     RHFQLEYGCTPGVWRTSQS"
     gene            96993..97991
                     /locus_tag="ECL_RS00485"
                     /old_locus_tag="ECL_00098"
                     /db_xref="GeneID:9122609"
     CDS             96993..97991
                     /locus_tag="ECL_RS00485"
                     /old_locus_tag="ECL_00098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010426467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_013094869.1"
                     /db_xref="GeneID:9122609"
                     /translation="MNWQPFRGSAPGNMTIFSASFPDVSDQWPMKDETAREINALNQA
                     LKADPALRPPLIEYEEGGHAVLVPQNRYSEQAFRNRPALLAWRARLVPTALALFVVQN
                     PLEERLPEGTKMDSDSRQWFIHANDAIGVRSRAKVLAALVEKYIHNESENNWVSLASG
                     AAIPVLEALRNAKLDGQQVYLTLVDKDPVALSWAETMAAQEGLVVGEQLTLLRRNLLH
                     TLVRNDDLLLELGEHQAELVDALGIFEYFNDTDAVTFLQRALRLVKPGGAVIVSNMLT
                     SSPQIDFVLRGIGWEDIHPRSLQQLQDIHLAAGVPVENVTVVVPKDGVYAVMEVKV"
     gene            98522..98962
                     /locus_tag="ECL_RS00490"
                     /old_locus_tag="ECL_00099"
                     /db_xref="GeneID:9122610"
     CDS             98522..98962
                     /locus_tag="ECL_RS00490"
                     /old_locus_tag="ECL_00099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013094870.1"
                     /db_xref="GeneID:9122610"
                     /translation="MKIETAHSSHFERLVAIWESSVRATHHFLQESDIAALRPLLLNA
                     YLPNLTVVMARDDAGVIHGFLGVDENRIEMLFVDDASRGKGVGKLLLHYAIAEFGVNE
                     VDVNEQNPQGVAFYRHMGFVQVGRSEVDGQGNPFPLLHMRLNRD"
     gene            complement(98959..99987)
                     /locus_tag="ECL_RS00495"
                     /pseudo
                     /db_xref="GeneID:44145303"
     CDS             complement(98959..99987)
                     /locus_tag="ECL_RS00495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462654.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="virulence RhuM family protein"
                     /db_xref="GeneID:44145303"
     gene            complement(100046..100387)
                     /locus_tag="ECL_RS00500"
                     /old_locus_tag="ECL_00102"
                     /db_xref="GeneID:9122613"
     CDS             complement(100046..100387)
                     /locus_tag="ECL_RS00500"
                     /old_locus_tag="ECL_00102"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015570064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I addiction module toxin, SymE family"
                     /protein_id="WP_013094873.1"
                     /db_xref="GeneID:9122613"
                     /translation="MADSHSTPDTDQSGTERSLIVGYRPNVFDKSTPNIILSGKWLRT
                     AGFETGHQVTVKVMKGCIVLVAYNEQEQRLQDDYKRTKAKLIEIENALTAIQTPRAGK
                     RLAKTNTNHLA"
     gene            100513..100704
                     /locus_tag="ECL_RS00505"
                     /db_xref="GeneID:44145304"
     CDS             100513..100704
                     /locus_tag="ECL_RS00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009652903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin-antitoxin system HicB family antitoxin"
                     /protein_id="WP_028028019.1"
                     /db_xref="GeneID:44145304"
                     /translation="MSIISREKKPKGGGQSPQFKMRIDPALKEQLDAVAAEEGVSLAS
                     WLKELAREALRRKGLEPKG"
     gene            complement(100747..101040)
                     /locus_tag="ECL_RS00510"
                     /old_locus_tag="ECL_00103"
                     /db_xref="GeneID:9122614"
     CDS             complement(100747..101040)
                     /locus_tag="ECL_RS00510"
                     /old_locus_tag="ECL_00103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013094874.1"
                     /db_xref="GeneID:9122614"
                     /translation="MQNFYHLDQLIHGYFNQDYDLINDGEDTIEGIIGLFKKTAPGWL
                     LKELAEEIDTFIECYGDKLDDEFKSRYGFDFSPELWETTSYDFLMTVRRLALA"
     gene            complement(101048..101503)
                     /locus_tag="ECL_RS00515"
                     /db_xref="GeneID:44145305"
     CDS             complement(101048..101503)
                     /locus_tag="ECL_RS00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013204427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_052429245.1"
                     /db_xref="GeneID:44145305"
                     /translation="MEESGMTVVMSPVQLAAVLSDKSVTEEETLSNRLLRGLGVLPGA
                     VETDNELLARFEQNKRLIMSSTFKNLNVAESVISRAIYYNRANIKSLLGGGNRGGRLT
                     IVYPAGQEIGYGFSRGSTQRISMRSVRIVIELKEYNGKPYYILTAFPTP"
     gene            complement(101744..101838)
                     /locus_tag="ECL_RS00520"
                     /old_locus_tag="ECL_tRNA001"
                     /db_xref="GeneID:9122615"
     tRNA            complement(101744..101838)
                     /locus_tag="ECL_RS00520"
                     /old_locus_tag="ECL_tRNA001"
                     /product="tRNA-Sec"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(101802..101804),aa:Sec,seq:tca)
                     /db_xref="GeneID:9122615"
     gene            102167..104485
                     /gene="yicI"
                     /locus_tag="ECL_RS00525"
                     /old_locus_tag="ECL_00104"
                     /db_xref="GeneID:9127669"
     CDS             102167..104485
                     /gene="yicI"
                     /locus_tag="ECL_RS00525"
                     /old_locus_tag="ECL_00104"
                     /EC_number="3.2.1.177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-xylosidase"
                     /protein_id="WP_013094875.1"
                     /db_xref="GeneID:9127669"
                     /translation="MKISDGNWLIQPGLTVTYPVQVFDVEQQGNDLVVYVAPRDVRER
                     AWQLDTLMFTVRLFAPQEGIVGVRIEHFQGAQDKGPHYPLNVLKDVRVETVNNAEYAE
                     LKSGNLSVRVTKGEFWALDFLRNGQRITGSELKNNGYVQDSNTNRNYLFERLDLGVGE
                     TVYGLGERFTALVRNGQQVDTWNRDGGTSTEQSYKNIPFYLTNRGYGVLVNHPENVSF
                     EIGSEKVSKVQFSVEGEYLEYFVIDGPTPKAVLDRYTQFTGRPALPPAWSFGLWLTTS
                     FTTNYDEATVNSFIDGMAERDLPLHVFHFDCFWMKAFQWCDFEWDPVTFPDPEGMIRR
                     LKEKGLKVCVWINPYIGQKSPVFNELKEKGYLLKRPDGSVWQWDKWQPGLAIYDFTNP
                     DACRWYADKLKGLVEIGVDCFKTDFGERIPTDVQWFDGSDPQKMHNHYAFIYNALVWN
                     VLKETVGEEEAVLFARSASVGAQQFPVHWGGDCYANYESMAESLRGGLSIGLSGFGFW
                     SHDIGGFENTAPAHVYKRWCAFGLFSSHSRLHGSKSYRVPWAYDDESCDVVRHFTQLK
                     CQLMPYLYRQAALARECGTPMLRAMMLEFPDDPACDYLDRQYMLGDALMVAPVFSEAG
                     EVQFYLPEGRWTHLWHNDEVQGCRWHKQQHDFMSLPVYVRDNTLLALGNNKHKPDYAW
                     NEGTAFQLFNLDEGATAVSEVPAADGSVAFTLKASRKGDTVTLTGAGDARNWSVCLRN
                     VQKVSGVKGGSYAGSEWGVVVDAEGDEVVVHL"
     gene            complement(104534..106237)
                     /locus_tag="ECL_RS00530"
                     /old_locus_tag="ECL_00105"
                     /db_xref="GeneID:9122616"
     CDS             complement(104534..106237)
                     /locus_tag="ECL_RS00530"
                     /old_locus_tag="ECL_00105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsmA family protein"
                     /protein_id="WP_013094876.1"
                     /db_xref="GeneID:9122616"
                     /translation="MKFIGKLLVYLLVALLLVLLALYFLLQTRWGASQVSSWVTVNTD
                     YELSFDLMDHRFSSPSHILLENVTFGRDGQPATLVAKKVDIGLGSRQLTDPLHMDTIT
                     LVDGTLNLSPQTAPMPFQADRLQLNNMAFNSPNTEWDLSAQKVTGGVSPWQPEAGNVL
                     GKNAQIQMSAGSLTLNGVPATNVLIQGQLNGKEVVLNTIGADMARGSLTGSALRNADG
                     SWVIDTMRLNEIRLQSDKTLLDFFSPLNTIPSLQIGRLEVTDARLQGPDWAVTDLDLS
                     LRNLTLSKGDWQSLDGRLSMNASEFIYGSLHLFDPILNAEFSPQGVALRQFTSRWEGG
                     MVRTSGNWLRDGKALVLDDVAVAGLEYTLPQNWKTLWMDPLPEWLNSVTLKKFGLSRN
                     LVIDIDPAFPWQITSLDGYGANLQLAQDHKWGVWGGSATLNGAAATFNRVDVRRPSLA
                     LNANAATVNITDLSAFTEKGILEATATVSQLAQRQTTVSLNGRGVPLNILQQWGWPAL
                     PVSGDGNIQLTASGSVQANTPLKPTVNGKLSAVNMDKQQVQQTMTGGVVSTPPSPQPS
                     P"
     gene            complement(106357..107748)
                     /locus_tag="ECL_RS00535"
                     /old_locus_tag="ECL_00106"
                     /db_xref="GeneID:9122617"
     CDS             complement(106357..107748)
                     /locus_tag="ECL_RS00535"
                     /old_locus_tag="ECL_00106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004855527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-xanthine permease"
                     /protein_id="WP_013094877.1"
                     /db_xref="GeneID:9122617"
                     /translation="MSVNSIESPDAQPIAQKQNSELIYRLEDRPPLPQTLFAACQHLL
                     AMFVAVITPALLICQALGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQG
                     TSFNFVAPLIMGGTALKTGGADVPTMMAALFGTLMLASCTEMVISRVLHLARRVITPL
                     VSGVVVMIIGLSLIQVGLTSIGGGYAAMSDHTFGAPKNLLLAGVVLAIIILLNRQRNP
                     YLRVASLVIAMAAGYLLAWALGMLPENTAPTNSALITVPTPLYYGLGIDWGLLLPLML
                     VFMITSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCF
                     GQNNGVIQLTGVASRYVGFVVALMLIILGLFPAVSGFVQHIPEPVLGGATLVMFGTIA
                     ASGVRIVSREPLNRRAIMIIALSLAVGLGVSQQPLILQFAPDWVKNLLSSGIAAGGIT
                     AIVLNLVFPPEKN"
     gene            107974..109176
                     /gene="gltS"
                     /locus_tag="ECL_RS00540"
                     /old_locus_tag="ECL_00107"
                     /db_xref="GeneID:9122618"
     CDS             107974..109176
                     /gene="gltS"
                     /locus_tag="ECL_RS00540"
                     /old_locus_tag="ECL_00107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/glutamate symporter"
                     /protein_id="WP_013094878.1"
                     /db_xref="GeneID:9122618"
                     /translation="MIHLDTLSTLVAATLVLLLGRKLVHSVSFLKKYTIPEPVAGGLL
                     VALALLVLKKSMGWEIDFDMSLKDPLMLAFFATIGLNANLASLRSGGKVLGVFLIVVV
                     GLLLMQNAIGIGMASLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFENATEV
                     AMACATFGLVLGGLIGGPVARYLVKHSTTPDGRPDDELVPTAFEKPDVGRTITSLVMI
                     ETIAMIAICLTLGKVVAQWLAGTAFELPTFVCVLFIGVILSNGLALMGFYRVFERAVS
                     VLGNVCLSLFLAMALMSLKLWELASLALPMVAILAVQALFMALYAMFVTWRMMGKNYD
                     AAVLAAGHCGFGLGATPTAIANMQAITERFGPSHMAFLVVPMVGAFFIDIVNALVIKL
                     YLMLPMFA"
     gene            complement(109179..111953)
                     /gene="recG"
                     /locus_tag="ECL_RS00545"
                     /old_locus_tag="ECL_00108"
                     /pseudo
                     /db_xref="GeneID:9122619"
     CDS             complement(109179..111953)
                     /gene="recG"
                     /locus_tag="ECL_RS00545"
                     /old_locus_tag="ECL_00108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009008421.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /db_xref="GeneID:9122619"
     gene            complement(111958..114072)
                     /gene="spoT"
                     /locus_tag="ECL_RS00550"
                     /old_locus_tag="ECL_00111"
                     /db_xref="GeneID:9122622"
     CDS             complement(111958..114072)
                     /gene="spoT"
                     /locus_tag="ECL_RS00550"
                     /old_locus_tag="ECL_00111"
                     /EC_number="3.1.7.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020455762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional GTP
                     diphosphokinase/guanosine-3',5'-bis pyrophosphate
                     3'-pyrophosphohydrolase"
                     /protein_id="WP_013094882.1"
                     /db_xref="GeneID:9122622"
                     /translation="MYLFESLNQLIQTYLPEDQIKRLQQAYLVARDAHEGQTRSSGEP
                     YITHPVAVACILAEMKLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSK
                     LDKLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHIKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILS
                     EIEGRLQEAGIPCRVSGREKHLYSIYCKMVLKEQRFHSIMDIYAFRVIVHDADTCYRV
                     LGQMHSLYKPRPGRMKDYIAIPKANGYQSLHTSMIGPHGVPVEVQIRTEDMDQMAEMG
                     VAAHWAYKEHGGESSTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVF
                     TPEGRIVELPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQPLASGQTVEIITAP
                     GARPNAAWLNFVVSSKARAKIRQLLKNLKRDDSVSLGRRLLNHALGGSRKLAEIPPEH
                     IQRELDRMKLTSLDDLLAEIGLGNAMSVVVAKNLQQGEAIPSAPGASGHAHLPIKGAD
                     GVLITFAKCCRPIPGDPIIAHVSPGKGLVIHHESCRNIRGYQKEAEKFMAVEWDKETA
                     QEFITEIKVDMFNHQGALANLTAAINTASSNIQSLNTEEKDGRVYSAFIRLTARDRVH
                     LANIMRKIRVMPDVIKVTRNRN"
     gene            complement(114092..114367)
                     /gene="rpoZ"
                     /locus_tag="ECL_RS00555"
                     /old_locus_tag="ECL_00112"
                     /db_xref="GeneID:9122623"
     CDS             complement(114092..114367)
                     /gene="rpoZ"
                     /locus_tag="ECL_RS00555"
                     /old_locus_tag="ECL_00112"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013511051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_000135058.1"
                     /db_xref="GeneID:9122623"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEEND
                     KTTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
     gene            complement(114422..115045)
                     /gene="gmk"
                     /locus_tag="ECL_RS00560"
                     /old_locus_tag="ECL_00113"
                     /db_xref="GeneID:9122624"
     CDS             complement(114422..115045)
                     /gene="gmk"
                     /locus_tag="ECL_RS00560"
                     /old_locus_tag="ECL_00113"
                     /EC_number="2.7.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000046969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_013094883.1"
                     /db_xref="GeneID:9122624"
                     /translation="MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRKP
                     RPGEVHGEHYFFVDHDEFKAMIGRDAFLEHAEVFGNYYGTSRETIEQVLATGVNVFLD
                     IDWQGAQQIRKKMPDSRSIFILPPSKDELDRRLRGRGQDSEEVIAKRMEQAVAEMSHY
                     AEYDYLIVNDDFDAALSDLKTILRAERLRMSRQKQRHDALITKLLAD"
     gene            115297..116967
                     /gene="ligB"
                     /locus_tag="ECL_RS00565"
                     /old_locus_tag="ECL_00115"
                     /db_xref="GeneID:9122626"
     CDS             115297..116967
                     /gene="ligB"
                     /locus_tag="ECL_RS00565"
                     /old_locus_tag="ECL_00115"
                     /EC_number="6.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigB"
                     /protein_id="WP_013094885.1"
                     /db_xref="GeneID:9122626"
                     /translation="MWRWISGFMLLWCGSAAAVCPVWSQARAEKEIATLSAQIKRWDD
                     AYWQQGISEVNDEVYDQLNGRLKQWQHCFGHASPDAALPALTGRIKHPVAHTGVHKVS
                     SKEELGQWMHARRNLWMQPKVDGVAVTLVYRGGTLAQAISRGDGLKGEDWTSQVRLIP
                     SVPQHLYGALANSVLQGELFWQRENHIQQQMGGMNARAKVAGAMMRQQDNAFLREVGV
                     FIWAWPDGPKEMKTALAELSDAGFTLTARYTLPVEHIEAVEKQRSAWHTAALPFATDG
                     IVVRSADELPGENWLPGEGSWVVAWKYPPVAQVAEVRDIHFTVGRTGKIAVVAGLEPV
                     RLDDKQVQRVSLGSVGRWQRLDIAPGDQIQVSLAGQGIPRFDKVVWRGTDRQKPEPPV
                     PQYHSLSCFYASPECMEQFFARLTWLSSKQGLDIAGLGESGWRALWQAHRFEHIFSWL
                     LLTQAQLQTTPGFSAARGLALWHQFNLVRERPFIRWIMAMGVPLAQATLKAAGELSWQ
                     TMHQRSAMDWQTLPGTGEEKARQIVNWLHAPEVDVLAKWLAEQHIKGF"
     gene            complement(116970..117587)
                     /locus_tag="ECL_RS00570"
                     /old_locus_tag="ECL_00116"
                     /db_xref="GeneID:9122627"
     CDS             complement(116970..117587)
                     /locus_tag="ECL_RS00570"
                     /old_locus_tag="ECL_00116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trimeric intracellular cation channel family
                     protein"
                     /protein_id="WP_013094886.1"
                     /db_xref="GeneID:9122627"
                     /translation="MLLHTLYLIGITAEAMTGALAAGRRRMDTFGVIIIATATALGGG
                     SVRDILLGHYPLGWVKNPEYVIIVATAAVVTTIVAPVMTHLRRLFLVLDALGLIVFSI
                     IGAQIALDMGEGPVIATIAAVVTGVFGGVLRDMFCKRIPLVFQKELYAGISFAAAVLY
                     IALQHYVSNHDVVVISTLLFGFTARMLALRLKLGLPVFHYKHSAH"
     gene            complement(117793..118656)
                     /locus_tag="ECL_RS00575"
                     /old_locus_tag="ECL_00117"
                     /db_xref="GeneID:9122628"
     CDS             complement(117793..118656)
                     /locus_tag="ECL_RS00575"
                     /old_locus_tag="ECL_00117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005122606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YicC family protein"
                     /protein_id="WP_013094887.1"
                     /db_xref="GeneID:9122628"
                     /translation="MIRSMTAYARREIKGSWGSATWEMRSVNQRYLETYFRMPEQFRS
                     LEPVVRERIRTRLTRGKVECNLRFEPDASAQGELILNEKLAKQLVNAANWVKMQSDEG
                     EINPVDILRWPGVMAAGEQDLDAIAAEILAALDSTLDDFIVARETEGQALKAMIEQRL
                     EGVSAEVAKVRTHMPEVLQWQRERLVAKLEEAEVQLENNRLEQELVLMAQRVDVAEEL
                     DRLEAHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINADVTNSAIELKVLI
                     EQMREQIQNIE"
     gene            118782..119498
                     /gene="rph"
                     /locus_tag="ECL_RS00580"
                     /old_locus_tag="ECL_00118"
                     /db_xref="GeneID:9122629"
     CDS             118782..119498
                     /gene="rph"
                     /locus_tag="ECL_RS00580"
                     /old_locus_tag="ECL_00118"
                     /EC_number="2.7.7.56"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006803115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="WP_013094888.1"
                     /db_xref="GeneID:9122629"
                     /translation="MRPAGRSANQVRPVTLTRNYTKHAEGSVLVEFGDTKVLCTASIE
                     EGVPRFLKGQGQGWITAEYGMLPRATHTRNAREAAKGKQGGRTMEIQRLIARALRAAV
                     DLKTLGEFTITLDCDVIQADGGTRTASITGACVALADALNKLVAAGKLKTNPMKGMVA
                     AVSVGIVNGEALCDLEYVEDSAAETDMNVVMTEDGRIIEVQGTAEGEPFTHEELLTLL
                     ALARGGIESIVTTQKAALEN"
     gene            119566..120207
                     /gene="pyrE"
                     /locus_tag="ECL_RS00585"
                     /old_locus_tag="ECL_00119"
                     /db_xref="GeneID:9122630"
     CDS             119566..120207
                     /gene="pyrE"
                     /locus_tag="ECL_RS00585"
                     /old_locus_tag="ECL_00119"
                     /EC_number="2.4.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="WP_013094889.1"
                     /db_xref="GeneID:9122630"
                     /translation="MKPYQRQFIEFALNKQVLKFGEFTLKSGRKSPYFFNAGLFNTGR
                     DLALLGRFYAEALVDSGIDFDLLFGPAYKGIPIATTTAVALAEHHDRDVPYCFNRKEA
                     KTHGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERG
                     RGEISAIQEVERDYSCKVTSIINLKDLIAYLEEKPEMADHLAAVRAYREEFGV"
     gene            complement(120291..120887)
                     /gene="slmA"
                     /locus_tag="ECL_RS00590"
                     /old_locus_tag="ECL_00120"
                     /db_xref="GeneID:9122631"
     CDS             complement(120291..120887)
                     /gene="slmA"
                     /locus_tag="ECL_RS00590"
                     /old_locus_tag="ECL_00120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000818604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid occlusion factor SlmA"
                     /protein_id="WP_013094890.1"
                     /db_xref="GeneID:9122631"
                     /translation="MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVS
                     EAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVQLILGFGERN
                     PGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKKMREGEGYSTDETLLAS
                     QILAFCEGMLSRFVRSEFKYSPTDDFDARWPLVAAQLQ"
     gene            complement(121008..121466)
                     /gene="dut"
                     /locus_tag="ECL_RS00595"
                     /old_locus_tag="ECL_00121"
                     /db_xref="GeneID:9122632"
     CDS             complement(121008..121466)
                     /gene="dut"
                     /locus_tag="ECL_RS00595"
                     /old_locus_tag="ECL_00121"
                     /EC_number="3.6.1.23"
                     /function="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000976070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dUTP diphosphatase"
                     /protein_id="WP_015570042.1"
                     /db_xref="GeneID:9122632"
                     /translation="MMKKIDVKILDPRVGEQFPLPTYATSGSAGLDLRACLDDAVELA
                     PGATTLIPTGLAIHIADPSLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVW
                     NRGQDSFTIEPGERIAQMVFVPVVQAEFNLVADFDATDRGEGGFGHSGRK"
     gene            complement(121444..122655)
                     /gene="coaBC"
                     /locus_tag="ECL_RS00600"
                     /old_locus_tag="ECL_00122"
                     /db_xref="GeneID:9122633"
     CDS             complement(121444..122655)
                     /gene="coaBC"
                     /locus_tag="ECL_RS00600"
                     /old_locus_tag="ECL_00122"
                     /EC_number="4.1.1.36"
                     /EC_number="6.3.2.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418096.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate--cysteine ligase CoaBC"
                     /protein_id="WP_086528250.1"
                     /db_xref="GeneID:9122633"
                     /translation="MSLAGKKIVLGVSGGIAAYKTPELVRRLRERGADVRVAITEGGK
                     AFITPLSLQAVSGYPVSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGM
                     ANDLVSTICLATPAPVAVVPAMNQQMYRNAATQHNLQTLTSRGLLIWGPDSGSQACGD
                     VGPGRMLDPLTIVDMAAAHFSPVNDLQHLNIMITAGPTREPLDPVRYITNHSSGKMGF
                     AIAAAAAKRGANVTLVSGPVSLPTPPFVQRIDVTTALEMEAAVQARAQNQQIFIGCAA
                     VADYRAETISDAKIKKQGDELTLKMVKNPDIVAGVAALKTHRPYVVGFAAETNNVEEY
                     ARQKRTRKNLDLICANDVSLATQGFNSDSNALHLFWQDGDKILPLERKELLGQQLLDE
                     IVTRYDEKNRR"
     gene            122828..123496
                     /locus_tag="ECL_RS00605"
                     /old_locus_tag="ECL_00123"
                     /db_xref="GeneID:9122634"
     CDS             122828..123496
                     /locus_tag="ECL_RS00605"
                     /old_locus_tag="ECL_00123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_013094892.1"
                     /db_xref="GeneID:9122634"
                     /translation="MEDEDELLLPREKLLRYGVTLLKDEELLALFLRTGTPGKTVFTL
                     AKDLIGHFGSLYGLMTAELAEFAHVEGIGVAKYAQLKGIAELARRFQCVRMQEEDPIL
                     TPAMTREFLQSQLTDIEREIFMVIFLDNRNRVLKHSHLFSGTLSHVEVHPREIVREAI
                     KLNAAGVILAHNHPSGCAEPSRADKEITDRIVKCCQFMDIRVLDHLIIGRGEYLSFAE
                     HGWI"
     gene            123714..123950
                     /gene="rpmB"
                     /locus_tag="ECL_RS00610"
                     /old_locus_tag="ECL_00124"
                     /db_xref="GeneID:9122635"
     CDS             123714..123950
                     /gene="rpmB"
                     /locus_tag="ECL_RS00610"
                     /old_locus_tag="ECL_00124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008457442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_002436699.1"
                     /db_xref="GeneID:9122635"
                     /translation="MSRVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEK
                     RFVTLRVSAKGMRVIDKKGIDTVLSELRARGEKY"
     gene            123973..124140
                     /gene="rpmG"
                     /locus_tag="ECL_RS00615"
                     /old_locus_tag="ECL_00125"
                     /db_xref="GeneID:9122636"
     CDS             123973..124140
                     /gene="rpmG"
                     /locus_tag="ECL_RS00615"
                     /old_locus_tag="ECL_00125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010847629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_013094893.1"
                     /db_xref="GeneID:9122636"
                     /translation="MAKGIREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVR
                     QHVMYKEAKIK"
     gene            124215..125024
                     /gene="mutM"
                     /locus_tag="ECL_RS00620"
                     /old_locus_tag="ECL_00126"
                     /db_xref="GeneID:9122637"
     CDS             124215..125024
                     /gene="mutM"
                     /locus_tag="ECL_RS00620"
                     /old_locus_tag="ECL_00126"
                     /EC_number="3.2.2.23"
                     /EC_number="4.2.99.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional DNA-formamidopyrimidine
                     glycosylase/DNA-(apurinic or apyrimidinic site) lyase"
                     /protein_id="WP_013094894.1"
                     /db_xref="GeneID:9122637"
                     /translation="MPELPEVETSRRGIEPHLVGATILHATVRNGRLRWPVSDEIHAL
                     SDKPILSVQRRAKYLLLELPDGWIIIHLGMSGSLRILTEELPAEKHDHVDLVMSNGKV
                     LRYTDPRRFGAWLWTKELEGHSVLAHLGPEPLSEAFNAEYLKAKCAKKKTPIKPWLMD
                     NKLVVGVGNIYASESLFAAGIHPDRLASSLSAQECELLVRVIKAVLLRSIEQGGTTLK
                     DFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIIATKHAQRATFYCRQCQK"
     gene            complement(125027..125506)
                     /gene="coaD"
                     /locus_tag="ECL_RS00625"
                     /old_locus_tag="ECL_00127"
                     /db_xref="GeneID:9122638"
     CDS             complement(125027..125506)
                     /gene="coaD"
                     /locus_tag="ECL_RS00625"
                     /old_locus_tag="ECL_00127"
                     /EC_number="2.7.7.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantetheine-phosphate adenylyltransferase"
                     /protein_id="WP_013094895.1"
                     /db_xref="GeneID:9122638"
                     /translation="MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSKKP
                     MFDLNERVALATEAIAHLPNVEVVGFSDLMANFARAQQATILIRGLRAVADFEYEMQL
                     AHMNRHLMPELESVFLMPSKEWSFISSTLVKEVARHHGDVTHFLPVNVHQALMDKLK"
     gene            complement(125510..126280)
                     /locus_tag="ECL_RS00630"
                     /old_locus_tag="ECL_00128"
                     /db_xref="GeneID:9122639"
     CDS             complement(125510..126280)
                     /locus_tag="ECL_RS00630"
                     /old_locus_tag="ECL_00128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008502696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_013094896.1"
                     /db_xref="GeneID:9122639"
                     /translation="MSTRLSVVLIAKNAADLTPDCLASVAWADEIILLDSGSEDNTAD
                     VARAAGAKVYTNTDWQGYGIQRQRAQGYATGDYVLMLDTDERITPELRQAIQAVLAAP
                     TPGTVYSIARRNYFLGRFMRHSGWYPDRVTRLYERERYQYNDNLVHESLACDSAPVVP
                     LTGDLLHLTCRDFASFQRKQLNYATAWAQERHQRGKKATLTGIFTHTLGAFLKTLLLR
                     GGVLDGKQGWLLAVVNAQYTFNKYTELWALSRGYSEKT"
     gene            complement(126280..127554)
                     /gene="waaA"
                     /locus_tag="ECL_RS00635"
                     /old_locus_tag="ECL_00129"
                     /db_xref="GeneID:9122640"
     CDS             complement(126280..127554)
                     /gene="waaA"
                     /locus_tag="ECL_RS00635"
                     /old_locus_tag="ECL_00129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="WP_013094897.1"
                     /db_xref="GeneID:9122640"
                     /translation="MELLYTALLYIIQPLVWLRLLLRSRKAPAYRKRWAERYGFCRNK
                     VAPDGILLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVMSAFGKDVHH
                     VYLPYDLPCAMNRFLETVRPKLVIVMETELWPNMISALHARKIPLVIANARLSERSAK
                     GYGKLGKFMRRLLSKITLIAAQNEEDAARFISLGLKRNQLAVTGSLKFDISVTPELAA
                     RAITLRRQWAPRRQVWIATSTHDGEEAIILQAHRKLLEKFPDLLLILVPRHPERFKDA
                     REMVQKGGFSFTLRSSGEIPSTSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHN
                     PLEPAAHAIPVLMGPHTFNFKDICAKLQQAEGLITVTDADSVVKEVSTLLTDEDYRLW
                     YGRHAVEVLHQNQGALTRLLQLLQPYLPQRSH"
     gene            complement(127621..128610)
                     /locus_tag="ECL_RS00640"
                     /old_locus_tag="ECL_00130"
                     /db_xref="GeneID:9122641"
     CDS             complement(127621..128610)
                     /locus_tag="ECL_RS00640"
                     /old_locus_tag="ECL_00130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_013094898.1"
                     /db_xref="GeneID:9122641"
                     /translation="MQNSAPLLSVVVAVYNGEAFLDQFFTCLVDQRIDSMEVIIVNDG
                     STDRSMQIVENWREKLPQMQVIEQQNQGVSIARNTGLAVATGQYLSFPDIDDVFKPGM
                     YQHLLDMAVTQRLDVATCNGNYVWENNKKPSRPIFPEDKLASTGVMSGPAWLKMALDS
                     RKFLHVTWLNIYRHDFIREHGFHFEPGLRHQDIPWTTEVLLAAERVQYTSERYYDYYI
                     HSASVSHMPDNDDTLIRSARHYMKILQMLDAINQRYPDKVKGIPACHWQIAKEGLGII
                     HTFDNMKDEQKKAFIIKEFFDKGIWKLIWKNAKSPRLRWRLGRRYFRLKRYVA"
     gene            complement(128622..129722)
                     /locus_tag="ECL_RS00645"
                     /old_locus_tag="ECL_00131"
                     /db_xref="GeneID:9122642"
     CDS             complement(128622..129722)
                     /locus_tag="ECL_RS00645"
                     /old_locus_tag="ECL_00131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017693963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_044159063.1"
                     /db_xref="GeneID:9122642"
                     /translation="MRILMIIDGLPGGGAEKTVLTLSSGLTEMGHQVSLFSLRKVCDY
                     AIPEGIDYQVVQDTCKKPWRKLTEIPRRARLLDQAIERAERSGKFDVVFSHLHKTDRI
                     VAHCRALERDKVWFCVHGMFSFSYLRHRRGLSRWFKHTKIRHTYEKRNVVAVSGAVLK
                     DLSETLALNLRRTAVIHNPFDIPEIQRLADAPFEMQGKDYIIHVGRFHEHKRHDRLLR
                     AFALSQLNTTLVMMGNGSEAKIQKLKLLARELGIEDKTVFRPFEPNPYPWIKGARLLV
                     LSSDCEGFGNVLVESIICQTPPVSTHCPGGPAEILKGDLSRGLAEMNDESLAKTLADI
                     YTSPPVVDRATIASFGIKAICQQYIALVDNQK"
     gene            complement(129725..130852)
                     /locus_tag="ECL_RS00650"
                     /old_locus_tag="ECL_00132"
                     /db_xref="GeneID:9122643"
     CDS             complement(129725..130852)
                     /locus_tag="ECL_RS00650"
                     /old_locus_tag="ECL_00132"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004154806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 4 protein"
                     /protein_id="WP_013094900.1"
                     /db_xref="GeneID:9122643"
                     /translation="MKHHRLAIVRQKYRPDGGAERFVSRALTALSNQNLELNVITREW
                     QGEKQDDWHIHICDPRKWGRISRERGFAHAARALWQQQQFDIVQSHERIPGCDIYRAG
                     DGVHRRWLLQRARILPAWRAKLLMHDRYHRYVMNAEREMYQAPELKAVICNAEMIKRE
                     IVEDFDIDAKKIHVIYNSIDSTRFVPAEEAQRIALRQQFGLPTDAVIFCFVGSGFERK
                     GLASAIRAVAGTAAWLIVVGQDKAERRYRDLARSLGCEGQIRFLGMQKETLPFYQLSD
                     GLLLPTLYDPFPNVILEAMACGLPVITSESCGGAEFIQQGQNGFYCDALDISTLKEAV
                     AATPSLEKNNDMGRAARERVKDATPEKLSSQLISLYQKLLD"
     gene            complement(130849..131919)
                     /gene="rfaQ"
                     /locus_tag="ECL_RS00655"
                     /old_locus_tag="ECL_00133"
                     /db_xref="GeneID:9122644"
     CDS             complement(130849..131919)
                     /gene="rfaQ"
                     /locus_tag="ECL_RS00655"
                     /old_locus_tag="ECL_00133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014881992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipopolysaccharide heptosyltransferase
                     III"
                     /protein_id="WP_013094901.1"
                     /db_xref="GeneID:9122644"
                     /translation="MMMNNLPDTPDLRILLIKLRHHGDMLLTTPVIDSLRQKWPQAQI
                     DVLLYEETRDMLAAHPAIGTVYGIDRKWKQLGTLKHLQKEWQLLCALRKQHYHLVINL
                     ADQWRSAIVTRFTGAPVRLGFAFNKRNNAFWRFCHSDLVSVAGHNALHTVEQNLSILS
                     PLPVTAQPAVTMAYHAEDWHEAHQKLMQNGVGDNYIVIQPTSRWFFKCWDEGKMAQTI
                     TALQQDGHTVVLTAGPDKKELAMIDRILAASPETGVVSLAGQLTLRQLASLIDHASLF
                     IGVDSVPMHMAAALQTPCVALFGPSKLTFWSPWQVNGEVIWAGDYGPLPDPDAIDTKT
                     KERYLDAIPVDAVVSAARRYLS"
     gene            132070..133026
                     /locus_tag="ECL_RS00660"
                     /old_locus_tag="ECL_00134"
                     /db_xref="GeneID:9122645"
     CDS             132070..133026
                     /locus_tag="ECL_RS00660"
                     /old_locus_tag="ECL_00134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010426399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deacetylase"
                     /protein_id="WP_013094902.1"
                     /db_xref="GeneID:9122645"
                     /translation="MKKPAFIITIDTEGDNLWQNHRVIKTENARYLARFQTLCERFGF
                     KPVWLTNYEMAIEPVFIEFAKDVIARGQGEVGMHLHAWNSPPEHDLTGDDWRWQPYLI
                     EFSDEVMREKVLFMTRLLEETFQTKMLSHRAGRWAFDSRYARLLIELGYQVDCSVTPR
                     VNWRNAKGAPQGNGGTNYQHFPDHAYFIDTDDISRAGNSPLLEVPMSIQYKHPAWLNT
                     VKQGYDRLRGKYRSPSVNWLRPSGGNASQMIQVAQQCLSQGHDYVEFMLHSSEFMPGG
                     SPTFKDEAAIEGLYQDLEVLFSWLSDKTVGMTLAEFYQYKKN"
     gene            complement(133050..134261)
                     /locus_tag="ECL_RS00665"
                     /old_locus_tag="ECL_00135"
                     /db_xref="GeneID:9122646"
     CDS             complement(133050..134261)
                     /locus_tag="ECL_RS00665"
                     /old_locus_tag="ECL_00135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015570034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase family protein"
                     /protein_id="WP_013094903.1"
                     /db_xref="GeneID:9122646"
                     /translation="MEKVKLRLYQLTLTLSLVSLALVLVSSGKQREFFYIAIYASILG
                     LAVEYKKITWRPFSIAYPVLLVGILNLIWYFSYEFHNEGLNAYSDYLGASKKLILASF
                     LIFYLDRFKSHVTKQNFQKYFLIATSVGFVLATGYGLFQAIQGIDRVEMAINRPTIAA
                     YIYSVLSLAFVYSLYLQQNVKLYLLAGFVVLLSYFVILLTATRAAMGLYLILAIVLTL
                     YQFRKIHLKSLMIFLCIVAGIIIVSYKPLISPKIQQTQNEITKYQKGHDATSLGARFS
                     MWNVGIMTGLAHPLGQSIESREIWAKQYVKEGHAHVAAALGYMRIHLHNEFIEKYSLQ
                     GIPGLAVLLFFYVSMIVYAMTNRNGLLLTAMLLLLLYGLTDVMLLSSEALIFFMTLFA
                     LSTSFSQTKRQ"
     gene            complement(134249..135157)
                     /locus_tag="ECL_RS00670"
                     /old_locus_tag="ECL_00136"
                     /db_xref="GeneID:9122647"
     CDS             complement(134249..135157)
                     /locus_tag="ECL_RS00670"
                     /old_locus_tag="ECL_00136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_013094904.1"
                     /db_xref="GeneID:9122647"
                     /translation="MAFLSIIIAAHNAEDTLHTTLESLHNAIDNAGDDVEVIIFNDSS
                     DDSTQDIIETWLPAFPNVHSRHVQFRNVGLVRNSAFSLASGDYITMLDSDDRLKPGSI
                     RDAVAFLKTERPDMLLTRLLEIRDIKKITPNWQGFSPVALSQREAIKRFLLHKDFQAH
                     LIGQFIHRKLYESNPIPSMVCYEDFAVFPGMLMQSSKIAYQRRGHYYYIKRSDSLSSK
                     LDASKIKTLVECTLLMEKTFQQPFQHLINCHWFDIYSNHRQHLTDQHFQLVKQRVKAL
                     YSLSFFLSSDVRFSYKKRVIEALWKK"
     gene            complement(135163..136272)
                     /locus_tag="ECL_RS00675"
                     /old_locus_tag="ECL_00137"
                     /db_xref="GeneID:9122648"
     CDS             complement(135163..136272)
                     /locus_tag="ECL_RS00675"
                     /old_locus_tag="ECL_00137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007369504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 9 protein"
                     /protein_id="WP_013094905.1"
                     /db_xref="GeneID:9122648"
                     /translation="MSYVFLLILLLPVKLIRKLFRKDTGKNLVIQTAKIGDFVNATPL
                     LAYLQKSDVLISRSVGALAKHDETIEEIFFIEQHKRSLWRKLSFACRIMNRYDNVYLL
                     QPNSVNLFFAAVCNAKNKQFLSIYTRRWYHGIFYLTADGTVEHGKKTLSVTNYLKLAD
                     RSLTWQDSPKHATKPLFKPATYPAILDKPDVIRIGISIAAGNKAKTVPPVIWKRIIDR
                     LADLPCEFYVFGAPDEQSWLDDITRAYGDIPNVVNLIGKIPLEDLPWAISRMDCYIAS
                     DSGNVYIADAVDVPVVLLFGPCCHYEQRPLGNVMLIGNDDNICSYVFETKYYFSQDRE
                     ELFAVTDESLNELERFICALPKATATPYTFDALGN"
     gene            complement(136276..137259)
                     /gene="rfaC"
                     /locus_tag="ECL_RS00680"
                     /old_locus_tag="ECL_00138"
                     /db_xref="GeneID:9122649"
     CDS             complement(136276..137259)
                     /gene="rfaC"
                     /locus_tag="ECL_RS00680"
                     /old_locus_tag="ECL_00138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006812408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide heptosyltransferase RfaC"
                     /protein_id="WP_013094906.1"
                     /db_xref="GeneID:9122649"
                     /translation="MRVLIVKTSSMGDVLHTLPSLTDAMRAIPGIRFDWVVEEGFAQI
                     PTWHEAVDRVIPVAIRRWRKAWFSTPIKAERKAFRDAVQAQRYDSIIDAQGLVKSAAL
                     VTRLAHGVKHGMDWQTAREPLASLFYNRRHHIAKQQHAVERTRELFAKSLGYTKPETQ
                     GDYAISQHFLRDAEKPAQPWLVFLHATTRDDKHWPETHWRRLIELMQPAGIHIKLPWG
                     AEHERQRAERLAAGFSHVEVLPKLTLAQVAAELAGAKAVVSVDTGLSHLTAALDRPNI
                     TIFGPTDPGLIGGYGKNQHQMVSPTQQTRDISADAIFSFLQDSHWLSDRDI"
     gene            complement(137263..138309)
                     /gene="rfaF"
                     /locus_tag="ECL_RS00685"
                     /old_locus_tag="ECL_00139"
                     /db_xref="GeneID:9122650"
     CDS             complement(137263..138309)
                     /gene="rfaF"
                     /locus_tag="ECL_RS00685"
                     /old_locus_tag="ECL_00139"
                     /EC_number="2.4.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014881998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase RfaF"
                     /protein_id="WP_013094907.1"
                     /db_xref="GeneID:9122650"
                     /translation="MRILVIGPSWVGDMMMSQSLYRTLKARYPQAIIDVMAPAWCRPL
                     LSRMPEVNEAIPMPLGHGALEIGERRKLGHSLREKRYDRAYVLPNSFKSALVPFFAGV
                     PHRTGWRGEMRYGLLNDARVLDKEAWPLMVERYVALAYDKGVMRSAKDLPQPLLWPQL
                     QVSEGEKSQTCNAFGLSSERPMIGFCPGAEFGPAKRWPHYHYAELAKQLIDEGYQIVL
                     FGSAKDHEAGNEILAALSTEQQAWCRNLAGETQLEQAVILLAACKAVVTNDSGLMHVA
                     AALNRPLVALYGPSSPDFTPPLSNKARVIRLITGYHKVRKGDAAQGYHQSLIDITPQR
                     VLEELNELLLSEEG"
     gene            complement(138312..139244)
                     /gene="rfaD"
                     /locus_tag="ECL_RS00690"
                     /old_locus_tag="ECL_00140"
                     /db_xref="GeneID:9122651"
     CDS             complement(138312..139244)
                     /gene="rfaD"
                     /locus_tag="ECL_RS00690"
                     /old_locus_tag="ECL_00140"
                     /EC_number="5.1.3.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020233050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-glyceromanno-heptose 6-epimerase"
                     /protein_id="WP_013094908.1"
                     /db_xref="GeneID:9122651"
                     /translation="MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVD
                     LNIADYMDKEDFLIQIMAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLH
                     YCLEREIPFLYASSAATYGGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQVLPEANS
                     QIVGFRYFNVYGPREGHKGSMASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVA
                     AVNLWFWENGVSGIFNLGTGRAESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFT
                     QADLTNLRAAGYDKPFKTVAEGVTEYMAWLNRDA"
     gene            139460..140656
                     /gene="kbl"
                     /locus_tag="ECL_RS00695"
                     /old_locus_tag="ECL_00141"
                     /db_xref="GeneID:9122652"
     CDS             139460..140656
                     /gene="kbl"
                     /locus_tag="ECL_RS00695"
                     /old_locus_tag="ECL_00141"
                     /EC_number="2.3.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020239151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine C-acetyltransferase"
                     /protein_id="WP_013094909.1"
                     /db_xref="GeneID:9122652"
                     /translation="MRGDFYKQLNSDLETARAEGLFKEERIITSAQQADITVADGSHV
                     INFCANNYLGLANHPELIAAAKSGMDTHGFGMASVRFICGTQDSHKQLEKKLANFLGM
                     EDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMVE
                     LEARLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFV
                     GENGRGSHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNS
                     LAPAIVAASIKVLEMVESGAELRDRLWSNARLFREKMSAAGFTLAGADHAIIPVMLGD
                     AVVAQNFARELQKEGIYVTGFFFPVVPKGQARIRTQMSAAHSPEQIERAVEAFTRIGK
                     QLGVIA"
     gene            140666..141694
                     /gene="tdh"
                     /locus_tag="ECL_RS00700"
                     /old_locus_tag="ECL_00142"
                     /db_xref="GeneID:9122653"
     CDS             140666..141694
                     /gene="tdh"
                     /locus_tag="ECL_RS00700"
                     /old_locus_tag="ECL_00142"
                     /EC_number="1.1.1.103"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006177738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="WP_013094910.1"
                     /db_xref="GeneID:9122653"
                     /translation="MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHI
                     YNWDQWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFNIGDRVSGEGHITCGHCRNCRGG
                     RTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSF
                     DLVGEDVLVSGAGPIGIMAAAVAKHVGARNVVITDVNEYRLSLARKMGVTRAVDVSKE
                     SLADVMEELGMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKV
                     IFKGLFIKGIYGREMFETWYKMAALIQSGLDLSPIITHRFSVDDFQKGFDAMRSGQSG
                     KVILSWDK"
     gene            complement(141723..>142463)
                     /locus_tag="ECL_RS00705"
                     /old_locus_tag="ECL_00143"
                     /pseudo
                     /db_xref="GeneID:9122654"
     CDS             complement(141723..>142463)
                     /locus_tag="ECL_RS00705"
                     /old_locus_tag="ECL_00143"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882674.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:9122654"
     gene            complement(142501..143736)
                     /locus_tag="ECL_RS00710"
                     /old_locus_tag="ECL_00144"
                     /pseudo
                     /db_xref="GeneID:9122655"
     CDS             complement(142501..143736)
                     /locus_tag="ECL_RS00710"
                     /old_locus_tag="ECL_00144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611734.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /db_xref="GeneID:9122655"
     gene            complement(<143801..143989)
                     /locus_tag="ECL_RS00715"
                     /old_locus_tag="ECL_00146"
                     /pseudo
                     /db_xref="GeneID:9122657"
     CDS             complement(<143801..143989)
                     /locus_tag="ECL_RS00715"
                     /old_locus_tag="ECL_00146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882674.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:9122657"
     gene            complement(144005..145210)
                     /locus_tag="ECL_RS00720"
                     /old_locus_tag="ECL_00147"
                     /db_xref="GeneID:9122658"
     CDS             complement(144005..145210)
                     /locus_tag="ECL_RS00720"
                     /old_locus_tag="ECL_00147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_044159585.1"
                     /db_xref="GeneID:9122658"
                     /translation="MPQKRKILLLDTGKEWGGGTNSMLELLKRIDRDKFDITCCFYND
                     YSRAGGQTIGQVLNSIGIPLIVIPQHKQPAWAKLLKEAGRGLLFFSRNARKAFTRHVD
                     TLWRIRPNVSKIETLFSHGGFDTLYMNNQPGSNEEGYLAAAKLQARLIQHCRIEPVLS
                     PPLVKLVNAHATKIIAVSHGVEQVLLQHGIRPDLCTTVNNAIDIYQPLPDRRAMRQRL
                     GIDDETFVFGSIGSLIPRKANHHTLEALAQFSLKHPEAKWKMVLVGEGPERDALAAQA
                     QNLGIASHVIFTGFQNTPFDYLATFDAFILASKSEGLPRVVLEAMLLNIPVIGSQVTG
                     TAELIDHASTGLLFPWSDVSQLAQHLDSIWTDADLRARLATAARQNVCRNYAIEKYVS
                     GVEAVLGAQ"
     gene            145417..146217
                     /locus_tag="ECL_RS00725"
                     /db_xref="GeneID:44145306"
     CDS             145417..146217
                     /locus_tag="ECL_RS00725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008502710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_045901902.1"
                     /db_xref="GeneID:44145306"
                     /translation="MFKITVCLLTFNSERLLRDVIPPLLKIADEIVIVDSGSTDNTLH
                     ICQSYGLSPVYKKYGWHGEQMNHAVSLASHDWVLCIDSDEILDSDTVDAILKLKRSDE
                     PDPGMAWRICRHWYVLGEKVRTLYPVSSPDFPVRLFNRKQARFNNRPVDDKVEGFRHS
                     ERIPGYVRHDTFHTLHELFSKLNGYTTRLVQYQTIRPSICRGVISAIGAFFKWYLFSG
                     AWRQGRVGAATGLYATAYSFLKYFKAWYQYQERKEPVTKEHTDSHITE"
     gene            complement(146229..147161)
                     /locus_tag="ECL_RS00730"
                     /old_locus_tag="ECL_00150"
                     /db_xref="GeneID:9122661"
     CDS             complement(146229..147161)
                     /locus_tag="ECL_RS00730"
                     /old_locus_tag="ECL_00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017693955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divergent polysaccharide deacetylase family
                     protein"
                     /protein_id="WP_013094917.1"
                     /db_xref="GeneID:9122661"
                     /translation="MLQFRRIVLSVASALALVAPVYAGKLAIVIDDFGYRPHYENQVL
                     AMPAAISVAVLPNAPHAREMATKAHNSGHQVLIHLPMAPISKQPLEKDTLRPEMSSDE
                     IDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYGMLKVMQALERYNLYFLDSMTIGNSQA
                     MRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQLARRNGSAIAIGHPHPSTVRVL
                     QQMLPTLPSDITLVRPSDLLNEPQVDTSTPNQGKPGSSTPRNPFRGVKRCVPKHAPEP
                     VYATRFFSVIGESMSQSTLVQYFQHQWQGWGKKA"
     gene            complement(147165..148448)
                     /gene="envC"
                     /locus_tag="ECL_RS00735"
                     /old_locus_tag="ECL_00151"
                     /db_xref="GeneID:9122662"
     CDS             complement(147165..148448)
                     /gene="envC"
                     /locus_tag="ECL_RS00735"
                     /old_locus_tag="ECL_00151"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein hydrolase activator EnvC"
                     /protein_id="WP_013094918.1"
                     /db_xref="GeneID:9122662"
                     /translation="MRGKAIFSITWVVKPLRLSVRPLFYASALSAGVLLCAASAHADD
                     RDQLKSIQADIAAKERAVRQQQQQRASLLAQLKQQEEAISAAARELRETQNTLSQLNK
                     QIDEMNASIAKLERQRDAQERNLAAQLDAAFRQGEHTGLQLILSGEESQRGQRLQAYF
                     GYLNQARQETIAQLKQTREEVTTQKAELEEKQSQQQTLLYEQQAQQAKLEQARNERKK
                     TLSGLESSIQAGQSQLSEMRANESKLRNSIARAEAAAKARAEKEAREAQAVRDKQQEA
                     SRKGTTYKPSESERSLMSRTGGLGSPRGQAYWPVRGTILHRYGEQLQGELRWKGIVIG
                     ASEGSEVKAIADGRVILADWLQGYGLVVVVEHGKGDMSLYGYNQSALVSVGTQVRAGQ
                     PIALVGSSGGQGRPSLYFEIRRQGQAVNPQPWLGR"
     gene            complement(148458..150002)
                     /gene="gpmM"
                     /locus_tag="ECL_RS00740"
                     /old_locus_tag="ECL_00152"
                     /gene_synonym="pgmI"
                     /db_xref="GeneID:9122663"
     CDS             complement(148458..150002)
                     /gene="gpmM"
                     /locus_tag="ECL_RS00740"
                     /old_locus_tag="ECL_00152"
                     /gene_synonym="pgmI"
                     /EC_number="5.4.2.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="WP_013094919.1"
                     /db_xref="GeneID:9122663"
                     /translation="MSVSKKPMVLVILDGYGYREDQQDNAIFNAKTPVMDALWAKRPH
                     TLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKERTFFANPVLCGA
                     VDKAVAAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPR
                     SAKGSLEAFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEQAYDLMTLAKGEFQFAT
                     AVEGLEAAYARDENDEFVKATVIRAEGQADAAMEDGDALIFMNFRADRAREITRAFVN
                     SDFDGFARKKAVNINFIQLTEYAADIDAPCAYPPASLANTFGEWMAKNDKTQLRISET
                     EKYAHVTFFFNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIVSGKY
                     DTIICNYPNGDMVGHTGVMEAAIKAVEALDHCVEQVAKAVESVGGQLLITADHGNAEQ
                     MRDPATGQAHTAHTNLPVPLIYVGDKALKAVEGGKLSDVAPTMLSLMGMPIPEEMTGK
                     PLFIVE"
     gene            150251..150682
                     /locus_tag="ECL_RS00745"
                     /old_locus_tag="ECL_00153"
                     /db_xref="GeneID:9122664"
     CDS             150251..150682
                     /locus_tag="ECL_RS00745"
                     /old_locus_tag="ECL_00153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-like domain-containing protein"
                     /protein_id="WP_013094920.1"
                     /db_xref="GeneID:9122664"
                     /translation="MQEIMQFVSRHPVLSIAWIGLLAAVLFTTFKGLTSKIKVITRGE
                     ATRLINKEDAVVVDLRQRDDFRKGHIAGAINLLPAEIKANNVGELEKHKAQPIIVVDG
                     TGMQAQESASLLHKAGFENVSVLKEGISGWSGENLPLVRGK"
     gene            150694..150945
                     /gene="grxC"
                     /locus_tag="ECL_RS00750"
                     /old_locus_tag="ECL_00154"
                     /db_xref="GeneID:9122665"
     CDS             150694..150945
                     /gene="grxC"
                     /locus_tag="ECL_RS00750"
                     /old_locus_tag="ECL_00154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016538905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin 3"
                     /protein_id="WP_010426371.1"
                     /db_xref="GeneID:9122665"
                     /translation="MANIEIYTKATCPFCHRAKALLNSKGVTFQELPIDGDAIKREEM
                     IQRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLS"
     gene            150979..151446
                     /gene="secB"
                     /locus_tag="ECL_RS00755"
                     /old_locus_tag="ECL_00155"
                     /db_xref="GeneID:9122666"
     CDS             150979..151446
                     /gene="secB"
                     /locus_tag="ECL_RS00755"
                     /old_locus_tag="ECL_00155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-export chaperone SecB"
                     /protein_id="WP_003860835.1"
                     /db_xref="GeneID:9122666"
                     /translation="MSEQNNTEMTFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDL
                     DTASTQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIGGIEGNQMAHCLGAYC
                     PNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGAEQHQDA"
     gene            151446..152465
                     /gene="gpsA"
                     /locus_tag="ECL_RS00760"
                     /old_locus_tag="ECL_00156"
                     /db_xref="GeneID:9122667"
     CDS             151446..152465
                     /gene="gpsA"
                     /locus_tag="ECL_RS00760"
                     /old_locus_tag="ECL_00156"
                     /EC_number="1.1.1.94"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase"
                     /protein_id="WP_013094921.1"
                     /db_xref="GeneID:9122667"
                     /translation="MSTVNASMTVIGAGSYGTALAITLARNGHEVVLWGHDPKHIATL
                     QHDRCNVAFLPDVPFPDSLHLESDLATALAASRNILIVVPSHVFGDVLQQIKPLMRPD
                     ARIVWATKGLEAETGRLLQDVAREVLGTEIPLAVISGPTFAKELAAGLPTAISLASTD
                     QAFSDDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTAL
                     ITRGLTEMSRLGAALGADPATFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVKGA
                     QEKIGQVVEGYRNTKEVRELAHRFGVEMPITEEIYQVLYCGKNAREAALTLLGRARKD
                     ERSSN"
     gene            152541..153362
                     /gene="cysE"
                     /locus_tag="ECL_RS00765"
                     /old_locus_tag="ECL_00157"
                     /db_xref="GeneID:9122668"
     CDS             152541..153362
                     /gene="cysE"
                     /locus_tag="ECL_RS00765"
                     /old_locus_tag="ECL_00157"
                     /EC_number="2.3.1.30"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001112113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="WP_013094922.1"
                     /db_xref="GeneID:9122668"
                     /translation="MPCEELDIVWNNIKAEARALADCEPMLASFYHATLLKHENLGSA
                     LSYMLANKLASSIMPAIAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPL
                     LYLKGFHALQAYRIGHWLWKEGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHAT
                     GIVVGETAVIEDDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGA
                     KIGAGSVVLQPVPPHTTAAGVPARIVGKPDSDKPSMDMDQHFNGIHHTFEYGDGI"
     gene            complement(153359..153832)
                     /gene="trmL"
                     /locus_tag="ECL_RS00770"
                     /old_locus_tag="ECL_00158"
                     /db_xref="GeneID:9122669"
     CDS             complement(153359..153832)
                     /gene="trmL"
                     /locus_tag="ECL_RS00770"
                     /old_locus_tag="ECL_00158"
                     /EC_number="2.1.1.-"
                     /EC_number="2.1.1.207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (uridine(34)/cytosine(34)/5-
                     carboxymethylaminomethyluridine(34)-2'-O)-
                     methyltransferase TrmL"
                     /protein_id="WP_013094923.1"
                     /db_xref="GeneID:9122669"
                     /translation="MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRL
                     RRAGLDYHEFTAVVRHHDYAAFLESEKPERMFALTTKGTPAHSAVSYQAGDYLMFGPE
                     TRGLPATILDALPAEQKIRIPMMPDSRSMNLSNAVSVVVYEAWRQLGYPGAILRS"
     gene            complement(153878..155218)
                     /locus_tag="ECL_RS00775"
                     /old_locus_tag="ECL_00159"
                     /db_xref="GeneID:9122670"
     CDS             complement(153878..155218)
                     /locus_tag="ECL_RS00775"
                     /old_locus_tag="ECL_00159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017382575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic acid/H+ symport family MFS transporter"
                     /protein_id="WP_013094924.1"
                     /db_xref="GeneID:9122670"
                     /translation="MAYSGKVDIQQVIDDSSFSWFHWLLIVLGFLVLAIDGFDTAAMG
                     YIAPTLSAEWGIHKQDLGPVLSAALLGLSLGALIAGPVSDRMGRKRVLVFSCLFFGLA
                     SLGAAWAQTLNTLTLWRFLTGLGLGAAMPNAITLISEFAPKRCRAMAINTMYCGFPLG
                     AAGGGAISSWLIPHHGWRSVLLTGAIAPLILTLLLALFLPESVKFLVQRGRDMMQIRR
                     IASRFARDTLDGVTGFFLAEERVASKKGSVAQLFSMPWLPGTLMLWVTYFMGLVIYYV
                     LLSWMPTLMLGMGYPLAESAWLTSLFTFGGTAGILLAGWMMDRWEAHRVVAGGFMLTM
                     ALILLLGMEHNHIALFGGLIFLMGIAMNGAQSGMQTLAATFYPTECRATGIAWMQGIG
                     RFGGVAGTMTSAQLLSMQWQADSILMILSLPALVAAGATVYKMLRCRPQEPGVA"
     gene            complement(155400..156587)
                     /gene="lldD"
                     /locus_tag="ECL_RS00780"
                     /old_locus_tag="ECL_00160"
                     /db_xref="GeneID:9122671"
     CDS             complement(155400..156587)
                     /gene="lldD"
                     /locus_tag="ECL_RS00780"
                     /old_locus_tag="ECL_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent L-lactate dehydrogenase LldD"
                     /protein_id="WP_013094925.1"
                     /db_xref="GeneID:9122671"
                     /translation="MIISAASDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNVEDLSE
                     VALRQRVLKNMSDLSLETKLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIP
                     FTLSTVSVCPIEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPT
                     PGARYRDAHSGMSGPNAAMRRYWQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLE
                     DYIGWLANNFDPSISWKDLEWIREFWDGPMVIKGILDPDDARDAVRFGADGIVVSNHG
                     GRQLDGVLSSARALPAIADAVKGDIAILADSGIRNGLDVVRMIALGADSVLLGRAYLY
                     ALATSGQAGVANLLNLIEKEMKVAMTLTGAKTIGEISKDSLVQELSKIPAALAPLTHG
                     DAA"
     gene            complement(156584..157357)
                     /gene="lldR"
                     /locus_tag="ECL_RS00785"
                     /old_locus_tag="ECL_00161"
                     /db_xref="GeneID:9122672"
     CDS             complement(156584..157357)
                     /gene="lldR"
                     /locus_tag="ECL_RS00785"
                     /old_locus_tag="ECL_00161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator LldR"
                     /protein_id="WP_020686511.1"
                     /db_xref="GeneID:9122672"
                     /translation="MIVMPRRLSDEIASRVRALIEEQQLEAGMKLPAERQLAAQLGVS
                     RNSLREALATLVSEGVLVSRRGGGTFVRWQHDDWSEQNIVQPLKTLMENDPDYSFDIL
                     EARHAIETSTAWHAAMRATEADKEKLRACFDATQSSDPDIASQADVRFHLAIAEASHN
                     VVLLQTMRGFFDLLQSSVKQSRQRMYLVPPVFAQLTEQHEAVLNAILAGDAEAARKAM
                     MAHLGFVHTTIKRFDEDQARQARITRLPGDSDISRENKA"
     gene            complement(157354..159009)
                     /gene="lldP"
                     /locus_tag="ECL_RS00790"
                     /old_locus_tag="ECL_00162"
                     /db_xref="GeneID:9122673"
     CDS             complement(157354..159009)
                     /gene="lldP"
                     /locus_tag="ECL_RS00790"
                     /old_locus_tag="ECL_00162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="WP_013094927.1"
                     /db_xref="GeneID:9122673"
                     /translation="MSLWQQNYDPAGNIWLSSLIASLPILFFFFALIKLKLKGYLAAT
                     YTVAIALLVALFFYKMPIDRALASVVYGFFYGLWPIAWIIIAAVFVYKISVKTGQFDI
                     IRSSILSITPDQRLQMLIVGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLC
                     LIVNTAPVAFGAMGIPILVAGQVTGLDSFEIGQMVGRQLPFLTIIVLFWIMAIMDGWR
                     GVKETWPAVMVAGGSFAIAQYLSSNFLGPELPDIISSLVSLVCLTLFLKRWQPVRIFR
                     FADMGASHVDQTLARTGYTAGQIVRAWSPFLFLTATVTLWSIPPFKALFAPGGALYDM
                     VINISVPFLDKMVARMPPVVHDATPYAAVFKFDWFSATGTAILFAALLSVVWLRMKSA
                     AAVQTFAATIKELMLPIYSIGMVLAFAFISNYSGLSSTLALALAHTGHAFTFFSPFLG
                     WLGVFLTGSDTSSNALFAALQATAAQQIGVSDVLLVAANTTGGVTGKMISPQSIAIAC
                     AAVGLVGKESDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP"
     gene            complement(159287..160753)
                     /locus_tag="ECL_RS00795"
                     /old_locus_tag="ECL_00163"
                     /db_xref="GeneID:9122674"
     CDS             complement(159287..160753)
                     /locus_tag="ECL_RS00795"
                     /old_locus_tag="ECL_00163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004158503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3320 domain-containing protein"
                     /protein_id="WP_052429246.1"
                     /db_xref="GeneID:9122674"
                     /translation="MLYLIVGAGQGVATFSVSQRKAIQDELEILRRLNPQYEDFFNSH
                     PAEPFFIKNLENIQGDERDVIMISVGYARNKQGYLAMRFGPLGSQGGERRLNVLISRA
                     KRRCEVFASITDEDIDLERAKGVGVLAFKLFLQYARTGRLSMSTVSGRPMDSVFEEQV
                     ASALQKRGYQVHPQVGIAGFFIDLAIADPDLPGRYLLGIECDGSAYHSSRSARERDRL
                     RQAVLEDHGWIIHRIWSTDWFQRPEEQLQKVIYAIENAKRELNNRAEHTYGRSRAVPV
                     DIVTVEREDVVEIGLDRTDSANDQSIIYEEAQPEANLSYALHETPTGILADMVEKIVF
                     TESPIHLNEVITRLRSAWGLQRAGARIESVVSQAAQIACKRGKIYKEQEFFIHKEVAI
                     RIRNRQHVLSAGVRKPELIAPIEIASGVFDIVSASLGATEDEIITSVSRMLGFKSTSS
                     LLRKVISEVIEQEIKDNRLKQQDGLIVIGDASSAQKAI"
     gene            complement(160754..161874)
                     /locus_tag="ECL_RS00800"
                     /old_locus_tag="ECL_00164"
                     /db_xref="GeneID:9122675"
     CDS             complement(join(160754..161616,161616..161874))
                     /locus_tag="ECL_RS00800"
                     /old_locus_tag="ECL_00164"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611474.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISSen4 family transposase"
                     /protein_id="WP_144340281.1"
                     /db_xref="GeneID:9122675"
                     /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKY
                     GSMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKLLTTDQKREAVMLMCD
                     ATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITELALERRRFGYRRIWQLLRR
                     EGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMDALST
                     GRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTC
                     RALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKIINDW
                     RQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
     gene            complement(162035..162397)
                     /locus_tag="ECL_RS00805"
                     /pseudo
                     /db_xref="GeneID:44145307"
     CDS             complement(162035..162397)
                     /locus_tag="ECL_RS00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312505.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="YibL family ribosome-associated protein"
                     /db_xref="GeneID:44145307"
     gene            complement(162456..163046)
                     /locus_tag="ECL_RS00810"
                     /old_locus_tag="ECL_00168"
                     /db_xref="GeneID:9122679"
     CDS             complement(162456..163046)
                     /locus_tag="ECL_RS00810"
                     /old_locus_tag="ECL_00168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MltR family transcriptional regulator"
                     /protein_id="WP_013094931.1"
                     /db_xref="GeneID:9122679"
                     /translation="MMHSEAQVILRPDYRLSDMQAIMEQTQAFENRVLERLNAGKTVR
                     SFLITAVELLTEAVNILVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGV
                     LNRQEYEDAELLMALREELNHDGNEYTFTDDEILGPFGELHCVTALPPAPHFDNSDPE
                     LYAMQKLRYQQVVRSTMVLSLTELISRISLKKAFQK"
     gene            complement(163043..164191)
                     /gene="mtlD"
                     /locus_tag="ECL_RS00815"
                     /old_locus_tag="ECL_00169"
                     /db_xref="GeneID:9122680"
     CDS             complement(163043..164191)
                     /gene="mtlD"
                     /locus_tag="ECL_RS00815"
                     /old_locus_tag="ECL_00169"
                     /EC_number="1.1.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol-1-phosphate 5-dehydrogenase"
                     /protein_id="WP_013094932.1"
                     /db_xref="GeneID:9122680"
                     /translation="MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARH
                     SYQVHVVGENEQVETVSGVNAVSSIGDDVIDLIASVDLVTTAVGPVVLERIAPAVAKG
                     LAKRKAQGIDTPLNIIACENMVRGTTQLKGHVLAAVADEDKAWVEAHVGFVDSAVDRI
                     VPPSESATNDPLEVTVETFSEWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNT
                     GHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQK
                     ILGRFENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHY
                     RSEQDPQAQELAQLIDDQGAQAALAQISGLDANSDVVAEAVNAYNATK"
     gene            complement(164292..166199)
                     /locus_tag="ECL_RS00820"
                     /old_locus_tag="ECL_00170"
                     /db_xref="GeneID:9122681"
     CDS             complement(164292..166199)
                     /locus_tag="ECL_RS00820"
                     /old_locus_tag="ECL_00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannitol transporter subunit IICBA"
                     /protein_id="WP_013094933.1"
                     /db_xref="GeneID:9122681"
                     /translation="MSSDFKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLP
                     NETLAKLVGPMITYLLPLLIGYTGGRLVGGDRGGVVGAITTMGVIVGADMPMFLGAMI
                     AGPLGGWAIKKFDVWVDGKIKSGFEMLVNNFSAGIIGMILAILAFLGIGPAVEVLSKI
                     LAAGVNFMVAHDMLPLASIFVEPAKILFLNNAINHGIFSPLGIQQSHDLGKSIFFLIE
                     ANPGPGMGVLLAYMFFGRGSAKQSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILG
                     GMTGVFTLSVLNGGLVSPASPGSILAVLAMTPKGAYFANIAAICAAMAVSFVVASILL
                     KTSKVKEDDDIEAATRRMHDMKAESKGATPLSAGDVSNDLSHVRKIIVACDAGMGSSA
                     MGAGVLRKKVQDAGLTNISVTNSAINSLPPDVDLVITHRDLTERAMRQVPQAQHISLT
                     NFLDSGLYTSLTERLVAAQRHEDNEVKVRTSLQDSFDESNAHLFKLGAENIFLGRTAS
                     TKEEAIRFAGEQLVKGGYVQPEYVDAMLEREKLTPTYLGESIAVPHGTVEAKDRVLKT
                     GVVFCQYPDGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAQTE
                     SVEEVLALLNK"
     gene            166859..167215
                     /locus_tag="ECL_RS00825"
                     /old_locus_tag="ECL_00172"
                     /db_xref="GeneID:9122683"
     CDS             166859..167215
                     /locus_tag="ECL_RS00825"
                     /old_locus_tag="ECL_00172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008502729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3302 domain-containing protein"
                     /protein_id="WP_013094935.1"
                     /db_xref="GeneID:9122683"
                     /translation="MFLNYFALGVLIFVFLVLFYGIIAIHDIPYNMAKKRNHPHADAI
                     HTAGWISLFTLHAIWPFLWIWATLYREDRGWGMQNHITKPDEVPGMDALAKRVAELEQ
                     KLAAVQPTADTKTLER"
     gene            167218..168354
                     /locus_tag="ECL_RS00830"
                     /old_locus_tag="ECL_00173"
                     /db_xref="GeneID:9122684"
     CDS             167218..168354
                     /locus_tag="ECL_RS00830"
                     /old_locus_tag="ECL_00173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_013094936.1"
                     /db_xref="GeneID:9122684"
                     /translation="MDLLIILTYVAFAWAIFKIFRIPVNQWTLATATLGGVFIVAGLI
                     LLMNYNHPYTFTAQKAVISIPITPQVTGVVSEVTDKNNQLIKKGEVLFKLDPGRYQAR
                     VDRLQADLVTATHNIDVLKAQLSEAVANTTRVSAERDRLYKDYQRYLKGSQAKVNPFS
                     ESDIDNARQNYLAQDALVKGSVAEQTQIKSQLDSMVNGEQSQIASLRAQLAEAKYNLD
                     QTVVRAPSNGYITQVLIRPGTYAAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGD
                     EAEVVFNALPGQVFSGKLTSILPVVPGGSYQAQGALQSLTVTPGTDGVQALIELEPNA
                     DVDALPDGIYAQVAVYSDHFAHVSVMRKVLLRMTSWMHYLYLDH"
     gene            168444..169052
                     /locus_tag="ECL_RS00835"
                     /old_locus_tag="ECL_00174"
                     /db_xref="GeneID:9122685"
     CDS             168444..169052
                     /locus_tag="ECL_RS00835"
                     /old_locus_tag="ECL_00174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_013094937.1"
                     /db_xref="GeneID:9122685"
                     /translation="MKLIGSYTSPFVRKISILLLEKGIEFEFVNEQPYNAENGVAQYN
                     PLGKVPALVTDEGEYWFDSPIIAEYIELLGVAPAMLPADPKAALAVKQIEALADGIMD
                     AALTSVREQARPVAQQSETELLRQREKISRSLDRCEQLIQEGKIATDSLNLATIAIAC
                     AIGYLNFRRVSPGWCVDRPLLVKLAETLFQRESFARTEPPKA"
     gene            169156..170541
                     /gene="selA"
                     /locus_tag="ECL_RS00840"
                     /old_locus_tag="ECL_00175"
                     /db_xref="GeneID:9122686"
     CDS             169156..170541
                     /gene="selA"
                     /locus_tag="ECL_RS00840"
                     /old_locus_tag="ECL_00175"
                     /EC_number="2.9.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-seryl-tRNA(Sec) selenium transferase"
                     /protein_id="WP_013094938.1"
                     /db_xref="GeneID:9122686"
                     /translation="MTTHHSLYSQIPATDRLLREPLIHSAVERFGHTATVEMLRLLQD
                     EARRHIQAENALPGWCVAWEQELEQRLVDKGQSALRPVINLTGTVLHTNLGRAQQAEE
                     AVDAVTQAMRSPVTLEYDLDGAGRGHRDRALADLLCQLTGAEDACIVNNNAAAVLLML
                     AATASGKEVVVSRGELVEIGGAFRIPDVMRQAGCTLHEVGTTNRTHAKDYRAAVNENT
                     ALLMKVHTSNYHIEGFTKAVEEAELAAIGQELNVPVVADLGSGSLVDLSQYGLPKEPM
                     VQEMIAAGVSLVSFSGDKLLGGPQAGIIVGKRELIAKLQQHPLKRALRADKMTLAALD
                     ATLRLYLHPEKLAERLPTLRLLTRDAASIRAQAELLLPNVASHYADFDVRIESCQSQI
                     GSGSLPVDRLPSAALTFTPRDGRGSRLDALSTRWRALPTPVIGRIYDGRMWLDLRCLE
                     DEERFLEMLLK"
     gene            170538..172385
                     /gene="selB"
                     /locus_tag="ECL_RS00845"
                     /old_locus_tag="ECL_00176"
                     /db_xref="GeneID:9122687"
     CDS             170538..172385
                     /gene="selB"
                     /locus_tag="ECL_RS00845"
                     /old_locus_tag="ECL_00176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine-specific translation elongation
                     factor"
                     /protein_id="WP_013094939.1"
                     /db_xref="GeneID:9122687"
                     /translation="MIIATAGHVDHGKTTLLQAITGVNADRLPEEKKRGMTIDLGYAY
                     WPQPDGRVLGFIDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVMAQTREHLAILQLT
                     GNPQLTVALTKADRVDATRINEVREAVQATLREYGFTDAALFETVATEGRGIDALRHH
                     LQQLSSREHASHHRFRLAIDRAFTVKGAGLVVTGTALSGEVKVGDTVWLTGINKPMRV
                     RGLHAQNQPVDHAHAGQRIALNIAGDAEKAQLNRGDWLLSEAPPEPSERVIVSLQTHI
                     PLSQWQPLHIHHAASHITGRVSLLENDLAELVFDTPLWLADNDRLVLRDISARETLAG
                     ARVVTLNPPRRGKRKPEYLQWLSALAQASNDKAALEVHLERGAVNLTDFAWARQLSNE
                     GLLPLTQQPGFIQAGNNLLNAPVAACWQRKVLNTLATYHEQHQDEPGPGRERLRRMAL
                     PMEDDALVLLLIENMRESGVIKSHHGWLHLPDHKAGFTAEQEAIWQKAAPLFGDEPWW
                     VRDLARETNTDEQVMRQVLRHAAQQGLIVAIVKDRYYRNDRIVAFASLIRELDQARGS
                     TCAADFRDRLNVGRKLAIQILEYFNRIGFTRRRGNDHLLRDSLLFPETA"
     gene            172472..174010
                     /locus_tag="ECL_RS00850"
                     /old_locus_tag="ECL_00177"
                     /db_xref="GeneID:9122688"
     CDS             172472..174010
                     /locus_tag="ECL_RS00850"
                     /old_locus_tag="ECL_00177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001551836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_013094940.1"
                     /db_xref="GeneID:9122688"
                     /translation="MTNNPPSSRIQPGEYGFPLKLKPRYDNFIGGDWVAPVDGEYYSN
                     LTPVTGQPLCEIASSGKRDIDLALDAAHKAKDKWGQTSVQDRAAILFKIADRMEQNLE
                     LLATAETWDNGKPIRETMAADVPLAIDHFRYFASCIRAQEGGISEVDSDTVAYHFHEP
                     LGVVGQIIPWNFPLLMASWKMAPALAAGNCIVLKPARLTPLSVLLLMDIIGDLLPPGV
                     INVVNGAGGEIGEYLATSKRIAKVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNI
                     FFEDVMAEEDAFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERFMERAIRRVESI
                     RSGNPLDNVTQMGAQVSHGQLETILNYIDIGKKEGADVLTGGRRKVLGGDLQEGYYLE
                     PTILSGKNNMRVFQEEIFGPVLAVTTFKTLEEALEIANDTPYGLGAGVWSRNGNLAYK
                     MGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLEHYQQTKCLLVSYSDKP
                     LGLF"
     gene            complement(174007..174972)
                     /locus_tag="ECL_RS00855"
                     /old_locus_tag="ECL_00178"
                     /db_xref="GeneID:9122689"
     CDS             complement(174007..174972)
                     /locus_tag="ECL_RS00855"
                     /old_locus_tag="ECL_00178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013094941.1"
                     /db_xref="GeneID:9122689"
                     /translation="MMNKLQLKPRELKIISVIAATHSIGDAAALLGMAQANVSKYLSD
                     FETRVGLKVFERTTRQLALTQFGEALLPYVNATLDKNSQLINFIADYKHEKRGKVTIY
                     APTGIVTYLSRHVIHQIKDIGDIRISLKTYNLDRNEFSEGVTFPDDCDILITYAQPKD
                     ESLVASVLTQYSVTAFATEEYLNQHPLNGPEDLIHHSCILIDSMLVDDANIWRFRVHG
                     SDDVQDYRVTGNYISDNTQTALELARNNLGIVFAPKESLRKELKNGSLVPCFPHQEEW
                     WLDLTAIFRKREYQPWRVQYVLDGVLNNLRQQIAQAAHGRPELDD"
     gene            175090..175830
                     /locus_tag="ECL_RS00860"
                     /old_locus_tag="ECL_00179"
                     /db_xref="GeneID:9122690"
     CDS             175090..175830
                     /locus_tag="ECL_RS00860"
                     /old_locus_tag="ECL_00179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MipA/OmpV family protein"
                     /protein_id="WP_013094942.1"
                     /db_xref="GeneID:9122690"
                     /translation="MTIKNNLLIAATLFATSSAMAGDFSLGAGAVFNESPYKGYNENT
                     TAVPLISYEGDRFYVRQTTGGWILWKDEKNEFSLTASWMPLHFDPDDNDDPQMKHLDE
                     RKASAFLGGAYYRHENWGSLKVAVSGDAMDESGGVVGEISYFRPIRMERLTLTPSVGI
                     FYSDESYNDYYYGVSGSESRRSGLNEYAAGDSWTPYVGLAAKYQLTQNLFLNASAVYT
                     VLPDDVKNSPMIDRDDSFALMTGLSWRF"
     gene            176041..176226
                     /locus_tag="ECL_RS00865"
                     /db_xref="GeneID:44145308"
     CDS             176041..176226
                     /locus_tag="ECL_RS00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017382585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system HicA family
                     toxin"
                     /protein_id="WP_071843252.1"
                     /db_xref="GeneID:44145308"
                     /translation="MKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKD
                     IKPGTLAQIWRQAGIKH"
     gene            176241..176645
                     /locus_tag="ECL_RS00870"
                     /old_locus_tag="ECL_00180"
                     /db_xref="GeneID:9122691"
     CDS             176241..176645
                     /locus_tag="ECL_RS00870"
                     /old_locus_tag="ECL_00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system HicB family
                     antitoxin"
                     /protein_id="WP_013094943.1"
                     /db_xref="GeneID:9122691"
                     /translation="MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALT
                     AHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWLLVDINMKQFDGKAERINITLPR
                     RLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP"
     gene            complement(176699..178654)
                     /locus_tag="ECL_RS00875"
                     /old_locus_tag="ECL_00181"
                     /db_xref="GeneID:9122692"
     CDS             complement(176699..178654)
                     /locus_tag="ECL_RS00875"
                     /old_locus_tag="ECL_00181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007670781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 127 protein"
                     /protein_id="WP_013094944.1"
                     /db_xref="GeneID:9122692"
                     /translation="MSIMEADLHNLKINDPFLGQYQRLVRDVVIPYQWDALNDRVAEA
                     EPSHAITNFRIAAGLEEGEFYGMVFQDSDVAKWLEAVAWSLCQKPDAELEKTADEVIE
                     LIAAAQCEDGYLNTYFTVKAPDERWTNLAECHELYCAGHMIEAGVAYFQGTGKRRLLE
                     VVCKLADHIDTVFGPREGQLHGYPGHPEIELALMRLYDVTEEPRYLNLVKYFIEARGT
                     QPHFYDIEYEKRGRTSYWHTYGPAWMVKDKAYSQAHQPLAEQQTAIGHAVRFVYLMAG
                     MAHLARLSKDDAKRQDCLRLWSNMAQRQLYITGGIGSQSSGEAFSSDYDLPNDTVYAE
                     SCASIGLMMFARRMLEMEADSRYADVMERALYNTVLGGMALDGKHFFYVNPLEVHPRT
                     LAFNHIYDHVKPVRQRWFGCACCPPNIARVLTSLGHYIYTVRPDALFINLYVGNEVTI
                     PVGDETLKLRISGNYPWQEEVNIEIASPVPVTHTLALRLPDWCANPHVSLNGEGMTGE
                     VSRGYLHLTRRWQEGDTLTLTLPMPVRRVYGHPQVRQQAGKVALQRGPLVYCLEEADN
                     GANLHNLALPADSEFRVFEGKGIFAHKMLIQAEGVTHDAAEAGSEALWQYDRPAVQRQ
                     PKTLTFIPWFSWANRGEGEMRIWVDED"
     gene            complement(178665..180017)
                     /locus_tag="ECL_RS00880"
                     /old_locus_tag="ECL_00182"
                     /db_xref="GeneID:9122693"
     CDS             complement(178665..180017)
                     /locus_tag="ECL_RS00880"
                     /old_locus_tag="ECL_00182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004868866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013094945.1"
                     /db_xref="GeneID:9122693"
                     /translation="MTSTPITESDVAQRVREERLSVREKIGYGLGDAGGTVITCLIMN
                     FLTFFYTDIFGLTPALVGTLFIADRTQSRWGRFRPWQLWVAFPIGIIGVLTFTVPEAS
                     MGVKIAWAFGTYLLLSVGYTAINVPYCALINTMTTRHSEVISCQSWRFVLCGVAGFLV
                     SVGLPWLVAALGQGNAARGYQLGVGVLCTLAVVMFLCCFFWVRERVPLALMGKFTLRE
                     HLAGLRKNDQLLLMLVMSFLLINVFNIRGGGYMYFITYVLQGSTAYTSLFFTMVTFAA
                     ILGAVIVSPLSRRVDTVKLYYYTNLVLAAIAAGMWFLPGGPAHQTLWLIVILSNGVIL
                     GFTLPLHFSLMAFADDYGEWKTGVRSSGMNFAFNLFFIKLAWASSAGIISLVFIAVAY
                     QPGAGNQTPASLQGITAMETLLPALFHLLLAVSIRWCRLNNPMMSRIATDLRQRHVPS
                     "
     gene            180242..181060
                     /locus_tag="ECL_RS00885"
                     /old_locus_tag="ECL_00183"
                     /db_xref="GeneID:9122694"
     CDS             180242..181060
                     /locus_tag="ECL_RS00885"
                     /old_locus_tag="ECL_00183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006808609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_013094946.1"
                     /db_xref="GeneID:9122694"
                     /translation="MLELSIVLPIKVQNGGLFISRGVGRHPARKLTSWEIIFVEKGTL
                     TIQEENRLFEVKAGESLLLWPKRRHVGTEDFPADLRFYWLHFEVKPGPSALPEASPLT
                     IEQHCCVRDVPSVIALFRQFLSEQEKLQRSVALEMLLLLILQKISLSAGYEDRPDEAG
                     AALAWKAKQLIRTQFHLPLSTSLLAKSLHCNADYLGRVFRRTFHLTLTEAIHRQRVRA
                     AEKMLLNDSASLTEVATRCGFNDVGYFRQIFSKHTGLTPAVWKRRYCKEHINSG"
     gene            complement(181061..181756)
                     /gene="araD"
                     /locus_tag="ECL_RS00890"
                     /old_locus_tag="ECL_00184"
                     /db_xref="GeneID:9122695"
     CDS             complement(181061..181756)
                     /gene="araD"
                     /locus_tag="ECL_RS00890"
                     /old_locus_tag="ECL_00184"
                     /EC_number="5.1.3.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="WP_013094947.1"
                     /db_xref="GeneID:9122695"
                     /translation="MLEQLKAEVLAANLALPAHQLVTFTWGNVSAVDRDSGLMVIKPS
                     GVEYDVMTADDMVVVNIATGEVVEGSMKPSSDTPTHLALYRRYPEIGGIVHTHSRHAT
                     IWSQAGQDLPAWGTTHADYFYGAIPCTRRMTTAEIAGDYEYQTGEVIIKTFEERDISP
                     MQIPAVLVHSHGPFAWGKDAADAVHNAVVLEECAYMGLFSRQLAPQLPVMQQELLDKH
                     YLRKHGAHAYYGQ"
     gene            complement(181750..182610)
                     /locus_tag="ECL_RS00895"
                     /old_locus_tag="ECL_00185"
                     /db_xref="GeneID:9122696"
     CDS             complement(181750..182610)
                     /locus_tag="ECL_RS00895"
                     /old_locus_tag="ECL_00185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418039.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 3-epimerase"
                     /protein_id="WP_013094948.1"
                     /db_xref="GeneID:9122696"
                     /translation="MRQHPLGIYEKALPKSLTWPERLVLAKSCGFDFVEMSVDETDER
                     LSRLAWSTTQRASLVEAMLETGVSIPSMCLSAHRRFPFGSRDETVRARAREIMSSAIK
                     LARDLGIRTIQLAGYDVYYEEHDEGTRQRFAEGLAWAVEQAAAAQVMVAVEIMDTAFM
                     NSISKWKKWDEMLASPWFSVYPDVGNLSAWGNNVAAELTLGIDRIAAIHLKDTQPVTA
                     QSPGQFRDVPFGEGCVDFVGVFNTLNKLNYRGAFLIEMWTEKAKEPVLEIIQARRWIE
                     ARMQEGGMTC"
     gene            complement(182613..183266)
                     /gene="ulaD"
                     /locus_tag="ECL_RS00900"
                     /old_locus_tag="ECL_00186"
                     /db_xref="GeneID:9122697"
     CDS             complement(182613..183266)
                     /gene="ulaD"
                     /locus_tag="ECL_RS00900"
                     /old_locus_tag="ECL_00186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-L-gulonate-6-phosphate decarboxylase
                     UlaD"
                     /protein_id="WP_013094949.1"
                     /db_xref="GeneID:9122697"
                     /translation="MSRPLLQLALDHTSLQAAQRDVARLSDHVDIIEAGTILCLTEGL
                     NAVRALREQCPGKTLVADWKVADAGETLAEQAFGAGANWMTIICAAPLATVEKGHAVA
                     LRCGGEIQMELFGYWTLDDARAWHRIGVKQAIYHRGRDAQASGQQWGEADLARMKALS
                     DIGLQLSVTGGITPADLPLFKQINVKAFIAGRALADAANPPQVAEAFHSQIRDIWGA"
     gene            complement(183263..184768)
                     /locus_tag="ECL_RS00905"
                     /old_locus_tag="ECL_00187"
                     /db_xref="GeneID:9122698"
     CDS             complement(183263..184768)
                     /locus_tag="ECL_RS00905"
                     /old_locus_tag="ECL_00187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_013094950.1"
                     /db_xref="GeneID:9122698"
                     /translation="MSEKEPFWLGIDCGGTYLKAGLYTREGKEVCIERRTVATLSPRA
                     GYAERDMNQLWQQCHTTVALLLNNARVSGEQIKGVGISAQGKGLFLLDKQDRPLGNAM
                     LSSDRRALDIVQRWQQDGIPEKLYPHTRQTLWTGHPASLLRWVKENEPQRYQQIGCVM
                     MAHDYLRWCLTGVKGCEESNISESNLYNMNTGQYDPQLTRWLGISEIDNALPPVVGSA
                     EICGEITAQAAALTGLATGTPVVGGLFDVVSTAICAGLHDEHTLNAVMGTWAVTSGIA
                     NALRDNEPHPYVYGRYVHPQQYIVHEASPTSSGNLEWLTAQWGEMSFSEINRAVASLP
                     KAESDLLFLPFLYGSNAGLEMTSGFYGMQALHTRAHLLQAVYEGVVFSHMTHLNRMLE
                     RFTYVQALRVTGGPTHSDVWMQMLADVSGLAIALPQVEETGCSGAALAALVGTGVYPD
                     FYAAQHALRHDIRVIEPDMHAHAAYQRKYQRYQLLISALQGYHARVKEHDL"
     gene            complement(184905..186224)
                     /locus_tag="ECL_RS00910"
                     /old_locus_tag="ECL_00188"
                     /db_xref="GeneID:9122699"
     CDS             complement(184905..186224)
                     /locus_tag="ECL_RS00910"
                     /old_locus_tag="ECL_00188"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005120509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013094951.1"
                     /db_xref="GeneID:9122699"
                     /translation="MNTSTQALHADIPRQRWLRIIPPILIACIISYMDRVNIAFAMPG
                     GMDEELGISATMAGLAGGIFFIGYLFLQVPGGKIAVHGSGKKFIGWSLVAWAVISVLT
                     GLVTSQYQLLVLRFLLGVAEGGMLPVVLTMISNWFPDAERGRANAIVIMFVPIAGIIT
                     APLSGWIITALDWRWLFIIEGLMSIVVLVLWAFTVYDRPQEARWISEAEKNYLVKTLA
                     AEQQAIAGKEVKNASLSAVLSDKTMWQLIALNFFYQTGIYGYTLWLPTILKELTHTSI
                     GQVGVLAILPYIGAIAGMFLFSSLSDRTGKRKLFVSLPLIGFALCMFLSVALKEHTWL
                     AYAALVGCGFFLQSAAGVFWTIPARLFSAEMAGGARGVINALGNLGGFCGPYAVGVLI
                     TLYSKDAGVYCLAVSLALASLLALLLPAKCDAGAEPNPTVNSHKRAA"
     gene            complement(186270..187196)
                     /locus_tag="ECL_RS00915"
                     /old_locus_tag="ECL_00189"
                     /db_xref="GeneID:9122700"
     CDS             complement(186270..187196)
                     /locus_tag="ECL_RS00915"
                     /old_locus_tag="ECL_00189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010436725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4862 family protein"
                     /protein_id="WP_013094952.1"
                     /db_xref="GeneID:9122700"
                     /translation="MTNTGFIIGAYPCAPSFHQKGEQEEQTFWRELSDTPHIRGLEQP
                     CLEHLHPYGDEWLFRHTPGEWQIVVTAVMETMRRRGTNGAFGLASADEDQRKASVEFY
                     RHLCQKIAAVNARFPGKVIALEMQAAPQAGNASVEQAIEAFARSIREIAGWDWSCDLV
                     LEHCDAMTGPAPRKGFLPLEQVLEVIKETDISICINWARSAIEGRNTTLPVEHVQTAL
                     QAGKLAALMFSGTTIRGEYGEWQDLHAPFSSYCADSLMTTEHAKALFTAASAATLKFS
                     GIKLLEINANADISHRIAILRDGISQMKKATQ"
     gene            complement(187348..187815)
                     /locus_tag="ECL_RS00920"
                     /old_locus_tag="ECL_00190"
                     /db_xref="GeneID:9122701"
     CDS             complement(187348..187815)
                     /locus_tag="ECL_RS00920"
                     /old_locus_tag="ECL_00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YhcH/YjgK/YiaL family protein"
                     /protein_id="WP_013094953.1"
                     /db_xref="GeneID:9122701"
                     /translation="MIFGHISQPNPCRLPRAIEKALDFLRTTDFSMLKPGVVEIEGRN
                     LFAQILDLTTKEPHENRPEVHRHYLDIQFLAWGEEKIGIAIDTGNNNISESLLEQRDI
                     IFYHNSENESFIEMVPGSYAIFFPQDVHRPACIKNKETAIRKIVVKVALSELD"
     gene            complement(187826..188824)
                     /gene="yiaK"
                     /locus_tag="ECL_RS00925"
                     /old_locus_tag="ECL_00191"
                     /db_xref="GeneID:9122702"
     CDS             complement(187826..188824)
                     /gene="yiaK"
                     /locus_tag="ECL_RS00925"
                     /old_locus_tag="ECL_00191"
                     /EC_number="1.1.1.130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydro-L-gulonate 2-dehydrogenase"
                     /protein_id="WP_013094954.1"
                     /db_xref="GeneID:9122702"
                     /translation="MKVTFEELKAAFNRVLLDRGVKAETADACAEMFARTTESGVYSH
                     GVNRFPRFIQQLDAGDIIPDAQPKRVTTLGAIEQWDAQRAIGNLTAKKMMDRATELAS
                     DHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPAWGSKECCIGTNPLI
                     VAIPSSPITMVDMSMSMFSYGMLEVNRLAGRTLPVDGGFDDEGNLTKEPGVIEKNRRI
                     LPMGYWKGSGLSIVLDMIATLLSNGSSVAEVTQDNSDEYGVSQIFIAIEVDRLIDGPT
                     RDAKLQRIMDFITTAERADENVAVRLPGHEFTRLLEENRRNGITIDDSVWAKIQAL"
     gene            189050..189868
                     /gene="yiaJ"
                     /locus_tag="ECL_RS00930"
                     /old_locus_tag="ECL_00192"
                     /db_xref="GeneID:9122703"
     CDS             189050..189868
                     /gene="yiaJ"
                     /locus_tag="ECL_RS00930"
                     /old_locus_tag="ECL_00192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014839765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator YiaJ"
                     /protein_id="WP_013094955.1"
                     /db_xref="GeneID:9122703"
                     /translation="MSMKESDMTQEKERPAGSQSLFRGLMLIEILSNYPNGCPLAHLS
                     ELAGLNKSTVHRLLQGLQSCGYVTPAPAAGSYRLTTKFIAVGQKALSSLNIIHVAAPH
                     LESLNIATGETVNFSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMA
                     FGHQDYVASYWESHQDQIQPLTRNTITELSAMYDELAEIREHSMAMDKEENELGVSCI
                     AVPVFDIHGRVPYAISISLSTSRMKQIGEKNLLTPLRETADAISRELGFNVREG"
     gene            189872..190327
                     /locus_tag="ECL_RS00935"
                     /old_locus_tag="ECL_00193"
                     /db_xref="GeneID:9122704"
     CDS             189872..190327
                     /locus_tag="ECL_RS00935"
                     /old_locus_tag="ECL_00193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S dicluster domain-containing protein"
                     /protein_id="WP_013094956.1"
                     /db_xref="GeneID:9122704"
                     /translation="MNRFIMADSAKCIGCRTCEVACVVSHQDAISTDAFTPRIRVVKG
                     DAFTTAVGCHQCEDAPCANVCPTQAIRRGEGAWQVEQARCIGCKRCMVACPFGAMQVQ
                     WAGDTLQALKCDLCAHRADGPACVEACPTHALSCVDPARLRTERLRHLA"
     gene            complement(190332..191588)
                     /gene="avtA"
                     /locus_tag="ECL_RS00940"
                     /old_locus_tag="ECL_00194"
                     /db_xref="GeneID:9122705"
     CDS             complement(190332..191588)
                     /gene="avtA"
                     /locus_tag="ECL_RS00940"
                     /old_locus_tag="ECL_00194"
                     /EC_number="2.6.1.66"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006177773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate transaminase"
                     /protein_id="WP_013094957.1"
                     /db_xref="GeneID:9122705"
                     /translation="MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAQIP
                     EMNTYFQTLLAQMLENGKATDALCNYDGPQGKTELLKLLADMLREELGWDIEPQNIAL
                     TNGSQSAFFYLFNLFAGRRADGTTKKVLFPLAPEYIGYADSGLEEDLFVSARPNIELL
                     PEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDDELMKLDALANQHGIPLVID
                     NAYGVPFPGIIFSEARPLWNPNIVLCMSLSKLGLPGSRCGIIVANEKIITAITNMNGI
                     ISLSPGGIGPAMMCEMIKRNDLLRLSNDVIKPFYYQRVQETIAILRRYLPEERCLIHK
                     PEGAIFLWLWFKDLPITTELLYQRLKKRGVLMVPGDYFFPGLDKPWPHTHQCMRMNYV
                     PDPEKIEAGVKILAEEIEFAWREDVQ"
     gene            complement(<191779..193812)
                     /locus_tag="ECL_RS00945"
                     /old_locus_tag="ECL_00195"
                     /pseudo
                     /db_xref="GeneID:9122706"
     CDS             complement(<191779..193812)
                     /locus_tag="ECL_RS00945"
                     /old_locus_tag="ECL_00195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013364227.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /db_xref="GeneID:9122706"
     gene            194127..194951
                     /locus_tag="ECL_RS00950"
                     /old_locus_tag="ECL_00196"
                     /db_xref="GeneID:9122707"
     CDS             194127..194951
                     /locus_tag="ECL_RS00950"
                     /old_locus_tag="ECL_00196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein bax"
                     /protein_id="WP_014830204.1"
                     /db_xref="GeneID:9122707"
                     /translation="MISTPIRRYGAAILMLLTTTFSGGVLAKTHTDTTSKKAHVIKTT
                     SSKVSSKQEYSRNSAKSSSLPDLRKYPSGTPRKKAFLRTVMPYITSQNAAITADRNWL
                     IAKQYDSRWTPSERARLKDIAKRYKVSWNGNTRRVPWNSLLERVDIIPGSMVATMAAA
                     ESGWGTSKLARNNNNLFGMKCVKGRCKNAPGKVKGYSQFESVKDSVNAYVVNLNTHPA
                     YSSFRKSRAQLRKADQEVTASTMIHKLKGYSTQGQRYNNYLFAMYQDNQRLIAAHM"
     gene            complement(194989..196167)
                     /locus_tag="ECL_RS00955"
                     /old_locus_tag="ECL_00197"
                     /db_xref="GeneID:9122708"
     CDS             complement(194989..196167)
                     /locus_tag="ECL_RS00955"
                     /old_locus_tag="ECL_00197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator"
                     /protein_id="WP_013094960.1"
                     /db_xref="GeneID:9122708"
                     /translation="MFEKRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFIKED
                     FRTRLENIKDWLGDGVIADYDDPVIEQLLTDVDVPIVGVGGSYHSPEHYPPVHYIATD
                     NHALVESAFLHLKEKGVHRFAFYGLPASSGKRWAVEREHAFCQLVAQEKYRGVVYQGL
                     ETAPENWQHAQNRLADWLQTLPPQTGIIAVTDARARHVLQVCEHLHIPVPEKLCVIGI
                     DNEELTRYLSRVALSSVAQGTRQMGYQAAKLLHRLLDNESLPLQRLLVPPVRVVERRS
                     TDYRSLNDPAVIQAMHFIRNHACKGIKVDQVLDSVGISRSNLEKRFKEEVGETIHAVI
                     HAEKLEKARSLLISTSLSINEISQMCGYPSLQYFYSVFRKEYDNTPKEYRERHSEVMM
                     "
     gene            complement(196201..197382)
                     /locus_tag="ECL_RS00960"
                     /old_locus_tag="ECL_00198"
                     /db_xref="GeneID:9122709"
     CDS             complement(196201..197382)
                     /locus_tag="ECL_RS00960"
                     /old_locus_tag="ECL_00198"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_013094961.1"
                     /db_xref="GeneID:9122709"
                     /translation="MSKSNPSDIKVAVQTPGAFAGLKALNLQVFVMIAAIIAIMLFFT
                     WMTDGSYLSARNVSNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGVAAIFD
                     VWLGWPLPLTVAVTLVLGLVLGAWNGWWVAYRKVPSFIVTLAGMLAFRGVLIGITNGT
                     TVSPTSAAMSQIGQSYLSDSMGFTIGVVGLLAFVVWQWRGRMRRQSLGLASSPSTSVV
                     GRQALTAVIVLGAIWLLNDYRGVPTPVLLLALLLLGGMFMATRTAFGRRIYAIGGNLE
                     AARLSGINVERTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGG
                     TSLAGGVGSVAGAVMGAFIMASLDNGMSMMDVPTFWQYIVKGAILLLAVWMDSATKRR
                     T"
     gene            complement(197360..198901)
                     /locus_tag="ECL_RS00965"
                     /old_locus_tag="ECL_00199"
                     /db_xref="GeneID:9122710"
     CDS             complement(197360..198901)
                     /locus_tag="ECL_RS00965"
                     /old_locus_tag="ECL_00199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose ABC transporter ATP-binding protein"
                     /protein_id="WP_013094962.1"
                     /db_xref="GeneID:9122710"
                     /translation="MPYLLEMKSITKRFGAVKAVDNVSLRLNPGEVVSLCGENGSGKS
                     TLMKVLCGIYPHGSYEGEIVFAGEVIQATHIRDTERKGIAIIHQELALVKHLTVLENI
                     FLGAEISRHGVLDYDTMTLRCEKLLAQVSLAISPDTRVGDLGLGQQQLVEIAKALNKQ
                     VRLLILDEPTASLTEQETAVLLDIIRDLQNHGIACIYISHKLNEVKAISDTICVIRDG
                     QHIGTREAEGMSEDDIITMMVGRELTALYPNEPHTTGDEVLRVENLTAWHPVNRHIKR
                     VNNISFSLHRGEILGVAGLVGAGRTEAVQCLFGVWPGRWEGTVYIDGKPVKIDNCQQA
                     IAHGIAMVPEDRKKDGIVPVMAVGKNITLAALDQFSGALSSLDDAAEQQCILQSLARL
                     KVKTSSPELAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLINQ
                     LVQQGIAVIVISSELPEVLGLSDRVLVMHEGKLKANLINQNLTQEQVMEAALRSERHV
                     EKQSV"
     gene            complement(198974..199966)
                     /gene="xylF"
                     /locus_tag="ECL_RS00970"
                     /old_locus_tag="ECL_00200"
                     /db_xref="GeneID:9122711"
     CDS             complement(198974..199966)
                     /gene="xylF"
                     /locus_tag="ECL_RS00970"
                     /old_locus_tag="ECL_00200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-xylose ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013094963.1"
                     /db_xref="GeneID:9122711"
                     /translation="MKIKNLTLTLCTTLLLASFAGHAKEVKIGMAIDDLRLERWQKDR
                     DIFVKKAESLGASVFVQSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEA
                     KQEGIKVLAYDRMINNADIDYYISFDNEKVGELQAKSLVDKVPQGNYFLMGGSPVDNN
                     AKLFREGQMKVLKPYIDSGKIKVVGDQWADGWLPENALKIMENALTANNNKIDAVVAS
                     NDATAGGAIQALSAQGLAGKVAISGQDADLAGVKRIIAGTQTMTVYKPITELANTAAE
                     IAVELGNGKQPKADATLNNGLKDVPARLLTPIEVNKENIDATVIKDGFHKKSEL"
     gene            200337..201659
                     /gene="xylA"
                     /locus_tag="ECL_RS00975"
                     /old_locus_tag="ECL_00201"
                     /db_xref="GeneID:9122712"
     CDS             200337..201659
                     /gene="xylA"
                     /locus_tag="ECL_RS00975"
                     /old_locus_tag="ECL_00201"
                     /EC_number="5.3.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="WP_014830210.1"
                     /db_xref="GeneID:9122712"
                     /translation="MQAYFDQLDRVRYEGPKTTNPLAFRHYNPDELVLGKRMEDHLRF
                     AACYWHTFCWNGADMFGVGSFDRPWQQPGEAIELAKRKADVAFEFFHKLNVPYYCFHD
                     VDVSPEGASLKEYLNNFAQMVDVLAAKQQQSGVKLLWGTANCFTNPRYGAGAATNPDP
                     EVFSWAATQVVTAMNATHQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVE
                     HKHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAG
                     HSFHHEIASAIALGIFGSVDANRGDAQLGWDTDQFPNSVEENALVMYEIIKAGGFTTG
                     GLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKVAARMIEDGELDKRVAKRYSGWNS
                     ELGQQILKGQLSLAEIAKYAEQHQLAPQHQSGHQELLENLVNHYLFDK"
     gene            201719..203173
                     /gene="xylB"
                     /locus_tag="ECL_RS00980"
                     /old_locus_tag="ECL_00202"
                     /db_xref="GeneID:9122713"
     CDS             201719..203173
                     /gene="xylB"
                     /locus_tag="ECL_RS00980"
                     /old_locus_tag="ECL_00202"
                     /EC_number="2.7.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylulokinase"
                     /protein_id="WP_013094965.1"
                     /db_xref="GeneID:9122713"
                     /translation="MYIGIDLGTSGVKAILLSEQGDVLATQTEKLQVSRPHPLWSEQD
                     PEQWWQATDRAIKGLGAQHSLREVTALGIAGQMHGATLLDSQHRVLRPAILWNDGRCA
                     EECALLEERVPASRDITGNLMMPGFTAPKLLWVQRHEPEIFRQVAKVLLPKDYLRFRM
                     TGDFASDMSDAAGTMWLDVAKRDWSEAMLDACHLTREHMPALFEGSEITGTLQSAVAE
                     RWNMPAVPVVAGGGDNAAGAVGVGMVDAGQAMLSLGTSGVYFAVSDGYRSNPESAVHS
                     FCHALPGKWHLMSVMLSAASCLDWAAKLTGMADVPALITAAQQADENAGTVWFLPYLS
                     GERTPHNNPEAKGVFFGLTHQHGPAELARAVLEGVGYALADGMDVVHDCGLNPASITL
                     IGGGARSSYWRQMLSDISGLQLDYRTGGDVGPALGAARLAQIAMNPEKPLSQLLPQLT
                     LEQAHLPDATRHARYAERRDVFRKIYQQLLPLMS"
     gene            203277..203816
                     /locus_tag="ECL_RS00985"
                     /old_locus_tag="ECL_00203"
                     /db_xref="GeneID:9122714"
     CDS             203277..203816
                     /locus_tag="ECL_RS00985"
                     /old_locus_tag="ECL_00203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010436757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase family protein"
                     /protein_id="WP_013094966.1"
                     /db_xref="GeneID:9122714"
                     /translation="MSRIALINIDTQQSFHHRDYWQEQDVPAFEQAMLGLTEGCQSRG
                     IPVVDIFHVDEKGPFSLQSGYVKPMAFLRHQPDVVFQKHVHNAFTDTGLDRWLRERDI
                     NQLILCGIRTEQCCETTARVASDLGYAVTFVSEAMLTFPMTYKGVTLSAAEIRHRTET
                     VLSGRFAAIKTVAETLESL"
     gene            203816..204736
                     /locus_tag="ECL_RS00990"
                     /old_locus_tag="ECL_00204"
                     /db_xref="GeneID:9122715"
     CDS             203816..204736
                     /locus_tag="ECL_RS00990"
                     /old_locus_tag="ECL_00204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017458220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_013094967.1"
                     /db_xref="GeneID:9122715"
                     /translation="MRIDVWFVMLPGVLSLDMTGPAETFVLAGDAFRLHYIGPQPEVQ
                     TSIGLMMSGIAPLPERLPEGSLLVLPGVSDSRVQFSTPQAMQIQHWLMRLQPAIQRQD
                     ITVMCVCSGALLAAKSGLLNNRQCTTHHEVIGRLRAAVPTATIKENRIFVQDENVWTS
                     AGITSGIDLALHMINRLCGPEKALAVAREMVVWFRRSGDDPQLSPWLRYRNHLHPAIH
                     RAQDALTADPQKAWNVPDIAALAHVSPRHLTRLFQTHLGISVRDYLEQLRLAVAEQWL
                     LQGRGVEQSSLAAGFSSPRQFHRARQRVVN"
     gene            complement(204729..205724)
                     /locus_tag="ECL_RS00995"
                     /old_locus_tag="ECL_00205"
                     /db_xref="GeneID:9122716"
     CDS             complement(204729..205724)
                     /locus_tag="ECL_RS00995"
                     /old_locus_tag="ECL_00205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_013094968.1"
                     /db_xref="GeneID:9122716"
                     /translation="MQSKISWIDNLRGIACLMVVMIHTTTWYVTNAHSISPVNWDVAN
                     ILNSASRVSVPLFFMISGFLFFGERSAQPRHFIRIAACLGFYSAVALIYITLFTSISP
                     GLSLKYLLQKPVFYHLWFFFAIIVIYLVSPLIQVKNVSGKMLLALMVVIGIIANPNTV
                     SQKIDGFEWLPVNLYINGDTFYYVLYGMLGRAIGMMDTQKRGISWLCGALFIIGVIII
                     SRGTLHELQWRGNFADTWYLYCGPMVFICAVSLLTLVKNTLNARPLPVLGFISRHSLG
                     IYGFHALVIHALRTRGVELKSWPVLDIVWIFSVTLVVSLLLSMLLQKLDTRRFVS"
     gene            205908..206213
                     /locus_tag="ECL_RS01000"
                     /old_locus_tag="ECL_00206"
                     /db_xref="GeneID:9122717"
     CDS             205908..206213
                     /locus_tag="ECL_RS01000"
                     /old_locus_tag="ECL_00206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_013094969.1"
                     /db_xref="GeneID:9122717"
                     /translation="MMMKRVGSLFLLVVLAGCSTPQEAPAQKAQQGKMSPERSLNMEQ
                     LCKDQAAHRYNLDTQKIDVTGSERFQGSYELRGHTSRKEGFVCSFDADGQFLHLSMR"
     gene            206374..207285
                     /gene="glyQ"
                     /locus_tag="ECL_RS01005"
                     /old_locus_tag="ECL_00207"
                     /db_xref="GeneID:9122718"
     CDS             206374..207285
                     /gene="glyQ"
                     /locus_tag="ECL_RS01005"
                     /old_locus_tag="ECL_00207"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="WP_003860141.1"
                     /db_xref="GeneID:9122718"
                     /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMT
                     SLRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSL
                     KELGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPIT
                     GEITYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDF
                     LFTCFEQYEKEAQQLLALETPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRI
                     RTLTKAVAEAYYASREALGFPMCNRNK"
     gene            207295..209364
                     /gene="glyS"
                     /locus_tag="ECL_RS01010"
                     /old_locus_tag="ECL_00208"
                     /db_xref="GeneID:9122719"
     CDS             207295..209364
                     /gene="glyS"
                     /locus_tag="ECL_RS01010"
                     /old_locus_tag="ECL_00208"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001291772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit beta"
                     /protein_id="WP_013094970.1"
                     /db_xref="GeneID:9122719"
                     /translation="MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGK
                     IEWFAAPRRLALKVANLAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITV
                     DQAERLTTDKGEWLLYRAHVKGERAEALLPNMIATSLAKLPIPKLMRWGASDVHFVRP
                     VHTVTLLLGDTVIPATILGVASDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIAD
                     YEQRKAKIKADAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEA
                     LVYTMKGDQKYFPVYANDGKLLPNFIFVANIESKDPQQIISGNEKVVRPRLADAEFFF
                     NTDRKKRLEDNLPRLQTVLFQQQLGTLRDKTDRIAELSGWIAREIGADVNHATRAGLL
                     SKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPSNPVAC
                     AVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAV
                     RLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKA
                     VSHFRTLEAASALAAANKRVSNILAKSDETLNERVNAATLKEPEEIALAMQVVVLRDK
                     LEPYFAEGRYQEALVELAELRDVIDAFFEKVMVNVEDKDLRINRLSMLEKLRELFLRV
                     ADISLLQ"
     gene            209597..211216
                     /locus_tag="ECL_RS01015"
                     /old_locus_tag="ECL_00209"
                     /db_xref="GeneID:9122720"
     CDS             209597..211216
                     /locus_tag="ECL_RS01015"
                     /old_locus_tag="ECL_00209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-F family ATP-binding cassette
                     domain-containing protein"
                     /protein_id="WP_013094971.1"
                     /db_xref="GeneID:9122720"
                     /translation="MAHFAQSPSFILHQVTCQFATGNILFGPLNLSLETSLCALVGRN
                     GSGKTRLLRMLAGLDEPASGHIERFASHVYVAQQQDISPQTTLAELLGYDAIFAARKR
                     IDRGDYQPDDLEMLDGYWDLAERLNEAFLQAKLPPFDPDKPAAEFSGGERIRALLCGA
                     FTAEADFLLLDEPTNHLDRQGRAWFYDQLRRYQGGVLVASHDRELLAQVPRILELSPS
                     GLRSYGGNYADYKQQRDAEQQAARAALEHAATERKRTRARMQKEHDDSQRRSAKTIRT
                     VDTLNIASFERVKYKAAAKERIGSWKKQHSDQNDVLNAAVNKARERVEEDAPIMFTLP
                     GSQIAEGKQVLVLEELQLPHVSLPPMNWRMDGPMRVALRGPNGCGKSTLLKVILGETA
                     PRAGSCKVSVTCAYLDQHLSQLDLTQSVMAHLNLSNTPLEEGTLRTRLAQLQLGADKV
                     SLPLAELSGGERLKAALACVLWREHATQLLLLDEPTNHLDLASVQAIEAALAGFPGAL
                     LVVSHDESFLQGLALTHELVWEETGWHCEGL"
     gene            complement(211263..211550)
                     /locus_tag="ECL_RS01020"
                     /old_locus_tag="ECL_00210"
                     /db_xref="GeneID:9122721"
     CDS             complement(211263..211550)
                     /locus_tag="ECL_RS01020"
                     /old_locus_tag="ECL_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator"
                     /protein_id="WP_013094972.1"
                     /db_xref="GeneID:9122721"
                     /translation="MEYKDPEFELLSSLEQIIFKDVPQTVTLQQKSNPFTEYEQLRKG
                     TGLKTDEFARAMGVSVAMVLEWESKREKPTPTELKLMRLIQANPALSKQIA"
     gene            211882..212592
                     /locus_tag="ECL_RS01025"
                     /old_locus_tag="ECL_00212"
                     /db_xref="GeneID:9122723"
     CDS             211882..212592
                     /locus_tag="ECL_RS01025"
                     /old_locus_tag="ECL_00212"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3053 domain-containing protein"
                     /protein_id="WP_013094974.1"
                     /db_xref="GeneID:9122723"
                     /translation="MATGKSCSRWFAPIAALLMVVSLSGCFDKEGDQRKAFIDFLQNT
                     VMRSGERLPTLTADQKKQFGPFVSDYAILYGYSQQVSQAMDSGIRPVVDSVNAIRVPQ
                     DYVTQREPLRQSNGALGVLSQQLQNAKMQADASRSALKQGDDLKPVFDKVYEKVVTKP
                     SDALQPLIPAAQIFTQQLVQVGDFISQQGTQVSFVANGIQFPTSQQASQYNTLIGPLA
                     SQHQAFSQAWSAAVAATE"
     gene            212839..213051
                     /gene="cspA"
                     /locus_tag="ECL_RS01030"
                     /old_locus_tag="ECL_00213"
                     /db_xref="GeneID:9122724"
     CDS             212839..213051
                     /gene="cspA"
                     /locus_tag="ECL_RS01030"
                     /old_locus_tag="ECL_00213"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA chaperone/antiterminator CspA"
                     /protein_id="WP_003860775.1"
                     /db_xref="GeneID:9122724"
                     /translation="MSAKMTGLVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKS
                     LDEGQKVSFTIESGAKGPAAGNVVSL"
     gene            complement(213110..214084)
                     /gene="ghrB"
                     /locus_tag="ECL_RS01035"
                     /old_locus_tag="ECL_00214"
                     /db_xref="GeneID:9122725"
     CDS             complement(213110..214084)
                     /gene="ghrB"
                     /locus_tag="ECL_RS01035"
                     /old_locus_tag="ECL_00214"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016151146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate/hydroxypyruvate reductase GhrB"
                     /protein_id="WP_013094975.1"
                     /db_xref="GeneID:9122725"
                     /translation="MKPSVILYKALPDDLQKRLEEHFTVTQVKNLSPETVAQHAGAFA
                     RAEGLLGSSEKVDVALLEKMPKLRATSTVSVGYDNFDVDALNARNILLMHTPHALTET
                     VADTLMALMLSTARRVVEVAERVKAGEWTKSIGPDWFGVDVHGKTLGIVGMGRIGLAL
                     AQRAHFGFNMPILYNARRHHSEAEERFNARYCELDTLLQEADFVCLILPLTDETRHLI
                     GKAAFAKMKKSAIFINAGRGPVVDEKALIEALQNGEIHAAGLDVFEQEPLPVDSPLLS
                     LPNVVALPHIGSATHETRYNMAATAVDNLIAALNGNVEKNCVNPQVQQ"
     gene            complement(214111..215391)
                     /locus_tag="ECL_RS01040"
                     /old_locus_tag="ECL_00215"
                     /db_xref="GeneID:9122726"
     CDS             complement(214111..215391)
                     /locus_tag="ECL_RS01040"
                     /old_locus_tag="ECL_00215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013094976.1"
                     /db_xref="GeneID:9122726"
                     /translation="MNSSTNAVKRWWYIMPIVFITYSLAYLDRANFSFASAAGITEDL
                     GITKGISSLLGALFFLGYFFFQIPGAIYAERRSVRKLIFVCLILWGACASLTGVVNNI
                     PALAAIRFILGVVEAAVMPAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGY
                     LIQSFGWREMFIIEGVPAIIWAFCWWVLVKDKPAQAKWLSEDEKAALQAQLDKEQQGL
                     KAVRNYGEAFRSRNVILLCAQYFTWSIGVYGFVLWLPSIIRSGGENLGMVEVGWLSSV
                     PYLAATIAMIIVSWASDKLQNRKLFVWPLLLIAAFAFIGSWAVGANHFWVSYTLLVIA
                     GAAMYAPYGPFFAIIPEMLPRNVAGGAMALINSMGALGSFCGSWFVGYLNGATGSPSA
                     SYIFMGVALFASVWLTLIVKPANNQQLPVGARHA"
     gene            complement(215508..216446)
                     /locus_tag="ECL_RS01045"
                     /old_locus_tag="ECL_00216"
                     /db_xref="GeneID:9122727"
     CDS             complement(215508..216446)
                     /locus_tag="ECL_RS01045"
                     /old_locus_tag="ECL_00216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_013094977.1"
                     /db_xref="GeneID:9122727"
                     /translation="MHKTLDVITIGEAMAMFVATETGELSTVEHFIKRVAGAELNVAT
                     GLARLGLKTGWVSRVGDDSFGHFVLDSLKKEGIDAAGVTLDGRFPTGFQLKSKVENGT
                     DPIVEYFRKGSAASHLSVEDYHADYFASARHLHLSGVAAALSASSYELLDHAATTMKA
                     QGKTISFDPNLRPVLWKSEAEMVEKLNRLAFQADWVLPGVKEGVILTGENTPEGIADF
                     YLNKGVKAVVLKTGADGAWFKTADGEQGAVAAVKVENVVDTVGAGDGFAVGVISALLE
                     GKPLPQAIARGNWIGSLAIQVQGDSEGLPTRAQLNE"
     gene            complement(216450..217199)
                     /locus_tag="ECL_RS01050"
                     /old_locus_tag="ECL_00218"
                     /db_xref="GeneID:9122728"
     CDS             complement(216450..217199)
                     /locus_tag="ECL_RS01050"
                     /old_locus_tag="ECL_00218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate isomerase/epimerase"
                     /protein_id="WP_013094978.1"
                     /db_xref="GeneID:9122728"
                     /translation="MGRKIMVVTAAYGADQVRQAGGQRAMLPVIAGAGADGVEIRREL
                     FNSEELQALPALGESIELLGLLACYSAPAPLFMPDGALNPDLPRYLSEASTLNALWLK
                     VSLGHFSGTRPLTALRALLNESGMALVVENDQTDCGQLAPMQRFQAACREMALPVTLT
                     FDMGNWLWVGDSPEEAATRLAPAVSYIHVKAAVPHKAQFRAVAPDRADARWLALLSQL
                     PADAPRGIEFPLEGADLTAVTRHYVNLLREE"
     gene            complement(217304..218320)
                     /locus_tag="ECL_RS01055"
                     /old_locus_tag="ECL_00219"
                     /db_xref="GeneID:9122729"
     CDS             complement(217304..218320)
                     /locus_tag="ECL_RS01055"
                     /old_locus_tag="ECL_00219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003837718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_013094979.1"
                     /db_xref="GeneID:9122729"
                     /translation="MSKPTRATISDVAKAARTGKTSISRYLNGEKHLLSDALLARIEQ
                     AIADLDYRPSIMARGLKRGRTRLIGLIIADITNPYSVNVLSGIEAACREKGFTPLVCN
                     TNNEVDQELHYLDLLRSYQVEGIVVNAVGMREEGLNRLQQSSLPMVLIDRKIPEFACD
                     VVGLDNTQAATTATEHLIEQGFEAILFLSEPLGMVNTRRERLNAFRATLERYPGVIAE
                     NAETPLHEADQLDNTLRQFHTRHRGMRKAVISANGALTLQVARSLKRIGLHWGSDIGL
                     LGFDELEWAELAGVGITTLKQPTWQIGYAAVEQVVRRIEGISDAVREQVFSGELIVRG
                     STAR"
     gene            complement(218450..219112)
                     /locus_tag="ECL_RS01060"
                     /old_locus_tag="ECL_00220"
                     /db_xref="GeneID:9122730"
     CDS             complement(218450..219112)
                     /locus_tag="ECL_RS01060"
                     /old_locus_tag="ECL_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family lipoprotein"
                     /protein_id="WP_013094980.1"
                     /db_xref="GeneID:9122730"
                     /translation="MKKRVLVIAALVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSL
                     VGAGVGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMKGTGVSVTRS
                     GDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYNKTAVNVIGYTDSTGSQEL
                     NMRLSQQRADSVASSLITQGVEANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSP
                     IQ"
     gene            219277..221598
                     /locus_tag="ECL_RS01065"
                     /old_locus_tag="ECL_00222"
                     /db_xref="GeneID:9122732"
     CDS             219277..221598
                     /locus_tag="ECL_RS01065"
                     /old_locus_tag="ECL_00222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin guanine dinucleotide-containing
                     S/N-oxide reductase"
                     /protein_id="WP_013094982.1"
                     /db_xref="GeneID:9122732"
                     /translation="MSTSTKTILTAAHWGPMLVETDGENVLSSRGALPTQHPNSLQTV
                     VRDQVHSKTRVRWPMVRKGFLASPDKPQGIRGQDEFVRVSWDDALALIHAQHKRIRDS
                     YGPASIFAGSYGWRSNGVLHKASTLLQRYMSLAGGYTGHLGDYSTGAAQAIMPYVVGG
                     NEVYQQQTSWPLVLEHTEVVVLWSANPLNTLKIAWNASDEQGIGYFDALRKSGKRIIC
                     IDPMRSETMDFFGDSAEWLAPHMGTDVAMMLGIAHTLVEKGWHDADFLARCTSGFDKF
                     ADYLTGKTDGVAKTAAWAADICGIPADKLRELAALFHENTTMLMSGWGMQRQQFGEQK
                     HWMLVTLAAMLGQIGTPGGGFGLSYHFANGGNPTRKAAVLASMQGSVKGGVDAVDKIP
                     VARIVEALENPGGFYQHNGLDRHFPDIKFVWWAGGANFTHHQDTNRLIRAWQKPELVV
                     ISECFWTASAKHADIVLPATTSYERNDLTMTGDYSNQHMVPMKRVVAPRDEARDDFDV
                     FAELSERWEAGGRERFTEGKTDLEWLETFYQIAAQRGAAQGVTLPPFAEFWEANAIFE
                     MPESEQNAQFVRFADFRRDPENHPLKTESGKIVIYSERIARFGYADCPAHPTWLEPDE
                     WHGNAQPEQLQVLSAHPAHRLHSQLNYSSLREQYAVAGREPITLHAEDAKARGIADGD
                     LVRVWNHRGQVLAGAVVSDGIKPGVICIHQGAWPDLDESGICKNGAVNVLTKDLPSSK
                     LGNGCAGNTALAWVEKYQGPELTLTAFDPPASS"
     gene            complement(221561..222007)
                     /locus_tag="ECL_RS01070"
                     /old_locus_tag="ECL_00223"
                     /db_xref="GeneID:9122733"
     CDS             complement(221561..222007)
                     /locus_tag="ECL_RS01070"
                     /old_locus_tag="ECL_00223"
                     /EC_number="2.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013094983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_013094983.1"
                     /db_xref="GeneID:9122733"
                     /translation="MIRKWQSENTASLLSLWLESTTEAHPFIEASYWKENEAMVRDVY
                     LPSAETWVWEQDGEPYGFISVMQSQFVGALFVAPAYIGKGIGRALLNHVQQRFPHLSL
                     EVYQKNVRAVNFYHAQGFRIEDSAWQDDTQHPTWIMSWQADQTPSE"
     gene            complement(221985..222566)
                     /gene="tag"
                     /locus_tag="ECL_RS01075"
                     /old_locus_tag="ECL_00224"
                     /db_xref="GeneID:9122734"
     CDS             complement(221985..222566)
                     /gene="tag"
                     /locus_tag="ECL_RS01075"
                     /old_locus_tag="ECL_00224"
                     /EC_number="3.2.2.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011915440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="WP_013094984.1"
                     /db_xref="GeneID:9122734"
                     /translation="MQRCGWVSQDQLYIDYHDREWGVPETDGKKLFEMICLEGQQAGL
                     SWITVLKKRENYRNAFHQFDPVRVAAMTDDDVERLVQDAGIIRHRGKIQAIIGNARAY
                     LAMEQNGEPFSEFVWTFVNNDPQITQAATLAEIPASTPASDALSKALKKRGFKFVGST
                     ICYAFMQACGLVNDHVTGCFCHPGGHHDPQMAK"
     gene            222726..223424
                     /locus_tag="ECL_RS01080"
                     /old_locus_tag="ECL_00225"
                     /db_xref="GeneID:9122735"
     CDS             222726..223424
                     /locus_tag="ECL_RS01080"
                     /old_locus_tag="ECL_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter domain-containing protein"
                     /protein_id="WP_023620076.1"
                     /db_xref="GeneID:9122735"
                     /translation="MMIKKISGRHAVSGLVGISACLLSGHSAFAWQQEYIVSDPQSNT
                     AERYTWDADHQPRYDDILAERIQSSQNAPGLALNLPSGSTSAGAMSVGWNFPLAGHVT
                     TGPVVAWRYDGTTPMMINEFGDSVTTQALTDPLWHASVSTLGWRVDTQYGELRPWAQI
                     SYNQQYGENQWKSQFGMPQTPAPAQNGNWMDVTVGTDIPFTSHMAAYASLAQGEDSTT
                     GEQFLYTLGVSANF"
     gene            223663..224865
                     /locus_tag="ECL_RS01085"
                     /old_locus_tag="ECL_00226"
                     /db_xref="GeneID:9122736"
     CDS             223663..224865
                     /locus_tag="ECL_RS01085"
                     /old_locus_tag="ECL_00226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013094986.1"
                     /db_xref="GeneID:9122736"
                     /translation="MNTSSYNRTRWLTLFGTIVTQFALGSVYTWSLFNSALSDKLGAP
                     ISQVAFSFGLLSLGLALSSSVAGKLQERFGVKRVTMASGILLGLGFFLTAYSNNLLML
                     WLSAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDSHLLA
                     SVGLEKTFMIWGAIVLVMILFGATLMKDAPQQEVKTVNGVMENDFTLAQSMRKPQYWM
                     LAVMFLTACMSGLYVIGVAKDIAQGMVKLDAMTAANAVTVISIANLSGRLVLGILSDK
                     IARIRVITLGQVVSLVGMAALLFAPLNEATFFAAIACVAFNFGGTITVFPSLVSEFFG
                     LNNLAKNYGVIYLGFGIGSICGSLIASLFGGFYVTFCVIFALLIISLALSTTIRQPQR
                     EVFNEAHA"
     gene            225105..226799
                     /gene="eptB"
                     /locus_tag="ECL_RS01090"
                     /old_locus_tag="ECL_00228"
                     /db_xref="GeneID:9122738"
     CDS             225105..226799
                     /gene="eptB"
                     /locus_tag="ECL_RS01090"
                     /old_locus_tag="ECL_00228"
                     /EC_number="2.7.8.42"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010426224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kdo(2)-lipid A phosphoethanolamine
                     7''-transferase"
                     /protein_id="WP_023620079.1"
                     /db_xref="GeneID:9122738"
                     /translation="MKYIRSITQQRLCLMLAVYIGLFLNGAVLFRRVEGYFEDLTVRN
                     GIFAAIEVFGSVLATFFLLRLLSLFGRRTWQILASLVVIISAAASYYMTFMNVVIGYG
                     IVASVMTTDIDLSKEVVGKGFIVWTILTCLLPLFFIWSNTCRYTLLRQLRTRGQRIRT
                     VAVVLLAGLLVWAPIRLMEKQQKRIEKATGVDMPSYGGVVANSYLPSNWLSALGLYAW
                     AQADESSDVKSLMNPTKKFHYEAPADGLDDTYVVFVIGETTRWDHMGILGYDRDTTPK
                     LAQEKNLVAYRGYSCDTATKLSLRCMFVREGGASDNPQRTLKEQNVFAVLKQLGFSSD
                     LFAMQSEMWFYTNTLADNIAYREQIGAEPRNRGKTVDDMLLLSEMEQSLKNHPQGKHL
                     IVLHTKGSHYSYYQRYTRDFAKWQPECIGINKYCSKQELINAYDNSVLYVDTFLSRVI
                     DQLRDKKAIVIYAADHGESINEQEHLHGTPRKLAPPEQFRVPMIMWMSDKYLENPDKA
                     KMFAHLKQQAEIKVPRRHVELYDTIMGCLGYTSPDGGINENNNWCKLPESSQKAAQ"
     gene            226891..226967
                     /locus_tag="ECL_RS01095"
                     /old_locus_tag="ECL_tRNA002"
                     /db_xref="GeneID:9122739"
     tRNA            226891..226967
                     /locus_tag="ECL_RS01095"
                     /old_locus_tag="ECL_tRNA002"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:226925..226927,aa:Pro,seq:tgg)
                     /db_xref="GeneID:9122739"
     gene            227588..229195
                     /locus_tag="ECL_RS01100"
                     /old_locus_tag="ECL_00229"
                     /db_xref="GeneID:9127670"
     CDS             227588..229195
                     /locus_tag="ECL_RS01100"
                     /old_locus_tag="ECL_00229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_023620080.1"
                     /db_xref="GeneID:9127670"
                     /translation="MSISLKKSGMLKLGLSLVAMTVAASVQAKTLVYCSEGSPEGFNP
                     QLFTSGTTYDASSVPIYNRLVEFKTGTTEVIPGLAEKWDVSEDGKTYTFHLRQGVKWQ
                     DSKEFKPTRDFNADDVVFSFDRQKNAQNPYHKVSGGSYEYFEGMGLPDLIAEVKKVDD
                     KTVQFVLTRPEAPFLADLAMDFASILSKEYADNMLKAGTPEKVDLNPIGTGPFQLLQY
                     QKDSRILYKAFPGYWGTKPQIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADIARM
                     KQDKNINLMEQAGLNVGYLSFNTEKKPFDDVKVRQALTYAVNKEAIIKAVYQGAGVAA
                     KNLIPPTMWGYNDDVKDYTYDPEKAKALLKEAGQDKGFTVELWAMPVQRPYNPNARRM
                     AEMVQADWAKIGVQAKIVTYEWGEYLKRAKAGEHQAVMMGWTGDNGDPDNFFATLFSC
                     AAAKDGSNYSRWCYKPFEDLIQPARATDDHNKRIELYKQAQVVMHDQAPALIVAHSTV
                     YEPVRKEVKGYVVDPLGKHHFENVSVE"
     gene            229357..230376
                     /gene="dppB"
                     /locus_tag="ECL_RS01105"
                     /old_locus_tag="ECL_00231"
                     /db_xref="GeneID:9122741"
     CDS             229357..230376
                     /gene="dppB"
                     /locus_tag="ECL_RS01105"
                     /old_locus_tag="ECL_00231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter permease DppB"
                     /protein_id="WP_014830232.1"
                     /db_xref="GeneID:9122741"
                     /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGI
                     SPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLGISLKSRLPVWDEFVPRFKATLEL
                     GICAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVQL
                     NLTPVSGRVSDMVFLDDSNPLTGFMLIDTAIWGEEGNFIDAVAHMILPAMVLGTIPLA
                     VIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLA
                     GAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPR
                     IRHKK"
     gene            230386..231289
                     /gene="dppC"
                     /locus_tag="ECL_RS01110"
                     /old_locus_tag="ECL_00233"
                     /pseudo
                     /db_xref="GeneID:9122743"
     CDS             230386..231289
                     /gene="dppC"
                     /locus_tag="ECL_RS01110"
                     /old_locus_tag="ECL_00233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010426221.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter permease DppC"
                     /db_xref="GeneID:9122743"
     gene            231300..232283
                     /gene="dppD"
                     /locus_tag="ECL_RS01115"
                     /old_locus_tag="ECL_00234"
                     /db_xref="GeneID:9122744"
     CDS             231300..232283
                     /gene="dppD"
                     /locus_tag="ECL_RS01115"
                     /old_locus_tag="ECL_00234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter ATP-binding protein"
                     /protein_id="WP_013094994.1"
                     /db_xref="GeneID:9122744"
                     /translation="MALLNVDKLSVHFGDEGTPFRAVDRISYSVNQGEVVGIVGESGS
                     GKSVSSLAIMGLIDYPGRVMAENLQFNGQDLKRISEKQRRQLVGAEVAMIFQDPMTSL
                     NPCYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQVGIPDPASRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALVLITHDLALVA
                     EAAHKIIVMYAGQVVETGSSHDIFRAPRHPYTQALLRALPEFAQDKARLASLPGVVPG
                     KYDRPQGCLLNPRCPYATDKCRAEEPELNQLADGRQSKCHYPLDDAGRPTL"
     gene            232280..233293
                     /gene="dppF"
                     /locus_tag="ECL_RS01120"
                     /old_locus_tag="ECL_00235"
                     /db_xref="GeneID:9122745"
     CDS             232280..233293
                     /gene="dppF"
                     /locus_tag="ECL_RS01120"
                     /old_locus_tag="ECL_00235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005229354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter ATP binding subunit
                     DppF"
                     /protein_id="WP_013094995.1"
                     /db_xref="GeneID:9122745"
                     /translation="MSTQQATTQQPLLQAIDLKKHYPVKKGIFAPERLVKALDGVSFT
                     LERGKTLAVVGESGCGKSTLGRLLTMIETPTGGELYYQGQDLLKHDPQAQKLRRQKIQ
                     IVFQNPYGSLNPRKKVGQILEEPLLINSNLSKEQRREKALAMMAKVGLKTEHYDRYPH
                     MFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFI
                     SHDLSVVEHIADEVMVMYLGRCVEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRER
                     IKLTGELPSPLNPPPGCAFNARCIRRFGPCTQLQPQLKDYRGQLVACFAVDQDENGEK
                     PQA"
     gene            complement(233337..234293)
                     /gene="coaA"
                     /locus_tag="ECL_RS01125"
                     /old_locus_tag="ECL_00236"
                     /gene_synonym="panK"
                     /db_xref="GeneID:9122746"
     CDS             complement(233337..234293)
                     /gene="coaA"
                     /locus_tag="ECL_RS01125"
                     /old_locus_tag="ECL_00236"
                     /gene_synonym="panK"
                     /EC_number="2.7.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017901456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I pantothenate kinase"
                     /protein_id="WP_162837627.1"
                     /db_xref="GeneID:9122746"
                     /translation="MLMSKKEQTLMTPYLHFNRSQWAALRDSVPMTLTEGEIARLKGI
                     NEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVG
                     KSTTARVLQALLSRWPEHRSVELITTDGFLHPNEVLKERGLMKKKGFPLSYDMHRLVK
                     FVSDLKSGVPNVTAPVYSHLIYDRIPGGDKTVVQPDILILEGLNVLQSGMDYPHDPHH
                     VFVSDFVDFSIYVDAPEDLLQSWYINRFLKFREGAFTDPDSYFHHYAQLSEEEAVKVA
                     TGLWNEINYVNLKENILPTRERASLILTKSEKHAVDQIRLRK"
     gene            234605..234680
                     /locus_tag="ECL_RS01130"
                     /old_locus_tag="ECL_tRNA003"
                     /db_xref="GeneID:9122747"
     tRNA            234605..234680
                     /locus_tag="ECL_RS01130"
                     /old_locus_tag="ECL_tRNA003"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:234638..234640,aa:Thr,seq:tgt)
                     /db_xref="GeneID:9122747"
     gene            234689..234773
                     /locus_tag="ECL_RS01135"
                     /old_locus_tag="ECL_tRNA004"
                     /db_xref="GeneID:9127671"
     tRNA            234689..234773
                     /locus_tag="ECL_RS01135"
                     /old_locus_tag="ECL_tRNA004"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:234723..234725,aa:Tyr,seq:gta)
                     /db_xref="GeneID:9127671"
     gene            234891..234965
                     /locus_tag="ECL_RS01140"
                     /old_locus_tag="ECL_tRNA005"
                     /db_xref="GeneID:9127672"
     tRNA            234891..234965
                     /locus_tag="ECL_RS01140"
                     /old_locus_tag="ECL_tRNA005"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:234924..234926,aa:Gly,seq:tcc)
                     /db_xref="GeneID:9127672"
     gene            234972..235047
                     /locus_tag="ECL_RS01145"
                     /old_locus_tag="ECL_tRNA006"
                     /db_xref="GeneID:9127673"
     tRNA            234972..235047
                     /locus_tag="ECL_RS01145"
                     /old_locus_tag="ECL_tRNA006"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:235005..235007,aa:Thr,seq:ggt)
                     /db_xref="GeneID:9127673"
     gene            235166..236350
                     /gene="tuf"
                     /locus_tag="ECL_RS01150"
                     /old_locus_tag="ECL_00237"
                     /db_xref="GeneID:9127674"
     CDS             235166..236350
                     /gene="tuf"
                     /locus_tag="ECL_RS01150"
                     /old_locus_tag="ECL_00237"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_462349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_013094997.1"
                     /db_xref="GeneID:9127674"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPIVRGSALKALEGDAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIIKVGEEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREEIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     LG"
     gene            236580..236963
                     /gene="secE"
                     /locus_tag="ECL_RS01155"
                     /old_locus_tag="ECL_00239"
                     /db_xref="GeneID:9122749"
     CDS             236580..236963
                     /gene="secE"
                     /locus_tag="ECL_RS01155"
                     /old_locus_tag="ECL_00239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007665874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_013094999.1"
                     /db_xref="GeneID:9122749"
                     /translation="MSANTEAQGSGRGLEAMKWVVVAVLLIVAIVGNYLYRDIMLPLR
                     ALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     gene            236965..237510
                     /gene="nusG"
                     /locus_tag="ECL_RS01160"
                     /old_locus_tag="ECL_00240"
                     /db_xref="GeneID:9122750"
     CDS             236965..237510
                     /gene="nusG"
                     /locus_tag="ECL_RS01160"
                     /old_locus_tag="ECL_00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005280494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="WP_003862341.1"
                     /db_xref="GeneID:9122750"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFAQVEKA"
     gene            237666..238094
                     /gene="rplK"
                     /locus_tag="ECL_RS01165"
                     /old_locus_tag="ECL_00241"
                     /db_xref="GeneID:9122751"
     CDS             237666..238094
                     /gene="rplK"
                     /locus_tag="ECL_RS01165"
                     /old_locus_tag="ECL_00241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006121495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_008503452.1"
                     /db_xref="GeneID:9122751"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKIS
                     RAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED"
     gene            238098..238802
                     /gene="rplA"
                     /locus_tag="ECL_RS01170"
                     /old_locus_tag="ECL_00242"
                     /db_xref="GeneID:9122752"
     CDS             238098..238802
                     /gene="rplA"
                     /locus_tag="ECL_RS01170"
                     /old_locus_tag="ECL_00242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_013095000.1"
                     /db_xref="GeneID:9122752"
                     /translation="MAKLTKRMSVIRDKVDATKQYDINEAIALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLAD
                     QIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTM
                     GAGVAVDQAGLSAAAN"
     gene            239095..239592
                     /gene="rplJ"
                     /locus_tag="ECL_RS01175"
                     /old_locus_tag="ECL_00243"
                     /db_xref="GeneID:9122753"
     CDS             239095..239592
                     /gene="rplJ"
                     /locus_tag="ECL_RS01175"
                     /old_locus_tag="ECL_00243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002438625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_013095001.1"
                     /db_xref="GeneID:9122753"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRAVEGTSFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRD
                     AKEAA"
     gene            239659..240027
                     /gene="rplL"
                     /locus_tag="ECL_RS01180"
                     /old_locus_tag="ECL_00244"
                     /db_xref="GeneID:9122754"
     CDS             239659..240027
                     /gene="rplL"
                     /locus_tag="ECL_RS01180"
                     /old_locus_tag="ECL_00244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005122872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_013095002.1"
                     /db_xref="GeneID:9122754"
                     /translation="MSITKDQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAG
                     PAADAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSK
                     DDAEALKKSLEEAGAEVEVK"
     gene            240347..244375
                     /gene="rpoB"
                     /locus_tag="ECL_RS01185"
                     /old_locus_tag="ECL_00245"
                     /db_xref="GeneID:9122755"
     CDS             240347..244375
                     /gene="rpoB"
                     /locus_tag="ECL_RS01185"
                     /old_locus_tag="ECL_00245"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004870488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_008503453.1"
                     /db_xref="GeneID:9122755"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTE
                     QILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEADGKVYVEKGRRITARHIRQ
                     LEKDDIKHIEVPVEYIAGKVAAKDYVDESTGELICPANMELSLDLLAKLSQAGHKRIE
                     TLFTNDLDHGPYISETVRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLD
                     DEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDE
                     MYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLF
                     SRIYAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPHD
                     ANGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQ
                     RAYDLGTDVRQKVDLNTFSDEEVLRLAENLRKGMPIATPVFDGAKEAEIKELLQLGGL
                     PTSGQITLFDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
                     ESFNVLLKEIRSLGINIELEDE"
     gene            244452..248675
                     /gene="rpoC"
                     /locus_tag="ECL_RS01190"
                     /old_locus_tag="ECL_00246"
                     /db_xref="GeneID:9122756"
     CDS             244452..248675
                     /gene="rpoC"
                     /locus_tag="ECL_RS01190"
                     /old_locus_tag="ECL_00246"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_013095003.1"
                     /db_xref="GeneID:9122756"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERHQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEYEKDANGEFVAK
                     TSLKDTTIGRAILWMIVPKGLPFSIVNQALGKKAISKMLNTCYRILGLKPTVIFADQT
                     MYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANDRVSKAMMDNLQTETVINRDGVEEQQVSFNSIYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTLEGITMTPVIEGGDVKEPLRDRVLGRVTAEDILKPGTADI
                     LVPRNTLLHEQWCDLLEANSVDSVKVRSVVSCDTDFGVCAHCYGRDLARGHIINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKLSNAKSVVNSSGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMAKGDGEQVAGGETVANWDPHTMPVITE
                     VSGFIRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTTGGKDLRPALKIVDAQGNDV
                     LIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVITPVDGSEPYEEMIPKWRQLNVFEGERV
                     ERGDVVSDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLR
                     KATIENAGSSEFLEGEQVEYSRVKIANRELEANGKIGATFSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEL
                     PAAPQVTAEDASASLAELLNAGLGGSDNE"
     gene            complement(248733..249050)
                     /locus_tag="ECL_RS01195"
                     /old_locus_tag="ECL_00247"
                     /db_xref="GeneID:9122757"
     CDS             complement(248733..249050)
                     /locus_tag="ECL_RS01195"
                     /old_locus_tag="ECL_00247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017460024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS lactose/cellobiose transporter subunit IIA"
                     /protein_id="WP_013095004.1"
                     /db_xref="GeneID:9122757"
                     /translation="MEDLETTIMELLVNAGAARSAALTALQMARKGDFDEAEKAMEES
                     REYVKHAHTIQTQLIGLDEGTGKLPVNLITVHSQDHLMNAMVIQDLAGDMIELYRRIP
                     LLN"
     gene            complement(249050..249358)
                     /locus_tag="ECL_RS01200"
                     /old_locus_tag="ECL_00248"
                     /db_xref="GeneID:9122758"
     CDS             complement(249050..249358)
                     /locus_tag="ECL_RS01200"
                     /old_locus_tag="ECL_00248"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008503456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter subunit IIB"
                     /protein_id="WP_023334100.1"
                     /db_xref="GeneID:9122758"
                     /translation="MKNIVLCCAAGMSTSMLVQRMKDAAQKKGVEVTIKAVPVAEFKD
                     NIATADIVLLGPQVKYEQAKLQAQAEPLGKKVAVIDMMDYGMMKGDAVLEKALKLLES
                     "
     gene            complement(249505..251046)
                     /locus_tag="ECL_RS01205"
                     /old_locus_tag="ECL_00249"
                     /db_xref="GeneID:9122759"
     CDS             complement(249505..251046)
                     /locus_tag="ECL_RS01205"
                     /old_locus_tag="ECL_00249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_044159596.1"
                     /db_xref="GeneID:9122759"
                     /translation="MALHSRKLSFTRPIMLSFAGILCSFALIAVVVTLSQQKDFLEDY
                     HKINGNFTHNLAVNYTESILRENDYILGRSALYFARNDTLNEMLNVNPSQGLQMLMHL
                     QNLMPTVSSISLTDTQGRYLRAPEVLPTEKSKTFDPRTRPWFIAQAEASIFSHYTRPY
                     MDYFTGHPTVTLYKPLISPEGRLKGTIAFHLDLTSMGFTLRQMVAPVQGEFFVVERDG
                     AVVLHPDPGALFKQYVSEALMDKMTSSEGHLYDKKTKAWYYYYSFTNPDWFVIYRVSG
                     ATLTDITRHETTIVGWGFALAAIIIILFGLYLRHESRTVLMTIINAIKTGDVNQAPRL
                     EAMLSHTIQSNKAREMAYVRQATHDALTGCKNRRAFDSDVDELLSAHQPFALALIDID
                     NFKSINDTWGHLSGDIVLRNVAREGIQIMQPHNVSVYRYGGEEFAVIFQADQIASAFS
                     LLDAWRTAVEKRLWREENLRVTFSAGLGEWHFEPLEELVGSVDNALYSAKQQGKNRII
                     RTSVG"
     gene            complement(251374..252507)
                     /gene="thiH"
                     /locus_tag="ECL_RS01210"
                     /old_locus_tag="ECL_00250"
                     /db_xref="GeneID:9122760"
     CDS             complement(251374..252507)
                     /gene="thiH"
                     /locus_tag="ECL_RS01210"
                     /old_locus_tag="ECL_00250"
                     /EC_number="4.1.99.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000847564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-iminoacetate synthase ThiH"
                     /protein_id="WP_013095007.1"
                     /db_xref="GeneID:9122760"
                     /translation="MTTFTDRWRQLNWDDIALRINSKTQADVERALQARHLSRDDMMA
                     LLSPAASTFLEPMAQRAQRLTRQRFGNTVSFYVPLYLSNLCANNCTYCGFSMSNRIKR
                     KTLDESEIARECAAIREMGFEHLLLVTGEHQSKVGMDYFRQHLPAIRRQFASLQMEVQ
                     PLSQEEYAELKTLGLDGVMVYQETYHEATYARHHLKGKKQDFFFRLETPDRLGRAGID
                     KIGLGALIGLSDSWRVDCYMVAEHLLWLQQHYWQSRYSISFPRLRPCTGGVEPASVMD
                     ERQLVQAICAFRLLAPEVELSLSTRESPAFRDRVIPLAINNVSAFSKTQPGGYADDHP
                     ELEQFAPHDSRRPEAVAAALTAQGLQPVWKDWDSWLGRASQMR"
     gene            complement(252504..253274)
                     /gene="thiG"
                     /locus_tag="ECL_RS01215"
                     /old_locus_tag="ECL_00251"
                     /db_xref="GeneID:9122761"
     CDS             complement(252504..253274)
                     /gene="thiG"
                     /locus_tag="ECL_RS01215"
                     /old_locus_tag="ECL_00251"
                     /EC_number="2.8.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000944065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="WP_013095008.1"
                     /db_xref="GeneID:9122761"
                     /translation="MLRIADKVFDSHLFTGTGKFASPQLMVDAIRESGSQLVTLALKR
                     VDLRHHSDAILAPLLDAGVTLLPNTSGAKTAEEAIFAAQLAREALGTHWLKLEIHPDA
                     RWLLPDPIETLKAAEKLVQQGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQG
                     LETRAMLEIIIEQATVPVVVDAGIGVPSHAAQALEMGASAVLVNTAIAVADDPIRMAR
                     AFRMAVEAGLLARESGPGTRSFQAQATSPLTGFLEALS"
     gene            complement(253276..253476)
                     /gene="thiS"
                     /locus_tag="ECL_RS01220"
                     /old_locus_tag="ECL_00252"
                     /db_xref="GeneID:9122762"
     CDS             complement(253276..253476)
                     /gene="thiS"
                     /locus_tag="ECL_RS01220"
                     /old_locus_tag="ECL_00252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006810523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="WP_013095009.1"
                     /db_xref="GeneID:9122762"
                     /translation="MRILFNDEPMKCDDGLTVAALLEKLRQLKPGTALALNQQILPRE
                     QWEHQQVSEGDQILLFQVIAGG"
     gene            complement(253460..254215)
                     /locus_tag="ECL_RS01225"
                     /old_locus_tag="ECL_00253"
                     /db_xref="GeneID:9122763"
     CDS             complement(253460..254215)
                     /locus_tag="ECL_RS01225"
                     /old_locus_tag="ECL_00253"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HesA/MoeB/ThiF family protein"
                     /protein_id="WP_013095010.1"
                     /db_xref="GeneID:9122763"
                     /translation="MNDRDFMRYSRQILLEDIAIDGQQKLLASRVLIVGLGGLGAPAA
                     LYLAGAGVGTLVLADDDEVHISNLQRQILFTTEDVNQPKAQITRKRLKQLNPDITLIA
                     HQERLHGDTLQREVALADAVLDCTDNMATRQAINAACVAQNTPLITASAVGFGGQMMV
                     LTPPWAQGCYRCLWPDDAEPERNCRTAGILGPVVGVMGTLQALEAIKLLSGMETERNT
                     LRLFDARSSGWRHLALHRASHCPVCGGRNAHSV"
     gene            complement(254208..254843)
                     /gene="thiE"
                     /locus_tag="ECL_RS01230"
                     /old_locus_tag="ECL_00254"
                     /db_xref="GeneID:9122764"
     CDS             complement(254208..254843)
                     /gene="thiE"
                     /locus_tag="ECL_RS01230"
                     /old_locus_tag="ECL_00254"
                     /EC_number="2.5.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine phosphate synthase"
                     /protein_id="WP_013095011.1"
                     /db_xref="GeneID:9122764"
                     /translation="MYQPDFPCVPFRLGLYPVVDSVAWIERLLACGVRTIQLRIKDKR
                     DDEVEADVVAAIALGRRYDARLFINDYWRLAVKHQAYGVHLGQEDLETTDLSAIRDAG
                     LRLGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLTQLAAHVKRLADYP
                     TVAIGGISLERAPAVLDTGVGSIAVVSAITQAADWQAATAQLLKLAGAGDE"
     gene            complement(254843..256738)
                     /gene="thiC"
                     /locus_tag="ECL_RS01235"
                     /old_locus_tag="ECL_00255"
                     /db_xref="GeneID:9122765"
     CDS             complement(254843..256738)
                     /gene="thiC"
                     /locus_tag="ECL_RS01235"
                     /old_locus_tag="ECL_00255"
                     /EC_number="4.1.99.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine synthase ThiC"
                     /protein_id="WP_013095012.1"
                     /db_xref="GeneID:9122765"
                     /translation="MSTTKLTRREQRAQAQHFIDTLEGTAFPNSKRIYITGSQADIRV
                     PMREIQLSPTLIGGSKAHPQYEDNEAVPVYDTSGPYGDPAVAINVQQGLPKLRQPWID
                     ARNDCEELSDRSSAYTKARLADDGLDELRFAGLLTPKRAKAGKCVTQLHYARQGIVTP
                     EMEFIAIRENMGRERIRSEVLRHQHPGEGFGARLPENITPQFVRDEVAAGRAIIPANI
                     NHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYI
                     HETREWILRNSPVPIGTVPVYQALEKVNGIAEDLTWEAFRDTLLEQAEQGVDYFTIHA
                     GVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYEHFREICEICAAYDVSLSL
                     GDGLRPGSIRDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEE
                     LEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKE
                     DVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPFTARAYH
                     DETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAATQTIEVGMADMSKTFRAKGGEI
                     YLKKEEA"
     regulatory      complement(256818..256927)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00059"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="TPP riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="thiamine pyrophosphate"
                     /db_xref="RFAM:RF00059"
     gene            complement(256982..257479)
                     /locus_tag="ECL_RS01240"
                     /old_locus_tag="ECL_00256"
                     /db_xref="GeneID:9122766"
     CDS             complement(256982..257479)
                     /locus_tag="ECL_RS01240"
                     /old_locus_tag="ECL_00256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rsd/AlgQ family anti-sigma factor"
                     /protein_id="WP_013095013.1"
                     /db_xref="GeneID:9122766"
                     /translation="MLNQLESLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKE
                     SFMRLNEKALDDFCQSLVDYLSDGHFNIYERIIREMEGTTPYLAASKLYPLLEANTQQ
                     IMDYYDSTLENAIDHDNYLEFQQALSDLGEALEERFTLEDKLIALALDHGLDVSHEDN
                     VARPA"
     gene            257575..258348
                     /gene="nudC"
                     /locus_tag="ECL_RS01245"
                     /old_locus_tag="ECL_00257"
                     /db_xref="GeneID:9122767"
     CDS             257575..258348
                     /gene="nudC"
                     /locus_tag="ECL_RS01245"
                     /old_locus_tag="ECL_00257"
                     /EC_number="3.6.1.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) diphosphatase"
                     /protein_id="WP_013095014.1"
                     /db_xref="GeneID:9122767"
                     /translation="MDRIIEKSDLGWWIVSHEQKLWLPAGEIPYGAAEKFDLVGLPAL
                     KIGEWQGEPVWLIQQPRRNDMGSVRQVLDQDVGLFQLAGRGVQLAEFYRSHKYCGYCG
                     HTMHPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGIHTVLAGF
                     VEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMADYDSGEIVIDQK
                     ELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRADAE"
     gene            258389..259453
                     /gene="hemE"
                     /locus_tag="ECL_RS01250"
                     /old_locus_tag="ECL_00258"
                     /db_xref="GeneID:9122768"
     CDS             258389..259453
                     /gene="hemE"
                     /locus_tag="ECL_RS01250"
                     /old_locus_tag="ECL_00258"
                     /EC_number="4.1.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_013095015.1"
                     /db_xref="GeneID:9122768"
                     /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNAELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFTST
                     IKSKADVDKLPVPDPEQELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMYAEPLALHALLDKLAKSVTLYLNAQIKAGAQSVMIFDTWGGVLTGRD
                     YQQFSLYYMHKIVDGLLRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIA
                     DARRRVGDKVALQGNMDPSMLYAQPARIEEEVASILAGFGQGEGHVFNLGHGIHQDVP
                     PEHAGAFVEAVHRLSAQYHK"
     gene            259463..260131
                     /gene="nfi"
                     /locus_tag="ECL_RS01255"
                     /old_locus_tag="ECL_00259"
                     /db_xref="GeneID:9122769"
     CDS             259463..260131
                     /gene="nfi"
                     /locus_tag="ECL_RS01255"
                     /old_locus_tag="ECL_00259"
                     /EC_number="3.1.21.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease V"
                     /protein_id="WP_013095016.1"
                     /db_xref="GeneID:9122769"
                     /translation="MDLASLRAQQIELASSVIREDRLDKDPPQYIGGADVGFEQGGEV
                     TRAAMVLLKYPSLELVEYKVARIATTMPYIPGFLSFREYPALLAAWEQLSQKPDLLFV
                     DGHGISHPRRLGVASHFGLLVDVPTIGVAKKRLCGAFEPLSAEPGALAPLIDKGEQLA
                     WVWRSKARCNPLFIATGHRVSMDSALAWVQRCMKGYRLPEPTRWADAVASARPAFVRW
                     QEIQ"
     gene            260176..260766
                     /locus_tag="ECL_RS01260"
                     /old_locus_tag="ECL_00260"
                     /db_xref="GeneID:9122770"
     CDS             260176..260766
                     /locus_tag="ECL_RS01260"
                     /old_locus_tag="ECL_00260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjaG family protein"
                     /protein_id="WP_013095017.1"
                     /db_xref="GeneID:9122770"
                     /translation="MLQNPIHLRLEKLESWQHVTFMACLCERMYPNYAAFCKQTEFGD
                     GHIYRRILDLIWETLTVKDAKVNFDSQLEKLEEAIPVADDFDLYGVYPAIDACVALSE
                     LIHSRLSGETLEHAIEVSKASITTVAMLEMTQAGREMTDEELRANPAVEQEWDIQWEI
                     FRLLAECEERDIELIKGLRADLREAGESNIGIIFNQ"
     gene            260953..261225
                     /gene="hupA"
                     /locus_tag="ECL_RS01265"
                     /old_locus_tag="ECL_00261"
                     /db_xref="GeneID:9122771"
     CDS             260953..261225
                     /gene="hupA"
                     /locus_tag="ECL_RS01265"
                     /old_locus_tag="ECL_00261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017460010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein HU-alpha"
                     /protein_id="WP_002445246.1"
                     /db_xref="GeneID:9122771"
                     /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDAVQL
                     VGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     gene            261237..261929
                     /locus_tag="ECL_RS01270"
                     /old_locus_tag="ECL_00262"
                     /db_xref="GeneID:9122772"
     CDS             261237..261929
                     /locus_tag="ECL_RS01270"
                     /old_locus_tag="ECL_00262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010425913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1481 domain-containing protein"
                     /protein_id="WP_044159086.1"
                     /db_xref="GeneID:9122772"
                     /translation="MNSFNEGAATPLLSFWRGALALAGVLLLSACSHDTSLPPFTASG
                     YADNQGAVRIWRKDSGGEVHLLSAFSPWHNGNTSTAEYRWQGDDLSFIELNIYGKTPE
                     HVKVRFDDHGELSFMQREVNAQKQQLSSDQVALYRYRAGQIRQTSDALRQGRVVLRQG
                     RWHTDGTVTTCEGQTVKPDLESWATEHIQRRQRHSSMEVSVAWLEAPEGSQLLLVANE
                     DFCTWQPTEKSF"
     gene            complement(261977..263269)
                     /gene="purD"
                     /locus_tag="ECL_RS01275"
                     /old_locus_tag="ECL_00263"
                     /db_xref="GeneID:9122773"
     CDS             complement(261977..263269)
                     /gene="purD"
                     /locus_tag="ECL_RS01275"
                     /old_locus_tag="ECL_00263"
                     /EC_number="6.3.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010425912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylamine--glycine ligase"
                     /protein_id="WP_013095019.1"
                     /db_xref="GeneID:9122773"
                     /translation="MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQ
                     NVAIGVTDIPALLSFAQNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLE
                     GSKAFTKDFLARHNIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMT
                     LEEAEAAVQDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRV
                     GNADTGPNTGGMGAYSPAPVVTDEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMI
                     DKQGNPKVIEFNCRFGDPETQPIMLRMKSDLVELCLAACDGKLDEKTSEWDERASLGV
                     VIAAGGYPGHYNTGDEIHGLPLEETEGAKVFHAGTKLADDDRVLTNGGRVLCATALGH
                     TVAEAQKRAYALMADIHWNGSFSRQDIGYRAIAREQGE"
     gene            complement(263285..264874)
                     /gene="purH"
                     /locus_tag="ECL_RS01280"
                     /old_locus_tag="ECL_00264"
                     /db_xref="GeneID:9122774"
     CDS             complement(263285..264874)
                     /gene="purH"
                     /locus_tag="ECL_RS01280"
                     /old_locus_tag="ECL_00264"
                     /EC_number="2.1.2.3"
                     /EC_number="3.5.4.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="WP_013095020.1"
                     /db_xref="GeneID:9122774"
                     /translation="MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLL
                     ADKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMEQHDIAPIDMVV
                     VNLYPFAQTVAREGCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYSAIINEM
                     DANEGSLTLDTRFDLAIKAFEHTAAYDSMIANYFGSLVPAYHGESKDPSGRFPRTLNL
                     NFIKKQDMRYGENSHQQAAFYIEEEVKEASVATAQQVQGKALSYNNIADTDAALECVK
                     EFNEPACVIVKHANPCGVAVSTSILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAI
                     ISRQFVEVIIAPSASEEALKITAAKQNVRVLVCGQWAERVPGLDFKRVNGGLLVQDRD
                     LGMVTAADLRVVTKRQPTEQELRDALFCWKVAKFVKSNAIVYAKENMTIGIGAGQMSR
                     VYSAKIAGIKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAADEHGIAMIFTDMRHFRH"
     gene            265437..266989
                     /locus_tag="ECL_RS01285"
                     /old_locus_tag="ECL_16S01"
                     /db_xref="GeneID:9122775"
     rRNA            265437..266989
                     /locus_tag="ECL_RS01285"
                     /old_locus_tag="ECL_16S01"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9122775"
     gene            267169..270094
                     /locus_tag="ECL_RS01290"
                     /old_locus_tag="ECL_23S01"
                     /db_xref="GeneID:9127644"
     rRNA            267169..270094
                     /locus_tag="ECL_RS01290"
                     /old_locus_tag="ECL_23S01"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9127644"
     gene            270145..270260
                     /gene="rrf"
                     /locus_tag="ECL_RS01295"
                     /old_locus_tag="ECL_5S01"
                     /db_xref="GeneID:9127652"
     rRNA            270145..270260
                     /gene="rrf"
                     /locus_tag="ECL_RS01295"
                     /old_locus_tag="ECL_5S01"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:9127652"
     gene            270437..271366
                     /gene="metA"
                     /locus_tag="ECL_RS01300"
                     /old_locus_tag="ECL_00265"
                     /db_xref="GeneID:9127660"
     CDS             270437..271366
                     /gene="metA"
                     /locus_tag="ECL_RS01300"
                     /old_locus_tag="ECL_00265"
                     /EC_number="2.3.1.46"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="WP_013095021.1"
                     /db_xref="GeneID:9127660"
                     /translation="MPIRVQDELPAVNFLREENVFVMTTSRATGQEIRPLKVLILNLM
                     PKKIETENQFLRLLSNSPLQVDIQLLRIDARESRNTPSEHLNNFYCNFDDIREENFDG
                     LIVTGAPLGLVEFNDVAYWPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTR
                     TEKLSGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAQLIRDYTDLEILAETEDGD
                     AYLFASKDKRIAFVTGHPEYDPHTLAAEYFRDVEAGLNPDVPYNYFPKNDPQNKPRAT
                     WRSHGNLLFTNWLNYYVYQITPYDLRHMNPTLE"
     gene            271637..273238
                     /gene="aceB"
                     /locus_tag="ECL_RS01305"
                     /old_locus_tag="ECL_00266"
                     /db_xref="GeneID:9122776"
     CDS             271637..273238
                     /gene="aceB"
                     /locus_tag="ECL_RS01305"
                     /old_locus_tag="ECL_00266"
                     /EC_number="2.3.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase A"
                     /protein_id="WP_013095022.1"
                     /db_xref="GeneID:9122776"
                     /translation="MTQQATTVDELAFTQPYGEQEQQILTAEAVEFLTELVTRFTPQR
                     NKLLAARIHQQQEIDNGKLPGFISETASIRRGDWKIRGIPEDLQDRRVEITGPVERKM
                     VINAMNANVKVFMADFEDSLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNP
                     AVLICRVRGLHLPEKHVTWRGEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQA
                     WQEAAWWSEVFSYAEDRFNLPRGTIKATLLIETLPAVFQMHEILHALRDHIVGLNCGR
                     WDYIFSYIKTLKNHPDRVLPDRQVVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFI
                     PSKDAERNNQVLNKVKADKELEARNGHDGTWIAHPGLADTAMEVFNHVLGDNKNQLFV
                     TRDDDAPIAEEQLLAPCSGERTEEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAAT
                     AEISRTSIWQWIHHQKTLSNGKPVTKSLFRQMLAEEMRVIQDELGEHRFSSGRFDDAA
                     RLMEQITTSDDLIDFLTLPGYRLLA"
     gene            273256..274575
                     /gene="aceA"
                     /locus_tag="ECL_RS01310"
                     /old_locus_tag="ECL_00267"
                     /db_xref="GeneID:9122777"
     CDS             273256..274575
                     /gene="aceA"
                     /locus_tag="ECL_RS01310"
                     /old_locus_tag="ECL_00267"
                     /EC_number="4.1.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate lyase"
                     /protein_id="WP_072072188.1"
                     /db_xref="GeneID:9122777"
                     /translation="MEHLHMKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSV
                     NPECTLAQNGAVKMWHLLHGGSKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAA
                     DANLASSMYPDQSLYPANSVPSVVDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIV
                     ADAEAGFGGVLNAFELMKSMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKL
                     VAARLAADVLGVPTLVIARTDADAADLITSDCDPYDSEFITGERTSEGFYRTHAGIEQ
                     AISRGLAYAPYADLVWCETSTPDLALAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLD
                     DKTIASFQQQLSDMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEF
                     AAGKEGYTFVSHQQEVGTGYFDNVTTIIQGGASSVTALTGSTEEAQF"
     gene            274626..276365
                     /gene="aceK"
                     /locus_tag="ECL_RS01315"
                     /old_locus_tag="ECL_00268"
                     /db_xref="GeneID:9122778"
     CDS             274626..276365
                     /gene="aceK"
                     /locus_tag="ECL_RS01315"
                     /old_locus_tag="ECL_00268"
                     /EC_number="2.7.11.5"
                     /EC_number="3.1.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006810510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional isocitrate dehydrogenase
                     kinase/phosphatase"
                     /protein_id="WP_013095024.1"
                     /db_xref="GeneID:9122778"
                     /translation="MSRGLELLIAQTILQGFDAQYGRFLEVTSGAQQRFEHADWHAVQ
                     QAMKQRIHLYDHHVGLVVEQLRCITDGKNPDAAFLLRVKEHYTHLLPDYPRFEIAESF
                     FNSVYCRLFDHRSLSPERLFIFSSQPERRFRTIPRPLAKDFFPDHGWEKLLHRVLTDL
                     PLRLPWENKARDIGFIIAHLHESFGEEALSHCHLQVANELFYRNKAAWLVGKLVTPSA
                     TVPFLLPIHRTDDGELFVDTCLTTSAEASIVFGFARSYFMVYAPLPAALVEWLREILP
                     GKTTAELYMAIGCQKHAKTESYREYLRYVTTADEQFIEAPGIRGMVMLVFTLPGFDRV
                     FKVIKDTFAPQKEMTAAHVRACYQLVKEHDRVGRMADTQEFENFVLDKRQIDPALMAL
                     LLQEAPAKITDLGDKIAISHLYIERRMVPLNIWLEQADGQALKDAIEEYGNAIRQLAA
                     ANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELSGEPWYSV
                     SPGDVFPEEFRHWLCADPRIGPLFEEMHADLFRASYWRGLQTRIKNGHVEDVYAYRRK
                     QRFCIRFSPYHAG"
     gene            complement(276434..277261)
                     /gene="iclR"
                     /locus_tag="ECL_RS01320"
                     /old_locus_tag="ECL_00269"
                     /db_xref="GeneID:9122779"
     CDS             complement(276434..277261)
                     /gene="iclR"
                     /locus_tag="ECL_RS01320"
                     /old_locus_tag="ECL_00269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006688341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxylate bypass operon transcriptional
                     repressor IclR"
                     /protein_id="WP_013095025.1"
                     /db_xref="GeneID:9122779"
                     /translation="MVTTVPAKRGRKPAATPAAQQGGQVQSLTRGLKLLEWIAESHSS
                     VALTELAQQAGLPNSTTHRLLTTMQQLGFVRQVGELGHWAVGAHAFIVGSSFLQSRNL
                     LAIVHPILRKLMEESGETVNLAVLDQSDHQAIIIDQVQCTQLMRMSAPIGGKLPMHAS
                     GAGKAFLSQLSEEQVTGLLHRKGLHAYTHATLVSPVHLKEDLALTRKRGYSFDDEEHA
                     LGLRCIAACIFDEHREPFAAISISGPISRMTDDRVTELGALVIKAAKEVTLAYGGIR"
     gene            277455..281138
                     /gene="metH"
                     /locus_tag="ECL_RS01325"
                     /old_locus_tag="ECL_00270"
                     /db_xref="GeneID:9122780"
     CDS             277455..281138
                     /gene="metH"
                     /locus_tag="ECL_RS01325"
                     /old_locus_tag="ECL_00270"
                     /EC_number="2.1.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000096005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_013095026.1"
                     /db_xref="GeneID:9122780"
                     /translation="MSSKVEQLRAQLNERILVLDGGMGTMIQSYRLSEDDFRGERFAD
                     WPCDLKGNNDLLVLSKPQVIADIHNAYFEAGADIVETNTFNSTTIAMADYQMESLSAE
                     INYEAAKLARACADAWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDQLV
                     AAYRESTKALVEGGSDLILIETVFDTLNAKAAIYAVKEEFEALGVELPIMISGTITDA
                     SGRTLSGQTTEAFYNSLRHAEALSFGLNCALGPDELRQYVQELSRIAECYVTAHPNAG
                     LPNAFGEYDLDADTMAAQIREWAESGFLNIVGGCCGTTPEHIAAMSNAVAGLPPRKLP
                     ELPVACRLSGLEPLTIGDDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVE
                     SGAQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWEVIEKGLKCIQG
                     KGIVNSISMKEGVDIFIHHAKMVRRYGAAVVVMAFDEVGQADTRERKIEICRRAYKIL
                     TEEVGFPPEDIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVS
                     FSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRR
                     DDATERLLDLAEKYRGSKSDDAANVQQAEWRSWDVKKRLEYSLVKGITEFIEQDTEEA
                     RQQAARPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASK
                     EQGSSNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPADKILRTAREVNA
                     DLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVY
                     VQNASRTVGVVSALLSDTQRDDFVARTRKEYETVRIQHARKKPRTPPVTLQAARDNDL
                     AFDWASYTPPVAHRLGVQEVTANIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEE
                     AKRLFKDANDMLDKLSAEKALNPRGVVGLFPANRVGDDIEIYRDETRTHVLTVSHHLR
                     QQTEKVGFANYCLADFVAPKLSGKADYIGAFAVTGGLEEDALADAFEAQHDDYNKIMV
                     KAIADRLAEAFAEYLHERVRKVYWGYAANENLSNEELIRENYQGIRPAPGYPACPEHT
                     EKGTIWQLLDVEAHTGMKLTESFAMWPGASVSGWYFSHPDSKYFAVAQLQRDQIEDYA
                     LRKGMSVSEVERWLAPNLGYDAD"
     gene            281255..282886
                     /locus_tag="ECL_RS01330"
                     /old_locus_tag="ECL_00271"
                     /db_xref="GeneID:9122781"
     CDS             281255..282886
                     /locus_tag="ECL_RS01330"
                     /old_locus_tag="ECL_00271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na/Pi cotransporter family protein"
                     /protein_id="WP_013095027.1"
                     /db_xref="GeneID:9122781"
                     /translation="MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSSSVEKK
                     PLAFCAGIGVTALVQSSNATTLLVTSFVAQDLVALAPALVIVLGADVGTALMARILTF
                     DLSWLSPLLIFIGVIFFLGRKQTRAGQLGRVGIGLGLILLALELIVQAVTPITEANGV
                     QVIFASLTGDIMLDALIGAVFAIVSYSSLAAVLLTATLTAAGAISFPVALCLVIGANL
                     GSGLLAMLNNSAANAAARRVALGSLLFKLVGSLIILPFVHPLANLMDNLSLPKAELVI
                     YFHVFYNLVRCLAMVPFAEPMARFCERLIRDEPELDARLKPKHLDTSALDTPALALAN
                     AARETLRMGDAMETMLEGLQKVMHGEPREEKELRRLADDINVLYTAIKLYLARIPQDE
                     LAEEESRRWAEIIEMSLNLEQASDIVERMGSEIADKSLAARRAFSVEGLKELEALHEQ
                     LLSNLKLAMLVFFSSDVPSARRLRRNKHRFRILNRRYSHAHVERLHQQNVQSIETSSL
                     HLGLLGDMKRLNSLFCAVAYSVMEQPDEDDERDEY"
     gene            complement(282883..283170)
                     /locus_tag="ECL_RS01335"
                     /old_locus_tag="ECL_00272"
                     /db_xref="GeneID:9122782"
     CDS             complement(282883..283170)
                     /locus_tag="ECL_RS01335"
                     /old_locus_tag="ECL_00272"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011915487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative addiction module antidote protein"
                     /protein_id="WP_013095028.1"
                     /db_xref="GeneID:9122782"
                     /translation="MHKLTPYDPAIALVDDEEIAVFMADALETGDSAYIAKALGVIAR
                     AKGMSTISQQTGLSREQLYRSFSDKGNPTLKTTLAVMKALGLGLTIKPAGD"
     gene            complement(283177..283479)
                     /locus_tag="ECL_RS01340"
                     /db_xref="GeneID:44145309"
     CDS             complement(283177..283479)
                     /locus_tag="ECL_RS01340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015570164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="WP_029882644.1"
                     /db_xref="GeneID:44145309"
                     /translation="MKEIVQTESFRRWEQNLKDRRARTIIASRLFRLANGLAGDIKPV
                     GEGICELRIHFGPGYRIYFKDQGNCIIVLLCGGDKSSQARDILMAKMLSNVSQWQE"
     gene            283677..284546
                     /gene="rluF"
                     /locus_tag="ECL_RS01345"
                     /old_locus_tag="ECL_00274"
                     /db_xref="GeneID:9122784"
     CDS             283677..284546
                     /gene="rluF"
                     /locus_tag="ECL_RS01345"
                     /old_locus_tag="ECL_00274"
                     /EC_number="5.4.99.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine(2604) synthase RluF"
                     /protein_id="WP_013095030.1"
                     /db_xref="GeneID:9122784"
                     /translation="MLPTQSIRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGD
                     QVMPGDVVKVNGQLIEPRDAEDLVFIALNKPVGIVSTTEDGERDNIVDFVNHSSRIFP
                     IGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYIVTVNKPVTDEFIRGMGAGVPIL
                     GTVTKKCKVKKEAPFAFRITLVQGLNRQIRRMCEYFGYEVTKLERTRIMNVSLSGIPL
                     GEWRDLTDDELIELFKLIENSSSEAKPKAKAKPKTQAIKRPVVKAPQSEEKGRGKPAG
                     KRFTQPGRKKKGR"
     gene            complement(284614..285558)
                     /gene="panS"
                     /locus_tag="ECL_RS01350"
                     /old_locus_tag="ECL_00275"
                     /db_xref="GeneID:9122785"
     CDS             complement(284614..285558)
                     /gene="panS"
                     /locus_tag="ECL_RS01350"
                     /old_locus_tag="ECL_00275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketopantoate/pantoate/pantothenate transporter
                     PanS"
                     /protein_id="WP_013095031.1"
                     /db_xref="GeneID:9122785"
                     /translation="MLSAITRLFPLWALLLSILAYYTPTTFTGIGPWVTTLLMLIMFG
                     MGVHLKIDDFKRVLSRPAPVAAGIFLHYLVMPLAAWLLAMAFKMPPDLSAGMVLVGSV
                     ASGTASNVMIYLAKGDVALSVTISSVSTLVGVIATPLLTRLYVDAHIQVDVMGMLLSI
                     LQIVVIPIALGLVIHHLFPRVVKAVEPYLPAFSMVCILAIISAVVAGSASHIASVGFV
                     VIIAIVLHNTIGLLGGYWGGKLFGFDESTCRTLAIEVGMQNSGLAAALGKIYFSPLAA
                     LPGALFSVWHNLSGSLLAGYWSGKPIEEKPQKTDEYRL"
     gene            complement(285651..287000)
                     /gene="lysC"
                     /locus_tag="ECL_RS01355"
                     /old_locus_tag="ECL_00276"
                     /db_xref="GeneID:9122786"
     CDS             complement(285651..287000)
                     /gene="lysC"
                     /locus_tag="ECL_RS01355"
                     /old_locus_tag="ECL_00276"
                     /EC_number="2.7.2.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine-sensitive aspartokinase 3"
                     /protein_id="WP_013095032.1"
                     /db_xref="GeneID:9122786"
                     /translation="MTSFVVAKFGGTSVADYDAMNRSADVVLADPNTRLVVLSASAGV
                     TNLLVSLSEGLEATERFVKLDALRKIQFDILERLQNPNVIREEVERLLENITTLAEAA
                     SLATSTALTDELVSHGELMSTLLFVEIMRERNVQAQWFDVRKIMRTSDRFGRAEPDVE
                     ALAELTNQQLVPRLDEGIVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALHATRVD
                     IWTDVPGIYTTDPRVVSAAKRIDVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFV
                     GSSKDPKAGGTLVCKKTENPPLFRALALRRKQTLVTLHSHNMLHSRGFLAEVFGILAR
                     HNISVDLITTSEVSIALTLDTTGSTSTGDTLLTQSLLIELSELCRVEVEENLALVAII
                     GNKLSRACGVGKEVFGVLDPFNIRMICYGASSYNLCFLVPAEQAEQVVQKLHQNLFE"
     gene            287376..289025
                     /gene="pgi"
                     /locus_tag="ECL_RS01360"
                     /old_locus_tag="ECL_00277"
                     /db_xref="GeneID:9122787"
     CDS             287376..289025
                     /gene="pgi"
                     /locus_tag="ECL_RS01360"
                     /old_locus_tag="ECL_00277"
                     /EC_number="5.3.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_013095033.1"
                     /db_xref="GeneID:9122787"
                     /translation="MKNINPTQTAAWQALQKHFDEMKDVTIAELFAKDADRFNKFSAT
                     FDDLMLVDFSKNRITEETLAKLQDLAKETELADAIKSMFSGEKINRTEDRAVLHVALR
                     NRSNTPIIVDGKDVMPEVNAVLEKMKAFSEAIISGSWKGYTGKAITDVVNIGIGGSDL
                     GPFMVTEALRPYKNHLNMHFVSNVDGTHIAEVLKNVNPETTLFLVASKTFTTQETMTN
                     AHSARDWFLKIAGDNKHVAKHFAALSTNGKAVGEFGIDTANMFEFWDWVGGRYSLWSA
                     IGLSIILSVGFDNFVELLSGAHAMDKHFSTTAPEKNLPVLLALIGIWYNNFFGAETEA
                     ILPYDQYMHRFAAYFQQGNMESNGKYVDRNGNAVDYQTGPIIWGEPGTNGQHAFYQLI
                     HQGTKMVPCDFIAPAITHNPLSDHHPKLLSNFFAQTEALAFGKSREVVEQEYRDQGKD
                     PATLEHVVPFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGAILNIFTFDQW
                     GVELGKQLANRILPELGDDKAISSHDSSTNGLINRYKAWRA"
     gene            289393..289635
                     /locus_tag="ECL_RS01365"
                     /old_locus_tag="ECL_00278"
                     /db_xref="GeneID:9122788"
     CDS             289393..289635
                     /locus_tag="ECL_RS01365"
                     /old_locus_tag="ECL_00278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095034.1"
                     /db_xref="GeneID:9122788"
                     /translation="MKKVLYGIFAISALAATSVYAAPVQVGEAAGSAATSASAGSSTA
                     ASTSTVSSAVGVALAATGGGDGSNTGTTTTTTTSTQ"
     gene            289699..290337
                     /locus_tag="ECL_RS01370"
                     /old_locus_tag="ECL_00279"
                     /db_xref="GeneID:9122789"
     CDS             289699..290337
                     /locus_tag="ECL_RS01370"
                     /old_locus_tag="ECL_00279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjbF family lipoprotein"
                     /protein_id="WP_013095035.1"
                     /db_xref="GeneID:9122789"
                     /translation="MKRPAIILICLLLQACSATTKGLGNSLWDSIFGTPGVHLTDDEL
                     QNMPYASQYMQLNDGPQLFVVLAFDENGQQKWVTQDQATIVTQHSRIVKTLLGGDNLL
                     EVNNLAADPLSKPNQITDGASWTRTMGWTEHKQVRYATARSTFRWDGTDSVRVGSDET
                     RVRVLDEEVTTDRATWHNRFWVDDEGQIRQSLQYLGAGFFPVKTTLIKAAKS"
     gene            290334..291071
                     /locus_tag="ECL_RS01375"
                     /old_locus_tag="ECL_00280"
                     /db_xref="GeneID:9122790"
     CDS             290334..291071
                     /locus_tag="ECL_RS01375"
                     /old_locus_tag="ECL_00280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="capsule biosynthesis GfcC family protein"
                     /protein_id="WP_013095036.1"
                     /db_xref="GeneID:9122790"
                     /translation="MKTLIRVALIASFATPLAWSAGTVKVYTPDSTQPKTLTNAGNLI
                     DLVGQPRLANSWWTGAVIAERQATVAAEQKHKALLARLTGLAEQEDGDDAAAINSLRQ
                     QLLALKVTGRQNINLDPDEVRVTEKGNPALEGDYTLWLPAQPSTITVMGLISSPGKKP
                     FTPGRDVASYLDEQSLLSGADNSYAWVIYPDGNTQKAPVAYWNKRHVEPMPGSIIFVG
                     FADHFWTKAYDGLNADILHSLTQRIPE"
     gene            291071..293167
                     /locus_tag="ECL_RS01380"
                     /old_locus_tag="ECL_00281"
                     /db_xref="GeneID:9122791"
     CDS             291071..293167
                     /locus_tag="ECL_RS01380"
                     /old_locus_tag="ECL_00281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjbH domain-containing protein"
                     /protein_id="WP_013095037.1"
                     /db_xref="GeneID:9122791"
                     /translation="MKKTYLYSMLALCVSAACHAETYPAPIGPSQSDFGGVGLLQTPT
                     ARMAREGEISLNYRDNDQYRYYSASVQLFPWLETTLRYTDVRTKQYSSVDAFSGDQTY
                     KDKAFDLKLRLWEESYWMPQVSVGAKDIGGTGLFDAEYIVASKAWGPFDFSLGLGWGY
                     LGTSGNVKNPFCTYSDKFCYRDNSYQKAGSINGDQMFHGPAALFGGVEYQTPWQPLRL
                     KLEYEGNDYSQEFAGKIEQKSKFNVGAIYRVTDWADVNLSYERGNTVMFGFTLRTNFN
                     DMRPHYNDNARPAYQPEPQDAILQHSVVANQLTLLKYNAGLADPKIQVKGDTLYVTGE
                     QVKYRDSREGIERANRIIMNDLPEGIRTIRVTENRLNLPQVTTETDVASLKRHLEGEP
                     LGHETELVQKRVEPIVPETTEQGWYIDKSRFDFHIDPVLNQSVGGPENFYMYQLGVMA
                     TADLWVTDHLLTTGSLFGNIANNYDKFNYTNPPNDTKLPRVRTRVREYVQNDAYVNNL
                     QANYFQYFGNGFYGQVYGGYLETMYGGAGAEVLYRPVDSNWAFGIDANYVKQRDWRSA
                     QDMMKFTDYSVKTGHLTAYWTPSFAQDVLVKASVGQYLAGDKGGTLDISKHFDSGVVV
                     GGYATITNVSPDEYGEGDFTKGVYVSIPLDLFSSGPTRSRAAIGWTPLTRDGGQQLGR
                     KFQLYDMTSDKNINFR"
     gene            complement(293223..293675)
                     /locus_tag="ECL_RS01385"
                     /old_locus_tag="ECL_00282"
                     /db_xref="GeneID:9122792"
     CDS             complement(293223..293675)
                     /locus_tag="ECL_RS01385"
                     /old_locus_tag="ECL_00282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008786912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_013095038.1"
                     /db_xref="GeneID:9122792"
                     /translation="MERRPTGVRNVTCGENVTLYEPCNLYDCVLGNGVFIGPFVEIQG
                     NTRIGDESKIQSHTFICEYVTLGERCFIGHGVMFANDMFRDGKPNTDRNSWGRITVGN
                     DVSIGSGATILAVSICDGVVIGAGSVVTKSITEKGVYAGNPARLLRRL"
     gene            293772..294182
                     /gene="psiE"
                     /locus_tag="ECL_RS01390"
                     /old_locus_tag="ECL_00283"
                     /db_xref="GeneID:9122793"
     CDS             293772..294182
                     /gene="psiE"
                     /locus_tag="ECL_RS01390"
                     /old_locus_tag="ECL_00283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-starvation-inducible protein PsiE"
                     /protein_id="WP_000202963.1"
                     /db_xref="GeneID:9122793"
                     /translation="MTSLTRPRVEFISTILQTVLNLGLLSLGLILVVFLGKETVHLAD
                     VLFAPEQTSKYALVEGLVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLII
                     VDHKSPLDVLIYSAAILLLVITLWLCNSKRLKRE"
     gene            294329..296023
                     /locus_tag="ECL_RS01395"
                     /old_locus_tag="ECL_00284"
                     /db_xref="GeneID:9122794"
     CDS             294329..296023
                     /locus_tag="ECL_RS01395"
                     /old_locus_tag="ECL_00284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012907712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS transporter subunit EIIC"
                     /protein_id="WP_013095039.1"
                     /db_xref="GeneID:9122794"
                     /translation="MAHSSILERITDVSQKLASEVHLRSLRDSFIISVPFLVLAGLFI
                     MLNYVFLDPKGILSGLLSTDTLVQLRNIGERVLNGTMNILSLMLVILIAYHIASKKKH
                     PTPVIPAMVALAVFYALMPIETVQTLADGQQARLTGMVSYGSTNAGGVFLAILTAVLS
                     TNLFLWISKNKKLQIRLGDDVPSMVVQSFQSMFSIMLTVAIFALVAFSVNLFLHTEIP
                     TLIQHLIQAPLVHLTTNLSGFLVLTTLTNLLFSLGIHPGGIINPILEPPLLVAMQENM
                     SAFASGQIPPHIIVLPFRDLYGHMGGTGSTLALLLAVFVRSHMSSHRNFSRTVIAPGI
                     FNINEPVIFGFPVLYNPLMMIPFILYPQINFTIAYFATAWGWVSKIVAYVPWSVPPLI
                     SGWLGSGGDFRNVILQILLLALGVVIYLPFLTAYERSLIKRSNETIINTLASESEITL
                     QEDNDIHRLDGKTIILACNEGMSTSLMASKMRKYCESQNCTLNVYAVNAGKLVDEYKN
                     AQLILLGPQIAYLQETILQDINHHCPVIPLDPQHFSKLDGPEVIHAALPYFKKESV"
     gene            296020..297063
                     /locus_tag="ECL_RS01400"
                     /old_locus_tag="ECL_00285"
                     /db_xref="GeneID:9122795"
     CDS             296020..297063
                     /locus_tag="ECL_RS01400"
                     /old_locus_tag="ECL_00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012907711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_013095040.1"
                     /db_xref="GeneID:9122795"
                     /translation="MINCAYIGFGKSATRYHLPYVLCRKDKYNVKRIYDIARKPEVEA
                     QPHYQHICFTSRLQDILEDNTLQLVVICTHPDSHFEYARLCLAHGKNVLVEKPFTTTP
                     EEAKTLFALAREKGLTVSPFQNRRFDSCYLTMKQAIESGKLGEIVEIESHFDYFRPAS
                     ETCPGSYFDGAFYGLGVHTLDQIIALLGRPQQVGYHLQRQRNPLNPDDAFTVHLYYPK
                     TTAIVKTSHLVKIPAPRFTVHGTRGSFIRYGIDQQETSLKAGIMPGHPGFGEDSECAV
                     LEYIDDAGCSVREELSAVPGDYGRVYDALYDTLSSGKANYVSEHEALTNLDILQKAFQ
                     QPTPAIVSLEEEA"
     gene            297066..297926
                     /locus_tag="ECL_RS01405"
                     /old_locus_tag="ECL_00286"
                     /db_xref="GeneID:9122796"
     CDS             297066..297926
                     /locus_tag="ECL_RS01405"
                     /old_locus_tag="ECL_00286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015963789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095041.1"
                     /db_xref="GeneID:9122796"
                     /translation="MKRLLNCRASDFRGPITGDSLRDAISASEGRVIMAEIAVQAPPL
                     FAEVTNAELLCAFGADLLLLKGIHFQRPALNGGEERFGADPVSQVKCLTGRLTGVNFE
                     VLPADDLSSPGAFLPAHLEAVRHADFYCLTGYDKPGVTAGRMCQAIAALRAQTNKLIL
                     AAKFYNSGLAQPQEYAGYISAGADGAIFSAPGGCRGASEGRVSHIAQAVQSLGGLAIT
                     TLSSSQEGADCATVRDIGLASKRCGSDMHNFGDAGVAGMADPEALNALSLAIRGRRHT
                     WVRMAASLSR"
     gene            297967..298671
                     /locus_tag="ECL_RS01410"
                     /old_locus_tag="ECL_00287"
                     /db_xref="GeneID:9122797"
     CDS             297967..298671
                     /locus_tag="ECL_RS01410"
                     /old_locus_tag="ECL_00287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012907709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_013095042.1"
                     /db_xref="GeneID:9122797"
                     /translation="MPKYMEIYHEVRRRIVVGIYAPDKKLPEGARLAAEFGCSELTIT
                     KALDLLVREGLVLRKRGLGSFVKRQVSAASNSHLIGTAQRCATQGKTLTTRVQLYTAV
                     PASADIAQKLQIPEGELVHEIHRVRVIAEIPSIVEYTWMPVALFPRLALSHVQHSIYA
                     YITHELGCTVHSAHMKVTGRNASEQERVWLELTEPTTLIQVEQTAFLDNGKLFEYSCA
                     RHLWHTFNFETDFVRV"
     gene            complement(298775..299665)
                     /gene="malG"
                     /locus_tag="ECL_RS01415"
                     /old_locus_tag="ECL_00288"
                     /db_xref="GeneID:9122798"
     CDS             complement(298775..299665)
                     /gene="malG"
                     /locus_tag="ECL_RS01415"
                     /old_locus_tag="ECL_00288"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter permease MalG"
                     /protein_id="WP_013095043.1"
                     /db_xref="GeneID:9122798"
                     /translation="MAMVQPKSQKLRLLATHLGLLIFIAAIMFPLLMVIAISLRSGNF
                     ATGSLIPDEISWEHWKLALGFSVEHADGRVTPPPFPVLLWLWNSVKVATITAIGIVTL
                     STTCAYAFARMKFPGKASLLKGMLIFQMFPAVLSLVALYALFDRLGQYVPFIGLNTHG
                     GVIFAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVV
                     FILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITV
                     VFLLAQRWLVNGLTAGGVKG"
     gene            complement(299680..301224)
                     /gene="malF"
                     /locus_tag="ECL_RS01420"
                     /old_locus_tag="ECL_00289"
                     /db_xref="GeneID:9122799"
     CDS             complement(299680..301224)
                     /gene="malF"
                     /locus_tag="ECL_RS01420"
                     /old_locus_tag="ECL_00289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter permease MalF"
                     /protein_id="WP_013095044.1"
                     /db_xref="GeneID:9122799"
                     /translation="MDVIKKKHWWQSDVLKWSAIGLLCLLVGYLVVLMYVQGEYLFAI
                     MTLILSSAGLYIFANRKAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSSTNQLAQ
                     ERATQVLLDSSYQAGKTFNFGLYPAGDEWKLALTDGESGKTYISDAFKFGGEQKLALK
                     EAPALPEGERANLRIITQNRQALTQLTAVLPDESKVTMSSLRQFSGTQPLYTLADDGT
                     LTNNQSGVKYRPNNDIGFYQSVNADGSWGDDKLSPGYTVTIGWDNFTRVFTDEGIQKP
                     FFAIFVWTVVFSVLTVLLTVAVGMVLACLVQWEALKGKAIYRVLLILPYAVPSFISIL
                     IFKGLFNQSFGEINMMLSALFGIKPAWFSDPTTARSMIIIVNTWLGYPYMMILCMGLL
                     KAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNG
                     GPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKA
                     TRMKFD"
     gene            complement(301350..302540)
                     /gene="malE"
                     /locus_tag="ECL_RS01425"
                     /old_locus_tag="ECL_00290"
                     /db_xref="GeneID:9122800"
     CDS             complement(301350..302540)
                     /gene="malE"
                     /locus_tag="ECL_RS01425"
                     /old_locus_tag="ECL_00290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000695396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose/maltodextrin ABC transporter
                     substrate-binding protein MalE"
                     /protein_id="WP_013095045.1"
                     /db_xref="GeneID:9122800"
                     /translation="MKIKTGARVFALSALAAMMISAPALAKIEEGKLVIWINGDKGYN
                     GLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLL
                     AEVTPDKAFQDKLFPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPK
                     LDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGL
                     TFLVDLIKNKHINADTDYSIAEAAFNKGETAMTINGPWAWTNIDKSKINYGVTLLPTF
                     NGKPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLDEVNKDKPLGAVALKSFQ
                     DQLAKDPRIAATMDNAQKGEIMPNIPQMAAFWYATRTAVINAASGRQTVDAALKDAQG
                     RITK"
     gene            302912..304021
                     /gene="malK"
                     /locus_tag="ECL_RS01430"
                     /old_locus_tag="ECL_00292"
                     /db_xref="GeneID:9122802"
     CDS             302912..304021
                     /gene="malK"
                     /locus_tag="ECL_RS01430"
                     /old_locus_tag="ECL_00292"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011915502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose/maltodextrin ABC transporter ATP-binding
                     protein MalK"
                     /protein_id="WP_008500080.1"
                     /db_xref="GeneID:9122802"
                     /translation="MASVQLRNVTKAWGDVVVSKDINLDIHEGEFVVFVGPSGCGKST
                     LLRMIAGLETITSGDLLIGDTRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFGLKL
                     AGAKKEVINQRVTQVAEVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEP
                     LSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP
                     LELYHYPADRFVAGFIGSPKMNFLPVKVTATAIEQVQVELPNRQQVWLPVDSANVQVG
                     ANMSLGIRPEHLLPSHIADVTLEGEVQVVEQLGHETQIHIQIPAIRQNLVYRQNDVVL
                     VEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV"
     gene            304093..305400
                     /locus_tag="ECL_RS01435"
                     /old_locus_tag="ECL_00293"
                     /db_xref="GeneID:9122803"
     CDS             304093..305400
                     /locus_tag="ECL_RS01435"
                     /old_locus_tag="ECL_00293"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000973663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltoporin"
                     /protein_id="WP_013095047.1"
                     /db_xref="GeneID:9122803"
                     /translation="MMITLRKVPLALAIAAGIMSAQAGAVDFKGYARSGIGWTGSGGE
                     QQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWEST
                     SPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLG
                     FGKLSLAATRSSESGGSATFADRDANGDRVYDNVVPNDVFDVRLAGLETNPGGTLELG
                     VDYGHTNIPDDYYLQPGASKDGWLFTAEHTQSMMKGFNKFVLQYGTDSMTSNGKGIPQ
                     GGSVDNDGSMWRVLDHGAITLADRWDLMYVGMYQNIDRDNNNGTEWWTVGVRPMFKWT
                     PIMSTLLEVGYDNVKSQRTDEKNSQYKITLAQQWQAGDSIWSRPAIRVFATYAKWDEK
                     WGYANNSDTGYTSGVAYSDTSAKTFSRGDNDEWTFGAQMEIWW"
     gene            305515..306459
                     /gene="malM"
                     /locus_tag="ECL_RS01440"
                     /old_locus_tag="ECL_00294"
                     /db_xref="GeneID:9122804"
     CDS             305515..306459
                     /gene="malM"
                     /locus_tag="ECL_RS01440"
                     /old_locus_tag="ECL_00294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012134648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltose operon protein MalM"
                     /protein_id="WP_013095048.1"
                     /db_xref="GeneID:9122804"
                     /translation="MKMKKSLVALCLSAGLLACVPAVSFADVNFVPQNTSAAPAIPAA
                     ALQQLTWTPVDQSKTQSTQLSMGGQQLNVPGISGPVAAYSVPANIGELTLTLTSEVNK
                     QTSVFAPNVLILDQNMTPSAFFPSDYFSYQEPGVMSADRLEGVMRLTPALGQQKIYVL
                     VFTTEKDLQQTTKLVDPAKAYAKGTGNSVPDIPDPLARHTTDGLVKLKVSTNSASSVL
                     VGPLFGSSGTGPVTVGNTAAPVYTAPAATAAATAAPAPAKKAEPVLNDTEEYFNNAIK
                     QAVKRGDVDKALKLLDEAERLGSTTARSTFISSVKGKG"
     gene            306640..307137
                     /gene="ubiC"
                     /locus_tag="ECL_RS01445"
                     /old_locus_tag="ECL_00295"
                     /db_xref="GeneID:9122805"
     CDS             306640..307137
                     /gene="ubiC"
                     /locus_tag="ECL_RS01445"
                     /old_locus_tag="ECL_00295"
                     /EC_number="4.1.3.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_709881.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate lyase"
                     /protein_id="WP_013095049.1"
                     /db_xref="GeneID:9122805"
                     /translation="MSHPALTQLRSLRYFDQIPALDPQQLDWLLLEDSMTKRFEQQGK
                     TVTVTMIQEGFVTSADIASELPLLPKEERYWLREILLCADGEPWLAGRTVVPESTLSG
                     PELALQRLGNTPLGRYLFTSSELTRDFIEIGRDAELWGRRSRLRLSGKPLILTELFLP
                     ASPLY"
     gene            307151..308020
                     /gene="ubiA"
                     /locus_tag="ECL_RS01450"
                     /old_locus_tag="ECL_00296"
                     /db_xref="GeneID:9122806"
     CDS             307151..308020
                     /gene="ubiA"
                     /locus_tag="ECL_RS01450"
                     /old_locus_tag="ECL_00296"
                     /EC_number="2.5.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="WP_013095050.1"
                     /db_xref="GeneID:9122806"
                     /translation="MEWSLTQNKLLAYHRLMRTDKPIGALLLLWPTLWALWVATPGVP
                     PLWILGVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGQVTEKEARVLFIV
                     LVLLSFLLVLTLNTMTILLSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAA
                     VSESVPLSCWLMFLANILWAVAYDTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGIL
                     QVAVLALMVAIGRLNGLNWEFYWSVLVAGLLFAYQQKLIAKRERDACFKAFMNNNYVG
                     LVLFLGLAMSYFG"
     gene            complement(308119..310539)
                     /gene="plsB"
                     /locus_tag="ECL_RS01455"
                     /old_locus_tag="ECL_00298"
                     /db_xref="GeneID:9122807"
     CDS             complement(308119..310539)
                     /gene="plsB"
                     /locus_tag="ECL_RS01455"
                     /old_locus_tag="ECL_00298"
                     /EC_number="2.3.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate 1-O-acyltransferase PlsB"
                     /protein_id="WP_013095051.1"
                     /db_xref="GeneID:9122807"
                     /translation="MSGWPRIYYKLLNLPLSVLVKSKSIPAEPALELGLDTSRPIMYV
                     LPYNSKADLLTLRAQCLAHDLPDPLEPLEVDGTLLPRYVFIHGGPRVFTYYTPKEESI
                     KLFHDYLDLHRSNPDLDVQMVPVSVMFGRRPGREKGEENPPLRMLNGIQKFFAVSWLG
                     RDSFVRFSPSVSLRRMADEHGTDKIIAQKLARVARMHFARQRLAAVGPRLPARQDLFN
                     KLLASKAIARAVEDEARSKKISHEKAQQNAIALMEEIAANFSYEMIRLSDRILGFTWN
                     RLYQGINVHNAERVRQLAHDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGIN
                     LNFWPAGPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFVEGGRSRTG
                     RLLDPKTGTLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGATKEKESLP
                     QMLRGLSKLRNLGQGYVNFGEPMPLMTYLNNHVPDWRESIDPIEAVRPAWLTPTVNGI
                     AAELMVRINNAGAANAMNLCCTALLASRQRSLTREQLTEQLDCYLDLMRNVPYSVDST
                     TPASTASELIDHALQMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIAHMLMLPSLMA
                     AIITQHRRISRQELLRHVETLYPMLKAELFLRWSKDELAIELDKMTEELRRQGLITVV
                     NDELHINPSRSRTLQLLAAGARETLQRYAITFWLLSANPSINRGTLEKESRTLAQRLS
                     VLHGINAPEFFDKAVFSSLVLTLRDEGFISDTGDAEPEETLKVYQMLAELITSDVRLT
                     IESATQGE"
     gene            310694..311062
                     /locus_tag="ECL_RS01460"
                     /old_locus_tag="ECL_00299"
                     /db_xref="GeneID:9122808"
     CDS             310694..311062
                     /locus_tag="ECL_RS01460"
                     /old_locus_tag="ECL_00299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017382619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_013095052.1"
                     /db_xref="GeneID:9122808"
                     /translation="MANNTTGLTRIIKAAGYSWKGFRAAWVNEAAFRQEGVAAIVAVI
                     IACFLDVDAITRVLLIGSVLLVMIVEILNSAIEAVVDRIGSDFHELSGRAKDMGSAAV
                     LLAIITAVITWVTLLWSHFR"
     gene            311171..311779
                     /gene="lexA"
                     /locus_tag="ECL_RS01465"
                     /old_locus_tag="ECL_00300"
                     /db_xref="GeneID:9122809"
     CDS             311171..311779
                     /gene="lexA"
                     /locus_tag="ECL_RS01465"
                     /old_locus_tag="ECL_00300"
                     /EC_number="3.4.21.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000646075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="repressor LexA"
                     /protein_id="WP_013095053.1"
                     /db_xref="GeneID:9122809"
                     /translation="MKALTTRQQEVFDLIRDHIGQTGMPPTRAEIAQRLGFRSPNAAE
                     EHLKALARKGVIEIVSGASRGIRLLVEEETGIPLVGRVAAGEPLLAQQHIEGHYQVDP
                     GMFKPSADFLLRVSGMSMKDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKK
                     QGNTVQLLPENNEFSPIVVDLREQNFSIEGLAVGVIRNGEWL"
     gene            311844..313181
                     /gene="dinF"
                     /locus_tag="ECL_RS01470"
                     /old_locus_tag="ECL_00302"
                     /db_xref="GeneID:9122811"
     CDS             311844..313181
                     /gene="dinF"
                     /locus_tag="ECL_RS01470"
                     /old_locus_tag="ECL_00302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter DinF"
                     /protein_id="WP_044159015.1"
                     /db_xref="GeneID:9122811"
                     /translation="MSLLTASDKALWRLALPMIFSNITVPLLGLVDTAVIGHLDSPIY
                     LGGVAIGATATSFLFMLLLFLRMSTTGLTAQAYGAKDPLRLARALVQPLILALGAGAL
                     IAILRTPLIDLALHVVGGSEAVLEQARRFLEIRWLSAPASLANLVLLGWLLGVQYARA
                     PVILLVVGNLLNIVLDLWLVMGLHMNVQGAALATAIAEYGTFILGLWMVWRVLVMRGI
                     SLALLKSAWRGNIRTLLALNRDIMLRSLLLQLCFGALTVFGARLGPDIVAVNAVLMTL
                     LTFTAYALDGFAYAVEAHSGQAYGARESGQLRDVWRAACRQSGLVALTFALIYACFGE
                     QIIALLTSLPALRELASHYLIWQVILPVVGVWCYLLDGMFIGATRGAEMRNSMAVAAA
                     GFALTLLTLPWLGNHGLWLSLAVFLALRGLSLGFIWHRHWQNNTWLPSRNDIS"
     gene            313302..313511
                     /locus_tag="ECL_RS01475"
                     /old_locus_tag="ECL_00303"
                     /db_xref="GeneID:9122812"
     CDS             313302..313511
                     /locus_tag="ECL_RS01475"
                     /old_locus_tag="ECL_00303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CsbD family protein"
                     /protein_id="WP_020686626.1"
                     /db_xref="GeneID:9122812"
                     /translation="MNKDEIGGNWKQFKGKAKEQWGKLTDDDMTVIEGKRDQLVGKIQ
                     ERYGYEKDQAEKEVGDWEKRNDYRW"
     gene            complement(313581..314093)
                     /gene="zur"
                     /locus_tag="ECL_RS01480"
                     /old_locus_tag="ECL_00304"
                     /db_xref="GeneID:9122813"
     CDS             complement(313581..314093)
                     /gene="zur"
                     /locus_tag="ECL_RS01480"
                     /old_locus_tag="ECL_00304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake transcriptional repressor Zur"
                     /protein_id="WP_013095057.1"
                     /db_xref="GeneID:9122813"
                     /translation="MDKSTKELLAQAEKLCAQRNVRLTPQRLEVLRLMTLQQGAISAY
                     DLLDLLRESEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFIC
                     DRCGVVKEEGAEGVEDIMHTLAARMGFALRHNVIEAHGLCSACVEVEACRHQDACHHD
                     HSILVKKKPR"
     gene            314209..314697
                     /locus_tag="ECL_RS01485"
                     /old_locus_tag="ECL_00305"
                     /db_xref="GeneID:9122814"
     CDS             314209..314697
                     /locus_tag="ECL_RS01485"
                     /old_locus_tag="ECL_00305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_023620296.1"
                     /db_xref="GeneID:9122814"
                     /translation="MKKPDCIRHWRDVEEPDNSTYPDSNELFSIGAPLARHLGLRRIG
                     IHHERLPPGRRTSYPHAESDEEEFIYVLEGYPEAWINGYLWKLEPGDSVGFPAGTGVC
                     HTFINNTEEEVRLLVVGEANKKHNRIYYPLNPEYAATREDRWVDHPPQFFGPHDGKPG
                     KK"
     gene            314867..316177
                     /locus_tag="ECL_RS01490"
                     /old_locus_tag="ECL_00306"
                     /db_xref="GeneID:9122815"
     CDS             314867..316177
                     /locus_tag="ECL_RS01490"
                     /old_locus_tag="ECL_00306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraF"
                     /protein_id="WP_013095059.1"
                     /db_xref="GeneID:9122815"
                     /translation="MKKHFKFSVVSIAVSLFMANQAGAANTWTESRSDAMGGTGVASG
                     SYGSGALINPALLAKAKPDDDVTVILPSVGVQVTDEDNLQDEIDTINDKINHYKDVVD
                     SLTPIEVITNPLGSIDQFQGAAKDLADELDYLKGKTARATAGAGIAVSIPNDVLSVAF
                     MAKGYAHGRVSSSIDQQDIDYLRSIQNSDAVAAGVALDAALNGTDQITKNLNSTASGR
                     AAIVSDYGVAIARQFDLGGVPVSLGVTPKLQKTWIYNYTTSIYDYDSNKWNDSRYRKD
                     DTGFNVDAGIAADFGENWTVGVSGQNLMSRDIDTKDIRIRNGRTGEVVSYKDTYQIRP
                     LVTAGAAWHNDLVTLTADGDLTETKGFKSEDTSQYVGVGAEVTPLSWLAVRAGYRADM
                     KGNDSNVFTGGVGFAPFNTVHVDLMGLYGEDETWGAGAQLSMTF"
     gene            316260..317255
                     /gene="dusA"
                     /locus_tag="ECL_RS01495"
                     /old_locus_tag="ECL_00307"
                     /db_xref="GeneID:9122816"
     CDS             316260..317255
                     /gene="dusA"
                     /locus_tag="ECL_RS01495"
                     /old_locus_tag="ECL_00307"
                     /EC_number="1.3.1.-"
                     /EC_number="1.3.1.91"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA dihydrouridine(20/20a) synthase DusA"
                     /protein_id="WP_013095060.1"
                     /db_xref="GeneID:9122816"
                     /translation="MSSEHQTAFPAHRFSIAPMLDWTDRHCRYFLRQLSRHTLLYTEM
                     VTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAHCAKLAEERGYDEINLNVGCPS
                     DRVQNGMFGACLMGNAQLVADCIKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTV
                     AGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSL
                     DEAKTHLAHMDGVMVGREAYQNPGILTTVDREIFGVEGADTDPVAVVRAMYPYIEREL
                     SNGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADIEVLEQALRLVADKR"
     gene            317392..317634
                     /gene="pspG"
                     /locus_tag="ECL_RS01500"
                     /old_locus_tag="ECL_00308"
                     /db_xref="GeneID:9122817"
     CDS             317392..317634
                     /gene="pspG"
                     /locus_tag="ECL_RS01500"
                     /old_locus_tag="ECL_00308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="envelope stress response protein PspG"
                     /protein_id="WP_013095061.1"
                     /db_xref="GeneID:9122817"
                     /translation="MLELLFVIGFFVMLLATGVSLLGILAALVVATVVMFIGGLFALT
                     IKLLPWLLLAVAVVWVIRAIKSPKLPTYQRNNRFRY"
     gene            complement(317819..318802)
                     /locus_tag="ECL_RS01505"
                     /old_locus_tag="ECL_00309"
                     /db_xref="GeneID:9122818"
     CDS             complement(317819..318802)
                     /locus_tag="ECL_RS01505"
                     /old_locus_tag="ECL_00309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_013095062.1"
                     /db_xref="GeneID:9122818"
                     /translation="MATRIEFHKHGGPDVLNAVEFTPAAPGENEVQVENKAIGINYID
                     TYIRGGLYPPPSLPSGLGTEAAGVVSKVGSAVKHVKEGDRVVYAQSALGAYSSVHNVP
                     ADKVALLPNAISFEQAAASFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQW
                     AKALGAKLIGTVGSAQKAQRALQAGAWQVINYREESIVERLKEVTGGKKVRVVYDSVG
                     KDTWEASLDCLQRRGLMVSFGNASGAVTGVNLGILNQKGSLYVTRPSLQGYITNREEL
                     LEASNELFSLIASGVIKVDVADAQKYALSDAQRAHEVLESRSTQGSSLLIP"
     gene            318863..320275
                     /gene="dnaB"
                     /locus_tag="ECL_RS01510"
                     /old_locus_tag="ECL_00310"
                     /db_xref="GeneID:9122819"
     CDS             318863..320275
                     /gene="dnaB"
                     /locus_tag="ECL_RS01510"
                     /old_locus_tag="ECL_00310"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_013095063.1"
                     /db_xref="GeneID:9122819"
                     /translation="MAGNKPFNKQTEPRERDFQVAGLKVPPHSIEAEQSVLGGLMLDN
                     ERWDDVAERVVSDDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGF
                     AYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLA
                     ESRVFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTA
                     GLQPSDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLS
                     RVDQTRIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHG
                     GIGLIMIDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELHVPVVALSQLNRSLEQRA
                     DKRPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVRL
                     TFNGQWSRFDNYAGPQYDDE"
     gene            320292..321371
                     /gene="alr"
                     /locus_tag="ECL_RS01515"
                     /old_locus_tag="ECL_00311"
                     /db_xref="GeneID:9122820"
     CDS             320292..321371
                     /gene="alr"
                     /locus_tag="ECL_RS01515"
                     /old_locus_tag="ECL_00311"
                     /EC_number="5.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_013095064.1"
                     /db_xref="GeneID:9122820"
                     /translation="MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLE
                     TARTLPDADAFGVARLEEALRLRAGGITQPILLLEGFFEAADLPTIADQHLHTAVHNE
                     EQLSALETAELSEPVTVWMKLDTGMHRLGVRPEHAQAFYQRLCQCKNVRQPVNIVSHF
                     ARADEPDCGATEQQLDIFNTFCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVS
                     PLENRPWGPDFGFQPVMSLVSKLIAVREHKAGEPVGYGGTWTSARDTRLGVVAMGYGD
                     GYPRAAPSGTPVLVNGREVKIVGRVAMDMICVDLGPDAQDKAGDDVVMWGDGLPVERI
                     AEITKVSAYELITRLTSRVAMKYID"
     gene            321498..322691
                     /gene="tyrB"
                     /locus_tag="ECL_RS01520"
                     /old_locus_tag="ECL_00312"
                     /db_xref="GeneID:9122821"
     CDS             321498..322691
                     /gene="tyrB"
                     /locus_tag="ECL_RS01520"
                     /old_locus_tag="ECL_00312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008503379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid transaminase"
                     /protein_id="WP_013095065.1"
                     /db_xref="GeneID:9122821"
                     /translation="MFQKVDAYAGDPILSLMERFKEDPRSDKVNLSIGLYYNEDGIIP
                     QLKAVAEAEARLNAAPHGASLYLPMEGLNTYRNAIAPLLFGADHAVLAQKRVATIQTL
                     GGSGALKVGADFLKKYFPDSGVWVSDPTWENHVAIFEGAGFKVATYPWFDSETNGVRV
                     DALLEKLNTLPERSIVLLHPCCHNPTGADLTNTQWDAVIEVLKARNLIPFLDIAYQGF
                     GAGMEEDAYAIRAVASAGLPVLVSNSFSKIFSLYGERVGGLSVVCEDAEAAGRVLGQL
                     KATVRRIYSSPPNFGAQVVATVLGDEQLKASWLAEVVSMRKRILSMRQELVNVLKEAV
                     PGHNFDYLLKQRGMFSYTGLSAAQVERLREEFGVYLIASGRMCVAGLNASNVHRVAQA
                     FAAVM"
     gene            322909..323622
                     /gene="aphA"
                     /locus_tag="ECL_RS01525"
                     /old_locus_tag="ECL_00313"
                     /db_xref="GeneID:9122822"
     CDS             322909..323622
                     /gene="aphA"
                     /locus_tag="ECL_RS01525"
                     /old_locus_tag="ECL_00313"
                     /EC_number="3.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase AphA"
                     /protein_id="WP_013095066.1"
                     /db_xref="GeneID:9122822"
                     /translation="MRKITLALSAACLLFSLNSTVVARASAPTPLYTGTTAAILAEQA
                     PIHWVSVAQIENSLMGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSEAYLKNPEFW
                     EKMNNGWDEFSIPKEVARALIAMHVKRGDSIYFVTGRSQTKTETVSKTLQDDFLIPAA
                     SMNPVIFAGDKPGQNTKTQWLEQKHIKVFYGDSDNDISAARDVGARGIRVLRASNSTY
                     RPLPMAGKFGEEVIVNSEY"
     gene            323735..324151
                     /locus_tag="ECL_RS01530"
                     /old_locus_tag="ECL_00314"
                     /db_xref="GeneID:9122823"
     CDS             323735..324151
                     /locus_tag="ECL_RS01530"
                     /old_locus_tag="ECL_00314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YjbQ family protein"
                     /protein_id="WP_013095067.1"
                     /db_xref="GeneID:9122823"
                     /translation="MWYQQTLTLSAKPRGFHLVTDEVIGQIRDLSRVKTGLLHLLLQH
                     TSASLTLNENCDPTVRSDMERHFLKTVPDNASYEHDYEGADDMPSHIKSSLLGVSLML
                     PVHNGRLLLGTWQGIWLGEHRIHGGSRKIIATLQGE"
     gene            324154..324507
                     /locus_tag="ECL_RS01535"
                     /old_locus_tag="ECL_00315"
                     /db_xref="GeneID:9122824"
     CDS             324154..324507
                     /locus_tag="ECL_RS01535"
                     /old_locus_tag="ECL_00315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MmcQ/YjbR family DNA-binding protein"
                     /protein_id="WP_013095068.1"
                     /db_xref="GeneID:9122824"
                     /translation="MTISELLQYCMSKPGAEQSVHSDWKATQIKVGDVLFAMVKEVEG
                     RPAASLKTSPELAELLRQQHDDVRPSKHLNKAHWSTVYLDGSLPGSQIYYLVDASYQQ
                     AVELLPEATRQQLSV"
     gene            complement(324511..327333)
                     /gene="uvrA"
                     /locus_tag="ECL_RS01540"
                     /old_locus_tag="ECL_00316"
                     /db_xref="GeneID:9122825"
     CDS             complement(324511..327333)
                     /gene="uvrA"
                     /locus_tag="ECL_RS01540"
                     /old_locus_tag="ECL_00316"
                     /EC_number="3.1.25.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit UvrA"
                     /protein_id="WP_013095069.1"
                     /db_xref="GeneID:9122825"
                     /translation="MDKIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIHDYLRLLYARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKG
                     EHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVIDRFKVRDDLATRLA
                     ESFETALELSGGTAVVSDMDDPNAEELLFSANFACPICGYSMRELEPRLFSFNNPAGA
                     CPTCDGLGVQQYFDPDRVIQNPELSLAGGAIRGWDKRNFYYFQMLKSLAEHYKFDVEA
                     PWASLSPNVHKVILFGSGKENIEFKYMNDRGDTSVRRHPFEGVLHNMERRYKETESSA
                     VREELAKFISNRSCATCEGTRLRREARHVFVENTALPTISDMSIGHAMDFFNNLKLSG
                     QRAKIAEKVLKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNERLLGTLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGV
                     HGGQVVAEGTLKDIMAVPESLTGQYMSGKRKIEVPKQRVAANPEKVLKLTGARGNNLK
                     DVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQTALNGATLAEPAPYRDIQGLEHF
                     DKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPEARSRGYTPGRFSFNVRGGRC
                     EACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEARE
                     FFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYIL
                     DEPTTGLHFADIQQLLDVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGE
                     ILVSGTPETVAECEASHTARFLKPLL"
     gene            327585..328109
                     /gene="ssb1"
                     /locus_tag="ECL_RS01545"
                     /old_locus_tag="ECL_00317"
                     /db_xref="GeneID:9122826"
     CDS             327585..328109
                     /gene="ssb1"
                     /locus_tag="ECL_RS01545"
                     /old_locus_tag="ECL_00317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein SSB1"
                     /protein_id="WP_003860284.1"
                     /db_xref="GeneID:9122826"
                     /translation="MASRGVNKVILVGNLGQDPEVRYMPSGGAVANITLATSESWRDK
                     ATGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQSGQEKYTTEV
                     VVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQQSAPAP
                     SNEPPMDFDDDIPF"
     gene            complement(328172..328453)
                     /locus_tag="ECL_RS01550"
                     /old_locus_tag="ECL_00318"
                     /db_xref="GeneID:9122827"
     CDS             complement(328172..328453)
                     /locus_tag="ECL_RS01550"
                     /old_locus_tag="ECL_00318"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_008503385.1"
                     /db_xref="GeneID:9122827"
                     /translation="MATITTSMVLLRWPLLSAVLMFLASTLNIQFRKSDYAGLAVIST
                     LLGLGAACWFATGLLGITLLDIAAVWENIKVVMVEAMSHTPPDWPMVIT"
     gene            329113..330678
                     /locus_tag="ECL_RS01555"
                     /old_locus_tag="ECL_00319"
                     /db_xref="GeneID:9122828"
     CDS             329113..330678
                     /locus_tag="ECL_RS01555"
                     /old_locus_tag="ECL_00319"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_023622182.1"
                     /db_xref="GeneID:9122828"
                     /translation="MNRSARRKMLRVVGIIMVVMLPVMLALWFAQLRAVSETSAQLRT
                     FAELALDKTELVIEQVDLARAEAEKYQGKVCTPSHRQYMLNVVRGRLFIADLIYAEGQ
                     NFRCSSIFTPDRPYAISPANYIRKPDIAIYYYRDTPFFTGYKMTYMQRGNYVVVVNPL
                     SYSEVMSTDHSLSWGVYDTVTNAFFSVSQKANVSLLNSMIRDKDVVFQKDDRFYTVVK
                     SDKRPIAAIVSTSNKRFYETLYHQATLTLPLGMICSIIILLVWSRTHRELNSPGRLLH
                     RALNKRQLCVHYQPIIDIKNNQCVGAEALLRWPGFNGPVMSPAEFIPLAEKEGMSERI
                     TDYVVEEVFSDLGHFLAAHPDLYISINLSATDFHSSRLIAMISDKARHYAVRAQQIKI
                     EVTERGFIDVPKTTPVIQAFRQAGYEVAIDDFGTGYSNLHNLYSLNVDILKIDKSFID
                     TLTTNSTSHLIAEHIIEMAQSLRLKTIAEGVETAEQVSWLLKRGVQFCQGWHFAKAMP
                     PQEFMTWQQQPLH"
     gene            complement(330684..331010)
                     /gene="soxS"
                     /locus_tag="ECL_RS01560"
                     /old_locus_tag="ECL_00320"
                     /db_xref="GeneID:9122829"
     CDS             complement(330684..331010)
                     /gene="soxS"
                     /locus_tag="ECL_RS01560"
                     /old_locus_tag="ECL_00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide response transcriptional regulator
                     SoxS"
                     /protein_id="WP_013095071.1"
                     /db_xref="GeneID:9122829"
                     /translation="MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRT
                     VMHQTLGEYIRQRRLLLAAQALRSTQRPIFDIAMDLGYVSQQTFSRVFRREFDRTPSD
                     YRHQLN"
     gene            331108..331566
                     /gene="soxR"
                     /locus_tag="ECL_RS01565"
                     /old_locus_tag="ECL_00321"
                     /db_xref="GeneID:9122830"
     CDS             331108..331566
                     /gene="soxR"
                     /locus_tag="ECL_RS01565"
                     /old_locus_tag="ECL_00321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redox-sensitive transcriptional activator SoxR"
                     /protein_id="WP_013095072.1"
                     /db_xref="GeneID:9122830"
                     /translation="MEKRLPRIKALLTPGEVAKRSGVAVSALHFYESKGLIKSIRNAG
                     NQRRYTRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSPKEWKELSSQWREEL
                     DRRIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDKLGEQGTGARLLEED"
     gene            331879..332550
                     /locus_tag="ECL_RS01570"
                     /old_locus_tag="ECL_00322"
                     /db_xref="GeneID:9122831"
     CDS             331879..332550
                     /locus_tag="ECL_RS01570"
                     /old_locus_tag="ECL_00322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_013095073.1"
                     /db_xref="GeneID:9122831"
                     /translation="MLTVHHLNQSRSHRVIWALEELSLPYEIVHYQREKTMLAPESLK
                     RVHPLGKSPVIEDNGLILAESGAILEYLQETYDAESQLKPLDPAHKVQYRFWLHYAEG
                     SLMPLLLMKLVFSSLGKPPVPFGIRTLGKALGQGVQKAYLNPQLETHARFIESHLAEN
                     SWFAGETLSMADIQMSFPIFALLARGGVEDLPHTHAWKKKVENRPAWQRTLEQGGPLT
                     IPGEA"
     gene            332849..334198
                     /gene="ghxP"
                     /locus_tag="ECL_RS01575"
                     /old_locus_tag="ECL_00323"
                     /gene_synonym="yjcD"
                     /db_xref="GeneID:9122832"
     CDS             332849..334198
                     /gene="ghxP"
                     /locus_tag="ECL_RS01575"
                     /old_locus_tag="ECL_00323"
                     /gene_synonym="yjcD"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanine/hypoxanthine transporter GhxP"
                     /protein_id="WP_013095074.1"
                     /db_xref="GeneID:9122832"
                     /translation="MSTPSARTGGSLDAIFKISARGSTVRQEIVAGLTTFLAMVYSVI
                     VVPGMLGKAGFPPAAVFVATCLVAGVGSIVMGLWANLPMAIGCAISLTAFTAFSLVLG
                     QHISVPVALGAVFLMGVLFTIISATGIRSWILRNLPHGVAHGTGIGIGLFLLLIAANG
                     VGLVIKNPLDGLPVALGHFASFPVIMSLIGLAVIIGLEKLKVPGGILLTIIGVSIVGL
                     IFDPTVHFSGIFAMPSLSDDNGNSLIGSLDIVGALNPVILPSVLALVMTAVFDATGTI
                     RAVAGQANLLDKDGQIIDGGKALTTDSLSSVFSGLVGASPAAVYIESAAGTAAGGKTG
                     LTAITVGVLFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVAKIDFADFVDAMSGL
                     ITAVFIVLTCNIVTGIMIGFASLVIGRLVSGEWRKLNIGTVVIAVALVVFYAGGWAI"
     gene            334349..335995
                     /locus_tag="ECL_RS01580"
                     /old_locus_tag="ECL_00324"
                     /db_xref="GeneID:9122833"
     CDS             334349..335995
                     /locus_tag="ECL_RS01580"
                     /old_locus_tag="ECL_00324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter"
                     /protein_id="WP_013095075.1"
                     /db_xref="GeneID:9122833"
                     /translation="MEIFFTILIMTLVVSLSGVVTRVLPFQVPLPLMQIAIGALLAWP
                     TFGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIFGLALALVVVTVVGIGF
                     LIYWVVPGIPLIPAFALAAVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGL
                     VALKFAVAVAMGTMIFTVGGATLEFFKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEP
                     ATQIVLLFLLPFASYLIAEHIGVSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWA
                     MLEFVFNGMVFLLLGLQLPGIMESSLVAAEADPNVEVWMLFTDIVLIYMALMLVRFGW
                     LWTMKNFSVRFLKKKPMEFGSWTTRELLIASFAGVRGAITLAGVLSIPLLLPTGDVFP
                     ARYELVFLAAGVILFSLFVGVIMLPILLQHIDAGDATQQHKEERIARAATAEVAIVAI
                     QKMEERLAADAEENIDNQLLTEVSSRVIGNLRRRADGRNDVESSLQEENLERRFRLAA
                     LRSERAELYHLRATRQISNETLQKLLHDLDLLEALLIENQ"
     gene            complement(336072..336959)
                     /locus_tag="ECL_RS01585"
                     /old_locus_tag="ECL_00325"
                     /db_xref="GeneID:9122834"
     CDS             complement(336072..336959)
                     /locus_tag="ECL_RS01585"
                     /old_locus_tag="ECL_00325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013095076.1"
                     /db_xref="GeneID:9122834"
                     /translation="MDIRTLRYFVEVVRQQSFTRAAEKLFVTQPTISKMLKNLEDELN
                     CTLLIRDGRKLLLTDTGRVVFERGLAILAEFRQLEAELDDINHLTKGVLRLGIPPMVG
                     MMMAGPISLFRQRYPGVELKISEFGGLTVQQAVTNGELDVAMTALPVEEESGLATLPL
                     FSHPLCVLVPRSGDWLKRDSVKPELLGEYPLLIYNEDFALSRQLMTLFNQHSVKPRIA
                     VRSGQWDFLAAMVQAGVGIAILPQPICERLDKNTLRWIPLESDLHWQLGMIWREGIYL
                     SHSAQAWLQCCEGFWVPSP"
     gene            337062..337469
                     /locus_tag="ECL_RS01590"
                     /old_locus_tag="ECL_00326"
                     /db_xref="GeneID:9122835"
     CDS             337062..337469
                     /locus_tag="ECL_RS01590"
                     /old_locus_tag="ECL_00326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CidA/LrgA family protein"
                     /protein_id="WP_013095077.1"
                     /db_xref="GeneID:9122835"
                     /translation="MAVALSRVTPAVVQRLQVPVQVLLYAGLFVFAEYLVGWLHLPLP
                     ANLVGMVLMLTLILCRVIPLSWVRAGARWLLAEMLLFFVPAVVAVVNYAQLLMVDGWR
                     IFAVIALSTLMVLGATAWVVDKVYRFEIRRQKT"
     gene            337466..338155
                     /locus_tag="ECL_RS01595"
                     /old_locus_tag="ECL_00327"
                     /db_xref="GeneID:9122836"
     CDS             337466..338155
                     /locus_tag="ECL_RS01595"
                     /old_locus_tag="ECL_00327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003031745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LrgB family protein"
                     /protein_id="WP_013095078.1"
                     /db_xref="GeneID:9122836"
                     /translation="MTNFQISVLCLIATLVIYFANKRLYRRFHALPLMPLVFTPILLV
                     LMLVFGHISWQNYIGESHWLLWLLGPATIAFAVPVYDNLNIIKRHWMSLSAGVITATV
                     VAVCSSVWLARLFTLPDEIQRSLAVRSVTTPFALAAAKPLGGQPDLVALFVVVTGVFG
                     MAVGDMLFLRLSIREGLAKGAGFGAASHGAGTARSYELGQQEGVVASLVMMLSGVLMV
                     LIAPLVAWVMF"
     gene            complement(338187..339836)
                     /gene="actP"
                     /locus_tag="ECL_RS01600"
                     /old_locus_tag="ECL_00328"
                     /db_xref="GeneID:9122837"
     CDS             complement(338187..339836)
                     /gene="actP"
                     /locus_tag="ECL_RS01600"
                     /old_locus_tag="ECL_00328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation/acetate symporter ActP"
                     /protein_id="WP_013095079.1"
                     /db_xref="GeneID:9122837"
                     /translation="MKRVLTALAATLPFAAHAADAITGEVQRQPTNWQAIIMFLIFVV
                     LTLYITWWASKRVRSRNDYYTAGGNITGFQNGLAIAGDFMSAASFLGISALVYTSGYD
                     GLIYSLGFLVGWPIILFLIAERLRNLGRFTFADVASYRLKQGPIRILSACGSLVVVAL
                     YLIAQMVGAGKLIELLFGLNYHVAVVLVGVLMVMYVLFGGMLATTWVQIIKAVLLLFG
                     ASFMAFMVMKHVGFSFNNLFTEAMAVHPKGEAIMSPGGLVKDPISALSLGLGLMFGTA
                     GLPHILMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPAFKDAAG
                     ALIGGNNMAAVHLADAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVF
                     RKGATEREELKVSKITVLILGVVAILLGILFEKQNIAFMVGLAFSIAASCNFPIILLS
                     MYWSKLTTRGAMVGGWLGLLTAVILMILGPTIWVQILGHEKALFPYEYPALFSIAVAF
                     IGIWIFSATDNSPEGNLEREKFRAQFIRSQTGLGVEQGRAH"
     gene            complement(339833..340147)
                     /locus_tag="ECL_RS01605"
                     /old_locus_tag="ECL_00329"
                     /db_xref="GeneID:9122838"
     CDS             complement(339833..340147)
                     /locus_tag="ECL_RS01605"
                     /old_locus_tag="ECL_00329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013368040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF485 domain-containing protein"
                     /protein_id="WP_013095080.1"
                     /db_xref="GeneID:9122838"
                     /translation="MNNDICQQIENSAHYRELVDKRQRFAFLLSIIMLIIYVGFILLI
                     AFAPHWLGTPLHEGTSVTRGIPIGIGVIVISFVLTGVYVWRANGEFDRLNKAVLREVK
                     AS"
     gene            complement(340282..342240)
                     /gene="acs"
                     /locus_tag="ECL_RS01610"
                     /old_locus_tag="ECL_00330"
                     /db_xref="GeneID:9122839"
     CDS             complement(340282..342240)
                     /gene="acs"
                     /locus_tag="ECL_RS01610"
                     /old_locus_tag="ECL_00330"
                     /EC_number="6.2.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006816721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate--CoA ligase"
                     /protein_id="WP_013095081.1"
                     /db_xref="GeneID:9122839"
                     /translation="MSQIHKHDIPANIADRCLINPEQYHEKYQQSVSDPDAFWGEQGH
                     ILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLAERGNETAIIWEGDDA
                     SQSKHISYKELHRDVCRFANVLLDQGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHS
                     VIFGGFSPEAVAGRIVDSSSKLVITADEGVRAGRGIPLKKNVDEALKNPNVKTVSNVI
                     VLKRTGGKIDWNEGRDLWWSDLIEKASDQHQPQEMNAEDPLFILYTSGSTGKPKGVLH
                     TTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVP
                     NWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINP
                     EAWEWYWKKIGNEKCPVMDTWWQTETGGFMITPMPGATRLKAGSATQPFFGVQPALVD
                     NEGNPLDGATEGNLVIVDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDG
                     YYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYVTLN
                     HGEEPSPELYADVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTS
                     NLGDTSTLADPGVVEKLLEEKQSIAMPS"
     gene            342664..343977
                     /gene="gltP"
                     /locus_tag="ECL_RS01615"
                     /old_locus_tag="ECL_00331"
                     /db_xref="GeneID:9122840"
     CDS             342664..343977
                     /gene="gltP"
                     /locus_tag="ECL_RS01615"
                     /old_locus_tag="ECL_00331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016155378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate:proton symporter GltP"
                     /protein_id="WP_013095082.1"
                     /db_xref="GeneID:9122840"
                     /translation="MKNVKVSLAWQILLALVLGILLGSYLHYHSDSREWLIANLLSPA
                     GDIFIHLIKMIVVPIVISTLVVGIAGVGDAKQLGRIGAKTILYFEVITTIAIILGITL
                     ANVFQPGSGIDMSQLATVDISKYQSTTAEVQSHAHGLMGTILSLVPTNIVASMAKGEM
                     LPIIFFSVLFGLGLSSLPATHREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVT
                     VANFGFASLWPLAKLVILVHFAILFFALVVLGIVARLCGLSIWILIRILKDELILAYS
                     TASSESVLPRIIEKMEAYGAPASITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGID
                     LSLWQEIVLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMA
                     RTALNVVGNALAVLVIAKWEHKFDRKKALAYEREVLGRFDKTADQ"
     gene            complement(344058..344732)
                     /locus_tag="ECL_RS01620"
                     /old_locus_tag="ECL_00332"
                     /db_xref="GeneID:9122841"
     CDS             complement(344058..344732)
                     /locus_tag="ECL_RS01620"
                     /old_locus_tag="ECL_00332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="WP_013095083.1"
                     /db_xref="GeneID:9122841"
                     /translation="MKPFLLLLLVFTSFVHADEIGSQYKAQAEAGDARAQYYLADTWF
                     SSGDSKQAAMWAEKAAKGGDIDAMALLSQIHFTQGDYAQAKALAQQATIAGSKRGAIM
                     LARVLVNTQGGKTDYPQAIKLLQTATEDIDNDSAVDAQMLLGLIYANGVEVAQDDALA
                     ASWFKRSSSLSRTGYAEYWAGMLFQQGEKGFITPNKQKALYWLNLSCTEGFDTGCEEF
                     DALSGE"
     gene            complement(344854..345006)
                     /locus_tag="ECL_RS01625"
                     /old_locus_tag="ECL_00333"
                     /db_xref="GeneID:9122842"
     CDS             complement(344854..345006)
                     /locus_tag="ECL_RS01625"
                     /old_locus_tag="ECL_00333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017382637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hok/Gef family protein"
                     /protein_id="WP_013095084.1"
                     /db_xref="GeneID:9122842"
                     /translation="MTPLKTALGIVFIICLTIVIFTFITRGKLCELTIKSEHQEVAAK
                     LACVAG"
     gene            complement(345328..347475)
                     /gene="fdhF"
                     /locus_tag="ECL_RS01630"
                     /old_locus_tag="ECL_00334"
                     /db_xref="GeneID:9122843"
     CDS             complement(345328..347475)
                     /gene="fdhF"
                     /locus_tag="ECL_RS01630"
                     /old_locus_tag="ECL_00334"
                     /EC_number="1.17.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_except=(pos:complement(347056..347058),aa:Sec)
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="WP_077681898.1"
                     /db_xref="GeneID:9122843"
                     /translation="MKKVVTVCPYCASGCKIHLVVDNGKIVRAEAAQGKTNQGTLCLK
                     GYYGWDFINDTQILTPRLKTPMIRRERGGKLEAVSWNEALDYVATRLSAIKAKYGPDA
                     IQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNA
                     INEIDNTDLVFIFGYNPADSHPIVANHVIRAKQNGAKIIVCDPRKIETARIADMHIAL
                     KNGSNIALLNAMGHVIIEENLYDQAFVATRTEGFEEYRKIVEGYTPESVEAITGVSAQ
                     EIRQAARMYAGAKTAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKAHVGVNPVRG
                     QNNVQGACDMGALPDTYPGYQYVKFPENRAKFAKAWGVESLPEHTGYRISELPHRAAH
                     GEVRAAYIMGEDPLQTDAELSAVRKGFEDLELVIVQDIFMTKTAAAADVILPSTSWGE
                     HEGVYTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHL
                     CPDFYGATYEKMGELGYIQWPCRDESEADQGTSYLFKEKFDTPNGLAQFFTCDWVAPI
                     DKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTADAERLGIEDEA
                     LVWVNSRKGRIITRAQVSDRPNKGAVYMTYQWWIGACNELVTENLSPITKTPEYKYCA
                     VRVEPIADQHAAEQYVIDEYNKLKARLRESAMG"
     gene            347728..348459
                     /locus_tag="ECL_RS01635"
                     /old_locus_tag="ECL_00337"
                     /db_xref="GeneID:9122846"
     CDS             347728..348459
                     /locus_tag="ECL_RS01635"
                     /old_locus_tag="ECL_00337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_013095088.1"
                     /db_xref="GeneID:9122846"
                     /translation="MKPAILVVDDDTAVCELLQDVLSEHVFTVLVCHNGQDALNRVHQ
                     EPGIALVLLDMMLPDINGLQVLLQLQKQRPDLPVVMLTGLGSESDVVVGLEMGADDYI
                     GKPFNPRVVVARVKAVLRRTGALAADTPAPRVAGIAFNGWTLDTTRCELIDPQRNPVP
                     LTQGEYGLLLALTQNARRVLSREQLLELTHSESADVFDRTIDVLIMRLRRKIEANPHQ
                     PALIKTIRGLGYVFAADVCHPDRAA"
     gene            complement(348464..349372)
                     /gene="lpxO"
                     /locus_tag="ECL_RS01640"
                     /old_locus_tag="ECL_00338"
                     /db_xref="GeneID:9122847"
     CDS             complement(348464..349372)
                     /gene="lpxO"
                     /locus_tag="ECL_RS01640"
                     /old_locus_tag="ECL_00338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008500041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A hydroxylase LpxO"
                     /protein_id="WP_013095089.1"
                     /db_xref="GeneID:9122847"
                     /translation="MFAAIIIAIFIISVIYAHSRGKEKQTLSRQLFDHSTFMAPINMF
                     MTAFSSLPARQPFFETERFPELNKLTENWEVIREEALRLQDHIKAAQNHNDAGFNTFF
                     KRGWKRFYLKWYADAHPSAQILCPVTTQLVSEIPSVKAAMFAELPAGAKLGKHRDPYA
                     GSVRYHLGLVTPNDDRCFIEVDQQRHSWRDGEAVIFDETYVHWAENKSDHTRIILFCD
                     IERPMKWRWAQAVNHWVGTTLMSAASSPNDDNDRTGGINRIFKYVHAGRERGQRLKKR
                     NRKLYYALKYLVITAIFAALIVAAIT"
     gene            complement(349515..350522)
                     /locus_tag="ECL_RS01645"
                     /old_locus_tag="ECL_00339"
                     /db_xref="GeneID:9122848"
     CDS             complement(349515..350522)
                     /locus_tag="ECL_RS01645"
                     /old_locus_tag="ECL_00339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase family protein"
                     /protein_id="WP_013095090.1"
                     /db_xref="GeneID:9122848"
                     /translation="MERKGIIAAGNMLVDHVHQIVQWPERGWLAEITHSERSTGGAPL
                     NVLLTLAKMHVGLPLQAVGLIGEDSDGDYILAMLDQYHVNRQRVQRTTFAPTSMSQVM
                     ADPSGQRTFFHSPGANRLLDLPAFDRLDGTMKIFHLGYLLLLDSLDMPDDEYGTRSAR
                     LLAQMREQGYETSLDLVSRKGDPRYQPLVLPALRHLDYLVINELEAGEFSGLEMRDGN
                     DAPHVAHIAEAAAQLLAAGVRQRVVIHCPEGAWGEAANEEGRWIPSWRLTQEEIIGSV
                     GAGDAFCAGFLYGCHESLPLAESIYLAHACARASLLAANAIYGAKTLEELTRFIQESS
                     A"
     gene            complement(350522..351382)
                     /locus_tag="ECL_RS01650"
                     /old_locus_tag="ECL_00340"
                     /db_xref="GeneID:9122849"
     CDS             complement(350522..351382)
                     /locus_tag="ECL_RS01650"
                     /old_locus_tag="ECL_00340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketose 1,6-bisphosphate aldolase"
                     /protein_id="WP_044159019.1"
                     /db_xref="GeneID:9122849"
                     /translation="MPLISLADGLAHARQHRYALGAFNVLDTHFLRALFAAAKQERSP
                     FIINIAEVHFKYVSLESLVEAVKYEAARHAIPVVLNLDHGLHFDAVVRALRLGFSSVM
                     FDGSTLSYEENIRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGHADEAYFTDPQL
                     AREFVDSTGIDALAVAIGNAHGKYKGEPKLDFPRLDAIRQQTGLPLVLHGGSGISDAD
                     FRRAIELGIHKINFYTGMSQAALSAVEQRMANRQPLYDEFAELLLGIEEAITDTVAEQ
                     MRIFGSAGQA"
     gene            complement(351393..352079)
                     /locus_tag="ECL_RS01655"
                     /old_locus_tag="ECL_00341"
                     /db_xref="GeneID:9122850"
     CDS             complement(351393..352079)
                     /locus_tag="ECL_RS01655"
                     /old_locus_tag="ECL_00341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-lyxose/D-mannose family sugar isomerase"
                     /protein_id="WP_013095092.1"
                     /db_xref="GeneID:9122850"
                     /translation="MKRSEINEILGHTRQFFSMHDVHLPPFASFPPTKWQQLDQAAWQ
                     EVFDLKLGWDVTAFGGSSFAAQGLTLFTLRNGSPNGTPYEKCYAEKIMHVRDGQLTPM
                     HFHWRKREDIINRGGGNLIIELWNAGAHAETENTDVTVTIDGCQQTHAPGSQLRLTPG
                     ESICLTPGLYHSFWGERGFGDVLVGEVSSVNDDEHDNHFLQPVARYNNIEEDEPAVLV
                     LCNEYNLFRI"
     gene            complement(352150..353325)
                     /locus_tag="ECL_RS01660"
                     /old_locus_tag="ECL_00342"
                     /db_xref="GeneID:9122851"
     CDS             complement(352150..353325)
                     /locus_tag="ECL_RS01660"
                     /old_locus_tag="ECL_00342"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="WP_013095093.1"
                     /db_xref="GeneID:9122851"
                     /translation="MPLQTVCQKFFSASLPDVHSFRINVLVSMAVALTHGADLTLTSL
                     GRSLPGRAHVKNKIKRVDRALGNTALHRDIPRIQHLLTHTITSLMPFCVIAVDWTGWH
                     DRNWYLLRASLVCNGRSLPLMSEVVPAELAQNSDVQCRFLDRLHDAIPKDKAVTIITD
                     AGFRTDWFRHVSQLGWSFTGRVRGCISFRLDGDKKWMKISELEATGQPVCVGYGVLSR
                     KPRTPCYGRFYLHKRPDAGRQGKGGMPKTQREHRSSAREPWLLFSNAEGLEPHQIMAL
                     YSRRMQIEQNFRDDKSPRFGFGLRLSRSQGKGRLEVLNMVAAMASLVMWLAGYRAERQ
                     CLHWHYQASSIRHRRVLSYLSLAEEVIRHEPGKVRRLNIVNEMKKLGKEYSNMVMVA"
     gene            complement(353451..354392)
                     /locus_tag="ECL_RS01665"
                     /old_locus_tag="ECL_00343"
                     /db_xref="GeneID:9122852"
     CDS             complement(353451..354392)
                     /locus_tag="ECL_RS01665"
                     /old_locus_tag="ECL_00343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013095094.1"
                     /db_xref="GeneID:9122852"
                     /translation="MRLKPLVTALCAGALLAATPFAQAKDLKSIGVTVGDLANPFFVQ
                     ITKGAELEARKLAGDNVKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGP
                     AVKRAKEAGIVVVAVDVAAEGADATITSDNTQAGEMACKYITDRLNGKGNVVIINGPP
                     VSAVQNRVEGCQTEFKKHPDIKVLSDNQNAKGSREGGLEVMTSLLAANPKIDGVFAIN
                     DPTAIGADLAAKQAQRNEFFIVGVDGSPDGEEALKRENSLFVATPAQDPQVMAAKAVE
                     IGYDILQGKPAPKEPVLIPVTMIDKKNVGTYKGWTVK"
     gene            complement(354421..355416)
                     /locus_tag="ECL_RS01670"
                     /old_locus_tag="ECL_00344"
                     /db_xref="GeneID:9122853"
     CDS             complement(354421..355416)
                     /locus_tag="ECL_RS01670"
                     /old_locus_tag="ECL_00344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="WP_013095095.1"
                     /db_xref="GeneID:9122853"
                     /translation="MTTPTHPQQVAKSASAKKMLMSDLMQTVGILPILILIVAVFGFI
                     APNFFTESNLLNITRQASINIVLAAGMTFIILTGGIDLSVGSILGTTAVAAMVVSLIP
                     EFAGLSIPAALMLGLVLGLFNGALVAFAGLPPFIVTLGTYTALRGAAYLLADGTTVIN
                     SNINFEWIGNNYLGPVPWLVVIALAVIVVCWFILRRTTLGVHIYAVGGNMQAARLTGI
                     KVWLVLLFVYGMSGLLSGLGGVMSASRLYSANGNLGMGYELDAIAAVILGGTSFVGGI
                     GTITGTLVGALIIATLNNGMTLMGVSYFWQLVIKGAVIIIAVLIDKYRTRHHQSA"
     gene            complement(355413..356933)
                     /locus_tag="ECL_RS01675"
                     /old_locus_tag="ECL_00345"
                     /db_xref="GeneID:9122854"
     CDS             complement(355413..356933)
                     /locus_tag="ECL_RS01675"
                     /old_locus_tag="ECL_00345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_013095096.1"
                     /db_xref="GeneID:9122854"
                     /translation="MSRTPVLEMRSIAKTFGNFHALKGVDLTVFPGEIHALMGENGAG
                     KSTLMKILAGAYTATSGEILIDGQPYHIKGPKDALAAGITLIYQEMQLAPNLTVAENI
                     FLGSELSRGGLVQRKEMAAQAQAVIDRLGANFNATDLVMKLTIAEQQQVEIARALHRN
                     SRILVMDEPTAALSSRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDG
                     QYVGSLTRDKLNASELVKMMVGRPLSDLFNKERDIPLGSPRLNVHHLTDGKKVQPCSL
                     QVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGMIEVDGEPVVIHSPRAAIENGIGF
                     LTENRKEQGLFLELAAQENITMATLERDATFGMLNRKKAQSISDDAIALLNIRVPHAQ
                     VRAGGLSGGNQQKLLISRWVAIGPRILILDEPTRGVDVGAKSEIYRIMNQMARKGVAI
                     LMISSELPEVVGMSDRVYVMREGSIAGELHGHDISQENIMTLATGVNDSHHQAVQL"
     gene            357115..359391
                     /locus_tag="ECL_RS01680"
                     /old_locus_tag="ECL_00346"
                     /db_xref="GeneID:9122855"
     CDS             357115..359391
                     /locus_tag="ECL_RS01680"
                     /old_locus_tag="ECL_00346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014068551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hybrid sensor histidine kinase/response
                     regulator"
                     /protein_id="WP_013095097.1"
                     /db_xref="GeneID:9122855"
                     /translation="MPSRSPFFASARGRLLIFNLLVVAVTLMVSGVAVLGFRHASQIQ
                     EQVQQQTLDDMTGSMNLARDTASVATAAVRLSQVVGALEYKGEAERLKQTQMALRHSL
                     EQLADAPLAQQEPGLVARIIRRSNELQQSVTGMLERGQRRHLQRNALLSSLYQSQSYL
                     RHLQDINRRFGSNIPDAQQLAEMDRLILAAIDTPSPRATLQQLDAVTATLPQRATQPV
                     VNLVLPDFNDELRRLAPLSKQLEESDLAISWYMFHIKALVAILNSDINQYVEQVAEAS
                     RLRTAQSHQELRSISVFISIFAVLALIITGCACWYIYRNLGSNLTAISRAMSRLAHGE
                     QDVSVPALQRRDELGELARAFNVFARNTASLEHTTRLLKEKTSQMEIDRIERQGLEEA
                     LLHSQKMKAVGQLTGGLAHDFNNLLAVIIGSLELTDPDSSDAPRIARALNAAERGALL
                     TQRLLAFSRKQSLTPHAVEMKPLLENLRELMRHSLPATLSLEIEAQSPAWPAWIDVGQ
                     LENAIINLVMNARDAMEGQTGVIKIRTWNQRVTRSDGRRQDMVALEVIDRGSGMTQEV
                     KSRVFEPFFTTKQTGSGSGLGLSMVYGFVRQSGGRVEIESAPGQGTTVRLHLPRSTLP
                     VVPEDETHSATASAENERLVLVLEDEADVRQTLCEQLHQLGYLTLEAESGEQALNMLA
                     ASPDIGMFISDLMLPGSLSGAEVINHVRSHYPQLPVLLISGQDLRPTHNPQLPDVALL
                     RKPFTRVQLAQALRKISA"
     gene            359512..360135
                     /locus_tag="ECL_RS01685"
                     /old_locus_tag="ECL_00347"
                     /db_xref="GeneID:9122856"
     CDS             359512..360135
                     /locus_tag="ECL_RS01685"
                     /old_locus_tag="ECL_00347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000636711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013095098.1"
                     /db_xref="GeneID:9122856"
                     /translation="MIVMPTTYSPNTVARSFTLVDEFELSGRVLHVIYDSQTPRAAII
                     EADIETFDGVPRHRVVAALDLQHKAHLGKDIIAVERCWEDTRVVQVEGICVDPAERDK
                     GLATRLYEALVLHCGVTLISDFEQYEGGKMLWQKIARESDQIAVFVLDTEQGAFWPYD
                     GSKVIYDGGCIPEDRIWSHSPDQKCSGIVLVAENKQRVRQIMEASPR"
     gene            360214..360537
                     /locus_tag="ECL_RS01690"
                     /old_locus_tag="ECL_00348"
                     /db_xref="GeneID:9122857"
     CDS             360214..360537
                     /locus_tag="ECL_RS01690"
                     /old_locus_tag="ECL_00348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095099.1"
                     /db_xref="GeneID:9122857"
                     /translation="MKRYSTALLFGLLSLSSQLAHADVIDDAIGNIQQAINDAYNPGS
                     SRSNDDDDRYDDDRRIDSRQYDDRRRQLEDRRRRLDERQRQLDDDRRRLEEDERRLEE
                     DYDRG"
     gene            complement(360590..361348)
                     /gene="phnP"
                     /locus_tag="ECL_RS01695"
                     /old_locus_tag="ECL_00349"
                     /db_xref="GeneID:9122858"
     CDS             complement(360590..361348)
                     /gene="phnP"
                     /locus_tag="ECL_RS01695"
                     /old_locus_tag="ECL_00349"
                     /EC_number="3.1.4.55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000059797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnP"
                     /protein_id="WP_013095100.1"
                     /db_xref="GeneID:9122858"
                     /translation="MSLTITLTGTGSAQLVPVFGCDCAACRRARLQENYRRRPCSAAV
                     KFNDAVTLLDAGIPHLMDDWPAGSFQQFLLTHYHMDHVQGLFPLRWGVGATIPVYGPP
                     DEAGCDDLFKHPGILDFSHMLEPFVMFELQGLRVTPLPLNHSKLTFGYLLESAHSRVA
                     WLSDTAGLPEKTVKFLLNNQPQAMIIDCSHEPRPQTPRNHCDLNTVVALNEVIGCPQV
                     ILTHISHQFDVWMMDNPLPDGIEAGYDGMVLVLD"
     gene            complement(361358..361792)
                     /gene="phnO"
                     /locus_tag="ECL_RS01700"
                     /old_locus_tag="ECL_00350"
                     /db_xref="GeneID:9122859"
     CDS             complement(361358..361792)
                     /gene="phnO"
                     /locus_tag="ECL_RS01700"
                     /old_locus_tag="ECL_00350"
                     /EC_number="2.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoalkylphosphonate N-acetyltransferase"
                     /protein_id="WP_013095101.1"
                     /db_xref="GeneID:9122859"
                     /translation="MPDCTLRPATADDAQIVYALICELKQAEFDHQAFHAGYLANLQD
                     HNMRYQLAELNGQVVGMIGLHMQFHLHHARWIGEIQELVVMPEARGLKVGSQLLAWAE
                     DTARQAGAELTELSTSVRRLDAHRFYVREGYTQSHFRFTKPL"
     gene            complement(361785..362336)
                     /gene="phnN"
                     /locus_tag="ECL_RS01705"
                     /old_locus_tag="ECL_00351"
                     /db_xref="GeneID:9122860"
     CDS             complement(361785..362336)
                     /gene="phnN"
                     /locus_tag="ECL_RS01705"
                     /old_locus_tag="ECL_00351"
                     /EC_number="2.7.4.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 1,5-bisphosphokinase"
                     /protein_id="WP_109455545.1"
                     /db_xref="GeneID:9122860"
                     /translation="MMGRVIWLMGPSGSGKDSLLSALRQREHPQLLVAHRYITRAANA
                     GSENHIALSEQEFFTRAGQNLLALSWHANGYYYGIGIEIDLWLHAGFDVLVNGSRAHL
                     PQARARYASALLPVCLQVSPDVLRSRLQSRGRESEKEIAQRLERAAHYTPADCHILNN
                     DGSLLQSVDNVLSLIRQKEKQHA"
     gene            complement(362333..363469)
                     /gene="phnM"
                     /locus_tag="ECL_RS01710"
                     /old_locus_tag="ECL_00352"
                     /db_xref="GeneID:9122861"
     CDS             complement(362333..363469)
                     /gene="phnM"
                     /locus_tag="ECL_RS01710"
                     /old_locus_tag="ECL_00352"
                     /EC_number="3.6.1.63"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-D-ribose 1-methylphosphonate
                     5-triphosphate diphosphatase"
                     /protein_id="WP_013095103.1"
                     /db_xref="GeneID:9122861"
                     /translation="MIINNVRLVLEDEVINGSIEIRDGAIRAYAETRSHLPEAMDGEG
                     GWLLPGLIELHTDNLDKFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAVAIGDVR
                     DGGDRLENLEKMINAVEETQKRGLNRAEHRLHLRCELPHHTTLPLFEKLVDREPVSLV
                     SLMDHSPGQRQFASLEKYREYYQGKYSLNDVEMARYEEEQLALAAQWSQPNRVSIAAM
                     CRDRNIALASHDDATHNHVRESHQLGSVIAEFPTTFEAAEASRAHGMNVLMGAPNIVR
                     GGSHSGNVAASKLASLGLLDILSSDYYPASLLDAAFRVADDDSNCFTLSQAIRLVTKN
                     PASALNLHDRGEIAEGKRADLVLAHRKGEHIHIDHVWRQGKRVF"
     gene            complement(363466..364146)
                     /gene="phnL"
                     /locus_tag="ECL_RS01715"
                     /old_locus_tag="ECL_00353"
                     /db_xref="GeneID:9122862"
     CDS             complement(363466..364146)
                     /gene="phnL"
                     /locus_tag="ECL_RS01715"
                     /old_locus_tag="ECL_00353"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnL"
                     /protein_id="WP_013095104.1"
                     /db_xref="GeneID:9122862"
                     /translation="MIHVENVSKTFVLHQQNGVRLPVLQNASLKVNSGECVVLHGHSG
                     SGKSTLLRSLYANYLPDEGHIHIRHADEWVDLVQAPARKVLEVRRSTIGWVSQFLRVI
                     PRISALDVVMQPLLDLGVPRETCAAKAASLLTRLNVPERLWHLAPSTFSGGEQQRVNI
                     ARGFIVDYPILLLDEPTASLDSKNSAAVVELIEQAKARGAAIVGIFHDESVRNRVADR
                     LHPMGTNV"
     gene            complement(364232..364987)
                     /gene="phnK"
                     /locus_tag="ECL_RS01720"
                     /old_locus_tag="ECL_00354"
                     /db_xref="GeneID:9122863"
     CDS             complement(364232..364987)
                     /gene="phnK"
                     /locus_tag="ECL_RS01720"
                     /old_locus_tag="ECL_00354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006177354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnK"
                     /protein_id="WP_013095105.1"
                     /db_xref="GeneID:9122863"
                     /translation="MKPLLSVNNLTHLYAPGKGFSDVSFELWPGEVLGIVGESGSGKT
                     TLLKSISARLAPQNGEILYEGASLYGMSEAERRRLLRTEWGVVHQHPLDGLRRQVSAG
                     GNIGERLMATGARHYGNIRETAQRWLTDVEIPASRIDDLPTTFSGGMQQRLQIARNLV
                     THPKLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVM
                     KQGQVVESGLTDRVLDDPLHPYTQLLVSSVLQN"
     gene            complement(364984..365829)
                     /gene="phnJ"
                     /locus_tag="ECL_RS01725"
                     /old_locus_tag="ECL_00355"
                     /db_xref="GeneID:9122864"
     CDS             complement(364984..365829)
                     /gene="phnJ"
                     /locus_tag="ECL_RS01725"
                     /old_locus_tag="ECL_00355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008500058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-D-ribose 1-methylphosphonate 5-phosphate
                     C-P-lyase PhnJ"
                     /protein_id="WP_013095106.1"
                     /db_xref="GeneID:9122864"
                     /translation="MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPM
                     PYGWGTGGIQLTASVIGESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTEKTEDAT
                     LIQTRHRIPETPLTEDQILIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYED
                     IARFGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPP
                     YTRVESLDFDDHPFTVQEWDEPCAICGSKHSYLDEVVLDDTGKRMFVCSDTDYCRQQS
                     EANSQ"
     gene            complement(365822..366886)
                     /locus_tag="ECL_RS01730"
                     /old_locus_tag="ECL_00356"
                     /db_xref="GeneID:9122865"
     CDS             complement(365822..366886)
                     /locus_tag="ECL_RS01730"
                     /old_locus_tag="ECL_00356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860221.1"
                     /note="required for the use of phosphonate and phosphite;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit PhnI"
                     /protein_id="WP_013095107.1"
                     /db_xref="GeneID:9122865"
                     /translation="MYVAVKGGEKAIAAAHALQAHRRRGDEQLPELSVAQIEQQLNLA
                     VDRVMTEGGVADRELAALALKQASGDNVEAIFLLRAWRTTVPRLAVSEPVNTAEMRLE
                     RRISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGETPTLSTTETGQEASPHVFSLLA
                     KQGLAKAEEETGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRN
                     HPFAAEIRSGYLDVEIIPEELGFAVNVGELLMTECEMVNGFVAPDDDTPHFTRGYGLV
                     FGMSERKAMAMALVDRALQAPDYGEQISGPAQDEEFVLAHADNVEAAGFVSHLKLPHY
                     VDFQAELELLKRLQRERENG"
     gene            complement(366886..367470)
                     /gene="phnH"
                     /locus_tag="ECL_RS01735"
                     /old_locus_tag="ECL_00357"
                     /db_xref="GeneID:9122866"
     CDS             complement(366886..367470)
                     /gene="phnH"
                     /locus_tag="ECL_RS01735"
                     /old_locus_tag="ECL_00357"
                     /EC_number="2.7.8.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnH"
                     /protein_id="WP_013095108.1"
                     /db_xref="GeneID:9122866"
                     /translation="MTLQPAFTLAVQDAQHSFRRLLKAMSEPGVIVSLHQLSQGWLPL
                     NLATTSVLLTLADNDTPVWLSGTLSNDIASQNLRFHTNAPLVEQPRQAVFAVADEQIS
                     HEQLNALSEGSAVAPETSATLLLQVASLSGGRMLRLTGAGIADERMVAPQLPECIIHE
                     LTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC"
     gene            complement(367467..367919)
                     /gene="phnG"
                     /locus_tag="ECL_RS01740"
                     /old_locus_tag="ECL_00358"
                     /db_xref="GeneID:9122867"
     CDS             complement(367467..367919)
                     /gene="phnG"
                     /locus_tag="ECL_RS01740"
                     /old_locus_tag="ECL_00358"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005132527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnG"
                     /protein_id="WP_013095109.1"
                     /db_xref="GeneID:9122867"
                     /translation="MHFDTSTRQRWMRALAHSQPAALASRMNALNLTPDYETLRAPEI
                     GLVQIQARMGGTGERFFGGDAALTRAVIRLSSGTLGYSYVLGRDKPHAERCAVIDALL
                     QEQPHFQTLMETLIAPLEANLAARTAARQAQVNTSRVDFFTLVRGDNA"
     gene            complement(367920..368645)
                     /gene="phnF"
                     /locus_tag="ECL_RS01745"
                     /old_locus_tag="ECL_00359"
                     /db_xref="GeneID:9122868"
     CDS             complement(367920..368645)
                     /gene="phnF"
                     /locus_tag="ECL_RS01745"
                     /old_locus_tag="ECL_00359"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism transcriptional regulator
                     PhnF"
                     /protein_id="WP_013095110.1"
                     /db_xref="GeneID:9122868"
                     /translation="MHLSRHPTSYPTRWQEIAAKLEVELRTHYRCGDYLPAEQQLADR
                     YEVNRHTLRRAIDQLVERGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPT
                     SEKLLSVLRPASSHVADALGIQEGDNVVHLRTLRRVNGVAVCQIDHYFSDLSLWPVLQ
                     HFSSGSLHDFLQDATGLVLKRTQTRISARRAQAKESKVLEIPNMAPLLCVRTLNHRDG
                     EINATEYSVSLTRADMIEFTMEH"
     gene            complement(368666..369445)
                     /gene="phnE"
                     /locus_tag="ECL_RS01750"
                     /old_locus_tag="ECL_00360"
                     /db_xref="GeneID:9122869"
     CDS             complement(368666..369445)
                     /gene="phnE"
                     /locus_tag="ECL_RS01750"
                     /old_locus_tag="ECL_00360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313113.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter, permease protein
                     PhnE"
                     /protein_id="WP_013095111.1"
                     /db_xref="GeneID:9122869"
                     /translation="MQTITLPPPKRSWFSLFSWAILLAVLVISWKGAEMDPLLLFKDA
                     GNMATFAADFFPPDFSQWQDYLGEMAVTLQIAVWGTALAVILSIPFGLMSAENIVPWW
                     IYQPMRRLMDACRAINEMVFAMLFVVAVGLGPFAGVMALFIHTTGVLSKLLSEAVEAI
                     EPGPVEGIRATGANKIEEILYGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIG
                     VTLWEAIRGFQFQQTCALMVLIIITVSLLDFLSQRLRKHFI"
     gene            complement(369562..370578)
                     /gene="phnD"
                     /locus_tag="ECL_RS01755"
                     /old_locus_tag="ECL_00361"
                     /db_xref="GeneID:9122870"
     CDS             complement(369562..370578)
                     /gene="phnD"
                     /locus_tag="ECL_RS01755"
                     /old_locus_tag="ECL_00361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013095112.1"
                     /db_xref="GeneID:9122870"
                     /translation="MSYKTVAALAFTSMFSISTLLSPAYAEEQEKALNFGIISTESQQ
                     NLKPQWEPFLKDMETKLGIKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRA
                     NGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDMLAKRKELTFGNGDPNSTSGFLVP
                     GYYVFAKNNASASDFKRTVNASHETNALAVANKQVDVATNNTENLDKLKTSAPDKLKE
                     LKVIWKSPLIPGDPIVWRKNLSESTKDKVYDFFMTYGKTPEEKAVLTRLGWAPFRPSS
                     DLQLVPIRQLALFKEMQGVKDNKGLKDEEKTSKVAAIQAQLEDLDRLTAALGAMTSVN
                     KAVQ"
     gene            complement(370602..371390)
                     /gene="phnC"
                     /locus_tag="ECL_RS01760"
                     /old_locus_tag="ECL_00362"
                     /db_xref="GeneID:9122871"
     CDS             complement(370602..371390)
                     /gene="phnC"
                     /locus_tag="ECL_RS01760"
                     /old_locus_tag="ECL_00362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_013095113.1"
                     /db_xref="GeneID:9122871"
                     /translation="MQTVIRVEKLSKTFHHNKALHAVDLTVQQGDMVALLGPSGSGKS
                     TLLRHLSGLITGDSIPESHVELLGNTVQRAGRLARDIRKSRAQTGCIFQQFNLVNRLT
                     VLENVLIGALGSTPFWRTCLRWFSPLQKQEALRALTRVGMAHFAHQRVSTLSGGQQQR
                     VAIARALMQKAKIILADEPIASLDPESARIVMETLHDINQNDGITVVVTLHQVDYALR
                     YCERIVALRQGHVFFDGASHQFDNERFDHLYRSINRVEENAKAA"
     gene            complement(371564..372007)
                     /gene="yjdN"
                     /locus_tag="ECL_RS01765"
                     /old_locus_tag="ECL_00363"
                     /db_xref="GeneID:9122872"
     CDS             complement(371564..372007)
                     /gene="yjdN"
                     /locus_tag="ECL_RS01765"
                     /old_locus_tag="ECL_00363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016159900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VOC family metalloprotein YjdN"
                     /protein_id="WP_013095114.1"
                     /db_xref="GeneID:9122872"
                     /translation="MPLSPYISFAGNCAEATAFYQQAVGAELLYKITFGEMPKSESSE
                     EGCPSGMQFPDSAIAHSNVRIAGSDIMMSDGLPPGSKAQYAGFTLVLDTQDVNEGQRW
                     FDNLADGGNIEMAWQETFWAHGFGKVTDKYGVPWMINVVKQQQSS"
     gene            complement(372088..372423)
                     /locus_tag="ECL_RS01770"
                     /old_locus_tag="ECL_00364"
                     /db_xref="GeneID:9122873"
     CDS             complement(372088..372423)
                     /locus_tag="ECL_RS01770"
                     /old_locus_tag="ECL_00364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004856597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phnA family protein"
                     /protein_id="WP_013095115.1"
                     /db_xref="GeneID:9122873"
                     /translation="MQLPHCPKCNSEYTYEDNGMFICPECAHEWNDAEPSQDADVLIV
                     KDANGNLLADGDSVTVVKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMK
                     LKSEFVKKN"
     gene            373024..375378
                     /gene="crfC"
                     /locus_tag="ECL_RS01775"
                     /old_locus_tag="ECL_00365"
                     /db_xref="GeneID:9122874"
     CDS             373024..375378
                     /gene="crfC"
                     /locus_tag="ECL_RS01775"
                     /old_locus_tag="ECL_00365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006177339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="clamp-binding protein CrfC"
                     /protein_id="WP_013095116.1"
                     /db_xref="GeneID:9122874"
                     /translation="MHTQTIFELSQEAERLLQLALQNLDTLKSMPIAMLESTATAITG
                     EKNNVLPLHFSARGVEAQQAMLNSELRKITRLEMVLAIVGTMKAGKSTTINAIVGTEV
                     LPNRNRPMTALPTLIRHTPGQKEPVLHFTHVSPIDDLIQLLQKKLCDDDRGKLAQRLE
                     IDKDMNTLLERIERGEAFEKHHLGAQPIFHCLKSLNDLVRLSQALDVAFPFSEYAAIE
                     HIPVIEVEFVHLAGLDAHLGQLTLLDTPGPNEAGQPHLQKMLTEQLSRASAVLAVMDY
                     TQLKSISDEEVRQAISVAGKSVPLYALVNKFDQKDRNSDDEEQVRAMISGTLMKGNIS
                     PGQIYPVSSMWAYLANRARYEMANHGQLPDHQEQRWVQDFAEAALGRRWRTADLDDIE
                     HIRHAADLLWEDSLFEQPIRKLIYAAYANASLFALRSASHKLLNYAQNAREYLDFRYQ
                     ALTVAFESLELNITRLEEDMALLQTRQRVASEEVKHEVEQALHATDDFMALQKGALQQ
                     AIGHIFNSHTLLDLAGIDPLNHRQDAPEALTQLVLDDERQAQTVLNSIRSACEQVMLD
                     AQTKISRELALRFDQLESTLARSLNEAMRPIELRIKEQLSHAGFRARISFPAFQANQL
                     NFNTRALFTDAIAEDTRPAGQPSAAGSVRETVSRWLNNPGWGWEDYVATRTRYVIDIA
                     QLHDKFMQHIDQFCEQIRKALTAQVDVSVTAGMATFFAEFSLCLAGLQESLRDSLAVR
                     QQNEHSTRSLSQLLKQSITTATWIQEDTRLLRDDIQTLFAAEQP"
     gene            375375..376250
                     /locus_tag="ECL_RS01780"
                     /old_locus_tag="ECL_00366"
                     /db_xref="GeneID:9122875"
     CDS             375375..376250
                     /locus_tag="ECL_RS01780"
                     /old_locus_tag="ECL_00366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029882903.1"
                     /db_xref="GeneID:9122875"
                     /translation="MTTQLLDGPGRTLECIHPKFMVDLVQGVDAPRHTHLGPQQLQFR
                     ERLTQEIMTHTRLRPWAMAGMLNENAALRLGLAEKLAGMLDPGHLALTRMADKLVALR
                     QQTSLRTQPSPGLVQQYAELSSHFLQRAAYKEKALSQRGLTVQAGDHSEQIFTRWRAG
                     HYDGWSLAGRCYIVLEELRWGAFGDACRLANADVAAMLKDNLRSMAANYLAQGINASP
                     TTRHFYHQWLTTPSTPGSIDHKDMLGWLGDWCQADSHPVSWSVTQNWQTVALGMPRLC
                     SAKRLVDGMVEEIFG"
     gene            complement(376294..377286)
                     /gene="kdgT"
                     /locus_tag="ECL_RS01785"
                     /old_locus_tag="ECL_00367"
                     /db_xref="GeneID:9122876"
     CDS             complement(376294..377286)
                     /gene="kdgT"
                     /locus_tag="ECL_RS01785"
                     /old_locus_tag="ECL_00367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003860201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate transporter"
                     /protein_id="WP_013095118.1"
                     /db_xref="GeneID:9122876"
                     /translation="MKIKATIERIPGGMMLVPLVLGAILNTLAPDTGAYFGGFTKGMI
                     TGTVPILAVWFFCIGASINLRATGTVLRKSGTLVITKIAVAWVVAMVCALFIPENGIQ
                     TGFFAGLSVLAIVSAMDMTNGGLYASLMNQYGTKEESGAFVLMSLESGPLMTMLILGS
                     AGLASFEPHHFVGAILPFLIGFALGNLDHDLRDFFSKATPVLIPFFGFALGNTINLKV
                     ILDTGLLGIVLGVAVIIITGIPLIIADRVIGGGNGTAGVAASSAAGAAVANPVIIAQI
                     NPAFEPVAASATALVAASVIVTAILVPIITALYAKRFGNLPEPDTEPKAVELHH"
     gene            377936..379438
                     /gene="proP"
                     /locus_tag="ECL_RS01790"
                     /old_locus_tag="ECL_00368"
                     /db_xref="GeneID:9122877"
     CDS             377936..379438
                     /gene="proP"
                     /locus_tag="ECL_RS01790"
                     /old_locus_tag="ECL_00368"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine/L-proline transporter ProP"
                     /protein_id="WP_013095119.1"
                     /db_xref="GeneID:9122877"
                     /translation="MLRRKKIKPITLRDVTIIDDAKLRKAITAASLGNAMEWFDFGVY
                     GFVAYALGKVFFPGADPSLQMIAALGTFSVPFLIRPLGGLFFGMLGDKYGRQKILAIT
                     IVIMSISTFCIGLIPSYASIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRK
                     RGFMGSWLDFGSIAGFVMGAGVVVLISTVVGEANFLEWGWRIPFFLALPLGIIGLYLR
                     HALEETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKHWRSLLVCIGLVISTNVTYY
                     MLLTYMPSYLSHNLHYSEDHGVLIIIAIMVGMLFVQPIMGLLSDRFGRRPFIILGSVA
                     LFALAIPAFILINSNVLGLIFAGLLMLAVILNCFIGVMASTLPAMFPTHIRYSALAAA
                     FNISVLIAGLTPTLAASLVESTQNLMMPAYYLMVIAVIGLITGITMKETANRPLKGAT
                     PAASDIQEAKEILREHYDNVEQKIEDIDAEIEELQKKRSRLVDQHPRINE"
     gene            complement(379472..380425)
                     /locus_tag="ECL_RS01795"
                     /old_locus_tag="ECL_00369"
                     /db_xref="GeneID:9122878"
     CDS             complement(379472..380425)
                     /locus_tag="ECL_RS01795"
                     /old_locus_tag="ECL_00369"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel/cobalt transporter"
                     /protein_id="WP_044159025.1"
                     /db_xref="GeneID:9122878"
                     /translation="MITQRLTRDWRIPGAGLMTLLLLIAGFTLHAHWGAFIQWCLATQ
                     ITLHRYLVMYLLQLNNHQYSGGLWLLTGAFFYGVLHAIGPGHGKFIVTTYLSTNKESE
                     LAARVVPFFGSMLQGVSAILFVFILAVGFNLASGDISTSRWYVEKISAVLIGAFGAFI
                     IYQALKSLRPRRMAISAITPLHQHDEHCGCGHHGVGADLAQGDWKTRLGVILAIGARP
                     CSGAIMILMFSNALGIVTWGMAAVMTMSLGTALSIMGLSLAVRYARERTVAWFGGDTS
                     LKWLVPAVKIAGGIVLILFATILFLTVIPISANGDYIAAGC"
     gene            380923..382474
                     /locus_tag="ECL_RS01800"
                     /old_locus_tag="ECL_16S02"
                     /db_xref="GeneID:9122879"
     rRNA            380923..382474
                     /locus_tag="ECL_RS01800"
                     /old_locus_tag="ECL_16S02"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9122879"
     gene            382534..382610
                     /locus_tag="ECL_RS01805"
                     /old_locus_tag="ECL_tRNA007"
                     /db_xref="GeneID:9127645"
     tRNA            382534..382610
                     /locus_tag="ECL_RS01805"
                     /old_locus_tag="ECL_tRNA007"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:382568..382570,aa:Ile,seq:gat)
                     /db_xref="GeneID:9127645"
     gene            382647..382722
                     /locus_tag="ECL_RS01810"
                     /old_locus_tag="ECL_tRNA008"
                     /db_xref="GeneID:9127675"
     tRNA            382647..382722
                     /locus_tag="ECL_RS01810"
                     /old_locus_tag="ECL_tRNA008"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:382680..382682,aa:Ala,seq:tgc)
                     /db_xref="GeneID:9127675"
     gene            382884..385812
                     /locus_tag="ECL_RS01815"
                     /old_locus_tag="ECL_23S02"
                     /db_xref="GeneID:9127676"
     rRNA            382884..385812
                     /locus_tag="ECL_RS01815"
                     /old_locus_tag="ECL_23S02"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9127676"
     gene            385864..385979
                     /gene="rrf"
                     /locus_tag="ECL_RS01820"
                     /old_locus_tag="ECL_5S02"
                     /db_xref="GeneID:9127653"
     rRNA            385864..385979
                     /gene="rrf"
                     /locus_tag="ECL_RS01820"
                     /old_locus_tag="ECL_5S02"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:9127653"
     gene            386456..386986
                     /locus_tag="ECL_RS01825"
                     /old_locus_tag="ECL_00370"
                     /db_xref="GeneID:9127661"
     CDS             386456..386986
                     /locus_tag="ECL_RS01825"
                     /old_locus_tag="ECL_00370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004124241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_013095121.1"
                     /db_xref="GeneID:9127661"
                     /translation="MKLNKVAMAVALTAALSSMSAFADTTNGQIEFQGELVNTACGLA
                     PGSSPVSVDFGQIPVSALANGARAGNVHQNIELQHCDTTVAQTAEVTYSPTSVNPTDA
                     SLAAFTSGTASGAGIGLRDSASQDVVWGNATTPVQLVDGTNTIPFVAYVKAESASATV
                     TAGSFQSTVNFEIAYQ"
     gene            387206..389679
                     /locus_tag="ECL_RS01830"
                     /old_locus_tag="ECL_00371"
                     /pseudo
                     /db_xref="GeneID:9122880"
     CDS             387206..389679
                     /locus_tag="ECL_RS01830"
                     /old_locus_tag="ECL_00371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830336.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus outer membrane usher protein"
                     /db_xref="GeneID:9122880"
     gene            389751..390464
                     /locus_tag="ECL_RS01835"
                     /old_locus_tag="ECL_00372"
                     /db_xref="GeneID:9122881"
     CDS             389751..390464
                     /locus_tag="ECL_RS01835"
                     /old_locus_tag="ECL_00372"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_013095123.1"
                     /db_xref="GeneID:9122881"
                     /translation="MAACALSLVAGYAQAGVSLDRTRIIITEKESSSSANLSNTSPDI
                     PFLAQSWVEDEKGNKIASPLIVLPPLQRINGGQKGIARVTKTAGIEKLPKDRESLFYL
                     NVREIPPKPEKPNTLQLAMQSRIKLFYRPEAVIPKTKGEVWQDRVVFQKSGSEMTVQN
                     PTPYYVTILSLTKGDGVKITRFPGIMVAPKSSQTFAVTDAGVSQFSMKFVNDYGGHPE
                     LKFRCDGNTCKALPPAQQG"
     gene            390483..391526
                     /locus_tag="ECL_RS01840"
                     /old_locus_tag="ECL_00373"
                     /db_xref="GeneID:9122882"
     CDS             390483..391526
                     /locus_tag="ECL_RS01840"
                     /old_locus_tag="ECL_00373"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_013095124.1"
                     /db_xref="GeneID:9122882"
                     /translation="MQHPYPYAALLAMCALGFSGAARSVVDGEIKAVNGTYEYLININ
                     NHDITSNQVGAVVIDEFDLAGMFQGRAYCAQPMISQPVYYTSQATLTQSGMTAGYLKL
                     NDYMDVKIEIYIGGNLQQYKTVPFDNVSNNVNQNYCNPPSTILDNQFASGAKGKVTFM
                     ITNPIINGVNLQGSEIATLYGRLGPGAMGQTPLSRVTIASGVITVPDKCIVNQGTPIV
                     VDFGNIPGTGSRLDGINYSQNVPIHVKCQGGSFSQGELNIKLGIQQANPAFSDGKYLS
                     TQGAVDRSELGIALRDSKGNPVVPNTFYNVPGFSHNEGDWNLIAAPVAKNTTSVIPEG
                     EFHASATVVAEFQ"
     gene            391536..392084
                     /locus_tag="ECL_RS01845"
                     /old_locus_tag="ECL_00374"
                     /db_xref="GeneID:9122883"
     CDS             391536..392084
                     /locus_tag="ECL_RS01845"
                     /old_locus_tag="ECL_00374"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_013095125.1"
                     /db_xref="GeneID:9122883"
                     /translation="MHRMIIILTCYLTVFAAAPAWARGELIGGDLSFKGVVMAYPCSI
                     APESGRILVDFGEISTKSLYIKGKTTPVPFAIKLQDCNPNVFNAVTVTFSGIANANMA
                     DRLAINATAPGNAGGVGIGLLEEDDTPVRLNVATRPTLINDTLLRLSFQAFVEAEPDA
                     VASGTLTTGPFTATAHYTLDYQ"
     gene            392108..392767
                     /locus_tag="ECL_RS01850"
                     /old_locus_tag="ECL_00375"
                     /db_xref="GeneID:9122884"
     CDS             392108..392767
                     /locus_tag="ECL_RS01850"
                     /old_locus_tag="ECL_00375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013095126.1"
                     /db_xref="GeneID:9122884"
                     /translation="MRYQFFLYDKNIFYSQGIKMVITSLLAEQADVLYSLTDDYDQLL
                     VQLQRQVNDEGCMWILCDLDSLPRERLHTLQLMKEFYQQENKNLIILLSKHNMPLFFA
                     LYSLLPTAHWLLKTENMESITPFFQRLLDKTRQGCCFSASLVNYTKKKLYDRSVEPTI
                     SGSEWWLMEELFKGKSLSQISDEVNVDIRRLSYIKRHLMKRLNIRSNIALFSAFRGIM
                     P"
     gene            392857..393057
                     /locus_tag="ECL_RS01855"
                     /old_locus_tag="ECL_00376"
                     /db_xref="GeneID:9122885"
     CDS             392857..393057
                     /locus_tag="ECL_RS01855"
                     /old_locus_tag="ECL_00376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4762 family protein"
                     /protein_id="WP_013095127.1"
                     /db_xref="GeneID:9122885"
                     /translation="MKKLTAFEAARIVGGTCKTCEITYQNVTVGGVTSCKQITTCTDK
                     HGCTTTMRDADSSKCGGIPNRY"
     gene            393172..393789
                     /locus_tag="ECL_RS01860"
                     /old_locus_tag="ECL_00377"
                     /db_xref="GeneID:9122886"
     CDS             393172..393789
                     /locus_tag="ECL_RS01860"
                     /old_locus_tag="ECL_00377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017374475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA family protein"
                     /protein_id="WP_044159563.1"
                     /db_xref="GeneID:9122886"
                     /translation="MVSVLITVLCYHIFVFKTFTRDDSQTQAFREVSPDMQANSPIKN
                     DRSIIEVMSYGCHYCAANEENLAEFSRTLPPDSTFTSIHIADEDNGLAAYAPLFATLE
                     AMGIEKQIRDSAYNAIITRNVDLTDEKKLNGWLVKNNIDVVKFNTFRLSKAVKERLSE
                     MAAITAYYDINATPMFIINKRYVVAQDREFPAFAQRIRELLEEDK"
     gene            393794..394750
                     /locus_tag="ECL_RS01865"
                     /old_locus_tag="ECL_00378"
                     /db_xref="GeneID:9122887"
     CDS             393794..394750
                     /locus_tag="ECL_RS01865"
                     /old_locus_tag="ECL_00378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044158985.1"
                     /db_xref="GeneID:9122887"
                     /translation="MVRLFIIWSVLSFKNSTGKIEDIQQRLTQCGVFFLRKIVRVVPL
                     PVTLTVAKGLCATRLFGRAFRLRNAVANENVRCLTGQKVRLNVAWLTVRRRLLEEAAT
                     WAQKPALLQQMRTCAAELNAVVTPLYEQNAPYILAPLHTVSDVLAAIIGASVTPGKAS
                     VVVSSSAELYSAPARAFGGVALDYCSIHQENKTLASNLMDLITDVAAGQRNMIIFPDI
                     TPDYTSQAEGMLVAKQPCRLFGRSARLHGGLVRLSGAIAAQVVFYHLSYDNRLHIHIH
                     PPVSSQHVASALPDIIESTLQASPQEWLLWHSHSLYFINHSR"
     gene            394753..396867
                     /locus_tag="ECL_RS01870"
                     /old_locus_tag="ECL_00379"
                     /db_xref="GeneID:9122888"
     CDS             394753..396867
                     /locus_tag="ECL_RS01870"
                     /old_locus_tag="ECL_00379"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_013095130.1"
                     /db_xref="GeneID:9122888"
                     /translation="MKNTIPNLIFQEETNECGLACVAMLAQTQGQTISLETLRDIFPA
                     SDHGTSLDTLMAILARLGIATAPVLFEHHELSELPLPAILHYGASHYVLLAWRKGNHV
                     CVMNPAIGEQWLPFAALKQEISGYALIVEPEQRLAADPALARPTAGQSMPRVMSMKET
                     ADVPGIYRLMLLTFMVSLTLFLMPTMVSSAINKAFSSVESSGFPYGWFILAFVVSSLM
                     ALGVRAIAERYIKRFVLIHSGVGFSRMLQNPLRFFEKRAPGEIFSRFTAWQMGLLQKI
                     ELDNGLRSDWVIGAIALAIMFWIAPILAAISAIGVTVMGIISVWAVIRDRWFTQQLQL
                     KSAALNDFFMETLQGILTVKTAGLEGQRQAQFAALSRELYTCLQRQKVYQQVKEGLYQ
                     LCGSLEMVAFMLVVLPMVHGKQISLGDFFAYSFLRQIFTSYVTRIFYAIIQKTQLHVI
                     DTRAHALFAPGGERAPAPLIAVPTADTTPALAFEALGYGYDPAVPVLSSVSLSLPAGE
                     QIAIVGESGAGKSTLLRLIAGLFSPQAGGCYAAGRALPAAHLAQYVCLQSQEDILFNA
                     SVRENITLFDAHYRERDRGRIEALLDALMLGDVVRALPGGLDALIRESHAALSLGQRQ
                     RLLLARALYSSRPVLLLDEPTANLDDETAAIVMATVHAHCRRAGKSLIVVTHSEQVLS
                     GFQQVYHLVDGRLSLREGSDEA"
     gene            396857..398008
                     /locus_tag="ECL_RS01875"
                     /old_locus_tag="ECL_00380"
                     /db_xref="GeneID:9122889"
     CDS             396857..398008
                     /locus_tag="ECL_RS01875"
                     /old_locus_tag="ECL_00380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="efflux RND transporter periplasmic adaptor
                     subunit"
                     /protein_id="WP_013095131.1"
                     /db_xref="GeneID:9122889"
                     /translation="MKHKSRWVMLGCGLAFVAAMAGVWVSMASPSPHTRLPVDTVGTG
                     DIEKVVLVTGILKPAVQVNVGAQVNGQLRKLYVRQGERVKKGQLLAEIDPTLQESELR
                     NTKAQLASARAQKRSAQAMLLRYRQELDRQRLMQRDGSGVRSEFEQARSQYAVQVQQI
                     AVSEAQIAQAEMAVKTAQANLSYTRIVAPVDGEVLGIVTREGQTIVSSQTAPTILVLA
                     DLDTMQVQTRISEADVQKIHPGQPLSFYVIANPDKRYASTMGYVQPAPQDAMEASGER
                     GMGGNAQAMAVYYTGTFEVPNAGRELKTSMTAQVFIQIARASNVLRVPVAALGQAQDA
                     DRYTITTVKDGNTQSRTIRIGIQDRQYAEVLEGLQAGEQVVLEQETERG"
     gene            398012..399943
                     /locus_tag="ECL_RS01880"
                     /old_locus_tag="ECL_00381"
                     /db_xref="GeneID:9122890"
     CDS             398012..399943
                     /locus_tag="ECL_RS01880"
                     /old_locus_tag="ECL_00381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_013095132.1"
                     /db_xref="GeneID:9122890"
                     /translation="MEPIIVLRRVCRRFHAGTQTLAVLSDISLTFHRGEMVAIVGASG
                     SGKSTLMNIIGCLDKPTSGEVLINGTPVHNADSLYLADLRSRYLGFIFQRYHLMPYLT
                     AEENIAIPALYTAMSEQERTVRVQRLAVQLGLENRLQHRPAELSGGQQQRVSICRALI
                     NGAHIILADEPTGALDSTRGKALMGVLHQLHASGHTVIIVTHDRDIARQAQRIIEISD
                     GRIISDVRHAEVHPSTLLPEQDNGRASLVSRFRESVRMAWRALLGHRMRAFLSMLGII
                     IGIASVVSSMAVGEGARRAIVDEIGKLGNTTLEIRPGTGWGNARPDMARALSMEDVRS
                     LQALPWVMGVSPVVSSTALAVRKGLDSSMMLSGVSQDFFTLQGLRVVQGNGFTARDVA
                     EGEPVMILDETGRDTLFPGGENPLGALVQIAGAPWRVIGVATRPGPKVVGGFMAAWVP
                     HTALQQRLTGQIPLESLVLRFQPPLTSQEAAQRVERHLLREHGRKDFFIQTDDRLANA
                     MQKTSDSMSLLITAIAAISLLVGGVGVMNIMLVSVTERTHEIGIRLSVGARPADIMNQ
                     FLIEAVMICVLGGLVGVSGAWLAGHIFAFVTDAFSMVFTVFPVLMACGFSAAIGLTFG
                     YFPARSAARLSPTEALARE"
     gene            399994..401322
                     /locus_tag="ECL_RS01885"
                     /old_locus_tag="ECL_00382"
                     /db_xref="GeneID:9122891"
     CDS             399994..401322
                     /locus_tag="ECL_RS01885"
                     /old_locus_tag="ECL_00382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family protein"
                     /protein_id="WP_013095133.1"
                     /db_xref="GeneID:9122891"
                     /translation="MTRSDYQRPLLSLPTQWPTMAEKGTENGWRFSDPRLSRVIEQVL
                     ESNNDLAAAALTLQQARVAAGLTSTNISPDVRVSGAASNSKNVRRGAPPQENYSGSVA
                     IAWELDLWGKLARTREQSEWQARASEQDYRATVLSTMGLTAQLYWRIALYNQQIRHQR
                     DGLTVSEQTVQQVSSWFNAGKVGQLDVLQAQQALLARQNQLRTLIQQRQNTRSALALM
                     LNRPAEQHADELRELDVHQQVPVAQKTPLRVIAQRPDIQAAESRLRAALAGYDAARLQ
                     FYPTLSLDASLNAGSQVFSQWFRDPIRTTGAALALPFIQWNTRQLTVAQADLAIKQAA
                     IAFRSTAYTALAEVDEAMENRLSADEQRSRLHQSLALSQRRLSLTESRYRAGAVDFQT
                     LLNAQDDLLNTENALAQTQYDYLYATLQLWLAQGGDTQNRMIKDEAEKWR"
     gene            401300..402553
                     /locus_tag="ECL_RS01890"
                     /old_locus_tag="ECL_00383"
                     /db_xref="GeneID:9122892"
     CDS             401300..402553
                     /locus_tag="ECL_RS01890"
                     /old_locus_tag="ECL_00383"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl-[acyl-carrier-protein] synthase
                     family protein"
                     /protein_id="WP_013095134.1"
                     /db_xref="GeneID:9122892"
                     /translation="MKLKNGDNRVVVTGYGAVTPLGVTADESWQAIMDYRLGYRYVDY
                     TARNIKTHFLGLVDNEPSLIGVPAAVRRRLPRFARLTFGAARQAMAMAFGGQPPQEFY
                     SPLDCGAIMGTGWGGLDESYDAQSDFSATGFASPFNCFYSMPSVTTAACSQFWGLNGF
                     QNTVVAACATGTIAIGEAYEVIRTGRAQMMLAGAGESLTSPCAIWNIDVLGALSKETQ
                     DPQRASCPFSAHRNGFVLSEGAAVLCLESREGALARGATILGEITGYANFSDAWDFTS
                     PAEDCLARVQTIISALRQAGLEPEHLDYINAHGTSTPLNDINETQSLKMALGEAVWTV
                     PISSTKSYSGHLISAAGAFESIVCLQAIANGIIPATTNFQHADECCDLDYVVEGHRHA
                     TIRRTLNLSFGFGGANAALILEKHS"
     gene            402550..403353
                     /locus_tag="ECL_RS01895"
                     /old_locus_tag="ECL_00384"
                     /db_xref="GeneID:9122893"
     CDS             402550..403353
                     /locus_tag="ECL_RS01895"
                     /old_locus_tag="ECL_00384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095135.1"
                     /db_xref="GeneID:9122893"
                     /translation="MMTLRYSQQDARLWAAFSGDYNPVHFDKAWVKSQGGSRLSVHGM
                     RALLDVKRFISPEVRRSSFLKCTVRLRRPLWRDTTYLLMCDPNKPVSASVYDLTAQTV
                     CLSCAIAPVNLFAVAEAESQRELGASTIAALHQTFLPLLPHAQQWHFLDALLFRHLLQ
                     DTALLHQKDIAPLIPSGHTLEALFTRYPVVQTHQEVVFDSHLLAPWQTVPLPEPLEIE
                     TLPATVVGDLRYGAVVRIAAQTRYQQHYISSAVTLKVGPLTKGNANELV"
     gene            403340..403591
                     /locus_tag="ECL_RS01900"
                     /old_locus_tag="ECL_00385"
                     /db_xref="GeneID:9122894"
     CDS             403340..403591
                     /locus_tag="ECL_RS01900"
                     /old_locus_tag="ECL_00385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_013095136.1"
                     /db_xref="GeneID:9122894"
                     /translation="MNSYEIIYSKISEMIADAKDLPLEALTPDTTLPQLELDSLDYVE
                     LMVLAKREFNVTLTAEMFMKKPHMTLRDLSLYIDQEMAG"
     gene            403593..404330
                     /locus_tag="ECL_RS01905"
                     /old_locus_tag="ECL_00386"
                     /db_xref="GeneID:9122895"
     CDS             403593..404330
                     /locus_tag="ECL_RS01905"
                     /old_locus_tag="ECL_00386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017145497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_044158989.1"
                     /db_xref="GeneID:9122895"
                     /translation="MTKRWMLITGGSRGIGQALVSHLLPEWNIVFTGRNEAGIGRTLA
                     QAKGLRTATWVKGYRCDGRDEADVQRLATSLLDEFGAPAAIVHNAGMTRDALHIHQTA
                     RDWQDVLTNNLVALVNWNRTLLPAMMMQGSGAVVLMSSVTAIKGNSGQTAYAASKAAM
                     IGLTRSLAQEMGRFGIRVNCLAPGLIEGEMVEAIPEARLKAMRQSIPLRRLGQTQDVA
                     HAVAFLAGEGSRYLTGQTLVLDGGLSA"
     gene            complement(404367..405488)
                     /locus_tag="ECL_RS01910"
                     /old_locus_tag="ECL_00387"
                     /db_xref="GeneID:9122896"
     CDS             complement(404367..405488)
                     /locus_tag="ECL_RS01910"
                     /old_locus_tag="ECL_00387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HD domain-containing protein"
                     /protein_id="WP_077681911.1"
                     /db_xref="GeneID:9122896"
                     /translation="MINPRLNLHHVRTAYIAWLLARESQFTPAQCRKTLLAALLHDIG
                     GLNEESRLQPMSYYDNELNNHAAVGAELLASVPLLNPLNAIVRYHHTHWNNGRGACVN
                     GIKTPKESHIIYLADRLDVLISHYRASDIITAQEEIIKIIVSGENDLFQPDYIHAFQR
                     VASRDHFWLRIQSTEFDDYIKEIPRIHNDPLSLHNFRDIAGMLAFIIDGFSQHGVQHS
                     LVVGRISGYLAREMGIPPVQCLKIEIGGLLHNLPSLALCATPAQTDEGKAVWDELYPI
                     EAIRDIAGWCQLQKSVDAKSAYPPEVTIIKASIWLASLLQGVTLSSEFKARVGETAEI
                     APALAGVVQQHSAILLQIFHESVKERRALVQRINQLTLS"
     gene            complement(405591..406058)
                     /locus_tag="ECL_RS01915"
                     /old_locus_tag="ECL_00388"
                     /db_xref="GeneID:9122897"
     CDS             complement(405591..406058)
                     /locus_tag="ECL_RS01915"
                     /old_locus_tag="ECL_00388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044158991.1"
                     /db_xref="GeneID:9122897"
                     /translation="MSKRVFFLLLCLALFLAGGMYSFTSPAVFSCESQFSVVQNINGK
                     SVHAEGLIFINMANDHILMNIDGLLSHDNKNQLISRTLKIKYKKFNPSANLYQVTSVR
                     TLRDSTDNIDDTVAINLLFGKGPDDKIIYLNKLNNNTLLFGNHTFPQYGCKRK"
     gene            complement(406051..406779)
                     /locus_tag="ECL_RS01920"
                     /db_xref="GeneID:44145310"
     CDS             complement(406051..406779)
                     /locus_tag="ECL_RS01920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix domain-containing
                     protein"
                     /protein_id="WP_023621694.1"
                     /db_xref="GeneID:44145310"
                     /translation="MRYDIEGFITFDTEDASLLNVLTGDCVELSQTSTRLLAELLNHR
                     GDILSRSEIFHSVFDQYGARASNSNLNQYISTLRRNLNDLGVEKEIITTVPRIGFKIA
                     DDVIIHNDREYRTPFLEEKTSEATRNPPPPSVFERIARIIALGIVSILLVIRPHTVDS
                     GNNVHKIVDDQCIIFTSPALSLWDVKNSFHFTTQPFDCSQPKELYLYKKQINGTLGNI
                     IQLLLVECDNGNCESFYYREKNNV"
     gene            406948..407268
                     /locus_tag="ECL_RS01925"
                     /db_xref="GeneID:44145311"
     CDS             406948..407268
                     /locus_tag="ECL_RS01925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427781.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014830351.1"
                     /db_xref="GeneID:44145311"
                     /translation="MKLSLCSYNPEAVHPGYNAPHDNLQMLAAEMGISGLAMIRGPEQ
                     MLILNLLKDHSTQGLSTRELANLCGISIYKVRHLLLPLEKYGQVIRDKMQKHHQWFLS
                     KDAT"
     gene            complement(408385..409532)
                     /locus_tag="ECL_RS01930"
                     /old_locus_tag="ECL_00389"
                     /db_xref="GeneID:9127677"
     CDS             complement(join(408385..409295,409295..409532))
                     /locus_tag="ECL_RS01930"
                     /old_locus_tag="ECL_00389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612015.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_088581786.1"
                     /db_xref="GeneID:9127677"
                     /translation="MSGKRYPEEFKTEAVKQVVDRGYSVASVATRLDITTHSLYAWIK
                     KYGPDSSANKEQSDAQAEIRRLQKELKRVTDERDIFKKSRGVLRKAVRLRYAFIRDNT
                     CCWPVRLLCRVLDVHPSGFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGYRKIH
                     LDLRDSGQQCGVNRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNPDAPD
                     KRWVTDITYIRTHEGWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWRRNPQ
                     KQVLVHSDQGSQYTSHEWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKKK
                     SYGTREEARSDIFDYIEMFYNSKRRHGSSDQMSPTEYENQYYQRLGSV"
     gene            409771..410787
                     /locus_tag="ECL_RS01935"
                     /pseudo
                     /db_xref="GeneID:44145312"
     CDS             409771..410787
                     /locus_tag="ECL_RS01935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414793.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5-like element IS5 family transposase"
                     /db_xref="GeneID:44145312"
     gene            410999..412246
                     /locus_tag="ECL_RS01940"
                     /old_locus_tag="ECL_00393"
                     /db_xref="GeneID:9122902"
     CDS             410999..412246
                     /locus_tag="ECL_RS01940"
                     /old_locus_tag="ECL_00393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000431673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_013095143.1"
                     /db_xref="GeneID:9122902"
                     /translation="MGSSELSLLQMAVMQSWNAVVITSADRAAGYPVKIANPAFCQMT
                     GYAIDELYGQSLKMLQGPATDQEVINRLRNCLSSGEYFEGMTTNYRKDGLPYLVRWNI
                     SPVRDEEGDITHFVSVQQDMTAYAKVEETSKILGQALDAAAQPILVTDAQAKIIFANQ
                     AFCQVSDYEESELIGNTPSLFKSGLQDDDFYKNVKASLMTAKTFQAIFINKRKDGTLY
                     HSEQSISAIKDHAGNITNYVSVGKDVTERLREEQALRESATVDQLTGLFNRNHGKALL
                     SEAYSFTLSREEPMSLILCDIDHFKQINDSFGHPVGDQILAQVSGLLRKSVRGNDRVI
                     RWGGEEFLILLENCTDMVAAELAERLRLRIASEQFQNVGKVTVSLGVASLFQKESLEQ
                     LISRCDEALYKSKRNGRNQLTLA"
     gene            complement(412296..413416)
                     /locus_tag="ECL_RS01945"
                     /old_locus_tag="ECL_00394"
                     /db_xref="GeneID:9122903"
     CDS             complement(join(412296..413158,413158..413416))
                     /locus_tag="ECL_RS01945"
                     /old_locus_tag="ECL_00394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611474.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISSen4 family transposase"
                     /protein_id="WP_144340281.1"
                     /db_xref="GeneID:9122903"
                     /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKY
                     GSMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKLLTTDQKREAVMLMCD
                     ATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITELALERRRFGYRRIWQLLRR
                     EGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMDALST
                     GRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTC
                     RALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKIINDW
                     RQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
     gene            complement(413466..414662)
                     /locus_tag="ECL_RS01950"
                     /old_locus_tag="ECL_00396"
                     /db_xref="GeneID:9122905"
     CDS             complement(413466..414662)
                     /locus_tag="ECL_RS01950"
                     /old_locus_tag="ECL_00396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000106740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_013095144.1"
                     /db_xref="GeneID:9122905"
                     /translation="MSSPKRFRFTNQLIKSLPPNTSDARSTDAEYSDTEISGLKCLVS
                     RREGRKKFLLRYLYHGRKRAIAIGHWPEVDVNLARQIAIEHKRSLATGTDPKQERENK
                     RMELTFDELFNQHYLPWAKSAKRSWGKDVQRYRDHIRPAIGQRLLSDITPASILRLQQ
                     TLSTSLSAATCNRVIVLIKAVFTWAGRQSMTSVHPARVVQLLRENNARQRYFTEDEIR
                     RIFLSADNDTSPVAARYVKLLLLTGLRRDELRLAKWEHVDPVKRTLWLPETKNGYGRI
                     VHLNSLAMDVIRTLPTQRGNPWLFIGKKQGMPLSNPVKAFQRIVRRAGIFDKEVCIHT
                     CRHSVAALIVSYGGTLYDVQAQLGHRSSQSSQRYAHLHPQRLQNTSQLLAERITAQLP
                     DLLPVD"
     gene            complement(415009..415596)
                     /locus_tag="ECL_RS01955"
                     /db_xref="GeneID:44145313"
     CDS             complement(415009..415596)
                     /locus_tag="ECL_RS01955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001615655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_023293471.1"
                     /db_xref="GeneID:44145313"
                     /translation="MDTHTPYNCNDIARLALAMHGHSYFFSLRRHLNINFSRDLNGSG
                     TQGLFIKKQNVDIDLIKVIFDYTDNKNDDFLYEADLIKDQRKDYEPTVNRGKHRFVAK
                     QIELNIDWNGNEIQQWRADIERLTRSHDNLEDWLKNGSEMLVCCASGFFCRLPTILTL
                     NDLKQYVAMGVTLEDLKTRLKCSKCGKRGSKVTVF"
     gene            416426..417310
                     /locus_tag="ECL_RS01960"
                     /old_locus_tag="ECL_00397"
                     /db_xref="GeneID:9122906"
     CDS             416426..417310
                     /locus_tag="ECL_RS01960"
                     /old_locus_tag="ECL_00397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019105617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="WP_013095145.1"
                     /db_xref="GeneID:9122906"
                     /translation="MHSKTKVVPVVSTKGGEGKSTQAANLGGFLADAGIKTLIIDGDH
                     AQPTASSIYPLAYEAPCGLYELLMQTVDLSKAENIISRTTIDNLDVIVSNDPRNLLPT
                     YMLNVPDGRVRLRNALSNQVFSQYDVILIDSQGSRSVMSELIILAATGEMIGMVKPVL
                     PDVREFMRGTVALMEELIPYMAFGISLPRIHMLVNCMDYTLLAKTTVEQAENIIVSGD
                     YSQHADKIVIDMLQTRIYDLDVYKQGHAAGQPVHRLEKKTSRKSDSAFDSMHGLACEL
                     FPEWVSLFDTLAKGGERV"
     gene            417303..418667
                     /gene="dnaB"
                     /locus_tag="ECL_RS01965"
                     /old_locus_tag="ECL_00398"
                     /db_xref="GeneID:9122907"
     CDS             417303..418667
                     /gene="dnaB"
                     /locus_tag="ECL_RS01965"
                     /old_locus_tag="ECL_00398"
                     /EC_number="3.6.4.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_044158999.1"
                     /db_xref="GeneID:9122907"
                     /translation="MSDDRRNIPGIYSPDAEQSVIGGLMLDNDRWDEVALRLSADDFF
                     QKVHKVIYQEMTRLVAAGKPLDLITLSESIESRGKDALEQLGGFAYLAELSKNTPSAA
                     NIVAYCDIVARTSRARQLASIGAEITESVRTPGTDIDRVMETAEQKITRLAERAEPEQ
                     GVTLLEGMERLLPELERRCNVPDGITGTPTGFEELDAMTSGLQAGDLVLIAARPSMGK
                     TALLISLLLNSLMKKSGSKGQLYSMEQPTEQILMRMLASLGSIDLTHLKSGLMDDEDW
                     ARATDASALLMGDLNDSLIIDDTGSLTPAMLRIRARRNARRYGHPSIIGLDYLQLMRC
                     PDQENRTQEIAEISRSLKALAKEMMCPVVALSQLNRQLESRADKRPNNGDLRDSGALE
                     QDADVIVFIYRDEVYHENTEDKGIAEIIISKQRQGPTGTIRLQYEGRFTRFSDVAGRP
                     GRSA"
     gene            418664..420370
                     /locus_tag="ECL_RS01970"
                     /old_locus_tag="ECL_00399"
                     /db_xref="GeneID:9122908"
     CDS             418664..420370
                     /locus_tag="ECL_RS01970"
                     /old_locus_tag="ECL_00399"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParB family protein"
                     /protein_id="WP_007372572.1"
                     /db_xref="GeneID:9122908"
                     /translation="MSNVRNLNLGAAMLQRGKTPAQGDAVPAAVPLPVSEMAMVLTLD
                     QLRPNPDNPRKSRNPHFDEIKASIRACGLVQVPKVTRDPDGEDVYIFSDGGNTRYQIL
                     CELWQETGDERFYRVHTIFKPWPGRLKCLVGHLAENEVRGDLSYIDKAFGVHSARAIQ
                     EELMGRPVTLRELSDLLNLEGYPIDYSTISRMEDTIKYLWPCIPNLLNSGLARLQVLS
                     LLRIRSQAGKVWSQFAHESSPQCSFDQVFEASCQGFDDPDSYAYETFRDEFIGQLVKA
                     LPHPSLNYDRWMIELDPREQKRREQFGEPPPLPVLTPPQEKAAGREPPEPQVTVLPPD
                     TASETPVTGLRSGTLTTPGRPEPAPELPADAELPVNALMTAGSEPRREVQNDLFGGRP
                     VISGETADPDSISLPDFSPDTLMSAFGEENASPAASVSSVAFAATGLEPVSDIWHIPA
                     LQDDIEHLQDMAYRLVFEIAEAMGCADNVREDKNPQSAGFAVSETGSEFVLFLAGLSG
                     SLPNRQFNMFMFCLNFFGSQSPADMAVFDDITVVKTMRLIRVIRRLRELQRLAAKGGE
                     NV"
     gene            420363..420620
                     /locus_tag="ECL_RS01975"
                     /old_locus_tag="ECL_00400"
                     /db_xref="GeneID:9122909"
     CDS             420363..420620
                     /locus_tag="ECL_RS01975"
                     /old_locus_tag="ECL_00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraR/DksA C4-type zinc finger protein"
                     /protein_id="WP_007372573.1"
                     /db_xref="GeneID:9122909"
                     /translation="MSDDLNDEMAQASTALFIQHGIDAIRAKVNSATPSKAFCECCGA
                     AIPVARQLAVPGVELCAGCQEVKEMKNRHRADGGRGMRHVG"
     gene            420610..421353
                     /locus_tag="ECL_RS01980"
                     /old_locus_tag="ECL_00401"
                     /db_xref="GeneID:9122910"
     CDS             420610..421353
                     /locus_tag="ECL_RS01980"
                     /old_locus_tag="ECL_00401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2786 domain-containing protein"
                     /protein_id="WP_013095147.1"
                     /db_xref="GeneID:9122910"
                     /translation="MSDNAKITARIRRLMALGTRNSNPHEAARAVALAQRLMQRHGLT
                     PDMLSLSDVSESVCFSLTSDAEKVPAWLSSLATVVCMATGCRCWFGWHVHVSPQGVSS
                     VRRSLHFYGFSERPEVALYIYTVLQRQLRAATDAHMSGYRTRRILLRTRRRRADQFRE
                     GWVSGVWQVLQSFAPSGEENAVLQRWLVRRHAGEPLEDMAVRSAGKCRGDRTARVAGF
                     FAGRDIDLHHGLSGAQASRQITAGGHAHD"
     gene            421438..422037
                     /locus_tag="ECL_RS01985"
                     /old_locus_tag="ECL_00402"
                     /db_xref="GeneID:9122911"
     CDS             421438..422037
                     /locus_tag="ECL_RS01985"
                     /old_locus_tag="ECL_00402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2857 domain-containing protein"
                     /protein_id="WP_007372575.1"
                     /db_xref="GeneID:9122911"
                     /translation="MSQHNLSQATTAILSSLLMDVKNGNIRRCESLGMSVEEIRALSH
                     LSLDELHYLSQSHVSVLDVTLNHENFWLMLNQARNEQKRFMMIDRALELGGSMELIDR
                     YFGLSPSEVSARRRLMGIESRQGRTQALTEPQDAALWAEWKAAGLSSPDSHQALEAMM
                     LAAEQLGLSLTAVWSRVCQWCREANAAGRRAEIPVRKEA"
     gene            422037..422267
                     /locus_tag="ECL_RS01990"
                     /old_locus_tag="ECL_00403"
                     /db_xref="GeneID:9122912"
     CDS             422037..422267
                     /locus_tag="ECL_RS01990"
                     /old_locus_tag="ECL_00403"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095148.1"
                     /db_xref="GeneID:9122912"
                     /translation="MEMGDFSPRQQVSPAVRRRAQQLFRAACGGQKVFRRLTMNGYLK
                     IDVGPFWRILSKDGCRQWWLMDHETYNREIRR"
     gene            422346..423584
                     /locus_tag="ECL_RS01995"
                     /old_locus_tag="ECL_00405"
                     /db_xref="GeneID:9122914"
     CDS             422346..423584
                     /locus_tag="ECL_RS01995"
                     /old_locus_tag="ECL_00405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_013095150.1"
                     /db_xref="GeneID:9122914"
                     /translation="MTIPADSIVAHTLARMQQNLERRTDTGDVSQERSGLLFMGNVHD
                     AFPRRLFLDTRLSPLDKTAWVMIRLYAQQNEGAIFPTYDELQVQLASAHSEKASRDTV
                     SRVLLMLRLTGWLSLCKRVRDDRGRVRGNIYAQHDEPLGYRDAETFDPGWLKLVEESC
                     LSRNKAVRMTALAVVNDILQDPGMRHRHSRLALIESRLSAPSTPRQMVSHRRAVNRSP
                     ESGLSQKSTKNIPESLSPENGLSTPSVDKTQSPESGLSLKSTSYTGVRNPDCNVRSFT
                     QSVNKKTYVPGGEHFLPDDFVNGLNSDDRQMLTTQMASLPEAVAKTLADMLREQLRLG
                     RLNNPVGWLFTMLRRARSGELNLPEAAAPAPAGSGSNNPPTTGTRAVPAAIIPVQPAR
                     RPSRDEVRAMIESIRQNVGR"
     gene            423831..424553
                     /locus_tag="ECL_RS02000"
                     /old_locus_tag="ECL_00406"
                     /db_xref="GeneID:9122915"
     CDS             423831..424553
                     /locus_tag="ECL_RS02000"
                     /old_locus_tag="ECL_00406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03761 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095151.1"
                     /db_xref="GeneID:9122915"
                     /translation="MADKQVTKTGSLQSEMTIALHTNYAIGLWLGRKREKQEDNTPVK
                     HGIIGMPQFFVRATLINQDSLNNNPWADEAMYRLEEKLRSATETMTGLIKQLDEEMSM
                     LPAGITLTEVTSVEPLDIHVFTRTPLGYRCVFLLVGFDQFAKKVLQASHYGLITRNGR
                     DNYLSEGGRLLRQIYGTVLSYRRVDATRLDAAENNEVWQKACQEAGEPDRAVLLGEKR
                     SAFSPPVNEASVNLLRLRYQTV"
     gene            424571..426582
                     /locus_tag="ECL_RS02005"
                     /old_locus_tag="ECL_00407"
                     /pseudo
                     /db_xref="GeneID:9122916"
     CDS             424571..426582
                     /locus_tag="ECL_RS02005"
                     /old_locus_tag="ECL_00407"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019105610.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase III"
                     /db_xref="GeneID:9122916"
     gene            427215..427706
                     /locus_tag="ECL_RS02010"
                     /old_locus_tag="ECL_00409"
                     /db_xref="GeneID:9122918"
     CDS             427215..427706
                     /locus_tag="ECL_RS02010"
                     /old_locus_tag="ECL_00409"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014542453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3577 domain-containing protein"
                     /protein_id="WP_007372582.1"
                     /db_xref="GeneID:9122918"
                     /translation="MTATTTTPASTGSASASQKKEFFNLNVNGIGYLSSIRRVQGGNG
                     EFTCAVINALTGPTDNASYTRFDVTIAGAETTKLINRCQKAVDEEEKVLIGFVLSGLK
                     ADVFTLQTGDHAGESRPSLKARLIKVEFIKKGQDVVYQAPNASQTPESGSSAQKEYDP
                     NSF"
     gene            427782..428282
                     /gene="ssb"
                     /locus_tag="ECL_RS02015"
                     /old_locus_tag="ECL_00410"
                     /db_xref="GeneID:9122919"
     CDS             427782..428282
                     /gene="ssb"
                     /locus_tag="ECL_RS02015"
                     /old_locus_tag="ECL_00410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000741240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_007372583.1"
                     /db_xref="GeneID:9122919"
                     /translation="MSARGVNKVILVGHLGQDPEVRYMPDSTAVTTLSVATSETWRDK
                     QTGENRENTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDTNGIERWTTEV
                     RVGVNGTMQMLGGGRNNSTNTSGNNAQSGQQGGWGQPQQPQQTPSAPQNPQNEPPMDF
                     DDDIPF"
     gene            428438..428722
                     /locus_tag="ECL_RS02020"
                     /old_locus_tag="ECL_00411"
                     /db_xref="GeneID:9122920"
     CDS             428438..428722
                     /locus_tag="ECL_RS02020"
                     /old_locus_tag="ECL_00411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002443844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1778 domain-containing protein"
                     /protein_id="WP_007372584.1"
                     /db_xref="GeneID:9122920"
                     /translation="MQTPVRKSVRDKQINIRATDEERAVIDYAASLVNKNRTDFIIER
                     AVHEAQNIILDQRVFVLDDARYQAFIRQLEAPVQNVEGRQRLMDVKPEWK"
     gene            428713..429195
                     /locus_tag="ECL_RS02025"
                     /db_xref="GeneID:44145314"
     CDS             428713..429195
                     /locus_tag="ECL_RS02025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_044159004.1"
                     /db_xref="GeneID:44145314"
                     /translation="MEINVTAPALLTEEHVLHSFDCGNAVLDDWLRRRALKNQHLNAS
                     RTFVICPEGTACVVGYYSLATGSVSHVDLSRSLRQNMPDPVPVVLLGRLAVDVSTQGN
                     NFGKWLLNDAVMRVSNLADQVGIKAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI
                     "
     gene            429428..430714
                     /locus_tag="ECL_RS02030"
                     /old_locus_tag="ECL_00414"
                     /db_xref="GeneID:9122923"
     CDS             429428..430714
                     /locus_tag="ECL_RS02030"
                     /old_locus_tag="ECL_00414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TcpQ domain-containing protein"
                     /protein_id="WP_013095156.1"
                     /db_xref="GeneID:9122923"
                     /translation="MAVPSRRVATGAALLACSVIQAGCSSAVSDPAPFANGRYQQPTR
                     FDDIYRNRAPDVVRYDRYTLVSTRPDDAQRDPLNQIVDITMPAQLVKTVGEGFRYLLL
                     ESGYSLCSATTSAFSELLSRPLPAVQRDIGPVRLSEALQIVAGPAWRLKVDDVNREIC
                     FELRDQYRSFAAPLPAPVSLVSQHAPVSLPPVIQPARTGGAAGTVNAVPRNPFTGDTS
                     INSTPGTLQKPVLTAQNQSVPSPVLTVAKTPAAQKSAALSPAGRPPVPPPAAAPKAAS
                     SQKTPVTAVHPVTVQPATVNAARQTVPVRPVTSLPPAPPVSGQTASSYIPGAPVTPQP
                     VGQTWRAEPGSTLKETLTGWASKATCSNGGNWVVIWPVSLDYRIDAPLVFHGNFESVL
                     VQVFDLYRKAEKPLFAEANRIQCLISVSDTPTGGGH"
     gene            430716..431159
                     /gene="pilM"
                     /locus_tag="ECL_RS02035"
                     /old_locus_tag="ECL_00415"
                     /db_xref="GeneID:9122924"
     CDS             430716..431159
                     /gene="pilM"
                     /locus_tag="ECL_RS02035"
                     /old_locus_tag="ECL_00415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus biogenesis protein PilM"
                     /protein_id="WP_007372587.1"
                     /db_xref="GeneID:9122924"
                     /translation="MGYALPVFVFCLVIALMAGDAQRHSAEHVRLSLQQTLPDQLATD
                     MLRTADAVNNWRHGRTVADGTVTPAQAGIVPAPDSRIQTVIQGGRLWVWVPATDGVYA
                     ALRTQSVTSALALTVSGGRLRMADGTDMNLSLPSGVTEGSIVYLN"
     gene            431179..432852
                     /locus_tag="ECL_RS02040"
                     /old_locus_tag="ECL_00416"
                     /db_xref="GeneID:9122925"
     CDS             431179..432852
                     /locus_tag="ECL_RS02040"
                     /old_locus_tag="ECL_00416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilN family type IVB pilus formation outer
                     membrane protein"
                     /protein_id="WP_013095157.1"
                     /db_xref="GeneID:9122925"
                     /translation="MPRLPFCLTALVAALALSSCSLNEISKMDKEASGQADTAQRVLQ
                     SRQTLTQPTVVWSDKPWVNLQPVTPVISTPDEKNLPACQITINRPEGISLPELGQRIT
                     ALCGIRVSITPDAFAALSSISTGSVVTSQMNGQLPAPDDNGRVPLSQMGTTSAQPVSV
                     QSSPSLIRGLKYQGDIRGLLDMAASGLGLSWRIDSSGVYFYQQDTRTFQLVILNTKVN
                     SSASINSGSGNQLGSGGGTSGGTTGDISSNQKTDYGMNSDLYDDIKKTVEQMVTPKSG
                     RFWLSSATGTLSVTDTPDVLNRIGRYIEYQNKVLSRQVQLNIQIVSVNQTRNEQMGLD
                     WGLVYKSLQNVGASLTGSMANASSSAASAGISILDTASGNAAKFSGSSLLIHALSEQG
                     NVSMALNQTDPTANLTPVAYQLSKSTGMLTSSSSTATANVGVTSTMTTTNVTTGLFMT
                     MLPFIQENGDVQLQFAFSYTSPPDIKSFVSRDGNTRNDTADTSTEGLARKVNLRSGQT
                     LVLTGSEQQNVSADKQGTFTPGNFILGGGQTGSRGRTTLVIMITPVLLR"
     gene            432921..434135
                     /gene="pilO2"
                     /locus_tag="ECL_RS02045"
                     /old_locus_tag="ECL_00417"
                     /db_xref="GeneID:9122926"
     CDS             432921..434135
                     /gene="pilO2"
                     /locus_tag="ECL_RS02045"
                     /old_locus_tag="ECL_00417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 4b pilus protein PilO2"
                     /protein_id="WP_072057195.1"
                     /db_xref="GeneID:9122926"
                     /translation="MAGLHWAPQHSVLSVRLRGRASPDTHCVTAGRGSASMAGVVSPG
                     RVRHRLYALAVAFQLSEGGNAWGIYRLSRDEDLWVFFAASGGQLSVMGDVTGTRAFIE
                     SAAQNFLRFNDADAPGLRCAATAEDGRDATTLTDRLSGAQLRRCRLRKRLAPMSLILP
                     AVVLTLATAAGVYWHDTVQQQADRDKAMEASRSRVAPKNDKPALPARAPHPWASQPPV
                     SVLLSNCWLTREPVFASVAGWRFTDGECVPEGLRLRFVATPGSTVEDFSRRARELLGH
                     AAVFNLQEGGKNGDVFIPFRKYLAGEYTDEALPGAEAQLMRFISHLQRRNLDVKFTEV
                     KPPAVAPGQEKNTPVQDWREFTFSVSSRLQPERLLQDFDAAGLRLTSVSITMSPQGQF
                     GYTMKGSIYAQN"
     gene            434122..434619
                     /gene="pilP"
                     /locus_tag="ECL_RS02050"
                     /old_locus_tag="ECL_00418"
                     /db_xref="GeneID:9122927"
     CDS             434122..434619
                     /gene="pilP"
                     /locus_tag="ECL_RS02050"
                     /old_locus_tag="ECL_00418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus biogenesis protein PilP"
                     /protein_id="WP_013095159.1"
                     /db_xref="GeneID:9122927"
                     /translation="MRRINPARTGLLLSVLLSGPALSATTADALPPNVTLGELEATQA
                     RNLILEQKVQTARLEQQLRESQSGQSTDRNYLATSLQPSAPLMTQPVPSQTAATSGTE
                     KRAGSVRLQEIYGRGTQLRARIVLPDGGVTEVAKGDQIPGTAKRVTEVTSTLVRLSDN
                     SELSF"
     gene            434627..436201
                     /gene="tadA"
                     /locus_tag="ECL_RS02055"
                     /old_locus_tag="ECL_00419"
                     /db_xref="GeneID:9122928"
     CDS             434627..436201
                     /gene="tadA"
                     /locus_tag="ECL_RS02055"
                     /old_locus_tag="ECL_00419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Flp pilus assembly complex ATPase component
                     TadA"
                     /protein_id="WP_013095160.1"
                     /db_xref="GeneID:9122928"
                     /translation="MTPDKDIMDFVFAEQHPSGGVTLLIDGNRRKEPAIQRWVMDVTR
                     EYPTAKTEFVTLSELNRRREVAERQGLALSRSVSESDLNSRDISVSQDKVISYMKLGN
                     EFSASDIHIEISADRKLSIVQLRIHGELEVVDEVKDVEGMTLASTSYLSMCDVREQSF
                     FAGREQSGRIDAKFARRAGLYGARYEHRPTPDGLIVVMRLIPDDGDNIPGLPQLGFLP
                     EQITLIMQILRLPEGMVLLTGPTGSGKSATLRVFSDIWLKLTGGKKRLLTLENPPEGR
                     IPGAIQTPVMPADNSPEAISRAWSNANASALRLDPDAILNGEMRDLYSLIAAIYASET
                     GHALFSTLHTQSPIGSLRRMEHFGIDRHLLADAALITGLIGQRLVPLLCEKCRIPWQV
                     KAPELDGETRARLEKYCTVEGVCDTGKLFFRNHEGCSHCQKTVPLTGRIVSRGVTGRT
                     AIAEVVRTDARLMQLWLSHGPAVARQYWVNQGGITRRMHLLRYLAQGRVDPVEGDLIC
                     PLDEDDIMQCEVPNVG"
     gene            436191..437306
                     /locus_tag="ECL_RS02060"
                     /old_locus_tag="ECL_00420"
                     /db_xref="GeneID:9122929"
     CDS             436191..437306
                     /locus_tag="ECL_RS02060"
                     /old_locus_tag="ECL_00420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system F family protein"
                     /protein_id="WP_013095161.1"
                     /db_xref="GeneID:9122929"
                     /translation="MSVKTRFSPERDMSLAEMLRYRLVRATFTGQYRQPFYETLRFLL
                     ENRKALEEALAMIGEVHTDFGRRWHPYYELVQDCLEGVKDNREGRSLKDVLAAWAPYE
                     EAALISAGMETGNIPGALMQADKLIVARRLILGQVVFASVFPSALALLSAGLLLANNM
                     ALVPTLSKMSDPARWTGALGLMNGVAQWTDRWGVTAAGATVGGVILAFWSLPRWRGRL
                     RRVADFLMPWSVYQDLQGAVFLMNIGALLGAGVQELKALQILNEFAPPWLQERIEAAM
                     ECMSDGDSLGMALRQSGYDFPSREAVNYLSLLDKGNSAASLITNYADRWLEQALTRVA
                     RRANVTKLFSLVLIMSFFLLILLMVMQIQDMNTFNIH"
     gene            437316..437912
                     /locus_tag="ECL_RS02065"
                     /old_locus_tag="ECL_00421"
                     /db_xref="GeneID:9122930"
     CDS             437316..437912
                     /locus_tag="ECL_RS02065"
                     /old_locus_tag="ECL_00421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV prepilin"
                     /protein_id="WP_007372593.1"
                     /db_xref="GeneID:9122930"
                     /translation="MSSQTSHYHQRQPDRGWGILEHGSIALFTVIVICIVGALVWGLS
                     GKKSVAVETSNIQTVVTNAQQLKQTQGGYNFTSGTTMTGTLIQQGGAPKAGWTIQGTA
                     SSGTGTMWNSYGGQVVMAPVASNGFNNGFSVTTQKVPQADCISIATQLGSGGAFSAIS
                     INSTDYSDGLVSAEDAGKACTADTGMTGNNTLVFTHNG"
     gene            437917..438396
                     /locus_tag="ECL_RS02070"
                     /old_locus_tag="ECL_00422"
                     /db_xref="GeneID:9122931"
     CDS             437917..438396
                     /locus_tag="ECL_RS02070"
                     /old_locus_tag="ECL_00422"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase domain-containing
                     protein"
                     /protein_id="WP_013095162.1"
                     /db_xref="GeneID:9122931"
                     /translation="MLRLTVLLLFILLSPRAGAFCFDAAGAKYHIDPLLIQAIATGES
                     SLRPGITNVNRDKKTGRALSTDYGLMQVNSSHIPALMAQGVIRSPQDLLTRPCLNVQI
                     GTWILAKHFQVCGISWNCLGSYNAGFRQDRHETRESYANRIYAIYRRLLLKERGIRL"
     gene            438393..439049
                     /locus_tag="ECL_RS02075"
                     /old_locus_tag="ECL_00423"
                     /db_xref="GeneID:9122932"
     CDS             438393..439049
                     /locus_tag="ECL_RS02075"
                     /old_locus_tag="ECL_00423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_013095163.1"
                     /db_xref="GeneID:9122932"
                     /translation="MTLLTLSMPWPTLGILFPLSLGLFNVMAILVRINLVISGHRNGG
                     SSPVRPAIVWLYAAAVSVMLLAPAPAILRLLSFFLSLFLFRMTLTDALTGLLPREMTV
                     SCLTAGLAAALLHPGFTEHLLSAVTAMLIFGGWRYGSTKIQGRECLGLGDVWLAGAIA
                     AWLGGASGLYALLTGVMFFVLWQLTVRRIREGGPMGPWLCAGAMSVTLLKLYQPLITW
                     "
     gene            439043..440360
                     /gene="pilV"
                     /locus_tag="ECL_RS02080"
                     /old_locus_tag="ECL_00424"
                     /pseudo
                     /db_xref="GeneID:9122933"
     CDS             439043..440360
                     /gene="pilV"
                     /locus_tag="ECL_RS02080"
                     /old_locus_tag="ECL_00424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000527441.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="shufflon system plasmid conjugative transfer
                     pilus tip adhesin PilV"
                     /db_xref="GeneID:9122933"
     gene            441412..442572
                     /locus_tag="ECL_RS02085"
                     /old_locus_tag="ECL_00426"
                     /db_xref="GeneID:9122935"
     CDS             441412..442572
                     /locus_tag="ECL_RS02085"
                     /old_locus_tag="ECL_00426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_013095165.1"
                     /db_xref="GeneID:9122935"
                     /translation="MAVRNRIKKMPLAKALDKYFSAVSVHKRGHLQEFYRINVIKRST
                     LSLKCMDEITSVDIADYRDMRLNTVSDRTGRTVSPNTVRLELALLSALYNLARIEWGT
                     CSHNPVEHVRKPAASPGRTRRLTSTEERRIARALRQKNPQLLAIFHLALETAMRQGEI
                     LSLRWEYVDLHLGIAHLPLTKNGTARDVPLSWKARQVLKEFAGPVTGPVFDYTSNGFK
                     SAWRVLLAELEIHDLHFHDLRHEAVSRLFELGTLNVMEVAAISGHKSMNMLKRYTHLR
                     ASQLVSKLDARRRQAQKLATLFVPYPAEISESGGLFRVQFSDLEHTAITAVNRDEALA
                     NAASHLLRIQALAARAGKRLPPPGEIGVREAHRVLINPFHKGGEAAGTDNGT"
     gene            442691..443548
                     /locus_tag="ECL_RS02090"
                     /old_locus_tag="ECL_00427"
                     /db_xref="GeneID:9122936"
     CDS             442691..443548
                     /locus_tag="ECL_RS02090"
                     /old_locus_tag="ECL_00427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid transfer protein"
                     /protein_id="WP_013095166.1"
                     /db_xref="GeneID:9122936"
                     /translation="MSLSHASPDELLPEAPEHQVSAPEVQSAAAVKPRIRLPFSPRKI
                     LQTGSIILLTVSLTGSLIALVVMGRQVSDLTIRVNTLDAAFRSGQIGQLTSNISAMEA
                     RLKTLEQQAATLASLPAAMQSADEQQSALRTSVSQLQEAGNDNTRAVTQLQSRVGSLE
                     HDVQQSRAELDEINRKAELTQKTPAPEKPRTSTGAVPPRVGAAVKKTDRSARRTVTPA
                     APFVLTGIERRGGQTFAVVIPRGVSQISAMRLLSPGDAMLGWTLRSTEGSGAAVFLVN
                     GREHRIQVE"
     gene            443566..444279
                     /locus_tag="ECL_RS02095"
                     /old_locus_tag="ECL_00428"
                     /db_xref="GeneID:9122937"
     CDS             443566..444279
                     /locus_tag="ECL_RS02095"
                     /old_locus_tag="ECL_00428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03759 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095167.1"
                     /db_xref="GeneID:9122937"
                     /translation="MKKTLMASLFLVPLMTSAATVRTSSAQSSISTSQESSTGVLSAQ
                     QQAQQWGLSDSDWSRYQTLMEGDRGIMSPGLDPLTALGVETDNSAERRRLAELWVRHE
                     YQRSEKELAFQREINAAWLRLYPETLAVNMGSNAAGIAHDTQGRLALFVKENCSRCDA
                     RLAAVLADDRPVDIYLVGGNSDEAIRTWAIRHNIPVEKVRSRQITLNHDGGLWLRYGQ
                     GQMPVILQQGENGWQLAAF"
     gene            444258..444869
                     /locus_tag="ECL_RS02100"
                     /old_locus_tag="ECL_00429"
                     /db_xref="GeneID:9122938"
     CDS             444258..444869
                     /locus_tag="ECL_RS02100"
                     /old_locus_tag="ECL_00429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase SLT domain-containing protein"
                     /protein_id="WP_007372603.1"
                     /db_xref="GeneID:9122938"
                     /translation="MAARRILMLGAGILFATAASGATDLQVIPDAYRQIAAAERVPAE
                     SLYSLAMAESTRKTAWGAKPWPWTINVAGRGYHYSTREEAFTALLGFMQRWPLKNIDV
                     GVAQVNLGWNGHFFPTYRDAFDPYTNLRAAARILRACYDARPGSWLRAAGCYHHPSGG
                     AHAATYMAIVRRKLSQIAMTGTPAAVGQPGLLARNSLSWIEPQ"
     gene            444866..445396
                     /locus_tag="ECL_RS02105"
                     /old_locus_tag="ECL_00430"
                     /db_xref="GeneID:9122939"
     CDS             444866..445396
                     /locus_tag="ECL_RS02105"
                     /old_locus_tag="ECL_00430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrating conjugative element protein"
                     /protein_id="WP_013095168.1"
                     /db_xref="GeneID:9122939"
                     /translation="MKNTLRYTLVFTLFSGLLTSAFSASATLTVVGDLGGESTGPLFD
                     AINAGPGQSATESPVLPPPPASLSLSDMLPVSTPEMSPGAVAARPLNLPGMPPVFVLG
                     DDASSRHWLTHHATTLSRMQATGMVISVRDEQGLNALRQLAPGVAMVPVSGGDLARRL
                     ALTHYPALITATGISQ"
     gene            445396..446040
                     /locus_tag="ECL_RS02110"
                     /old_locus_tag="ECL_00431"
                     /db_xref="GeneID:9122940"
     CDS             445396..446040
                     /locus_tag="ECL_RS02110"
                     /old_locus_tag="ECL_00431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_013095169.1"
                     /db_xref="GeneID:9122940"
                     /translation="MPASLIAELLNPHRGLSVLAMTGAVVLAFLALKPRTVSQRRHRR
                     YQKQAARALLRLPQLRDEAARMAWLRKMNPYVFEEMLLTALSRQGLRIQRNARYSGDN
                     GADGQVWINGRRWLIQAKRYSATISAAHVSVFGLLTEREGCPGLFVHTGRTGEVSREA
                     FRRYDGIILISGQRLLWLLSGDRRWMDTLTRPPHRSLTPQSQRKEPAPSPVIRD"
     gene            446055..446429
                     /locus_tag="ECL_RS02115"
                     /old_locus_tag="ECL_00432"
                     /db_xref="GeneID:9122941"
     CDS             446055..446429
                     /locus_tag="ECL_RS02115"
                     /old_locus_tag="ECL_00432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095170.1"
                     /db_xref="GeneID:9122941"
                     /translation="MPRMLYSLTDRIVDLVTSQAAKTAPMVIFVLVQCVLRICILRPL
                     IIFCCMVLAVLIAVPVAVFISPSFTPDVLAQGLLRVIHLLPGAYTPLCVAGALSELVY
                     LIRRFTVLPDFWPDNAAQRKGR"
     gene            446433..447209
                     /locus_tag="ECL_RS02120"
                     /old_locus_tag="ECL_00433"
                     /db_xref="GeneID:9122942"
     CDS             446433..447209
                     /locus_tag="ECL_RS02120"
                     /old_locus_tag="ECL_00433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015701173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095171.1"
                     /db_xref="GeneID:9122942"
                     /translation="MSDFLARTDANPPHWAGEVIGKWDDHKLRLYGGFLRRHYWTDQG
                     SINVFCIKGTDHPDYQGLTWHEFLHRGKRMDRNIPMLERNPGYYLETDRKKPSMYYNS
                     YDGIDWYIGADGNHRSGLARFLFHEREMAYLHGVHLNHYEFDEPLLAVYLALREELSQ
                     HAAQGFHMDLNVNRVHRAREDTAGWKTDIYSTSLYFSVGSWCREHADNLDISALAAPR
                     DFSCPDEGWQLLVSLMAWRDKRTATKRPGFFSRLTSRGRI"
     gene            447206..449323
                     /gene="traD"
                     /locus_tag="ECL_RS02125"
                     /old_locus_tag="ECL_00434"
                     /db_xref="GeneID:9122943"
     CDS             447206..449323
                     /gene="traD"
                     /locus_tag="ECL_RS02125"
                     /old_locus_tag="ECL_00434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system coupling
                     protein TraD"
                     /protein_id="WP_013095172.1"
                     /db_xref="GeneID:9122943"
                     /translation="MSDRYVMESLLRPAVELYSATVAASATCICLTAPWAVALSPSVS
                     WVTAAGFGVLALKRTREGMKILRYRQNIRRLPRYVLTSEQIPVSRRHLFLGKGFQWSV
                     RHTQRLIEARRPECEIYVQPSVLYRMAREMEKKMEYSLPWLCRLTCTDSALNPFRPLP
                     PVGGSPVYHGVEPDETTVTYDLGERVGHMLVIGTTRVGKTRLAELLITQDIRRTNAAG
                     EHEVVIVFDPKGDADLLRRMYAESHRAGRQDNFWVFHLGWPDISARYNAVGRFSRISE
                     VASRVAGQLSGEGNSAAFREFAWRFVNIITRALVALGQRPDYGLILRYVTNIGELYET
                     YVDNLLSEKAPQLMNTTEAMMQSGISDKDLPRHLQGRPNGVKIWVSEQVLGSPEGKKL
                     WDPVLDGLRSAVQYDRTYFDKIVASLLPLLEKLTTGKTAALLAPDYTDLDDPRPILDW
                     HNIIKSRGVVYVGLDALSDPVVAAAVGNSMFADLVSEGGHIYKFGLGDEEEGKSAKVA
                     INLHCDEFNELMGDEFIPLINKGGGAGFQVTAYTQTLSDIEARIGSTAKANQVVGNFN
                     TLVMLRVREKNTAMLLTDQLPEVDVYQKTLTSGVTDVSRPGEGTDFNSNVNDQVSLVK
                     VPMIRPADIINLPKGQAFALLEGGRLWKIRMPLPADNNDPHMPASLKHLADSMEKNYH
                     TGETWWTGGDITYAGGPDATAGQ"
     gene            449304..450065
                     /locus_tag="ECL_RS02130"
                     /old_locus_tag="ECL_00435"
                     /db_xref="GeneID:9122944"
     CDS             449304..450065
                     /locus_tag="ECL_RS02130"
                     /old_locus_tag="ECL_00435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03747 family integrating conjugative element
                     membrane protein"
                     /protein_id="WP_007372609.1"
                     /db_xref="GeneID:9122944"
                     /translation="MPQQDSENGQRSATPRQRQSGPIGLLLWDFPMGLIGVLLGSLLV
                     SLLIEYVCIALLWPEEGAAHSYQVMVAESHWLSEGYTRSLLMAAPVETVSRWVHVAWQ
                     WLFVDSGFSGWLQSFKSLSEKGSGLIPALNGIGATLVSWLGVYLQATVWVTLIFFIRV
                     MILFLSLPLFALVVITGVVDGLVRRDLRRYGAGYESSFVYHHAKRFIKPALYGPCMLY
                     LAWPTAVWPNLLLLPSALLVGGVLAVVTGSFKKYL"
     gene            450271..450588
                     /locus_tag="ECL_RS02135"
                     /old_locus_tag="ECL_00436"
                     /db_xref="GeneID:9122945"
     CDS             450271..450588
                     /locus_tag="ECL_RS02135"
                     /old_locus_tag="ECL_00436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014542427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_007372612.1"
                     /db_xref="GeneID:9122945"
                     /translation="MPHTRILTALLMAVLPALQCHASEKDELALVMRQLDQVQAGLDR
                     ARVVANQTQDARFYFDYQQATRDITTMKQGISTYLEPSRAQPASPSSSVTGQYRAQAP
                     AWR"
     gene            450579..450824
                     /locus_tag="ECL_RS02140"
                     /old_locus_tag="ECL_00437"
                     /db_xref="GeneID:9122946"
     CDS             450579..450824
                     /locus_tag="ECL_RS02140"
                     /old_locus_tag="ECL_00437"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004168502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03758 family integrating conjugative element
                     protein"
                     /protein_id="WP_007372613.1"
                     /db_xref="GeneID:9122946"
                     /translation="MAMNGAQLNGWSAGTGSSLTPSQLNTLILGTLAVVILLFSAWAL
                     VQAYRGVASKSVTFRQFNELAVRLIVLYLAMLFLFFH"
     gene            450838..451203
                     /locus_tag="ECL_RS02145"
                     /old_locus_tag="ECL_00438"
                     /db_xref="GeneID:9122947"
     CDS             450838..451203
                     /locus_tag="ECL_RS02145"
                     /old_locus_tag="ECL_00438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03745 family integrating conjugative element
                     membrane protein"
                     /protein_id="WP_007372614.1"
                     /db_xref="GeneID:9122947"
                     /translation="MISTLLRRYRAIRARAKHILLTGLFFTGNALADLPPIEQPTTGG
                     GGGTYNIMMGYAKMGGLALGLLVSVGAFLAVAHAVITSFHDIRKGKGSWTEFLLYGVV
                     GIILILVVIFLATKASDIL"
     gene            451213..451587
                     /locus_tag="ECL_RS02150"
                     /old_locus_tag="ECL_00439"
                     /db_xref="GeneID:9122948"
     CDS             451213..451587
                     /locus_tag="ECL_RS02150"
                     /old_locus_tag="ECL_00439"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03750 family conjugal transfer protein"
                     /protein_id="WP_007372615.1"
                     /db_xref="GeneID:9122948"
                     /translation="MAVIDFLPDRLNNPPVVWKGFTSGEFLLAAITGVIAGIPLAVPL
                     ALVPFIGWLAFPTCMLLMPMFVIFFGGGWIAGYKRGKPENYIWQRLEEIRCRTGLSRA
                     LILNSRAWEMKRTTAIKRGGLS"
     gene            451584..452228
                     /locus_tag="ECL_RS02155"
                     /old_locus_tag="ECL_00440"
                     /db_xref="GeneID:9122949"
     CDS             451584..452228
                     /locus_tag="ECL_RS02155"
                     /old_locus_tag="ECL_00440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000086096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03746 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095173.1"
                     /db_xref="GeneID:9122949"
                     /translation="MSRFRNGMTARDNHIFSLRIACALLFAGMLMAGIGWMRAPSELT
                     IHNPPDLRSGSTRKWWEVPPSTVYSFAFYIFQQLNSWPKNGEVDYPAKIAQMSPYLTP
                     SCQDFLNKDAEMRKNSDELRDRVRVVYEIPRRGYSSRSVTILDQDHWIAQLDLVADEY
                     YHTEPVKRALVRYPLKVVRWEGDPERNPFGLALDCYAATPQRLEAVTLPEPEKK"
     gene            452228..453136
                     /locus_tag="ECL_RS02160"
                     /old_locus_tag="ECL_00441"
                     /db_xref="GeneID:9122950"
     CDS             452228..453136
                     /locus_tag="ECL_RS02160"
                     /old_locus_tag="ECL_00441"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03749 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095174.1"
                     /db_xref="GeneID:9122950"
                     /translation="MKNPLKKCRLLLLAGLILSGAADAVELMKWERIPLQVPLTVGQE
                     RIVFVNKNVRVGFPPALNNKLRIQSTGGVVYLDASEAFPVTRLELQNKENGEIILLDV
                     SAAPGKTTREPVKIVYDGEVATATASDRQSVSSEGDSTGRSAQQADTETTKPDRKPAK
                     LNAPLPVVLTRYAAQNMYGPLRTVEPVPGISPVSLKLPSVITTLMPAEPVTVTPMAAW
                     SLQGSSVVALQVRNRSAGKVILDPRALEGQFTTATFQHRWLGRAGTPEDTTVLYLVTP
                     GRPEGAFIAEPPSLQPADGHKRRAKK"
     gene            453133..454656
                     /locus_tag="ECL_RS02165"
                     /old_locus_tag="ECL_00442"
                     /db_xref="GeneID:9122951"
     CDS             453133..454656
                     /locus_tag="ECL_RS02165"
                     /old_locus_tag="ECL_00442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014539520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03752 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095175.1"
                     /db_xref="GeneID:9122951"
                     /translation="MKAPSSNLLVKVAVPVVLASAVVVGVKSCSGGGNQTAAPHTASN
                     VALKDLSPEDLKALGIEGDTPQDTLRTVVGNFRKVQDRLDTLADDNKKLSDENKALKT
                     TNSNVDTQINQAVSNARAEEAQKRQQLSAEVTDLSTQVKQLMDQLRNGGAGTESGKNS
                     GSGSDIPIGLGYDSGLNSGAAGVSSSADGLHWVEPKDGVPVDASGRPVTDSNKNNATG
                     FSFATSFADTADAGKQAVGNTTAAVQTQLTDAQKATDPVYTLPENSTLVGSRAMTALL
                     GRIPVDGKVTDPYPFKVMIGKDNLTANGIELPDVQGAIVSGTATGDWTLSCVRGSITS
                     ITFVFSDGTVRTLPSPDGQGQNGNSSNQNSQGGNSSSIGWLSDDNGIPCISGTRKSNA
                     STYLPTIAALAAASAAGDAVAENQSTGQTNAYGGVTSTLTGNAGQAVLGKALSGGMRE
                     TVDWVKARYGQTFDAIYVPPGQTVALHITRQLAIDYEEKGRRVKYDFSLAGSGTGMD"
     gene            454698..455117
                     /locus_tag="ECL_RS02170"
                     /old_locus_tag="ECL_00443"
                     /db_xref="GeneID:9122952"
     CDS             454698..455117
                     /locus_tag="ECL_RS02170"
                     /old_locus_tag="ECL_00443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015701157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03751 family conjugal transfer lipoprotein"
                     /protein_id="WP_035943490.1"
                     /db_xref="GeneID:9122952"
                     /translation="MRWRSLRPVTLFLTGAVALLLAGCSTSKDEMLPPGDSTMLELWN
                     DGASATHATGESRTTLRRPVTDSERVISRQTRDSYSRTQENEIQQTFPRLPNPDLVMY
                     VFPHLADGNTPVPGYSTVFPFYSQVQYALPGERTEDL"
     gene            455117..457915
                     /locus_tag="ECL_RS02175"
                     /old_locus_tag="ECL_00444"
                     /db_xref="GeneID:9122953"
     CDS             455117..457915
                     /locus_tag="ECL_RS02175"
                     /old_locus_tag="ECL_00444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012669260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer ATPase"
                     /protein_id="WP_013095177.1"
                     /db_xref="GeneID:9122953"
                     /translation="MAFSLFRRRAEAQEAHQYGDGPFSVNGHEPLTREGRLTRSEEAK
                     LYETAPSIIDHIPWGEYLPEHQCILLDDGVSVGAVYEIIPVGTEGRPDSRLEEIRDVV
                     ENALQDSLPELDTHQWVVQFYCQDESDLMVYMDKIRGYVKPRAQGTDFTDAWLREQAR
                     HLQNVATEKGLFVDEAVTGAPWRGQIRRTRMVIYRWVESPYRDPMAPEVLLKQVCDRL
                     TAAMSGAGIQCQRQNGEQIHSWLLRWFNPEPTWVDKATLYRCARHTDDAPGELPLLND
                     FSESLWFTRPRSDAEKGVWWFDDVAHRAVPVARLRSAPTTGHLTGEVRRGDNINAIMD
                     LLPEGTVLVMTLVIHPQDKLEENFARLSRDSMGENVDSLRAREDAATARTYLGNKHKL
                     YRAAITLLIKARDLPSLDSRYLDLSSKLLNCGLEPVNPEHDIGPLSTYMRALPMCFNP
                     EQDRHNWYTRLMFVQHFACLAPVYGRDTGTGNPGFTFFNRGGGPLSVDPLNKNDRTQN
                     AHLLLFGPTGAGKSATALDKLAQMIAIYRSRIFLLEAGNSFGLAGDYFESLGLTVHRV
                     SIKPGKAISLAPFGDSHLLMQEKPDELIISEDALPDIDDDEDKDEKRDVLGEMEIAAR
                     LMITGGEPAEEQRMTRADRGMIREAIMIAARSTFEAGRQMLPEDLMFALQGIARDAGM
                     GEDGRERRTAARRARAEEMSEALRMFTEGFEGELFNRPGTPWPEADVTIVDLGTLARE
                     GYEAQMAVAVISLLNTINNIAEREQYSDRDIIVSIDEAHIVTANPLMGPYATKIVKMW
                     RKLGAWLWLFTQNLADFPDTAKKMLNMAEWWICLVMPPDEVEQIARFKTLNSEQKAML
                     LSATKLPKKYTEGVILSRKVQALFRAVPPSLYLALGMTEKEEKAERRLIMNELQCSEL
                     EAAFHVARRLDENRGLSI"
     gene            457927..458331
                     /locus_tag="ECL_RS02180"
                     /old_locus_tag="ECL_00445"
                     /db_xref="GeneID:9122954"
     CDS             457927..458331
                     /locus_tag="ECL_RS02180"
                     /old_locus_tag="ECL_00445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_007372621.1"
                     /db_xref="GeneID:9122954"
                     /translation="MKKLTMAPPMVVADKALIASVIFTVPPQGMASIGQSDSVSLDTL
                     LREILKRLKTPFLLSVYPHRVGRRSCVAVHLTDENEKKLDILITVTGNTLWPGEAEFR
                     NGLRWNVCVPDATDLLWVLKEIDRVTGGEICS"
     gene            complement(458493..458726)
                     /locus_tag="ECL_RS02185"
                     /old_locus_tag="ECL_00446"
                     /db_xref="GeneID:9122955"
     CDS             complement(458493..458726)
                     /locus_tag="ECL_RS02185"
                     /old_locus_tag="ECL_00446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PerC family transcriptional regulator"
                     /protein_id="WP_013095178.1"
                     /db_xref="GeneID:9122955"
                     /translation="MELKDSIAESLEHRGQWRRAARRWLAVMDLSDDDAVREAIARRR
                     EHCISMGANIAPDGRRNETRRLYKMQSRYNNGY"
     gene            458854..461280
                     /locus_tag="ECL_RS02190"
                     /old_locus_tag="ECL_00447"
                     /db_xref="GeneID:9122956"
     CDS             458854..461280
                     /locus_tag="ECL_RS02190"
                     /old_locus_tag="ECL_00447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_013095179.1"
                     /db_xref="GeneID:9122956"
                     /translation="MRYPFELDPQIIHHIIYSQAGSIGKAVIELIMNSVDAGAGAVII
                     DITPEGFSCRDDGRGFASYDDVKRYFGRFGTPHQEGDATYGRFRLGRGQIMAHARTLW
                     RSQRWQMSVDTREMGYHYDLEELTQPIQGCIISGEWYEPLTSQERMSCLQEIRDLVRY
                     TPVTVHLNGTIITRNPALEKWDMEDDEAWYRLREDGAVSIYNQGVLVRHDPAHIWGVG
                     GLVVSKKPLALNVSRTEILRKTCPVWASIAARFGRLAATFSDNQGKHRKTEARREKTA
                     RSLLSGEGDMQSLFNGEEVITLLPGKQHVTLEHFIRKCCHYPSAVDKNCFTLIRYAGD
                     VPRGELIARAGIAPVVHPVTLSRFGCYEPEEFMECLSRVRENLMAYREPLPREQRWGS
                     GWLSELALVDFETLSTNFIDSTQMVSEKQLDKETRRAWTALRWCLARYAAVCSGGEAG
                     YQSRSYGGKCFQILLGESTSSDAWTDGETYIAYNIDIVRRLKPDALRTASLLFSLTEH
                     EVAHEGDSLDCGHDEAFYQRFHDISTLCAPDRQRYMHVWLMKYTTSLEAESKRAKGTA
                     WRERYLTERASTGREKKGLPGVISHEGIEDAVNAPAEPEDVARLSFLNLQLNGAGTVA
                     PAETDWNSVVAAGIEQTRVNQDIRGQQKKLLEEWYASDKDETDILTDEQQADEAEEQM
                     WLESRKLHYLSILPGATEENLHDRAVAFLAYMTDSEEEELAAWAMRAWENSDQWYARN
                     TLSCSEADFLYEQDFDQPLGENVPADWLPFMQEGETRWSIERNAAAAGFIREMDYLEW
                     RRDSAIDDIP"
     gene            461448..461855
                     /locus_tag="ECL_RS02195"
                     /old_locus_tag="ECL_00448"
                     /db_xref="GeneID:9122957"
     CDS             461448..461855
                     /locus_tag="ECL_RS02195"
                     /old_locus_tag="ECL_00448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004155406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03757 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095180.1"
                     /db_xref="GeneID:9122957"
                     /translation="MKLPVCCLAALFLTAGVRAGTVIYTDSTHPVTGNPGPEVTVVLL
                     DAPDRLQAQLFGPLPADPAQAEQQARTVIGSPDFQRRQQDLAGAYAGLTRAWSLGLEK
                     YPAVVFDDKWVVYGTSDVDVATQKLNVWKEKAQ"
     gene            461852..462823
                     /locus_tag="ECL_RS02200"
                     /old_locus_tag="ECL_00449"
                     /db_xref="GeneID:9122958"
     CDS             461852..462823
                     /locus_tag="ECL_RS02200"
                     /old_locus_tag="ECL_00449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR03756 family integrating conjugative element
                     protein"
                     /protein_id="WP_013095181.1"
                     /db_xref="GeneID:9122958"
                     /translation="MKMSFSRPRRLALATLMVCTGTMASVNTASLLSSATSPDCISWR
                     ISGICYWLFCTPFGCSVKTSVKVTHFIPEAVVSAYLSPGANPWTEMSAVSSLADSTES
                     TLLGSAAGVATGGGRQEMKAPGERKQNLHFYYGDAYGHPATRLIGGMVPGYSCDSAAT
                     PFMPYFTSALDALAWRTGVPESLYPEALIPGQREIGSTIGGNMWGNVYPRSGFVTQTD
                     SYKSAAMVVQRVADIITRQGQLHVYSPLTGQRSPGYWPPDPVQENTGTKNHKWQRLSP
                     QLSQSCAVFPDTGGQEAQDGNYAWALWQPYSCCKRRGQTFLYSTDFS"
     gene            462835..464259
                     /locus_tag="ECL_RS02205"
                     /old_locus_tag="ECL_00450"
                     /db_xref="GeneID:9122959"
     CDS             462835..464259
                     /locus_tag="ECL_RS02205"
                     /old_locus_tag="ECL_00450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrating conjugative element protein"
                     /protein_id="WP_013095182.1"
                     /db_xref="GeneID:9122959"
                     /translation="MKQQYPQRLRRPLATLALFAALSLPALAVNTSLSSDGASVSGAI
                     NDGLFYSIGGGSVISPPPSRSNMSRLGLNDGWSSDLMCGNFDLKTTVGNQLNGITSGF
                     KDLMGNVIQGATGAVMSMPAMAIQRANPGLYEMLTNGVLQAGLSYDKALLNCQNMSKK
                     LADYTVGSKWQQAAVSEEYKDIVASSGGDAVSSDQQLQKATGEEGVTWVGGQKRGGKG
                     QQAIQPTRDLAKAGYNMMNSLPVTSNSSVGSASCNGTACQRWPSSDDAAAAVVKVLGD
                     RSIRTCRETSECTSGGTDNQPGSTVAGTGFSPVLEDATKTNLEQLDKLVGGQIQPTAE
                     NLGALKTGSLVVTRGVIQSLRDDPDKAALVQRLAGELAMADTVETALTMRRMLTTGES
                     EPNAAEQPEAIAEGDRRIDALDRELNALRNEMELRKAISNNSLLTTLERQGARNQDNQ
                     LQQKAGNQDQGFSQMNQTQSSGAK"
     gene            464261..464599
                     /locus_tag="ECL_RS02210"
                     /old_locus_tag="ECL_00451"
                     /db_xref="GeneID:9122960"
     CDS             464261..464599
                     /locus_tag="ECL_RS02210"
                     /old_locus_tag="ECL_00451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095183.1"
                     /db_xref="GeneID:9122960"
                     /translation="MKRSFLRGRTGRIVLMIAALLLITVAMFALASVFMAYDPDGHLT
                     RRWLHDSRWALFTWRLLMYAGIAVVWRMKVRPQMLARWPEVRARLPRTELLGVLFIAA
                     TECVAWAGVA"
     gene            464613..466157
                     /locus_tag="ECL_RS02215"
                     /old_locus_tag="ECL_00452"
                     /db_xref="GeneID:9122961"
     CDS             464613..466157
                     /locus_tag="ECL_RS02215"
                     /old_locus_tag="ECL_00452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG N-terminal
                     domain-containing protein"
                     /protein_id="WP_013095184.1"
                     /db_xref="GeneID:9122961"
                     /translation="MTANSFLEYFLILFGWVMNNAMWTILGSTGLFALPLVFKVMGVW
                     LKVREEGADEGNKGLLALPRIEHALYVSFVVMLFCCIPLLPVDISTIKFDSSRAKQCG
                     VSVPTPQNSGYSGLVNDFDGRTAEVPIWWYLLHMISKGTTQAMIASIPCGTELRQMRF
                     DVQNTKLRDPVLLQEVQDFANQCYSRAYFRLKNSNSQLSDATINSVGWIGSDYFLNTS
                     GYYDYYTATTPRGQWPYDSTRDSGYPDTGQGGYPTCKTWWSDGSSGLRKRVLASFGDN
                     TRKEMQRSFPGTQWEEVALRWLVSPRNAGLSGDGTTYAVGSSDNVTGVVGNMTRLTST
                     IGLGLKQAEALPGFDALKQALPMIQALLQMMIITVIPVLMMFSAYEPKTVVTISFALF
                     ALQFITFWWELAGWLDDRLITILYDNMAQQGLASSVPFANFISSTNDGWIMNLVLGMM
                     YVVFPVFWIGMLSWIGVNLGTAISTGLEKGGSLPQKAGAEAGRDAQKIATDKAGGALK
                     GGLKLK"
     gene            complement(466201..466491)
                     /locus_tag="ECL_RS02220"
                     /old_locus_tag="ECL_00453"
                     /db_xref="GeneID:9122962"
     CDS             complement(466201..466491)
                     /locus_tag="ECL_RS02220"
                     /old_locus_tag="ECL_00453"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012666827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095185.1"
                     /db_xref="GeneID:9122962"
                     /translation="MSKDGFRADDIASTFARFANKRRNIVCDESKLQRKKPEPLEFSS
                     ATNACGTAVLAGIADLMIITPERKKQNEEWSESWDAEREDWESQDRQWNDNR"
     gene            complement(466686..469352)
                     /locus_tag="ECL_RS02225"
                     /old_locus_tag="ECL_00454"
                     /db_xref="GeneID:9122963"
     CDS             complement(466686..469352)
                     /locus_tag="ECL_RS02225"
                     /old_locus_tag="ECL_00454"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair ATPase"
                     /protein_id="WP_013095186.1"
                     /db_xref="GeneID:9122963"
                     /translation="MKGSEWNKWDLHIHSPMTWLANVYADNCDIETYVRKLGEQQLSL
                     IGLTNYFYFQENELEIIRSEIGRQGLNITVLGNVEFRLDQQNKDEAFINVHVLFSDKL
                     STSKINEILSRLPLKLTDDSGKKVYACESSVRDSGHNVDTIVVNLSDLLEHLSSALRP
                     FIDYIVAVCPNGYGGYRPGATGRSAAIATEIDRQGHIIFGDPNDRDYFLTTTRYPGAS
                     LKPVFHCSDAHRAEHIGRAYTWVKAKPTFEGLRQALLEPEARLQLGADWLAQRPPKVH
                     FSHIAVEGTIFDGQAIRFKKQSIPLNQDMVAIIGGRGTGKSLLLDALRSRFAGATAYG
                     IEEREVNVEHLSIELDKTNGEKTLFDTRTDSYDYLHVSQGEIKTLCQQPGLISDEIKK
                     MLRLADCEVADEQRRGLGENLNAFQTFREYYVAQDERQYYINTPGYQDEVIKVAQDKI
                     NTLTSEKNKALIERFRANSLRATALTRGINAGNAFLREATAAETSLNSRLTEMNTVSA
                     GVVPVPPLDLSELMARVKAYMEALQTQLMETGEDNLRITAEFREQGIEQDITGVLDKI
                     QGYQREIQQAQLRHGEIQQRITQYNNDVRQRGNLVETYVRQLLEQKTAIDSCFAALAE
                     KPHLKPDQQELIKEILTDIRIYGQPHFDTARFYNGILERLNRGRFRTAGEQSGTEKLT
                     QVLGVRSIDDFVALVRGDAIIELPEEPGNKITLEAFLWRSEYFNNQGPYALQRFLCSP
                     EHISSYLTVRAEFEYKGKTVEKLSAGQRGTFYVCLKLATDAFGSPFVFDQPEDDLDND
                     FIMRQLVPLFRKIKLYRQVIIVTHNANLVVNCDAEQVIVASNEDEVISYRSGALEHGD
                     HGQKNSMRKAICDVLEGGRQAFEAREQKYGML"
     gene            469649..469864
                     /locus_tag="ECL_RS02230"
                     /old_locus_tag="ECL_00456"
                     /db_xref="GeneID:9122965"
     CDS             469649..469864
                     /locus_tag="ECL_RS02230"
                     /old_locus_tag="ECL_00456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095188.1"
                     /db_xref="GeneID:9122965"
                     /translation="MYTKMLNYLLPMHSQLVTVGDEMERQSKIRVNASESYARVALDH
                     LLAQYLPGQSRINDCVAALPAFSVPLM"
     gene            470195..470725
                     /locus_tag="ECL_RS02235"
                     /old_locus_tag="ECL_00458"
                     /db_xref="GeneID:9122967"
     CDS             470195..470725
                     /locus_tag="ECL_RS02235"
                     /old_locus_tag="ECL_00458"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019106256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_013095190.1"
                     /db_xref="GeneID:9122967"
                     /translation="MEITEADERHISAIQQIYAWHVLHGTATFETEPPDVAEMTARQK
                     NIHAAGLPWFVATENGEVLGYCYLSLYRERCAYRFTLEDSVYIAPAFQGRGIGTLLLS
                     RVVAWAEEHGFRQLIAVVGNSENIASLSLHRSAGFRHTGTLKSVGFKHGRWLDTVILQ
                     RTLGAGDVTLPDIPTG"
     gene            complement(470808..471530)
                     /gene="arsH"
                     /locus_tag="ECL_RS02240"
                     /old_locus_tag="ECL_00459"
                     /db_xref="GeneID:9122968"
     CDS             complement(470808..471530)
                     /gene="arsH"
                     /locus_tag="ECL_RS02240"
                     /old_locus_tag="ECL_00459"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical resistance protein ArsH"
                     /protein_id="WP_013095191.1"
                     /db_xref="GeneID:9122968"
                     /translation="MNELNDSLPNIIPDIFDTPDFTGKPLSETPGHAPRILMLYGSVR
                     ERSYSRLTTEEGARLLTAMGAEVRIFNPSGLPLPDDAPDTHPKVAELRELVRWSEGMV
                     WCSPERHGAMTGIMKAQIDWLPLSEGAVRPSQGKTLAVMQVSGGSQSFNAVNQMRILG
                     RWMRMITIPNQSSVAKAWQEFDEEGRMKPSAYYDRIVDVMEELMKFTLLTRGRTAYLV
                     DRYSERKESASALSGRVNQRSI"
     gene            complement(471829..>472188)
                     /locus_tag="ECL_RS02245"
                     /old_locus_tag="ECL_00460"
                     /pseudo
                     /db_xref="GeneID:9122969"
     CDS             complement(471829..>472188)
                     /locus_tag="ECL_RS02245"
                     /old_locus_tag="ECL_00460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372634.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /db_xref="GeneID:9122969"
     gene            472224..473437
                     /locus_tag="ECL_RS02250"
                     /db_xref="GeneID:44145315"
     CDS             join(472224..472518,472518..473437)
                     /locus_tag="ECL_RS02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612254.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_099516394.1"
                     /db_xref="GeneID:44145315"
                     /translation="MIFSPQHKTGDLMNKKTKRTFPPEFRLECAQLIVDKGYSYRQAS
                     EAMNVGSTTLESWVRQLRRERQGITPSATPITPDQQRIRELEKQVRRLEEQNTIFKKG
                     YRALNVRLAERFTIAARLSDSHTVVSLCSALEIHRSSYRYWRKRRDTVNPARVRLCSE
                     IRRAWNQSRGSAGARTLAEMLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQE
                     HTSLPNLLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHAD
                     TALISSALRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDN
                     SPMERFFRSLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENR
                     YHFYCKTVASIT"
     gene            complement(473727..474236)
                     /locus_tag="ECL_RS02255"
                     /old_locus_tag="ECL_00464"
                     /db_xref="GeneID:9122973"
     CDS             complement(473727..474236)
                     /locus_tag="ECL_RS02255"
                     /old_locus_tag="ECL_00464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase ArsC"
                     /protein_id="WP_007372635.1"
                     /db_xref="GeneID:9122973"
                     /translation="MMSKTYNVLFLCSGNSARSLFAEVLMNQLGGGKFRAFSAGTQPA
                     SSPHPLTLRVLNDQGFSTESLKSKHLQNFRHPDAPQMDFIFTLCDRMAGEGCPVFPGS
                     PITAHWGFRDPALAAGTDTEKYHAFVEVEKQIATRIRLFLSLPLDKIDRLSLQKQLQA
                     MGNTGSDEH"
     gene            complement(474309..474737)
                     /gene="arsC"
                     /locus_tag="ECL_RS02260"
                     /old_locus_tag="ECL_00465"
                     /db_xref="GeneID:9122974"
     CDS             complement(474309..474737)
                     /gene="arsC"
                     /locus_tag="ECL_RS02260"
                     /old_locus_tag="ECL_00465"
                     /EC_number="1.20.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-dependent arsenate reductase"
                     /protein_id="WP_007372636.1"
                     /db_xref="GeneID:9122974"
                     /translation="MSAITIYHNPACGTSRNTLELIRNSGVEPTVILYLETPPARAEL
                     VTLIADMGICVRDLLRKNVEPYEQLGLAEDKWSDDELIDFMLQHPILINRPVVVTPLG
                     TRLCRPSEVVLDILPDAQKGAFSKEDGEQVIDAQGQRVVK"
     gene            complement(474795..476084)
                     /gene="arsB"
                     /locus_tag="ECL_RS02265"
                     /old_locus_tag="ECL_00466"
                     /db_xref="GeneID:9122975"
     CDS             complement(474795..476084)
                     /gene="arsB"
                     /locus_tag="ECL_RS02265"
                     /old_locus_tag="ECL_00466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical efflux pump membrane protein ArsB"
                     /protein_id="WP_013095195.1"
                     /db_xref="GeneID:9122975"
                     /translation="MWLAAAIFILTIVLVIWQPRGLGIGWSAMLGALLALITGVVHPG
                     DIPAVWHIVWNATAAFIAVIIISLLLDESGFFEWAALHVARWGNGRGRWLFSWIVLLG
                     AAVAALFANDGAALILTPIVIAMLLALGFSKGTTLAFVMAAGFIADSASLPLIVSNLV
                     NIVSADFFKLGFNEYASVMVPVDIAAIIATLVMLHLYFRKDIPATYEISRLKAPEEAI
                     RDRNTFRTGWGILALLLLGFFGLEPLGIPVSAVAAVGALILFLVAKKGHAINTGKVLR
                     GAPWQIVIFSLGMYLVVYGLRNAGLTDYLSAVLNQFASQGLWAATLGTGFLTAFLSSI
                     MNNMPTVLVGALSIDGSTATGVIKEAMIYANVIGSDLGPKITPIGSLATLLWLHVLAQ
                     KDIRITWGYYFRVGIVMTLPVLFVTLVALALRLSVSF"
     gene            complement(476125..477891)
                     /gene="arsA"
                     /locus_tag="ECL_RS02270"
                     /old_locus_tag="ECL_00467"
                     /db_xref="GeneID:9122976"
     CDS             complement(476125..477891)
                     /gene="arsA"
                     /locus_tag="ECL_RS02270"
                     /old_locus_tag="ECL_00467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical pump-driving ATPase"
                     /protein_id="WP_013095196.1"
                     /db_xref="GeneID:9122976"
                     /translation="MNYLNTIPKFLFFTGKGGVGKTSLSCATAIRLADEGKRILLVST
                     DPASNVGQVFGQQIGNTLTVISDVPGLTALEIDPQAAAQQYRARIVDPVKGILPEDVV
                     RSIEEQLSGACTTEIAAFDEFTGLLTDDALLNDFDHVIFDTAPTGHTIRLLQLPGAWS
                     SFIETNPDGASCLGPLAGLEKQRERYSHALSVLADGEKTRLILVARAQQSTLAEVART
                     HDELLHVGLKHQYLVINGIMPAGEASEDSLASALYQREQRILSHMPQVLASLPTDRLS
                     LQQENLVGVTALRRLLTGENKPCSLPAAKPVSEPLSVPSLEMLIDDIARGGHGLVMLM
                     GKGGVGKTTLAAAVAVALADKGFDVHLTTSDPAAHLESTLNGQLPHLQVSRIDPHAET
                     ARYREHVLATKGKELDPQGRALLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMDTA
                     PTGHTLLLLDATGAYHREVVKRMGEKGHYLTPMMQLQDPERTKIMLVTLPETTPVLEA
                     AGLQEDLRRAGIEPWAWLINNSLVATETTSPLLLTRAAHEAAQINKVRTELASRMALI
                     PLQQEEPTGIEQLKRLTRQAGK"
     gene            complement(477915..478280)
                     /gene="arsD"
                     /locus_tag="ECL_RS02275"
                     /old_locus_tag="ECL_00468"
                     /db_xref="GeneID:9122977"
     CDS             complement(477915..478280)
                     /gene="arsD"
                     /locus_tag="ECL_RS02275"
                     /old_locus_tag="ECL_00468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000855179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite efflux transporter metallochaperone
                     ArsD"
                     /protein_id="WP_044158970.1"
                     /db_xref="GeneID:9122977"
                     /translation="MKTLSVYDPALCCSSGVCGTEVDQALVSFSADVTWLKQQGVSVE
                     RFNLSQQPLAFAENPSVKAFLERSGAESLPLILLDGEFVLSGRYPTRQDLARWFGLNQ
                     EKTGMAPGKSCCGGNTSCC"
     gene            complement(478303..478782)
                     /locus_tag="ECL_RS02280"
                     /old_locus_tag="ECL_00469"
                     /db_xref="GeneID:9122978"
     CDS             complement(478303..478782)
                     /locus_tag="ECL_RS02280"
                     /old_locus_tag="ECL_00469"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase ArsC"
                     /protein_id="WP_013095198.1"
                     /db_xref="GeneID:9122978"
                     /translation="MNILFLCTGNSCRSILAEATFNALSPEAHHAFSAGSQPKGEVHP
                     RALALLRKEGIPTDGYYSKSWNNLPVTPDVVITVCGNAAGETCPAYLAPAVRAHWGVE
                     DPDKTTGSDEEIDAAFEQAWHILRRRIEAFLLLAPSVLSGPEERLQAELNRIGETIF"
     gene            complement(478839..479192)
                     /locus_tag="ECL_RS02285"
                     /old_locus_tag="ECL_00470"
                     /db_xref="GeneID:9122979"
     CDS             complement(478839..479192)
                     /locus_tag="ECL_RS02285"
                     /old_locus_tag="ECL_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001114073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloregulator ArsR/SmtB family transcription
                     factor"
                     /protein_id="WP_013095199.1"
                     /db_xref="GeneID:9122979"
                     /translation="MAPITALQLFKNLSDETRLKIVLLLRASGELCVCELCGTLEESQ
                     PKISRHLSMLRESGLLIDRREGKWIHYRLSAHMPAWAAAVIEQAYLSQKEDISLLAGR
                     IARNSATTGGRAVCL"
     gene            479312..479494
                     /locus_tag="ECL_RS02290"
                     /old_locus_tag="ECL_00471"
                     /db_xref="GeneID:9122980"
     CDS             479312..479494
                     /locus_tag="ECL_RS02290"
                     /old_locus_tag="ECL_00471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095200.1"
                     /db_xref="GeneID:9122980"
                     /translation="MRIEKVTGWLFRLIPERVFDALSGIVCAEMDGIARDRLPEQTER
                     KATLPAAGQERRKRNN"
     gene            479651..480160
                     /locus_tag="ECL_RS02295"
                     /db_xref="GeneID:44145316"
     CDS             479651..480160
                     /locus_tag="ECL_RS02295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011465904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-70 family RNA polymerase sigma factor"
                     /protein_id="WP_052768258.1"
                     /db_xref="GeneID:44145316"
                     /translation="MKAWKMHEHELYCWLLRQTGNQADTDDLIQETFLRAIRQQRKFC
                     SIVNTRAWLFEVARHLVIDKSRRQRPYQPLHDGVCIQDNAPETVDSLAECLPRILDKM
                     TEDDRTILTLCDLEGMKQADFADRSGLTLAATKSRLLRARERLHKKLSSDCQVRLDEY
                     GRVCCFTPR"
     gene            480365..481366
                     /locus_tag="ECL_RS02300"
                     /old_locus_tag="ECL_00475"
                     /db_xref="GeneID:9122984"
     CDS             480365..481366
                     /locus_tag="ECL_RS02300"
                     /old_locus_tag="ECL_00475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_013095204.1"
                     /db_xref="GeneID:9122984"
                     /translation="MFQIFTDFATWLVYQRLNLSPATKLGDALHFFVEDVSKIFVLLL
                     VLIYFVAMLRASLDVGRVRDYLAGKHRGVGYLLGSCFGAITPFCSCSSIPVFLGFTSA
                     GIPLGITMAFLITSPLINEVAVLLLVSLLGWRFTLIYIVVGMAVGIAGGAFLDRIKAE
                     RWLADFAADALRDGQQHQTAVIRQSTGTPHMSLSKRHAFAKDETLTIFKRVWLWVILG
                     VGLGAALHGFVPDGWIASHLGAGQWWSVPVAVLVGIPLYSNATGVIPVMESLITNGLP
                     VGTALAFCMSTVAVSFPEFVLLKQVMKWQLLCILLLLLLTSFTLVGWVFNVVFPLVS"
     gene            481380..481610
                     /locus_tag="ECL_RS02305"
                     /old_locus_tag="ECL_00476"
                     /db_xref="GeneID:9122985"
     CDS             481380..481610
                     /locus_tag="ECL_RS02305"
                     /old_locus_tag="ECL_00476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011911471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin family protein"
                     /protein_id="WP_013095205.1"
                     /db_xref="GeneID:9122985"
                     /translation="MKHVKVLGTGCSSCKTTIRLIQQVADERGVAIQLEKVESLPEIM
                     KYKVMSTPAVVINDIVVHAGGIPSKDIIESWL"
     gene            complement(481721..481924)
                     /locus_tag="ECL_RS02310"
                     /old_locus_tag="ECL_00477"
                     /db_xref="GeneID:9122986"
     CDS             complement(481721..481924)
                     /locus_tag="ECL_RS02310"
                     /old_locus_tag="ECL_00477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095206.1"
                     /db_xref="GeneID:9122986"
                     /translation="MQKALMTAELLALARLSIMAFKKPLKYMDDTDAEVIARFKKTFT
                     PELIEQMCLRILGLEAERQSLNE"
     gene            complement(482006..482833)
                     /locus_tag="ECL_RS02315"
                     /old_locus_tag="ECL_00478"
                     /db_xref="GeneID:9122987"
     CDS             complement(482006..482833)
                     /locus_tag="ECL_RS02315"
                     /old_locus_tag="ECL_00478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001066652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_007372648.1"
                     /db_xref="GeneID:9122987"
                     /translation="MNNTIIACVDGSSSTRAVCEYAAWVAGKLDVPLALLHVLEKNEQ
                     PAVSDLTGAIGIDSREQLTQELVRIEGERNRLLMTQGRAILAGCAELLSQIGIPDVQQ
                     LQKHGALDIILADLKDIRLMILGRRGTQNPVGSNLESIIRLQKKPVLIVPETFTPPSK
                     AMFAFDGSEESRRNLRRLTLSPLLLGMECHVVMVNGDAHTLEEARRSLQTSGISAISR
                     LAEGRSVPEALCRYASDNNVDLIVMGAYGHSSLRRFFIGSNTTAMIEQTRVPLLMLR"
     gene            complement(482851..484329)
                     /locus_tag="ECL_RS02320"
                     /old_locus_tag="ECL_00479"
                     /db_xref="GeneID:9122988"
     CDS             complement(482851..484329)
                     /locus_tag="ECL_RS02320"
                     /old_locus_tag="ECL_00479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020158588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SulP family inorganic anion transporter"
                     /protein_id="WP_013095207.1"
                     /db_xref="GeneID:9122988"
                     /translation="MLLSSTRRDWLGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPQ
                     VGLYSAFCIPLVMAFFGGRPAMISSSTGAMALLMVTLVKDHGLQYLLAASILTGVFQL
                     IAGYLKLGGLMRFVSRSVVTGFVNALAILIFMAQLPELTNVTWHVYAMTAGGLAIIYL
                     FPYLNKTIPSPLVCIVVLTAIAMWLHLDVRTVGDMGKLPDSLPVFLLPDIPLNLDTLL
                     IILPYSAGLAVVGLLESMMTATIVDDMTDTPSDKNRECKAQGIANICTPFIGGMAGCA
                     MIGQSVINVKSGGRGRLSTLTAGVVLLCMVVFLRDLVSQIPMAALVAVMIMVSIGTFS
                     WRSVADLKSHPISTSVVMLATVVVVVATHNLAFGVLTGVLIASLNFATKVARFLVVSS
                     ELKKDTRFYKVTGQVFFASADRFMAYFDFREAVEKVVIDVAQAHFWDITSVSALDKVV
                     IKFRREGTEVEIRGMNEATRTIVDRFGVHDKPEEVEKLMGGH"
     gene            485082..485309
                     /locus_tag="ECL_RS02325"
                     /db_xref="GeneID:44145317"
     CDS             485082..485309
                     /locus_tag="ECL_RS02325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016241610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_007372650.1"
                     /db_xref="GeneID:44145317"
                     /translation="MKNVLVFFNSQPAELVKTLREVNIIRRVYPNGEEAHLKIMLSGM
                     HSVGRKKCEIFIASDRDLKHDEIITAANTLL"
     gene            485595..485915
                     /locus_tag="ECL_RS02330"
                     /old_locus_tag="ECL_00480"
                     /db_xref="GeneID:9122989"
     CDS             485595..485915
                     /locus_tag="ECL_RS02330"
                     /old_locus_tag="ECL_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001137910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF134 domain-containing protein"
                     /protein_id="WP_001137910.1"
                     /db_xref="GeneID:9122989"
                     /translation="MPRPRIPRNICGRPADTCFKPNARPMSQLEHVHLKEDEFEALRL
                     VDLLGMQQQEAAVAMGVSRQTLANVLKAARFKVVDCLTQGKALIMHSEREGVTQDDHS
                     HSSE"
     gene            485890..486351
                     /locus_tag="ECL_RS02335"
                     /old_locus_tag="ECL_00481"
                     /db_xref="GeneID:9122990"
     CDS             485890..486351
                     /locus_tag="ECL_RS02335"
                     /old_locus_tag="ECL_00481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095208.1"
                     /db_xref="GeneID:9122990"
                     /translation="MITAIPVNDDRVANHFTKASHLVFVDKRGAELSRTENPALGADC
                     SGKRKLVDLLVQQQVSRVVVRNIGERMLGKLLGHQIAVYQTDCGRRLFTELCDPDTRV
                     LTELNKPEQGRQSLNHEAKGKKCCHSDGNTAENACLRGHQHHHGNGRCCHS"
     gene            complement(486499..487717)
                     /locus_tag="ECL_RS02340"
                     /pseudo
                     /db_xref="GeneID:44145318"
     CDS             complement(486499..487717)
                     /locus_tag="ECL_RS02340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612254.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /db_xref="GeneID:44145318"
     gene            487781..488218
                     /locus_tag="ECL_RS02345"
                     /db_xref="GeneID:44145319"
     CDS             487781..488218
                     /locus_tag="ECL_RS02345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016241611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PaaI family thioesterase"
                     /protein_id="WP_044158965.1"
                     /db_xref="GeneID:44145319"
                     /translation="MNCYLNARKAHTCCMACGSRDNNPDSVSLMFSEHPNGSVCANYT
                     ADHRHQGYTGLLHGGMTSTLLDAAMTHCLFMQGVQALTAELTVRFISPVCTGEKLMVC
                     ARLLGQRRGIYQLEAWLTKGQQKVARATAKFIVPSQDIALAHR"
     gene            488332..488808
                     /locus_tag="ECL_RS02350"
                     /old_locus_tag="ECL_00485"
                     /db_xref="GeneID:9122994"
     CDS             488332..488808
                     /locus_tag="ECL_RS02350"
                     /old_locus_tag="ECL_00485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000043178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA starvation/stationary phase protection
                     protein"
                     /protein_id="WP_013095212.1"
                     /db_xref="GeneID:9122994"
                     /translation="MSKQIIDIGIAESSRVEIADGLARLLADTYTLYIKTHYYHWNVT
                     GPMFNSLHLMFENQYNELATAVDDIAERIRSLGCFAPGTYHEFSRLTAVNEDKDIPAA
                     KNMIENLVQGQETVVKTARSLFPVVNNANDEATADLLTQRIQLHEKTAWMLRSLLE"
     gene            complement(489111..489461)
                     /locus_tag="ECL_RS02355"
                     /old_locus_tag="ECL_00486"
                     /db_xref="GeneID:9122995"
     CDS             complement(489111..489461)
                     /locus_tag="ECL_RS02355"
                     /old_locus_tag="ECL_00486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000928911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_013095213.1"
                     /db_xref="GeneID:9122995"
                     /translation="MRMNEDTKRQTDMKNAALGAADVLRGLANSDRLLLMCQLSQGEA
                     NVTELEAAVGITQPTLSQQLGVMRRLKLVETRRAGKMVYYRIGDNRIMTLLNTLYDLY
                     CPQEDTGKESHNNE"
     gene            489623..491281
                     /locus_tag="ECL_RS02360"
                     /old_locus_tag="ECL_00487"
                     /db_xref="GeneID:9122996"
     CDS             489623..491281
                     /locus_tag="ECL_RS02360"
                     /old_locus_tag="ECL_00487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_013095214.1"
                     /db_xref="GeneID:9122996"
                     /translation="MKIVIVGGVAGGASAAARARRLSEDVSIVVLERGSNVSFANCGL
                     PYHIGGKIPLRQSLILKTPEDFKSRFNIDVRIYHEVTSVDPVNKTVTVKNLTSGEVYS
                     EEWDRLLLSTGAAPVVPPLPGLQEEGVFTLRNLTDMDAIQAWIEQHNVAHTTLVGGGF
                     IGLEVMEALSERGISVTLLEMGEQVMAPVDPEMASALHQEIRSHGVDLRLRTALNEVL
                     RTETGFRVALSDGEFLQTDMVILAIGVKPENTLATGAGLAVGKRGGISVNACMQTSIP
                     DIYAVGDAVETPDLVFQEPANVPLAGPANRQGRIAADNMLERHSLYHGSQGTSICKVF
                     SLSIGSVGANEKQLKAHGTRYEKVYVHAADHASYYPGATMISLKLLFSPDTGKILGAQ
                     ASGKKGVDKRIDVLAVAQRAGLTVNDLEHLELTYAPPFNSARDVVNQAGMVAANVIKG
                     DTVICHASDVLQREPGSYCFLDIRSPAELKQFGEYPDALSIPLDSLRENLEKLPKDKE
                     IFIGCQSGLRGHVAYRILQAHGFRAYNLSGGFITWKAVMASMNK"
     gene            complement(491342..492499)
                     /gene="nhaA"
                     /locus_tag="ECL_RS02365"
                     /old_locus_tag="ECL_00488"
                     /db_xref="GeneID:9122997"
     CDS             complement(491342..492499)
                     /gene="nhaA"
                     /locus_tag="ECL_RS02365"
                     /old_locus_tag="ECL_00488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009666071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaA"
                     /protein_id="WP_013095215.1"
                     /db_xref="GeneID:9122997"
                     /translation="MSANKKKLNGVVRGFISSPAAGGIILILASVAAIVVANSPLLEG
                     YESLLKYKTVGLSTEHWVNDGLMAIFFLFVGLEIKRELLVGQLATWSQRALPGFAALG
                     GVAVPALIYAGFNASNAETLRGWAIPAATDIAFALGVLTLLGRRVPASLKIFLSALAI
                     LDDMGAVAIIAIFYTSHISLMMLGGAMVTALMMFMMNRAGLKRLLPYLVAGCLMWFFM
                     LQSGVHATVAGILVALFIPLKTDSTSGSPLERLEHGLEPWVVFLILPVFGFANAGVSL
                     TGLTAEDLLSPVPVGVATGLFLGKQVGVFGLSLLAVGLGLAQKPKNSSWLQIYGVSVL
                     CGIGFTMSLFIGNLAFAESQLLIDEVKVGVLVGSVLSALTGALIMLLPRQR"
     gene            492947..493855
                     /locus_tag="ECL_RS02370"
                     /old_locus_tag="ECL_00491"
                     /db_xref="GeneID:9123000"
     CDS             492947..493855
                     /locus_tag="ECL_RS02370"
                     /old_locus_tag="ECL_00491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DHH family phosphoesterase"
                     /protein_id="WP_013095218.1"
                     /db_xref="GeneID:9123000"
                     /translation="MINVFGHLNPDSDAVCTAAVTAGWLNRCNRPARAWRPGEANPET
                     RYIFEAAGLSLPPLLDIPLKGEPVWLVDFTEPAQGPADLLQSNIIGIIDHHRLGGLVT
                     QLPPEVWIKPAGSSATVLWLLMDAEMRRTMPPTHATLLLGALLSDTINLCSPTTTEDD
                     IRTATELCVLSGIKRRAFAHGLMTAKTDISGQSAEQLLNKDLKAFSLAGTDVRIAQLE
                     VNSPEQVAPLLDELQNAMAQMAVTTGAGLIVLMVTDIQECFSTLYFAGPESGNITSCS
                     VPGMVSRKKQLLPWLEHFLSQSRRQP"
     gene            493852..494277
                     /locus_tag="ECL_RS02375"
                     /old_locus_tag="ECL_00492"
                     /db_xref="GeneID:9123001"
     CDS             493852..494277
                     /locus_tag="ECL_RS02375"
                     /old_locus_tag="ECL_00492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010260813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_013095219.1"
                     /db_xref="GeneID:9123001"
                     /translation="MKIYTHALVLVQGKEDGVTLLALAATLSRLLQMKITLAHICNDY
                     REMNYVSDGLMDDAVSKDVVQVKALFSELTSSVAEHVDARELVTMRRFEDVQKCITDT
                     GVDLVIAGHRNRFMGALTSRSAEYINHLNVDVLIKHIPN"
     gene            494294..495583
                     /gene="eno"
                     /locus_tag="ECL_RS02380"
                     /old_locus_tag="ECL_00493"
                     /db_xref="GeneID:9123002"
     CDS             494294..495583
                     /gene="eno"
                     /locus_tag="ECL_RS02380"
                     /old_locus_tag="ECL_00493"
                     /EC_number="4.2.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="WP_013095220.1"
                     /db_xref="GeneID:9123002"
                     /translation="MSFILEKVTAREILDSRGNPTVEVDAFTSDGMMARASVPSGAST
                     GSREATERRDGDATRFGGKGVRDAVKAVDTEICDTVRGTDVREQRRLDNLMRELDGTE
                     NKSRLGANAILGVSLAVARLAAQVTRQPLYRYLGGLNASLLPVPCMNIINGGVHARGQ
                     GADFQEFMIAPHGAPTLAEAVRQGSEVYQALRQILLSRNLSAAVGDEGGFAPAVSSNR
                     EPLEFIVQAIEKAGYRPGEDISICMDPASSEFYRDGKYHLRTESSALSSEEMTDYYGE
                     LMNQFPIVLLEDGLAEDDWAGWKYLHNKLGGRTELVGDDLFVTNVKYIRRGIEEKLAS
                     AALIKLNQIGTLSETFDAVSLCHEHGWGAFISHRSGETMDTFIADMTVALRAGHLKTG
                     APCRGERIEKYNQLMRIEQDLGSEARYAGIKAFVRRG"
     gene            495665..496054
                     /gene="crcB"
                     /locus_tag="ECL_RS02385"
                     /old_locus_tag="ECL_00494"
                     /db_xref="GeneID:9123003"
     CDS             495665..496054
                     /gene="crcB"
                     /locus_tag="ECL_RS02385"
                     /old_locus_tag="ECL_00494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010260804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fluoride efflux transporter CrcB"
                     /protein_id="WP_044158961.1"
                     /db_xref="GeneID:9123003"
                     /translation="MGSRALGQLSAIMIGGAVGCVIRWFFGVKLNSFFPSLPPGTLVV
                     NLLGAFIIGAAMAYFMRNPQLDPAWKLLIVTGLCGGLTTFSTFSVEVFTLLQVGNYLW
                     ALTSVLVHVVGSLLMTAAGFYLITLLA"
     gene            496424..496843
                     /locus_tag="ECL_RS02390"
                     /old_locus_tag="ECL_00495"
                     /db_xref="GeneID:9123004"
     CDS             496424..496843
                     /locus_tag="ECL_RS02390"
                     /old_locus_tag="ECL_00495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_013095222.1"
                     /db_xref="GeneID:9123004"
                     /translation="MITKILIAYDGSESAKEAMDFAFELAHHFNSELYVMAVCHLTEF
                     GGEVEMLDFVSRTQSYFYQRMRNLRKQYPEMKKKPRLHIATGHPAEQILHYADGHGID
                     HIVVGHRGKKQFSQWLLGSVARQVVDHAPCPVTVTRK"
     gene            497106..498644
                     /locus_tag="ECL_RS02395"
                     /old_locus_tag="ECL_00497"
                     /db_xref="GeneID:9123006"
     CDS             497106..498644
                     /locus_tag="ECL_RS02395"
                     /old_locus_tag="ECL_00497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_044158959.1"
                     /db_xref="GeneID:9123006"
                     /translation="MEFISILYATLDGNRQHTLRKNEPACFADLNLDKVITSITHGRE
                     VYNIKPFFYSPLEYLDDIYYRQGIIQDVGNENLYSAIKEFSSDMQKIREISGEKEYRY
                     YHYQQRRWELECILLYCQSVTKLREHLSSLLLGSSGMTNFRNYLSGYIDSENFKSLSA
                     MANRIKDNLEGIRYNLRIKGDTINVEHHADEINYSDKIINVFSKFKQRDVTVKLDFKS
                     HDTVMTNVEARILECVARLFPSVFSELDTFIETRSDYQSHTLNIFEREIQFYLASIEY
                     FRNFQNAGLSFCIPEINVNNKNITVTNGFDLALAYSLLKKKENVVCNDFQLRECERIL
                     VVSGPNQGGKTTFARMIGQLHYLALLGLYVPAEDANLFLVDNIFTHFEKSENIHNLRG
                     KLYDDLVRIKSILDVATSKSLIIMNEIFTSTTSHDALYLGTQIIKKIVMLDALCVCVT
                     FIDELTRLDRAIVSMMSTVENDERASRTYRIARKPSDGVAWSATLVQKYGLTYEKIKG
                     EVNG"
     gene            498641..500149
                     /locus_tag="ECL_RS02400"
                     /old_locus_tag="ECL_00498"
                     /db_xref="GeneID:9123007"
     CDS             498641..500149
                     /locus_tag="ECL_RS02400"
                     /old_locus_tag="ECL_00498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_013095225.1"
                     /db_xref="GeneID:9123007"
                     /translation="MNVYLMYKDADFVLDDIFPDNFNIQVRDLGLDVLFQSLSAGDEF
                     LYSVVKKACSQSLADVPCIEYRQAILRDCLYNSNIIREFYQAVLECLTMEKEKLHYIV
                     FGHSPSAMLHQSISFTRFFLENLKKVRAIAEKNIYFFESSGMTRLLKMIIQELNEDYL
                     RGIEEHLKQMDFKRGVLMSAKLGPGSRGDEYILREPNSPDKCWFRRIFSRRPEHYSVQ
                     IAPRDENGFRALSDLRDEGLVLVASAMAQSTEHLRNFFKSLRAELGFYVCCINLAEEL
                     NKRNLPQCFPVPVYKRERRLVFESLYDVCLGLTSDKNIVGNTLKTDNKNTFIITGANQ
                     GGKSTFLRSIGLAQIMMQSGMFVVAEYFCTDICGQIFTHYKCEEDSSMVSGKLDEELL
                     RMRDIVDLLEQDDLVLFNESFSATNSREGADIIRGIVMALAESRVKIFFVTHCSEFAC
                     AFYQEFHPDTEYLCAERRDDGERTFRIEEGAPMDTSFGEDLYQAVFTSDELA"
     gene            complement(500709..501677)
                     /locus_tag="ECL_RS02405"
                     /old_locus_tag="ECL_00500"
                     /db_xref="GeneID:9123009"
     CDS             complement(500709..501677)
                     /locus_tag="ECL_RS02405"
                     /old_locus_tag="ECL_00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5-like element IS903B family transposase"
                     /protein_id="WP_013087110.1"
                     /db_xref="GeneID:9123009"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     gene            complement(501699..502226)
                     /locus_tag="ECL_RS02410"
                     /db_xref="GeneID:44145320"
     CDS             complement(501699..502226)
                     /locus_tag="ECL_RS02410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-diphosphoglycerate-dependent
                     phosphoglycerate mutase"
                     /protein_id="WP_077681925.1"
                     /db_xref="GeneID:44145320"
                     /translation="MGKIILLRHGESEWNQQNRFTGWTDVTLTRRGEEEARHAARLIK
                     QAGIQIDSACTSVLNRAIHSLWLIMETLNLLWLPVSKTWRLNERHYGALQGMRKDEAA
                     QQMGEELVYHWRKSYRGIPPLLAAAPQLLHREARYHHIALSDLPKGESLEMALRRVIP
                     YWQHVIAPRVVSGLC"
     gene            complement(502481..502945)
                     /locus_tag="ECL_RS02415"
                     /db_xref="GeneID:44145321"
     CDS             complement(502481..502945)
                     /locus_tag="ECL_RS02415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015461888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_077270200.1"
                     /db_xref="GeneID:44145321"
                     /translation="MSGVSMRNSDNFFSFHKTPLSKCSLFIHVIGLRYTVCSVPASAD
                     PLNHIGGPAPHYRPGKFTCSTTKNQETITTLREISDLNNDAFVCELRYSRLKTGAPCG
                     RERIEKYNQLKRIENAMGEAAVFIGKPAFKKASPVPTPYLRSGGYKEVLCES"
     gene            505868..506752
                     /locus_tag="ECL_RS02420"
                     /old_locus_tag="ECL_00505"
                     /db_xref="GeneID:9123014"
     CDS             505868..506752
                     /locus_tag="ECL_RS02420"
                     /old_locus_tag="ECL_00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014538502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_013095229.1"
                     /db_xref="GeneID:9123014"
                     /translation="MAKLNKNLKTLARQAGGSFKTVADRMKIADRFAARLQSLNIQIR
                     DIKNIKTGHVELYVRSRLAEDISKRTLQNEMSAIRSLLRVAGKTFMADPSHEKLSNEA
                     LNISGTSRDGTKVAITDEHLDSVLSLVKEKDEGVAVAIQLSRLLGLRTEETIQSVKSL
                     STWKKALQNGENKIRVVFGTKGGRPRDTTIIKREETLKLLSSALKYTAEHNGKLIDKP
                     SLHLAIERYRNIVREAGMVGEFAPHSLRYAYTQDVIGLYLEHGFSVKEAQALASMDLG
                     HGDGRGHYVARIYSKTKS"
     gene            506826..507272
                     /locus_tag="ECL_RS02425"
                     /old_locus_tag="ECL_00506"
                     /db_xref="GeneID:9123015"
     CDS             506826..507272
                     /locus_tag="ECL_RS02425"
                     /old_locus_tag="ECL_00506"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_099725561.1"
                     /db_xref="GeneID:9123015"
                     /translation="MMNVLKVSRLVKVANRASFFDFISLVSEIEGRLKLLHAYSILFA
                     IDGKGDSYFSFEHVSRTTFLVTERLMEYKLLGLIPDHRVKCLDDIFEQCKQVLGDKKW
                     NMAVTGGTVVAQDVLDTYAETFLTTYVEESDTRFLKDFVQWYLSTC"
     gene            507559..507948
                     /locus_tag="ECL_RS02430"
                     /old_locus_tag="ECL_00507"
                     /db_xref="GeneID:9123016"
     CDS             507559..507948
                     /locus_tag="ECL_RS02430"
                     /old_locus_tag="ECL_00507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095231.1"
                     /db_xref="GeneID:9123016"
                     /translation="MTFLHIVYFVAVFADRFVCFIAPKTLIAEWFFWFTGDAKSLLLV
                     VRELELARSYQKDEASVLLTEFSVYHAAFFFGEREYYGLKVRWPRWFINRLHFTGMQL
                     DATQWQEGCQNGFSDAAALESRATAHC"
     gene            508031..508393
                     /locus_tag="ECL_RS02435"
                     /old_locus_tag="ECL_00508"
                     /db_xref="GeneID:9123017"
     CDS             508031..508393
                     /locus_tag="ECL_RS02435"
                     /old_locus_tag="ECL_00508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095232.1"
                     /db_xref="GeneID:9123017"
                     /translation="MTAFAITVDVLAASIHSKTGFISVMSEIEGLLQSATALNICGIP
                     DSIDLDGFPERCSQTIHLASVVGEAQEMNLIPDSLRQFVDDVVLTGKRFDAEGDTNAW
                     CYGFKLGTERGLANWSGV"
     gene            508517..508813
                     /locus_tag="ECL_RS02440"
                     /old_locus_tag="ECL_00509"
                     /db_xref="GeneID:9123018"
     CDS             508517..508813
                     /locus_tag="ECL_RS02440"
                     /old_locus_tag="ECL_00509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095233.1"
                     /db_xref="GeneID:9123018"
                     /translation="MLILASKAASALAHVSESLNQRKKEWFTNQSGHSSFRPEVIPDG
                     NGFTAIISRRTGYSPKDWTYQRCATAGRFASSRQAMNAGRRMAQQLADLRYRFD"
     gene            508897..509334
                     /locus_tag="ECL_RS02445"
                     /old_locus_tag="ECL_00510"
                     /db_xref="GeneID:9123019"
     CDS             508897..509334
                     /locus_tag="ECL_RS02445"
                     /old_locus_tag="ECL_00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_099725666.1"
                     /db_xref="GeneID:9123019"
                     /translation="MTVFNDIAFDRSYAPQGMHELWQGQRSLSRFIAYVAELEGELLA
                     IRAFRRCAIPDLTGSYGVPVRTFRLVSIARLIGYACMTGAFTDGLFEKYIAGLILLGE
                     QIAPRAWNFGFSEGQMHFDEMRSDDEASEEQRAVFCASADYIA"
     gene            509444..510055
                     /locus_tag="ECL_RS02450"
                     /old_locus_tag="ECL_00511"
                     /db_xref="GeneID:9123020"
     CDS             509444..510055
                     /locus_tag="ECL_RS02450"
                     /old_locus_tag="ECL_00511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095235.1"
                     /db_xref="GeneID:9123020"
                     /translation="MIRFTSDELRPLFTQNLGMQRPLILEKKLGIYLRVPDDRRPGEW
                     LKAWAAGCNPLKDADWFTLVDTLIPEHEFSFQTFMAQSMFDAVLNDHHDLLMKPVISK
                     LNNALTLHKGTRPPMKVYVPVGEYRYRIQWLYEQSLRHFHACVGDAERLSWRSQALHV
                     LDQVIRLDSKRAKPADRERFDRAVESVRDRIRSVMSDGSLRYY"
     gene            510128..511111
                     /locus_tag="ECL_RS02455"
                     /old_locus_tag="ECL_00512"
                     /db_xref="GeneID:9123021"
     CDS             510128..511111
                     /locus_tag="ECL_RS02455"
                     /old_locus_tag="ECL_00512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1738 domain-containing protein"
                     /protein_id="WP_013095236.1"
                     /db_xref="GeneID:9123021"
                     /translation="MKITTGRRKPAAVQTPDLYQQVTDKIILALENGVPPWRRPWRSA
                     QNVHGGSLPVNAVTGRAYSGINVPLLWMAAEEHGYTSDRWLTFRQAKAVGGYVRKNET
                     SALAIIYKPFEKQARDSSDNLLYRDGEPVMEQLAMLKQLQLFNVAQCDGLPESVQGEQ
                     PNTVEAEPPSELSAAQLQQVQQILSTTGVGCDHRRQDRAFYRPGADRIVMPTASQFRT
                     EADYWSTLLHELVHATGHSSRLNREGITSSSRKFGDPVYAFEELIAETGSAFLCVELG
                     ITGDVQHESYLAGWLKALREDKRAIFRACRFAREASEYLLAPLNRNTEQAA"
     gene            511208..512158
                     /locus_tag="ECL_RS02460"
                     /old_locus_tag="ECL_00513"
                     /db_xref="GeneID:9123022"
     CDS             511208..512158
                     /locus_tag="ECL_RS02460"
                     /old_locus_tag="ECL_00513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014542409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1281 domain-containing protein"
                     /protein_id="WP_013095237.1"
                     /db_xref="GeneID:9123022"
                     /translation="MFSWCQNRLEITGKSVCLDVMQPWIAGTEKPLYRHAIRQAIKLF
                     LAGCAGILKPVRAVDYAPYPMLTASGTGAQTSPNQAFQHFIELLEQNAWLDSKTLSRM
                     EKIWLQSGIDALKWEAIPFAARQIMAQLMAVHYADWFGVAGAGGQFDPQERWESLSIM
                     PETTCPCDMLMVMPSRLASELNGEGGLFTGLCITSELYMQLFGMEFPAGHQASWSRDD
                     VGSLTLSFASPWYPPSGEVMGIMSQMFDCEIRHYWISPDAGTSGFNCFDRGDHVDSGP
                     YQAEALRQSASGDGARMYLVTPETAAVPATTAAHYGSIRA"
     gene            512285..512971
                     /locus_tag="ECL_RS02465"
                     /old_locus_tag="ECL_00514"
                     /db_xref="GeneID:9123023"
     CDS             512285..512971
                     /locus_tag="ECL_RS02465"
                     /old_locus_tag="ECL_00514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_013095238.1"
                     /db_xref="GeneID:9123023"
                     /translation="MKSVINHEKAFLSLFSQTARYHHRHQVFEDFVSCSVIALQNSLQ
                     FCDKREEKYMRIVGRYEKTDISRMAQLLAHVTNGLDETPGDFLGRVFMQLELGDKYRG
                     QFFTPWNIGLMMARMQLGNVEDNFRDKPFITLSEPACGAGCMALAFAFVLREAGYSPH
                     RYLWVSAQDIDPLAAGMAYIQLSLSGVPGEVVIGNSLNDERRRILHTPAHYMGNWSFL
                     LQTRMNAAVA"
     gene            complement(513019..513432)
                     /locus_tag="ECL_RS02470"
                     /db_xref="GeneID:44145322"
     CDS             complement(513019..513432)
                     /locus_tag="ECL_RS02470"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_054442362.1"
                     /db_xref="GeneID:44145322"
                     /translation="MKINIRFSRLFLLAIPLAIYGTELLFWYVMMKRNIFPPEYISWR
                     VTILLTFVWISGFALYLCENAEKWPVLLMKLFSPVAGYILVACVATLDAFVMWDTKPF
                     TDNYVDFFRLGFLGSYIIPLILVFLSGIFDNFSDM"
     gene            complement(513684..514891)
                     /locus_tag="ECL_RS02475"
                     /old_locus_tag="ECL_00517"
                     /db_xref="GeneID:9123026"
     CDS             complement(join(513684..514570,514570..514891))
                     /locus_tag="ECL_RS02475"
                     /old_locus_tag="ECL_00517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611134.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_109455549.1"
                     /db_xref="GeneID:9123026"
                     /translation="MTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSHVARLHGIQP
                     SLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEVEILKEAV
                     EYAQSPKMDSARALVAKGRGIALVSRTMGVSRAQLSLRINRSADWQDRRCNRRDDEAD
                     AEILSEILDIISDMPSYGYRRVWGILRTQRRTEGLPPVNAKRLYRLMSEHNLLLLHDK
                     PERSKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAASTGG
                     YDSSTVQDVMLRSVEKRFGDGLPTTPVQWLTDNGSAYTAHETRRFARELNLEPCTTAV
                     SSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAAAFTHYNENHPHSALGYHSPR
                     EYRRQRTSLT"
     gene            complement(514967..515347)
                     /locus_tag="ECL_RS02480"
                     /old_locus_tag="ECL_00519"
                     /db_xref="GeneID:9123028"
     CDS             complement(514967..515347)
                     /locus_tag="ECL_RS02480"
                     /old_locus_tag="ECL_00519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001229302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_072072196.1"
                     /db_xref="GeneID:9123028"
                     /translation="MKFGGRCAYCGCFLPEKGWHADHVEPVRRDFEYVLAPVGSGVTH
                     VARNTGKVLHPDLHTIENLFPACAPCNLFKGAFSVEGMRKEISQQVERARTYSVNFRT
                     AERFGLVEIVDKPVVFWFEHDVAP"
     gene            complement(515489..516645)
                     /locus_tag="ECL_RS02485"
                     /old_locus_tag="ECL_00520"
                     /db_xref="GeneID:9123029"
     CDS             complement(join(515489..516408,516408..516645))
                     /locus_tag="ECL_RS02485"
                     /old_locus_tag="ECL_00520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612096.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3-like element ISEc52 family transposase"
                     /protein_id="WP_164928065.1"
                     /db_xref="GeneID:9123029"
                     /translation="MSAQSLKRESAQLVVDQNYTVADAASAMDVGLSTMTRWVKQLRD
                     ERQGKTPKASPITPEQIEIRELRKKLQRIEMENEIFKKGYRALDVRLPEQFSIIGKLR
                     ARYPVATLCHVFGVHRSSYKYWKNRPEKPDGRRAVLRSQVLELHGISHGSAGARSIAT
                     MATQRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIPNHLERQFAVTEPNQ
                     VWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMKALEMAWETRGKPV
                     GVMFHSDQGSHYTSRQFRQLLWRYRIRQSMSRRGNCWDNSPMERFFRSLKNEWVPATG
                     YVSFSDAAHAITDYIVGYYSALRPHEYNGGLPPNESENRYWKNSNAVASFC"
     gene            complement(516627..517451)
                     /locus_tag="ECL_RS02490"
                     /old_locus_tag="ECL_00522"
                     /db_xref="GeneID:9123031"
     CDS             complement(516627..517451)
                     /locus_tag="ECL_RS02490"
                     /old_locus_tag="ECL_00522"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095243.1"
                     /db_xref="GeneID:9123031"
                     /translation="MNNDMLTLAAKKYLSTFADHRNNPTNYEALTAWDNATSEFMALV
                     NNDELNIIASLLAGREADKTDNSQLRQRIADLEARPVAPFDFKETTDADYCREWAWRA
                     IKKDLPTEHWKTGENGTFYAFYLMGWHARLQYNEQRRSEYSQIADTILKTRTVSINTE
                     PWRSFVSDDDITALNRFAECCDDPESGGHDLEKEQVKRLEKIGLLRRSGRISFTTDFG
                     DFVLSAAGINLNLEMGEQVCPGLKWFTEFGHLNRGDMLTSEQHRCHNEKKKFQRRV"
     gene            complement(517448..517927)
                     /locus_tag="ECL_RS02495"
                     /old_locus_tag="ECL_00523"
                     /db_xref="GeneID:9123032"
     CDS             complement(517448..517927)
                     /locus_tag="ECL_RS02495"
                     /old_locus_tag="ECL_00523"
                     /inference="COORDINATES: protein motif:HMM:NF013798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="macro domain-containing protein"
                     /protein_id="WP_013095244.1"
                     /db_xref="GeneID:9123032"
                     /translation="MTLTVLPGDLFEQEADCLINAWNMNFIPWWLLWPKGVSGRLKQL
                     AGPEPFRQLARTGVMRPGTVCLTDGGKLKTPIIHAAALNMFWCSSESIVHCCTDAALN
                     LAAVKGFHSVAFPLLGSGIGGLTPSLSLEAMTRAIEINPYSKTLDIKIITYRKGDAV"
     gene            complement(517924..518577)
                     /locus_tag="ECL_RS02500"
                     /old_locus_tag="ECL_00524"
                     /db_xref="GeneID:9123033"
     CDS             complement(517924..518577)
                     /locus_tag="ECL_RS02500"
                     /old_locus_tag="ECL_00524"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095245.1"
                     /db_xref="GeneID:9123033"
                     /translation="MVQLQTQLNAIHERIAEAQNIVARRERSVKRAERNLEIAEDNLA
                     QLQNERDELLIASWGDIPNWQVIFDLVNPSPAMYEYKEKWVREKGLHAGGMYNCHTNQ
                     GAFSVGFTTTSEHELYQNIRMVEFVMQYLRTDHNNEKTMIVYNVPTDNCCHNFVFNTG
                     TGKYGITTDSYMSRSNITEFSTAEEALRYLQSISDTDIVPEPESLPGAVIYPDGDEE"
     gene            complement(518593..519129)
                     /locus_tag="ECL_RS02505"
                     /old_locus_tag="ECL_00525"
                     /db_xref="GeneID:9123034"
     CDS             complement(518593..519129)
                     /locus_tag="ECL_RS02505"
                     /old_locus_tag="ECL_00525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000733561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095246.1"
                     /db_xref="GeneID:9123034"
                     /translation="MIKMFSVVSLTTLLLTLTGCSGSSPLNDLSLSRLTSLINPVSQQ
                     QTQNSAEPNQRNYVGQFYGPIPIPAETVAMRLKQHYGFVSDIDVAAAHNSGQGNAGWS
                     ASAISEGTSWEAQPGNYYRMSRNWAENDRLTLDVRGNSKESFITATYISSNPEHLKKT
                     WTSRLWKQIPDVASGSLK"
     gene            complement(519202..520419)
                     /locus_tag="ECL_RS02510"
                     /old_locus_tag="ECL_00526"
                     /db_xref="GeneID:9123035"
     CDS             complement(519202..520419)
                     /locus_tag="ECL_RS02510"
                     /old_locus_tag="ECL_00526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003557916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraF"
                     /protein_id="WP_044158948.1"
                     /db_xref="GeneID:9123035"
                     /translation="MMKASVSMITRCISVALLVSAVPSVYAATGWMEARGDAMGGTGV
                     ASAHYGTAALSNPALLTHFGPTDYFSLVLPSVGAQVSDPDNTVDKADDVKDLWDRFDA
                     AADSQSGVSESAAALKNKLQDLKDTHANGQVGASVVATVPNQTLPFAVVVKSWGTVSV
                     EGKVSDHDLDYLDKVADGDIPPSAVDKNSLTSKAYGRAAVITDVGVAMAHEFETAGQR
                     WSLGITPKYQRIDLFNYNVSVRDFDKSDIHSGDYRNTKTGFNADLGLATDLTDNWTLG
                     LAVLNVIPRSVETKPVNGSTGTFKVKPQATAGAAWHSGFITTALDVDLTEASRFDTDK
                     KRQFASAGVELNAWSWMQVRAGYRQNIISNDGSAFTAGLGFSPFDVVHLDITGIAGTD
                     RTYGAVAQMQFTF"
     gene            complement(520505..521356)
                     /locus_tag="ECL_RS02515"
                     /old_locus_tag="ECL_00528"
                     /db_xref="GeneID:9123037"
     CDS             complement(520505..521356)
                     /locus_tag="ECL_RS02515"
                     /old_locus_tag="ECL_00528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_099725667.1"
                     /db_xref="GeneID:9123037"
                     /translation="MGDFIILMSGRLGISAAALVNIMIEGVMRETLTPHQAAVTRIPE
                     RFWLLMDEYNLSSPEVAHLLADWNMSLGVLENRERTLGYMTPPLLEKLSEWFYVSTGW
                     LSGKIVPPVRITVFPDWLDASRLLTCRIQEINPEDFIARPDLFFIRKKEQDDIFLFIR
                     RYTTINDTRFRVVECAGRCSVSGESGKQFTLFLALCGLLFKAEVLSLVDTFIDSGNIL
                     DSMISGEVLPPAALREIQKPFHDSHGKYTQRIWSTEEREPFLNPDNFINDEWRKIAED
                     IISTRSI"
     gene            complement(521669..522229)
                     /locus_tag="ECL_RS02520"
                     /old_locus_tag="ECL_00529"
                     /db_xref="GeneID:9123038"
     CDS             complement(521669..522229)
                     /locus_tag="ECL_RS02520"
                     /old_locus_tag="ECL_00529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012666838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095250.1"
                     /db_xref="GeneID:9123038"
                     /translation="MQQACVFSFFLLWLGLSGVMGLEITGGVPCSGFYLVWVLLSGLP
                     FLLRPLAWAERRFRPKMTLISQHGKRAWVHLAPWQPTTDLTPSRVCLFWQNVNASTCQ
                     ALETHRTVIISSHLLTGIRARRLLAHTTEYGLTVRSRIYQIPFTPWKRALMQLEILFR
                     QWRWRTDFRRDWPVLVLRRKSLNTEK"
     gene            522434..524014
                     /locus_tag="ECL_RS02525"
                     /old_locus_tag="ECL_00531"
                     /db_xref="GeneID:9123040"
     CDS             522434..524014
                     /locus_tag="ECL_RS02525"
                     /old_locus_tag="ECL_00531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014606767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding domain-containing protein"
                     /protein_id="WP_086538577.1"
                     /db_xref="GeneID:9123040"
                     /translation="MVRGLNWLTGRSRQEKRPGERLPAGATPSRTVADDGWRPAQTGR
                     SLLQADEYRRLIRVLTENSPLSQQVTEAWWLRPLEEMAGRVQACPGAWSGPFSGPGGF
                     NELSLNVATRAVRLVRGMMLPPGATPEEQAEQMPGWVCAAYWAGLFHHLPWLMQVEGA
                     LKSGRVWYPGLSVPGEPWRVRPAGEPPGATGSVYVAFRLLPEAALLWLQRWPVLSDTL
                     LLFLSGRRAEAGILNSIVNDALRSCGLSDTAVMSGQPPDPVSLVTVVPVTGHTFPKLY
                     ETDSIPLSSNDNSPDVSVPIKTGDMTYSFSQDGEKTSVNTVPSALVLESALSTHEPLL
                     SAENDISRDEEGGAQVSTENLLSLLDLMAEGKSSVVTENVPADSADSPPATELPPGTH
                     PSHEEGMDKEEQAGALFLEWVRDSVEDGTLSVNEKDSILHVLAQFVFMVSPACFYRHT
                     STAEGSVTDKDRLQKSFEALNVHHSRNGKGLFHYHQYDTPDKSGRFTKVSGYMINADI
                     IFKKGSCLTDSIWLSAKK"
     gene            524049..525014
                     /locus_tag="ECL_RS02530"
                     /old_locus_tag="ECL_00532"
                     /db_xref="GeneID:9123041"
     CDS             524049..525014
                     /locus_tag="ECL_RS02530"
                     /old_locus_tag="ECL_00532"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012666840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_013095253.1"
                     /db_xref="GeneID:9123041"
                     /translation="MADIVTFEKILDDYFFNKVLRRATEWSYRKVVRTFLEFYGEDIL
                     PENVTRMDVLKWRRYVLNEQMSSKRTWNNKVAHMRAVFNHAITNKLISARENPFNQVI
                     VKPDIKRKKTLSGEQMKKIDLIMERKIELEQMGVHDPRPNALEPAWFWMTVIETLKFT
                     GMRQNQLLHIRLCDVDLKLGIIELQAEGSKNHREHRVPITARLRPRLEQLYLMSVQKG
                     SKKGEQLFNINRFTPKKKRIIRAKNMDHLPMRAFFRRLSRECQCDISPHRFRHTIATD
                     LMKRPERSLNDVQMLLGHSSVAVTLEYVEANMDNLRRNLEAAYAA"
     gene            complement(525298..525373)
                     /locus_tag="ECL_RS02535"
                     /old_locus_tag="ECL_tRNA010"
                     /db_xref="GeneID:9123042"
     tRNA            complement(525298..525373)
                     /locus_tag="ECL_RS02535"
                     /old_locus_tag="ECL_tRNA010"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(525338..525340),aa:Phe,seq:gaa)
                     /db_xref="GeneID:9123042"
     gene            complement(525493..526068)
                     /locus_tag="ECL_RS02540"
                     /old_locus_tag="ECL_00533"
                     /db_xref="GeneID:9127678"
     CDS             complement(525493..526068)
                     /locus_tag="ECL_RS02540"
                     /old_locus_tag="ECL_00533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_710000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013095254.1"
                     /db_xref="GeneID:9127678"
                     /translation="MQREDVLGQALQLLEIQGIASTTLEMVADRIDYPLDELTRFWPD
                     KEALLYDALRYLSQQVDIWRRQLMLNEELTAEQKLLARYTALTECVSNNRYPGCLFIA
                     ACTYYPDPGHPIHQLADQQKRAAHDFTHELLTTLEVDDPAMVAKQMELVLEGCLSRML
                     VNRSQADVDTAHRLAEDILRFAQCRMGGALT"
     gene            complement(526117..527817)
                     /locus_tag="ECL_RS02545"
                     /old_locus_tag="ECL_00534"
                     /db_xref="GeneID:9123043"
     CDS             complement(526117..527817)
                     /locus_tag="ECL_RS02545"
                     /old_locus_tag="ECL_00534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide reductase DsbD"
                     /protein_id="WP_013095255.1"
                     /db_xref="GeneID:9123043"
                     /translation="MAQRFLTLILLLCSTSVFAGLFDAPGRSNFIPADQAFVFDFQQN
                     QHDLNLTWQVKEGYYLYRKQVSITPAQASVGALQLPAGEWHEDEFYGKSEIYRQHLSV
                     PVTVQQADKGATLTVTYQGCADAGFCYPPETRIVPLSEVKASAANVAPLPAEVKREGE
                     PASDLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQG
                     MALTYTALGLVVAAAGLQFQAALQHPYVLIGLSVMFILLALSMFGLFTLQLPSSLQTR
                     LTLLSNRQQGGSAGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNMWLGGGTLYLY
                     ALGMGLPLILVTVFGNRLLPKSGPWMETVKTAFGFVILALPVFLLERIVGDVWGMRLW
                     AMLGVAFFSWAFIVSLGAKSAWMRLVQIVLLAAALVSVRPLQDWAFGTPVAQNQAHLN
                     FIQIKNVDDLNQALAQARGKPVMLDLYADWCVACKEFEKYTFSDPQVQGALNGTVLLQ
                     ANVTANNAQDKALLKQLNVLGLPTILFFNQQGEEQPGQRVTGFMDAAAFSAHLRDRQP
                     "
     gene            complement(527793..528116)
                     /gene="cutA"
                     /locus_tag="ECL_RS02550"
                     /old_locus_tag="ECL_00535"
                     /db_xref="GeneID:9123044"
     CDS             complement(527793..528116)
                     /gene="cutA"
                     /locus_tag="ECL_RS02550"
                     /old_locus_tag="ECL_00535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divalent cation tolerance protein CutA"
                     /protein_id="WP_013095256.1"
                     /db_xref="GeneID:9123044"
                     /translation="MNTPDAVVVLCTAPDEASAQDLAAKVLAEKLAACVTLLPGATSL
                     YYWEGKLEQEYEVQMLLKTNPANQQALLDCLKSHHPYQTPELLVLPVLHGDNDYLSWL
                     NVSLR"
     gene            complement(528230..529531)
                     /locus_tag="ECL_RS02555"
                     /old_locus_tag="ECL_00536"
                     /db_xref="GeneID:9123045"
     CDS             complement(528230..529531)
                     /locus_tag="ECL_RS02555"
                     /old_locus_tag="ECL_00536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter"
                     /protein_id="WP_013095257.1"
                     /db_xref="GeneID:9123045"
                     /translation="MFGAELVIVLLAIYLGARLGGIGIGFAGGLGVLVLTLIFQIKPG
                     AIPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAERMLRRHPKYITFLAPLVTWFMTIL
                     AGTGHTAFSTLPVITEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFFAGILEP
                     MGVSYLTLLAICIPVTLIAVMITAVLCNFLGAELKDDPVYQERLAKGEVSLRGSQVFK
                     LKPHAKRSVVLFLIGIVAVMFYATAISDTVGLIQNPVLPRNEAIVVFMLTIATLISIT
                     CKIDTSEVLNASTFKSGMSACVCVLGVAWLGDTFVKAHISDIQTVAGDLLHNYPWLLA
                     VVLFFAATLLYSQAATTKALMPAALMLGVTPLTAIASFAAVSALFVLPTYPTLLAAVE
                     MDDTGSTRIGKYVFNHAFLIPGVVAITLCVILGFIIGGVVL"
     gene            complement(529648..531084)
                     /gene="aspA"
                     /locus_tag="ECL_RS02560"
                     /old_locus_tag="ECL_00537"
                     /db_xref="GeneID:9123046"
     CDS             complement(529648..531084)
                     /gene="aspA"
                     /locus_tag="ECL_RS02560"
                     /old_locus_tag="ECL_00537"
                     /EC_number="4.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006178931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_003855923.1"
                     /db_xref="GeneID:9123046"
                     /translation="MLNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNSKISDI
                     PEFVRGMVMVKKAAALANKELQTIPKSAANAIIAACDEVLNNGKCMDQFPVDVYQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYASV
                     VKLVDAINQLGDGFQRKAVEFQDILKMGRTQLQDAVPMTLGQEFHAFNVLLNEETKNL
                     LRTSELLLEVNLGATAIGTRLNTPDGYQQLAVQKLAEVSNLPVVPAEDLIEATSDCGA
                     YVMVHSALKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPE
                     VVNQVCFKVIGNDTTVTMASEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCIN
                     GITANKEVCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTE
                     AELDDIFSAQNLMHPAYKAKRYTDESEQ"
     gene            531414..531884
                     /gene="fxsA"
                     /locus_tag="ECL_RS02565"
                     /old_locus_tag="ECL_00538"
                     /db_xref="GeneID:9123047"
     CDS             531414..531884
                     /gene="fxsA"
                     /locus_tag="ECL_RS02565"
                     /old_locus_tag="ECL_00538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein FxsA"
                     /protein_id="WP_062676745.1"
                     /db_xref="GeneID:9123047"
                     /translation="MPVRWIPFIAFFLYVYIEISIFIQVAHVLGVLLTLILVIFTSVI
                     GMSLVRNQGFKNFLLMQQKMAAGESPAAEMIKSVSLIIAGLLLILPGFFTDFLGLLLL
                     LPPVQKHLTMKLLPHLRFSRMPGGGFSTGPGDTFEGEYQRKDDQHDRLDHKDDR"
     gene            complement(531922..533142)
                     /gene="yjeH"
                     /locus_tag="ECL_RS02570"
                     /old_locus_tag="ECL_00539"
                     /db_xref="GeneID:9123048"
     CDS             complement(531922..533142)
                     /gene="yjeH"
                     /locus_tag="ECL_RS02570"
                     /old_locus_tag="ECL_00539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-methionine/branched-chain amino acid
                     transporter"
                     /protein_id="WP_044158944.1"
                     /db_xref="GeneID:9123048"
                     /translation="MSGLKQELGLAQGVGLLSTSLLGTGVFAVPALAALVAGNNSLWA
                     WPVLIVLVFPVAIVFAILGRHFPSAGGVAHFVGMAFGPRLERVTGWLFLSVIPVGLPA
                     ALHIATGFGQALFGWHDEALLLAELGTLAIVWWVGSRGASSSANLQTIVAVLIVALIT
                     AIWWAGDIRVEEIPFPAITDINHAQLFAALSVMFWCFVGLEAFAHLASEFKHPERDFP
                     RALMIGLLVAGTVYWACTVLVLHFDAFGADKAAAASLPGIVVQLFGVKALWVACVIGY
                     LACFASLNIYIQSFARLVWSQARNKPQSRLAQLSKRQLPLNALNLVLGSCVVSTLCIY
                     ALKINLDALIIYANGIFIMIYLLCMLAGCRLLKGRYKALAVVGGVLCLLLLMMVGWKS
                     MYAVVMLAGLWVAL"
     gene            533321..533614
                     /locus_tag="ECL_RS02575"
                     /old_locus_tag="ECL_00540"
                     /db_xref="GeneID:9123049"
     CDS             533321..533614
                     /locus_tag="ECL_RS02575"
                     /old_locus_tag="ECL_00540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000027827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GroES"
                     /protein_id="WP_003855929.1"
                     /db_xref="GeneID:9123049"
                     /translation="MSIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEIIAVG
                     KGRILENGTVQPLDVKVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA"
     gene            533654..535300
                     /gene="groL"
                     /locus_tag="ECL_RS02580"
                     /old_locus_tag="ECL_00541"
                     /db_xref="GeneID:9123050"
     CDS             533654..535300
                     /gene="groL"
                     /locus_tag="ECL_RS02580"
                     /old_locus_tag="ECL_00541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005120975.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="WP_013095260.1"
                     /db_xref="GeneID:9123050"
                     /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITE
                     GLKAVAAGMNPMDLKRGIDKAVASAVEELKALSVPCSDSKAIAQVGTISANSDETVGK
                     LIAEAMDKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETGAVELESP
                     FILLADKKVSNIREMLPVLEAVAKAGKPLVIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIID
                     GVGEESAIQGRVAQIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KARVDDALHATRAAVEEGVVAGGGVALVRVAAKLAGLSGQNEDQNVGIKVALRAMEAP
                     LRQIVSNAGEEPSVVTNNVKAGEGNYGYNAATEEYGNMIDFGILDPTKVTRSALQYAA
                     SVAGLMITTECMVTDLPKGDAPDLGAAGGMGGMGGMGGMM"
     gene            complement(535539..536507)
                     /locus_tag="ECL_RS02585"
                     /old_locus_tag="ECL_00542"
                     /db_xref="GeneID:9123051"
     CDS             complement(535539..536507)
                     /locus_tag="ECL_RS02585"
                     /old_locus_tag="ECL_00542"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS5-like element IS903B family transposase"
                     /protein_id="WP_013087110.1"
                     /db_xref="GeneID:9123051"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     gene            complement(<536540..536914)
                     /locus_tag="ECL_RS02590"
                     /old_locus_tag="ECL_00543"
                     /pseudo
                     /db_xref="GeneID:9123052"
     CDS             complement(<536540..536914)
                     /locus_tag="ECL_RS02590"
                     /old_locus_tag="ECL_00543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003037948.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:9123052"
     gene            complement(536895..537572)
                     /locus_tag="ECL_RS02595"
                     /old_locus_tag="ECL_00544"
                     /db_xref="GeneID:9123053"
     CDS             complement(536895..537572)
                     /locus_tag="ECL_RS02595"
                     /old_locus_tag="ECL_00544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015963544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095262.1"
                     /db_xref="GeneID:9123053"
                     /translation="MSEVSPNQGKVTWVGYLAFFLTIIFFSGFFAKATEWWRVFDFTV
                     LNGTFGQVNGEGAASVSFRGTGGTGAKDGFLFALELAPSVILSLGIISVTEGLGGLRA
                     AQQLMTPVLKPLLGIPGICSLALIANLQNTDAAAGMTKELADEGVISDRERAIFATFQ
                     TSGSAIITNYFSSGAALFTSITVPVITPLAVILVFKFIGANFLRAWIAHMETRQIKER
                     EDDRRSA"
     gene            537827..538180
                     /locus_tag="ECL_RS02600"
                     /old_locus_tag="ECL_00545"
                     /db_xref="GeneID:9123054"
     CDS             537827..538180
                     /locus_tag="ECL_RS02600"
                     /old_locus_tag="ECL_00545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463195.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4156 domain-containing protein"
                     /protein_id="WP_013095263.1"
                     /db_xref="GeneID:9123054"
                     /translation="MRVKVCAGIVGAALLLAGCSSSNELTAAGQGVRFVEDKPGNECQ
                     FLGTATGEQSNWMSGQHGEEGGSMRGAANALRNQAAAMGGNVIYGVSSPTQGMLSSFV
                     PTASQMNGQVYKCPN"
     gene            complement(538228..539256)
                     /gene="epmB"
                     /locus_tag="ECL_RS02605"
                     /old_locus_tag="ECL_00546"
                     /db_xref="GeneID:9123055"
     CDS             complement(538228..539256)
                     /gene="epmB"
                     /locus_tag="ECL_RS02605"
                     /old_locus_tag="ECL_00546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EF-P beta-lysylation protein EpmB"
                     /protein_id="WP_013095264.1"
                     /db_xref="GeneID:9123055"
                     /translation="MAHIVTLNTPSREDWLSQLADVITSPDELLRLLELEQHTDLLAG
                     REAKRLFALRVPRAFVARMEKGNPDDPLLKQTLTAQEEFITAPGYSTDPLEEQNSVVP
                     GLLHKYLNRALLLVKGGCAVNCRYCFRRHFPYAENQGNKRNWQVALDYIAAHSELDEI
                     IFSGGDPLMAKDYELDWLLTQLEAIPHIKRLRIHSRLPIVIPARITDGLVSRLEQSRL
                     QVLLVNHINHANEIDDAFRAAMVRLRKAGVTLLNQSVLLRGVNDNARVLADLSNALFD
                     AGVMPYYLHVLDRVQGAAHFMVTDEEARQIVRELLTLVSGYMVPKLAREIGGEPSKTP
                     LDLQLRQS"
     gene            539297..539863
                     /gene="efp"
                     /locus_tag="ECL_RS02610"
                     /old_locus_tag="ECL_00547"
                     /db_xref="GeneID:9123056"
     CDS             539297..539863
                     /gene="efp"
                     /locus_tag="ECL_RS02610"
                     /old_locus_tag="ECL_00547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004871142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_014830362.1"
                     /db_xref="GeneID:9123056"
                     /translation="MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLR
                     RLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGD
                     SDKWLLDQAECIVTLWNGQPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPAKLSTGA
                     VVKVPLFVQTGEVIKVDTRSGEYVSRVK"
     gene            539911..540042
                     /locus_tag="ECL_RS02615"
                     /old_locus_tag="ECL_00548"
                     /db_xref="GeneID:9123057"
     CDS             539911..540042
                     /locus_tag="ECL_RS02615"
                     /old_locus_tag="ECL_00548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin A/B family lipoprotein"
                     /protein_id="WP_013095266.1"
                     /db_xref="GeneID:9123057"
                     /translation="MKRTVKILLLLALSSALLSGCNTTRGMGEDIQDLGHIISHAAS"
     gene            540151..540297
                     /gene="ecnB"
                     /locus_tag="ECL_RS02620"
                     /old_locus_tag="ECL_00549"
                     /db_xref="GeneID:9123058"
     CDS             540151..540297
                     /gene="ecnB"
                     /locus_tag="ECL_RS02620"
                     /old_locus_tag="ECL_00549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein toxin entericidin B"
                     /protein_id="WP_003025482.1"
                     /db_xref="GeneID:9123058"
                     /translation="MVKKTIAAIFSVLVLSSVLTACNTTRGVGQDISEGGSAISGAAT
                     KAQQ"
     gene            complement(540335..540934)
                     /locus_tag="ECL_RS02625"
                     /old_locus_tag="ECL_00550"
                     /db_xref="GeneID:9123059"
     CDS             complement(540335..540934)
                     /locus_tag="ECL_RS02625"
                     /old_locus_tag="ECL_00550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_013095267.1"
                     /db_xref="GeneID:9123059"
                     /translation="MFKILLIDRCHFTRAGFEAWLNHSGLFPGHFVVTGLNNLILARE
                     HILQWDPSVVIADLHGFMQDIHHFQQLSSLLNASEKVPFILLQSGEDKEMAGFLSQFP
                     IWASLTKNAGLETLATVINDALTTRASVEIPAVAAPLLTRQEEKVLTLWMDGASNQKI
                     ATHLRINGKTVYTYKRNIRMKLHMDTRFSPFLSLQESEN"
     gene            541197..541514
                     /gene="sugE"
                     /locus_tag="ECL_RS02630"
                     /old_locus_tag="ECL_00551"
                     /db_xref="GeneID:9123060"
     CDS             541197..541514
                     /gene="sugE"
                     /locus_tag="ECL_RS02630"
                     /old_locus_tag="ECL_00551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000118520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quaternary ammonium compound efflux SMR
                     transporter SugE"
                     /protein_id="WP_013095268.1"
                     /db_xref="GeneID:9123060"
                     /translation="MSWIILVIAGLLEVVWAIGLKYTHGFTRLTPSVITVTAMIVSIV
                     LLSWAMRSLPVGTAYAVWTGIGAVGAAITGILLLGESASLARIASLALIVCGIIGLKL
                     SAH"
     gene            complement(541511..542041)
                     /locus_tag="ECL_RS02635"
                     /old_locus_tag="ECL_00552"
                     /db_xref="GeneID:9123061"
     CDS             complement(541511..542041)
                     /locus_tag="ECL_RS02635"
                     /old_locus_tag="ECL_00552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipocalin family protein"
                     /protein_id="WP_013095269.1"
                     /db_xref="GeneID:9123061"
                     /translation="MRILPVIAAVTAAFLVVACSSPTPPSGVTVVSNFDAQRFLGTWY
                     EIARLDHRFERGLEKVTAHYSSMDDGGIQVINRGYNPDRQMWQQSTGKAYFTGDPRRA
                     ALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISSEMKQQMLDVAT
                     RQGFDVSKLIWVEQPH"
     gene            complement(542200..543345)
                     /locus_tag="ECL_RS02640"
                     /old_locus_tag="ECL_00553"
                     /db_xref="GeneID:9123062"
     CDS             complement(542200..543345)
                     /locus_tag="ECL_RS02640"
                     /old_locus_tag="ECL_00553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_045620946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class C beta-lactamase CMH-4"
                     /protein_id="WP_013095270.1"
                     /db_xref="GeneID:9123062"
                     /translation="MMKKSLSCALLLSVACSAFAAPMSEKQLADVVERTVTPLMKAQA
                     IPGMAVAVIYQGQPHYFTFGKADVAANKPVTPQTLFELGSVSKTFTGVLGGDAIARKE
                     ISLADPVTKYWPELTGKQWQGIRLLDLATYTAGGLPLQVPDDVTDNASLLRFYQSWQP
                     KWAPGTTRLYANTSIGLFGSLAVKPSGMRFEQAMAERVFKPLKLNHTWINVPHAEEPH
                     YAWGYREGKAVHVSPGMLDAEAYGVKSNVKDMASWVMANMAPETLPQSTLQQGIALAQ
                     SRYWRVGAMYQGLGWEMLNWPVDAKTVVDGSDNKVALAPLPVAEVNPPAPPVKASWVH
                     KTGSTGGFGSYVAFIPEKQIGIVMLANKSYPNPVRVETAYRILDALQ"
     gene            543478..544353
                     /locus_tag="ECL_RS02645"
                     /old_locus_tag="ECL_00554"
                     /db_xref="GeneID:9123063"
     CDS             543478..544353
                     /locus_tag="ECL_RS02645"
                     /old_locus_tag="ECL_00554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008321448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013095271.1"
                     /db_xref="GeneID:9123063"
                     /translation="MTRSYLPLNSLRAFEAAARHLSFTHAAIELNVTHSAISQHVKAL
                     EQHLNCQLFVRVSRGLMLTTEGENLLPVLNDSFDRIAGMLDRFANHRAQEKLKIGVVG
                     TFATGVLFSQLDDFRRSYPHIDLQLSTHNNRVDPAAEGLDYTIRYGGGAWHGTEATFL
                     CSAPLAPLCTPDIAAALHTPADILKFTLLRSYRRDEWTAWMQAAGENPPSPTHRVMVF
                     DSSVTMLEAAQTGTGIAIAPVDMFTHLLNSERIVQPFTTQIDLGSYWLTRLQSRAQTP
                     AMREFAQWLVGKMQK"
     gene            complement(544383..544742)
                     /gene="frdD"
                     /locus_tag="ECL_RS02650"
                     /old_locus_tag="ECL_00555"
                     /db_xref="GeneID:9123064"
     CDS             complement(544383..544742)
                     /gene="frdD"
                     /locus_tag="ECL_RS02650"
                     /old_locus_tag="ECL_00555"
                     /EC_number="1.3.5.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit FrdD"
                     /protein_id="WP_013095272.1"
                     /db_xref="GeneID:9123064"
                     /translation="MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVIILLVGIMLPLGL
                     FPGDALSYERVLAFAGSFIGRVFIFLMIVLPLWCGLHRIHHAMHDLKIHVPSGKWVFY
                     GLATILTVVTLIAVVTI"
     gene            complement(544753..545148)
                     /gene="frdC"
                     /locus_tag="ECL_RS02655"
                     /old_locus_tag="ECL_00556"
                     /db_xref="GeneID:9123065"
     CDS             complement(544753..545148)
                     /gene="frdC"
                     /locus_tag="ECL_RS02655"
                     /old_locus_tag="ECL_00556"
                     /EC_number="1.3.5.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit FrdC"
                     /protein_id="WP_013095273.1"
                     /db_xref="GeneID:9123065"
                     /translation="MTTKRKAYVRPMPSTWWKKLPFYRFYMLREGTAVPAVWFSLELM
                     YGVFALKHGPETWASFVGFLQNPIIVILNLIVLAAALLHTKTWFELAPKAANIIVKGE
                     KMGPEPVIKGLWAVTAVVSVVILFVALFW"
     gene            complement(545159..545893)
                     /locus_tag="ECL_RS02660"
                     /old_locus_tag="ECL_00557"
                     /db_xref="GeneID:9123066"
     CDS             complement(545159..545893)
                     /locus_tag="ECL_RS02660"
                     /old_locus_tag="ECL_00557"
                     /EC_number="1.3.5.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase iron-sulfur protein"
                     /protein_id="WP_013095274.1"
                     /db_xref="GeneID:9123066"
                     /translation="MAEMQTLKVEVVRYNPEVDTAPHSAFYEVPYDEQTSLLDALGYI
                     KDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLRDYTKGIKVEALGNFPIERD
                     LVVDMTHFIESLEAIKPYIIGNPRTPDQGPNTQTPAQMAKYHQFSGCINCGLCYAACP
                     QFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMPQLNSQNGVWSCTFVGYCSEVCPKH
                     VDPAAAIQQGKVESSKDFLIATLKPR"
     gene            complement(545886..547676)
                     /gene="frdA"
                     /locus_tag="ECL_RS02665"
                     /old_locus_tag="ECL_00558"
                     /db_xref="GeneID:9123067"
     CDS             complement(545886..547676)
                     /gene="frdA"
                     /locus_tag="ECL_RS02665"
                     /old_locus_tag="ECL_00558"
                     /EC_number="1.3.5.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase (quinol) flavoprotein
                     subunit"
                     /protein_id="WP_013095275.1"
                     /db_xref="GeneID:9123067"
                     /translation="MQTFQADLAVIGAGGAGLRAAIAAAQANPNAKIALISKVYPMRS
                     HTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLEQWGC
                     PWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLD
                     ILVDDGHARGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMAL
                     SHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLG
                     EPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLLERLPFICE
                     LAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQQCETRIKGLFAVGECSSVGLHGANRL
                     GSNSLAELVVFGRMAGERAMERAATAGEANGAALDAQVADVEKRLKDLVNQEGNENWS
                     KIRDEMGMSMEEGCGIYRTPELMQKTVDKLAELQERFKRVRITDTSSVFNTDLLYTIE
                     LGHGLNVAECMAHSALARKESRGAHQRLDEGCTERDDVNFLKHTLAWRDADGTTRLDY
                     SDVKITTLPPAKRVYGAEAEAAEKKEKANG"
     gene            547986..548963
                     /gene="epmA"
                     /locus_tag="ECL_RS02670"
                     /old_locus_tag="ECL_00559"
                     /db_xref="GeneID:9123068"
     CDS             547986..548963
                     /gene="epmA"
                     /locus_tag="ECL_RS02670"
                     /old_locus_tag="ECL_00559"
                     /EC_number="6.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000004771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P--(R)-beta-lysine ligase"
                     /protein_id="WP_013095276.1"
                     /db_xref="GeneID:9123068"
                     /translation="MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMS
                     QATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLAAGCGPVYQLCRSFRNE
                     EMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCSEAETLSYQQAFQRYLEID
                     PLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPQIGKDRPTFVYHFPAS
                     QASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQ
                     QPIDTNLLAALKAGLPDCSGVALGVDRLVMLALGAEQLGDVIAFTVDRA"
     gene            complement(549007..552330)
                     /gene="mscM"
                     /locus_tag="ECL_RS02675"
                     /old_locus_tag="ECL_00560"
                     /db_xref="GeneID:9123069"
     CDS             complement(549007..552330)
                     /gene="mscM"
                     /locus_tag="ECL_RS02675"
                     /old_locus_tag="ECL_00560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="miniconductance mechanosensitive channel MscM"
                     /protein_id="WP_013095277.1"
                     /db_xref="GeneID:9123069"
                     /translation="MRPIIVLLMAWCLSMGAYAATAPDAKQITQELEQAKAAKPAQPE
                     TVESLQSALNALEERKGSLERAQQYQQVIDNFPKLSQTLRNQLSNLRDEPRDVPAGMT
                     SDALNQEILQVSSQLLEKSRLAQQEQERAREIADSLSQLPQQQTDARRQLNEVERRIG
                     TQTGNTPQNQAQNLSLQAQSARLKALVDELELAQLSANNRQELSRMRSELAQKQSEQL
                     DAYLQALRNQLNSQRQREAERALESTELLAENSDNLPAGIVDQFKVNRELSAALNQQA
                     QRMDLVASQQRQATNQTLQVRQALNTLREQSQWLGSSNLLGEALRAQVSRLPEMPKPQ
                     QLDTEMAQLRVQRLHYEDLLNKQPQIRQIRQADGQPLTSEQNRILEAQLRTQRELLNS
                     LLQGGDTLILELTKLKVSNSQLEDALKEVNEATHRYLFWTSDVRPMTFSWPIEIVQDL
                     RRLISLDTFSQLGKASVMMLTSKETIFPLLGALILVGFSIYSRRHFTRFLERSSARVG
                     KVTQDHFWLTLRTVFWSILVASPLPVLWMTLGYGLREAWPYPLAVAIGDGVTATVPLL
                     WVVMICATFARPNGLFIAHFGWPRNRVARAMRYYLMSIGLIVPLIMALIMFDNLNDRE
                     FSGSLGRLCFMLICGALAIVTLSLKRAGIPLYLDKTGSGDNMFNRMLWNLLLCAPLVA
                     MLAAAVGYLATSQALLARLETSVAIWFLLLVIYHVIRRGMLIQRRRLAFDRAKHRRAE
                     ILAQRARGEDEPNHVNSTEGTIDADEVELDLDAISTQSLRLVRSILMLIALLSVIFLW
                     SEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILVLIITTQLVRNFPALLE
                     LALLQHLDLTPGTGYAITTITKYLILLFGGMVGFSMIGIEWSKLQWLVAALTFGLGFG
                     MQEIFANFVSGLIILFEKPIRIGDTVTIRDLTGSITKINTRATTISDWDRKEIIVPNK
                     AFITEQFINWSLSDSVTRVVLTVPAPSDANSEEVTQILYTAAERCTLVLDNPAPEVFL
                     VDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFREHGIDMPFPPFQMRLESLDG
                     LKTGKTLTSAARKRPAGSL"
     gene            complement(552350..553318)
                     /gene="psd"
                     /locus_tag="ECL_RS02680"
                     /old_locus_tag="ECL_00561"
                     /db_xref="GeneID:9123070"
     CDS             complement(552350..553318)
                     /gene="psd"
                     /locus_tag="ECL_RS02680"
                     /old_locus_tag="ECL_00561"
                     /EC_number="4.1.1.65"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006178960.1"
                     /note="Phosphatidylserine decarboxylase is synthesized as
                     a single chain precursor. Generation of the pyruvoyl
                     active site from a Ser is coupled to cleavage of a Gly-Ser
                     bond between the larger (beta) and smaller (alpha chains).
                     It is an integral membrane protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="WP_013095278.1"
                     /db_xref="GeneID:9123070"
                     /translation="MLNAFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKY
                     YKVDMKEAQKPDTASYRTFNEFFVRPLRDEVRPVDTDPNVLVMPADGVISQLGNIEDD
                     KILQAKGHNYSLEALLAGNYLMADLFRNGTFATTYLSPRDYHRVHMPCNGILREMIYV
                     PGDLFSVNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTIT
                     PPREGVIKRWTWPAGEEEGAVALLKGQEMGRFKLGSTVINLFAPGKVKLAEQLQSLSV
                     TKLGQPLAVSTEPFVTPDAEPAPLPEEEIKAELDASPLVDDKKDEG"
     gene            complement(553415..554500)
                     /gene="rsgA"
                     /locus_tag="ECL_RS02685"
                     /old_locus_tag="ECL_00562"
                     /db_xref="GeneID:9123071"
     CDS             complement(553415..554500)
                     /gene="rsgA"
                     /locus_tag="ECL_RS02685"
                     /old_locus_tag="ECL_00562"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_710029.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="small ribosomal subunit biogenesis GTPase RsgA"
                     /protein_id="WP_028027870.1"
                     /db_xref="GeneID:9123071"
                     /translation="MPLTGDQEPARLSKNKLSKGQQRRVNANHQRRLKTTSEKVDYDD
                     NLFGEPTEGVVISRFGMHADVESADGEIHRCNIRRTIRSLVTGDRVVWRPGKEAAEGV
                     TVKGIVEAVHERTSVLTRPDFYDGVKPIAANINQIVIVSAILPELSLNIIDRYLVACE
                     TLQVEPIIVLNKIDLLDDEGMDFVNEQMDIYRKIGYRVLMVSSYTKDGLKPLEEALTG
                     RISIFAGQSGVGKSSLLNNLLGLQQEILTNDVSDVSGLGQHTTTASRLYHFPHGGDVI
                     DSPGVREFGLWHLEPEQIFNGFVEFHDYLGACKYRDCKHDNDPGCAIREAVEKGEIAE
                     TRFDNYHRILESMDQVKTRKNFSDSDN"
     gene            554575..555120
                     /gene="orn"
                     /locus_tag="ECL_RS02690"
                     /old_locus_tag="ECL_00563"
                     /db_xref="GeneID:9123072"
     CDS             554575..555120
                     /gene="orn"
                     /locus_tag="ECL_RS02690"
                     /old_locus_tag="ECL_00563"
                     /EC_number="3.1.-.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="WP_013095280.1"
                     /db_xref="GeneID:9123072"
                     /translation="MSADENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGP
                     TIAVHQSDDQLALMDEWNVRTHTGSGLVERVKASTMGDREAELATLEFLKQWVPAGKS
                     PICGNSIGQDRRFLFKYMPELESYFHYRYLDVSTLKELARRWKPEILDGFKKQGTHQA
                     MDDIRESVAELAYYRENFIKL"
     gene            555317..555392
                     /locus_tag="ECL_RS02695"
                     /old_locus_tag="ECL_tRNA011"
                     /db_xref="GeneID:9123073"
     tRNA            555317..555392
                     /locus_tag="ECL_RS02695"
                     /old_locus_tag="ECL_tRNA011"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:555350..555352,aa:Gly,seq:gcc)
                     /db_xref="GeneID:9123073"
     gene            555437..555512
                     /locus_tag="ECL_RS02700"
                     /old_locus_tag="ECL_tRNA012"
                     /db_xref="GeneID:9127679"
     tRNA            555437..555512
                     /locus_tag="ECL_RS02700"
                     /old_locus_tag="ECL_tRNA012"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:555470..555472,aa:Gly,seq:gcc)
                     /db_xref="GeneID:9127679"
     gene            complement(555783..556922)
                     /gene="queG"
                     /locus_tag="ECL_RS02705"
                     /old_locus_tag="ECL_00564"
                     /db_xref="GeneID:9127680"
     CDS             complement(555783..556922)
                     /gene="queG"
                     /locus_tag="ECL_RS02705"
                     /old_locus_tag="ECL_00564"
                     /EC_number="1.17.99.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016160146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA epoxyqueuosine(34) reductase QueG"
                     /protein_id="WP_013095281.1"
                     /db_xref="GeneID:9127680"
                     /translation="MSQPLDLNQLAQKIKQWGAELGFQKVGITDTDLSASEPKLQAWL
                     DKQYHGEMEWMARHGMMRARPHELLPGTLRVISVRMNYLPANAAFARTLKNPSLGYVS
                     RYALGRDYHKLLRNRLKKLGETIQQHCVSLNFRPFVDSAPVLERPIAEKAGLGWTGKH
                     SLILSRDAGSFFFLGELLIDLPLPVDGPVEEGCGRCVACMTICPTGAIVEPYTVDARR
                     CISYLTIELEGAIPEEFRPLIGNRIYGCDDCQLICPWNRYSQLTDEEDFSPRKALHAP
                     QLIELFAWSEAWFLKVTEGSAIRRIGHLRWLRNVAVALGNAPWDEANIRALESRRGEH
                     PLLDEHIEWAIAQQIEKRNACVVEVQPPQKQRLVRVIEKGLPRDA"
     gene            556921..558444
                     /gene="nnr"
                     /locus_tag="ECL_RS02710"
                     /old_locus_tag="ECL_00565"
                     /db_xref="GeneID:9123074"
     CDS             556921..558444
                     /gene="nnr"
                     /locus_tag="ECL_RS02710"
                     /old_locus_tag="ECL_00565"
                     /EC_number="4.2.1.136"
                     /EC_number="5.1.99.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional ADP-dependent NAD(P)H-hydrate
                     dehydratase/NAD(P)H-hydrate epimerase"
                     /protein_id="WP_044158940.1"
                     /db_xref="GeneID:9123074"
                     /translation="MTDHTVKKNPASIPHSIWHADDLRRAEKEAADSLGITLYELMQR
                     AGEAAFNIARSAYPQSGHWLILCGHGNNGGDGYVVARLAVAAGLRVTLLALESDKPLP
                     EEASAAREAWLNAGGVIHASDIVWPEDVDLIVDGLLGTGLRSAPRDNVAALIARANAH
                     TAPVVALDIPSGLMAETGATPGAVIQAAHTVTFIALKPGLLTGKARDVVGSLHHNALG
                     LESWLAGQETHLSRFDATQLSHWLPPRRPTSHKGDHGRLVIIGGDHGTAGAIRMTGEA
                     ALRSGAGLVRVLTRSENIPPIITARPELMVHELTPQTLEESLEWADVVVIGPGLGQQA
                     WGKQALQKVENFRKPMLWDADALNLLAINPDKRHNRILTPHPGEAARLLNCSVAEIES
                     DRLLSARRLVKRYGGVAVLKGAGTVIASDEALGIIDAGNAGMASGGMGDVLSGIIGAL
                     LGQKLPLYDAACAGCVAHGAAADSLAARYGTRGMLATDLFCTLRRVVNPDVIDVEDD"
     gene            558437..558898
                     /gene="tsaE"
                     /locus_tag="ECL_RS02715"
                     /old_locus_tag="ECL_00566"
                     /db_xref="GeneID:9123075"
     CDS             558437..558898
                     /gene="tsaE"
                     /locus_tag="ECL_RS02715"
                     /old_locus_tag="ECL_00566"
                     /EC_number="2.3.1.234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     ATPase subunit type 1 TsaE"
                     /protein_id="WP_013095283.1"
                     /db_xref="GeneID:9123075"
                     /translation="MTNRAIPLPDEQATLELGKRVAQACQGATVIYLYGDLGAGKTTF
                     SRGFLQALGHNGNVKSPTYTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFAND
                     AICLVEWPQQGAGVLPDPDVEIHLDYQAQGREARISAVSSSGSSLLARLAG"
     gene            558915..560252
                     /gene="amiB"
                     /locus_tag="ECL_RS02720"
                     /old_locus_tag="ECL_00567"
                     /db_xref="GeneID:9123076"
     CDS             558915..560252
                     /gene="amiB"
                     /locus_tag="ECL_RS02720"
                     /old_locus_tag="ECL_00567"
                     /EC_number="3.5.1.28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003855985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase AmiB"
                     /protein_id="WP_044158937.1"
                     /db_xref="GeneID:9123076"
                     /translation="MINRVKGWLLAATVLLCAQAGAASLSDIQVSNGESQARITFSFM
                     GDPEYAFSQPDSRSVALDIKQTGVIQGLPLQFSGNNLVKSIRSGTPKDSQSLRLVVDL
                     TEKGKTRAVKQQNGANYTVVFTINADAPPPPPPPPVVAKRVEEPVYTPRPSEPARNPF
                     KTDNDRITGVTSSNTVTRPAASARRVVSSDKVIIAIDAGHGGQDPGAIGPGGTREKNV
                     TIAIARKLRTLLNDDPMFKGVLTRDGDYFISVMGRSDVARKQNANFLVSIHADAAPNR
                     NATGASVWVLSNRRANSEMANWLEEHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQF
                     GHSQRVGYDVATNVLNQLQGIGALHKRRPEHASLGVLRSPDIPSILVETGFISNNSEE
                     RLLGSDSYQQQIAEAIYNGLRKYFEAHPLQSAPQGGAAQTASAVLPGEMTATN"
     gene            560262..562106
                     /gene="mutL"
                     /locus_tag="ECL_RS02725"
                     /old_locus_tag="ECL_00568"
                     /db_xref="GeneID:9123077"
     CDS             560262..562106
                     /gene="mutL"
                     /locus_tag="ECL_RS02725"
                     /old_locus_tag="ECL_00568"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutL"
                     /protein_id="WP_013095285.1"
                     /db_xref="GeneID:9123077"
                     /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDI
                     DIERGGAKLIRIRDNGCGIKKEELALALARHATSKIASLDDLEAIISLGFRGEALASI
                     SSVSRLTLTSRTAEQQEAWQAYAEGRDMDVTIKPAAHPVGTTLEVLDLFYNTPARRKF
                     MRTEKTEFGHIDEIIRRIALARFDVTINLSHNGKVMRQYRAVAEGGQKERRLGAICGT
                     PFLEQALAIEWQHGDLALRGWVADPNASSAAFAEIQYCYVNGRMMRDRLINHAIRQAC
                     EDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQV
                     EPTLPLEKEEPASRPIPENRVAAGRNHFAEPAVAREPEAPRFSSAGSAPRPTGANYPN
                     AQPGYQKQQGALYRKLLETPAVTRKEHSEVQAPSLEGHSQSFGRVLTIIAPDMALLER
                     EGKLMLLALPVAERWLKQVQLTPGENAACAQPLLIPVRLKISTEETRVLQRAEAQLAQ
                     MGIEMVLESQHVTIRAVPLPLRQQNLQNLIPELIGYLAQQTTFDAANTAQWIARHLAS
                     EHTPWSMAQAISVLAEVERLCPHLVKAPPGGLLQPVDLQTAMTALKDD"
     gene            562099..563049
                     /gene="miaA"
                     /locus_tag="ECL_RS02730"
                     /old_locus_tag="ECL_00569"
                     /db_xref="GeneID:9123078"
     CDS             562099..563049
                     /gene="miaA"
                     /locus_tag="ECL_RS02730"
                     /old_locus_tag="ECL_00569"
                     /EC_number="2.5.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (adenosine(37)-N6)-dimethylallyltransferase
                     MiaA"
                     /protein_id="WP_013095286.1"
                     /db_xref="GeneID:9123078"
                     /translation="MIDVSKASLPKAIFLMGPTASGKTALAIELRKVLPVELISVDSA
                     LIYRGMDIGTAKPDAAELRAAPHRLLDILDPAQAYSAADFRRDALAEMAEITAAGRIP
                     LLVGGTMLYFKALLEGLSPLPSADPEIRAKIEQKAAEQGWDVLHQQLAEIDPVAAARI
                     HPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRF
                     HQMLASDFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEMVYRGVCATR
                     QLAKRQITWLRGWEGVHWLDSEKPQQALNEVIEVIGDIAH"
     gene            563135..563446
                     /gene="hfq"
                     /locus_tag="ECL_RS02735"
                     /old_locus_tag="ECL_00570"
                     /db_xref="GeneID:9123079"
     CDS             563135..563446
                     /gene="hfq"
                     /locus_tag="ECL_RS02735"
                     /old_locus_tag="ECL_00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA chaperone Hfq"
                     /protein_id="WP_013095287.1"
                     /db_xref="GeneID:9123079"
                     /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVI
                     LLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTGSNYHHGSNAQGSSAPAQDSDET
                     E"
     gene            563521..564801
                     /gene="hflX"
                     /locus_tag="ECL_RS02740"
                     /old_locus_tag="ECL_00571"
                     /db_xref="GeneID:9123080"
     CDS             563521..564801
                     /gene="hflX"
                     /locus_tag="ECL_RS02740"
                     /old_locus_tag="ECL_00571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002434123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase HflX"
                     /protein_id="WP_013095288.1"
                     /db_xref="GeneID:9123080"
                     /translation="MFDRYDAGEQAVLVHIYFSQDKDMEDLQEFESLVSSAGVEAMQV
                     ITGSRKAPHPKYFVGEGKAVEIADAVKATGASVVLFDHALSPAQERNLEALCECRVID
                     RTGLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQL
                     ETDRRLLRGRITQILSRLERVEKQREQGRRARTKADIPTVSLVGYTNAGKSTLFNQIT
                     EAQVYAADQLFATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQ
                     ATLLLHVIDAADVRVQENIDAVNVVLEEIEAHEIPTLLVMNKIDMLDDFEPRIDRDEE
                     NKPIRVWLSAQTGIGVPLLFQALTERLSGEVAQHTLRLPPQEGRLRSRFYQLQAIEKE
                     WMEDDGSVGMQVRMPIVDWRRLCKQEPALVDYIV"
     gene            564858..566117
                     /gene="hflK"
                     /locus_tag="ECL_RS02745"
                     /old_locus_tag="ECL_00572"
                     /db_xref="GeneID:9123081"
     CDS             564858..566117
                     /gene="hflK"
                     /locus_tag="ECL_RS02745"
                     /old_locus_tag="ECL_00572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FtsH protease activity modulator HflK"
                     /protein_id="WP_013095289.1"
                     /db_xref="GeneID:9123081"
                     /translation="MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGRDQGPPDLDD
                     IFRKLSKKLGGLGGGKGSGSGGNSTQGPRPQMGGRIVGIVAAAVVIIWAASGFYTIKE
                     AERGVVTRFGKFSHLVEPGLNWKPTFIDDVTAVNVESVRELAASGVMLTSDENVVRVE
                     MNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQR
                     ELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQ
                     PRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKV
                     LSHTRKVLVNDSKGGNLMVLPLDQMLKGGSAPAAKDNSGANNLLRLPPASSGSSSATT
                     TPSSNDGDIMDQRRANAQRNDYQRQGE"
     gene            566120..567124
                     /gene="hflC"
                     /locus_tag="ECL_RS02750"
                     /old_locus_tag="ECL_00573"
                     /db_xref="GeneID:9123082"
     CDS             566120..567124
                     /gene="hflC"
                     /locus_tag="ECL_RS02750"
                     /old_locus_tag="ECL_00573"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004097977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protease modulator HflC"
                     /protein_id="WP_013095290.1"
                     /db_xref="GeneID:9123082"
                     /translation="MRKSVIAIIVIVLVVLYTSIFVVKEGERGIKFQFSSVVRDSDKR
                     PVIYEPGLHFKVPFIQSVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSR
                     YFLATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTLEVRDALNSGTA
                     GTEDEVETPAADDAIAKAAERVQAETNGKVPVINPNSMAALGIEVVDVRIKQINLPAE
                     VSEAIYNRMRAEREAVARRHRSQGQEEAEKLRAAADYEVTKTLAESERQGRILRGEGD
                     AEAAKLFADAFSQDPDFYAFIRSLRAYENSFQSNQDVMVLSPDSDFFRYMKTPTNATR
                     "
     gene            567196..567393
                     /locus_tag="ECL_RS02755"
                     /old_locus_tag="ECL_00574"
                     /db_xref="GeneID:9123083"
     CDS             567196..567393
                     /locus_tag="ECL_RS02755"
                     /old_locus_tag="ECL_00574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2065 domain-containing protein"
                     /protein_id="WP_013095291.1"
                     /db_xref="GeneID:9123083"
                     /translation="MNSTIWLALALVLVLEGLGPMLYPRAWRRMIATLSQLPDNILRR
                     FGGGLVVAGIVIYYMLRKTIG"
     gene            567498..568796
                     /locus_tag="ECL_RS02760"
                     /old_locus_tag="ECL_00575"
                     /db_xref="GeneID:9123084"
     CDS             567498..568796
                     /locus_tag="ECL_RS02760"
                     /old_locus_tag="ECL_00575"
                     /EC_number="6.3.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019842885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthase"
                     /protein_id="WP_006178975.1"
                     /db_xref="GeneID:9123084"
                     /translation="MGNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTL
                     VINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKGLEDRGIPVRERLLLSE
                     ACPLILDYHVALDVAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKATFAE
                     KLKEVMEYHNFQLVNFYKADAVDYQKVLDDVMAIADILTGMVVDVSDLLDQARKRGDF
                     VMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIIKAYSTRVGA
                     GPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLD
                     VLDGLKEVKICVGYRMPDGREVTTTPLAADDWEGIEPIYETMPGWSETTFGVKERSGL
                     PQAALDYIKRIEELTEVPIDIISTGPDRTETMILRDPFDA"
     gene            568990..569415
                     /gene="nsrR"
                     /locus_tag="ECL_RS02765"
                     /old_locus_tag="ECL_00576"
                     /db_xref="GeneID:9123085"
     CDS             568990..569415
                     /gene="nsrR"
                     /locus_tag="ECL_RS02765"
                     /old_locus_tag="ECL_00576"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide-sensing transcriptional repressor
                     NsrR"
                     /protein_id="WP_014830384.1"
                     /db_xref="GeneID:9123085"
                     /translation="MQLTSFTDYGLRALIYMASLPDGKMTSISEVTEVYGVSRNHMVK
                     IINQLSRAGYVAAVRGKNGGIRLGKPAQSIRIGDVVRELEPLSLVNCSSEFCHITPAC
                     RLKQALSLAVQSFLKELDNYTLADLVEENQPLYKLLLVE"
     gene            569454..571895
                     /gene="rnr"
                     /locus_tag="ECL_RS02770"
                     /old_locus_tag="ECL_00577"
                     /db_xref="GeneID:9123086"
     CDS             569454..571895
                     /gene="rnr"
                     /locus_tag="ECL_RS02770"
                     /old_locus_tag="ECL_00577"
                     /EC_number="3.1.13.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="WP_013095293.1"
                     /db_xref="GeneID:9123086"
                     /translation="MSHDPFQEREAEKYANPIPSREFIIEHLTKREKPANREELAVEL
                     NIEGEEQTEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRVE
                     GRKDDLYLSSEQMKMCIHGDQILAQPLGADRKGRREARVVRVLVPKTSQIVGRYFTDA
                     GVGFVVPDDSRLSFDILIPPEEVMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNM
                     GTGMAVDMALRTHEIPYIWPKAVEEQIVGLKEEVPEESKAGRVDLRSLPLVTIDGEDA
                     RDFDDAVYCEKKRGGGWRLWVAIADVSYYVRPHTPLDNEARSRGTSVYFPSQVVPMLP
                     EVLSNGLCSLNPQVDRLCMVCEMTISSKGRLTGYKFYEAVMSSHARLTYTKVWHMLQG
                     DQDLREQYAPLVKHIEELHNLYKTLDQAREERGGISFESEEAKFIFNAERRIERIEQT
                     QRNDAHKLIEECMILANISAARFVEKAKEPALFRIHDKPSTEAITAFRSVLAELGLEL
                     PGGNKPEPRDYAELLESIGDRPDAEMLQTMLLRSMKQAIYDPENRGHFGLALQSYAHF
                     TSPIRRYPDLSLHRAIKYLLAQEQGHKGNTTETGGYHYSMEEMLQLGQHCSMTERRAD
                     EATREVSDWLKCDFMLDQVGNIFKGVIASVTGFGFFVRLDELFIDGLVHVSSLDNDYY
                     RFDQVGQRLIGESGGQTYRLGDRVEVKVEAVNMDERKIDFSLISSERAPRNVGKTARE
                     KAKKGGNGNASGKRRQAGKKVNFEPDSAFRGEKKQKPKAAKKEARKAKKPSAKTQKIA
                     AATKAKRAAKKQQAE"
     gene            571963..572697
                     /gene="rlmB"
                     /locus_tag="ECL_RS02775"
                     /old_locus_tag="ECL_00578"
                     /db_xref="GeneID:9123087"
     CDS             571963..572697
                     /gene="rlmB"
                     /locus_tag="ECL_RS02775"
                     /old_locus_tag="ECL_00578"
                     /EC_number="2.1.1.185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (guanosine(2251)-2'-O)-methyltransferase RlmB"
                     /protein_id="WP_013095294.1"
                     /db_xref="GeneID:9123087"
                     /translation="MSEMIYGIHAVQALLERAPERFQEVFILKGREDKRLMPLIHALE
                     AQGVVIQLANRQFLDEKSEGAVHQGIIARVKPGRQYQENDLPDLIAALDNPFFLILDG
                     VTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLART
                     MRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPM
                     AGSVSSLNVSVATGICLFEAVRQRGE"
     gene            complement(572776..574050)
                     /locus_tag="ECL_RS02780"
                     /old_locus_tag="ECL_00579"
                     /db_xref="GeneID:9123088"
     CDS             complement(572776..574050)
                     /locus_tag="ECL_RS02780"
                     /old_locus_tag="ECL_00579"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006810384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013095295.1"
                     /db_xref="GeneID:9123088"
                     /translation="MQPNAHKRALIAGSIGNFIEWYEFAVYGFLATVIAKNFFQLEGE
                     SGLTSLILTYASFAIAFFFRPLGAVVFGRIGDRIGRKPTLIIVLVLMTLATAAIGVVP
                     VYASIGIAAPLIVTLLRILQGLFAGGEYGGAVSLMTEFAPRGKRGLYGAWQSFTVALG
                     LLAGAGIVALLSALLTPEALHDWGWRIPFFLALPMGVVALWLRVSMEETPSFVQQQEK
                     PLIAQASTVATIKAIVMGIGRVMVWSAAGYTYLVIMPTYLQSALHTGFNQALLIAVIS
                     NVGFALTIIPSGILSDRIGRRTVMIIATALLLILALPLLKILQAESSTLAVKAIVVLI
                     AGGLVGMLAGPGPAMLSEMFPTRVRYTGLGLAYSLSNAIFSGCAGLIITGLIKETGNL
                     DIPAYYVMATAVVSIVALMTLRKDDHLRTLEE"
     gene            574244..575866
                     /locus_tag="ECL_RS02785"
                     /old_locus_tag="ECL_00580"
                     /db_xref="GeneID:9123089"
     CDS             574244..575866
                     /locus_tag="ECL_RS02785"
                     /old_locus_tag="ECL_00580"
                     /EC_number="1.3.8.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl-CoA dehydrogenase"
                     /protein_id="WP_013095296.1"
                     /db_xref="GeneID:9123089"
                     /translation="MHWQTHTVFNQPAPLSNSNLFLSDCALRDAVAREGAEWDSELLA
                     SIGQQLGTAESLELGRLANVNPPELLRYDPTGERLDDVRFHPAWHLLMQGLCANRVHN
                     LAWEEEARKGSFVARAARFVLHAQVEAGTLCPVTMTFAATPLLQQALPEPFQNWLTPL
                     LSDRYDPHLAPGAQKRGLLIGMGMTEKQGGSDVLSNTTKAEKCSDGSYRLVGHKWFFS
                     VPQSDAHLVLAQAKGGLSCFFVPRFLPDGQRNAVRLERLKDKLGNRSNASSEAEFLDA
                     SGWLLGEEGEGVRQILRMGGLTRFDCALGSHGLMRRALSVALYHAHQRQTFGKNLIDQ
                     PLMRDVLSRMALVLEGQTALLFRLARAWDKRADPQEAAWARLFTPAAKFSVCKAGIPF
                     VAEAMEVLGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLAKQPGMFDLLA
                     EDFAQVKGQDRHFDRSWRQLQQKLRKPQEAQGREIAHQLFLLGAGSQMLRHASPPVAQ
                     AWCRMMLDTRGGTLMTEQVQSDLLLRATGRVG"
     gene            complement(575863..577794)
                     /locus_tag="ECL_RS02790"
                     /old_locus_tag="ECL_00581"
                     /db_xref="GeneID:9123090"
     CDS             complement(575863..577794)
                     /locus_tag="ECL_RS02790"
                     /old_locus_tag="ECL_00581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_013095297.1"
                     /db_xref="GeneID:9123090"
                     /translation="MITFFRRAGLGAKLSLLTGVSVATLFLLFTFLLSHKASQQLEAL
                     AVEDLHNQSTGMVDMVQMFNTSLSEEVESYTRLFTTFLPQPLSVDSNQLQTINGLSVP
                     LLKGGETGLHENNALSDDFLTRTGAISTLFVRSGNDFVRVATSLRKENGDRAMGTVLD
                     TASPAYAAVTKGEVYRGLALLFGKRYITQYQPFKNAEGQVIGIIFVGVDITHSWNVMR
                     EKILNRRLGDSGHFFVLDRSNGKTRGQFLFHSNREGQLPEWDSATQQQLLSNTPGTLE
                     RTSEGGRILKMAYTPLPGWNWTIVGEVDKSVLLSSVTTMRDRFLLAGVALSVLFAALF
                     VIIIRRMLTRPLRNVIHLARQYAAGDLRASLSVTRQDEVGQLIDAINGIGGGLQKIVL
                     QVREAAGEIHLGTNALASDTGEISEQINKQASSVEETSASMEQLAATVQQNAANMEQT
                     QQLVGETSRAVHQGGETVTHAVSTMDDIRDASKRIEDITRVIESIAFQTNILALNAAV
                     EAARAGEHGKGFAVVAQEVRALAARSANAVKEIEQLIGDTLNKVSEGHALSEQTRLAM
                     DAIIAHIDNINQLVTEINHASREQSAGIRQVNLAMTHIGEASHINADRVSRSEQTAQS
                     LREKGSHLTQLVSLFQLKN"
     gene            complement(577965..578240)
                     /locus_tag="ECL_RS02795"
                     /old_locus_tag="ECL_00582"
                     /db_xref="GeneID:9123091"
     CDS             complement(577965..578240)
                     /locus_tag="ECL_RS02795"
                     /old_locus_tag="ECL_00582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008502907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_139152684.1"
                     /db_xref="GeneID:9123091"
                     /translation="MKRTLALTSLLLSVGLVSTTAQSAEFASADCVTGLNEIGQISVN
                     NISGSPQDVERVVALKADEQGASWYRIIQMQEDNRSDHWRVQAILYV"
     gene            complement(578389..578718)
                     /gene="bsmA"
                     /locus_tag="ECL_RS02800"
                     /old_locus_tag="ECL_00583"
                     /db_xref="GeneID:9123092"
     CDS             complement(578389..578718)
                     /gene="bsmA"
                     /locus_tag="ECL_RS02800"
                     /old_locus_tag="ECL_00583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biofilm peroxide resistance protein BsmA"
                     /protein_id="WP_071830088.1"
                     /db_xref="GeneID:9123092"
                     /translation="MAIRKRDMVMRRFATLLLLVLLSGCSALQGTPQPAPPVADHPQE
                     IRRNQTEGLQRMGTVSALVRGSPDDAEESIKAQAAAAKADYYVIIMIDETIITGQWYS
                     QAILYRK"
     gene            578856..579578
                     /gene="yjfP"
                     /locus_tag="ECL_RS02805"
                     /old_locus_tag="ECL_00584"
                     /db_xref="GeneID:9123093"
     CDS             578856..579578
                     /gene="yjfP"
                     /locus_tag="ECL_RS02805"
                     /old_locus_tag="ECL_00584"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003830461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_013095300.1"
                     /db_xref="GeneID:9123093"
                     /translation="MIEIETRRLGNHEILHAIPAGKSAHPLPVVVFYHGFTSSKLVYS
                     YFAVALAQAGFRVVMPDAPDHGARFTGDEQVRLGQFWQILHGSLSEFAGLRDALYQAG
                     LVADQRLSVAGASMGGMTALGIMARHPEVTSVACLMGSGYFTSLSKTLFPPQDATEID
                     ALLAEWEVTRALPRLADRPLLLWHGDADDVVPPGETFRLQQALQREGLDGNLTCLWEA
                     GVRHRITPAALDATVDFFRQHL"
     gene            complement(579575..580330)
                     /gene="ulaR"
                     /locus_tag="ECL_RS02810"
                     /old_locus_tag="ECL_00585"
                     /db_xref="GeneID:9123094"
     CDS             complement(579575..580330)
                     /gene="ulaR"
                     /locus_tag="ECL_RS02810"
                     /old_locus_tag="ECL_00585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator UlaR"
                     /protein_id="WP_013095301.1"
                     /db_xref="GeneID:9123094"
                     /translation="MTEAQRHQILLELLAQTGFITVEKVIERLGISPATARRDINKLD
                     ESGKLKKVRNGAEAISQQRPRWTPMNIHQAQNHDEKVRIARAASQLVNPGESVVINCG
                     STAFLLGREMCGKPVQIITNYLPLANYLIDQEHESVVIMGGQYNKSQSITLSPQDSEN
                     SLYAGHWMFTSGKGLTADGLYKTDMLTAMAEQNMLNVVGKLVVLVDSSKVGERAGMLF
                     SRAEQIDMVITGKHANPEILQKLEDQGVKILRV"
     gene            complement(580441..581505)
                     /gene="ulaG"
                     /locus_tag="ECL_RS02815"
                     /old_locus_tag="ECL_00586"
                     /db_xref="GeneID:9123095"
     CDS             complement(580441..581505)
                     /gene="ulaG"
                     /locus_tag="ECL_RS02815"
                     /old_locus_tag="ECL_00586"
                     /EC_number="3.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003856017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ascorbate 6-phosphate lactonase"
                     /protein_id="WP_010427455.1"
                     /db_xref="GeneID:9123095"
                     /translation="MSKVNTITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLG
                     CTGIWLKSEGGANICVDFWCGTGKQSHGNPLMKKGHQMQRMAGVEKLQPNLRTTPFVL
                     DPFAIRQIDAVLSTHDHNDHIDVNVAAAVMQNCADDVPFIGPQTCVDLWIGWGVPKER
                     CIVMKPGDVVKIKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDERAVNYLFKTPG
                     GSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMAEALNTKV
                     VIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNLEYHY
                     PRGFDDCFTIEPDLPFKSFL"
     gene            581865..583265
                     /gene="ulaA"
                     /locus_tag="ECL_RS02820"
                     /old_locus_tag="ECL_00587"
                     /db_xref="GeneID:9123096"
     CDS             581865..583265
                     /gene="ulaA"
                     /locus_tag="ECL_RS02820"
                     /old_locus_tag="ECL_00587"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIC"
                     /protein_id="WP_013095302.1"
                     /db_xref="GeneID:9123096"
                     /translation="MEILYNVFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKG
                     TIKTIIGFMLLQAGSGILTSTFKPVVAKMSEVYGINGAISDTYASMMATIDRMGDAYS
                     WVGYAVLLALALNIIYVLLRRITGIRTIMLTGHIMFQQAGLIAVSLYIFGYPMWTTII
                     CTAVLVSLYWGITSNMMYKPTQEVTDGCGFSIGHQQQFAAWLAYKVAPYLGKKEDSVE
                     DLKLPGWLNIFHDNIVSTAIVMTIFFGAILLSFGIDVVQAMAGKTHWTVYILQTGFSF
                     AVAIFIITQGVRMFVAELSEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGT
                     IGQLIAVGILVGCGSSILIIPGFIPMFFSNATIGVFANHFGGWRAALKICLVMGMVEI
                     FGCVWAVKLTGMSAWMGMADWSILAPPMMQGFASVGLVFMAVIILIALAYMFFAGRSL
                     RAEEDAEKQTAEVSAH"
     gene            583278..583583
                     /gene="ulaB"
                     /locus_tag="ECL_RS02825"
                     /old_locus_tag="ECL_00588"
                     /db_xref="GeneID:9123097"
     CDS             583278..583583
                     /gene="ulaB"
                     /locus_tag="ECL_RS02825"
                     /old_locus_tag="ECL_00588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIB"
                     /protein_id="WP_004109091.1"
                     /db_xref="GeneID:9123097"
                     /translation="MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEY
                     KSELNGADIIIASTHIAGEISVSGNKYVVGVRNMLSPADFGPKLLEVIKAHFPQDVK"
     gene            583593..584060
                     /gene="ulaC"
                     /locus_tag="ECL_RS02830"
                     /old_locus_tag="ECL_00589"
                     /db_xref="GeneID:9123098"
     CDS             583593..584060
                     /gene="ulaC"
                     /locus_tag="ECL_RS02830"
                     /old_locus_tag="ECL_00589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS ascorbate transporter subunit IIA"
                     /protein_id="WP_013095304.1"
                     /db_xref="GeneID:9123098"
                     /translation="MKLRDSLAENNSILLQAEASTWQEAVKLSVDLLVKADVVEPRYY
                     QAILDGVAQHGPYFVIAPGLAMPHGRPEEGVKKTGFALVTLKTPLVFNHEDNDPVDIL
                     ITMAAVDANTHQEVGIMQIVNLFDDEANFDRLRACRTEQEVLDLIDNATAAAV"
     gene            584074..584724
                     /gene="ulaD"
                     /locus_tag="ECL_RS02835"
                     /old_locus_tag="ECL_00590"
                     /db_xref="GeneID:9123099"
     CDS             584074..584724
                     /gene="ulaD"
                     /locus_tag="ECL_RS02835"
                     /old_locus_tag="ECL_00590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-L-gulonate-6-phosphate decarboxylase
                     UlaD"
                     /protein_id="WP_013095305.1"
                     /db_xref="GeneID:9123099"
                     /translation="MSLPMLQVALDNQTLSDAYETTRLIAEEVDIIEVGTILCVGEGV
                     RAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVA
                     KEFNGDVQIELTGFWTWEQAQAWRDAGIQQVVYHRSRDAQAAGVAWGDADISAIKRLA
                     DMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAQLWG"
     gene            584734..585594
                     /locus_tag="ECL_RS02840"
                     /old_locus_tag="ECL_00591"
                     /db_xref="GeneID:9123100"
     CDS             584734..585594
                     /locus_tag="ECL_RS02840"
                     /old_locus_tag="ECL_00591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 3-epimerase"
                     /protein_id="WP_013095306.1"
                     /db_xref="GeneID:9123100"
                     /translation="MLSKQVPLGIYEKALPAGECWLERLKLAKQLGFDFVEMSVDETD
                     ERLSRLDWSQEQRLALVSAVAETGVRVPSMCLSAHRRFPLGSEDDTVRAQGLEIMRKA
                     IRFAQDVGIRVIQLAGYDVYYQEANDETRRRFRDGLKESVEMASRAQVTLAMEIMDYP
                     LMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELLAGMGHIVAVHVKDTRPG
                     VFKNVPFGTGVVDFERCFQTLKQAGYCGPYLIEMWSETSDDPAGEVANARDWVRERMA
                     RAGLLEAEYA"
     gene            585587..586273
                     /locus_tag="ECL_RS02845"
                     /old_locus_tag="ECL_00592"
                     /db_xref="GeneID:9123101"
     CDS             585587..586273
                     /locus_tag="ECL_RS02845"
                     /old_locus_tag="ECL_00592"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="WP_013095307.1"
                     /db_xref="GeneID:9123101"
                     /translation="MLKLKQQVFDANMDLPRYGLVTFTWGNVSAIDREQGLVVIKPSG
                     VAYDAMSPDDMVVVDLEGNVVDGKWRPSSDTATHLALYRRYPSLGGVVHTHSTHATAW
                     AQAGRAIPALGTTHADYFFGDIPCTRALTQTEVEGEYELNTGNVIIETLGESEPLHTP
                     GIVVYQHGPFAWGKDAHDAVHNAVVMEEVARMAWIARGINPQLQGIDDYLMNKHFMRK
                     HGPNAYYGQK"
     gene            complement(586413..586688)
                     /locus_tag="ECL_RS02850"
                     /old_locus_tag="ECL_00593"
                     /db_xref="GeneID:9123102"
     CDS             complement(586413..586688)
                     /locus_tag="ECL_RS02850"
                     /old_locus_tag="ECL_00593"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_013095308.1"
                     /db_xref="GeneID:9123102"
                     /translation="MKKIAIAVMAALLLSANAMAAIKIDSRQARNMDDVQSLGVIYIN
                     HHFATESEADQALNKETDAQGANYYHVILMREPGSNGNMHASADIYR"
     gene            587032..587427
                     /gene="rpsF"
                     /locus_tag="ECL_RS02855"
                     /old_locus_tag="ECL_00594"
                     /db_xref="GeneID:9123103"
     CDS             587032..587427
                     /gene="rpsF"
                     /locus_tag="ECL_RS02855"
                     /old_locus_tag="ECL_00594"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_003856034.1"
                     /db_xref="GeneID:9123103"
                     /translation="MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGTIHRLEDWGR
                     RQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPM
                     VKAKDERRERRDDFANETADDSDAGDSEE"
     gene            587434..587748
                     /gene="priB"
                     /locus_tag="ECL_RS02860"
                     /db_xref="GeneID:44145323"
     CDS             587434..587748
                     /gene="priB"
                     /locus_tag="ECL_RS02860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001315977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal replication protein N"
                     /protein_id="WP_008502895.1"
                     /db_xref="GeneID:44145323"
                     /translation="MTNRLALSGIVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHR
                     QAWCQMPVIISGHENQAITHSLTVGSAVIVQGFISCHKAKNGLSKMVLHAEQIDLIDS
                     GD"
     gene            587753..587980
                     /gene="rpsR"
                     /locus_tag="ECL_RS02865"
                     /old_locus_tag="ECL_00596"
                     /db_xref="GeneID:9123105"
     CDS             587753..587980
                     /gene="rpsR"
                     /locus_tag="ECL_RS02865"
                     /old_locus_tag="ECL_00596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012986941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_000135199.1"
                     /db_xref="GeneID:9123105"
                     /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRI
                     TGTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
     gene            588022..588471
                     /gene="rplI"
                     /locus_tag="ECL_RS02870"
                     /old_locus_tag="ECL_00597"
                     /db_xref="GeneID:9123106"
     CDS             588022..588471
                     /gene="rplI"
                     /locus_tag="ECL_RS02870"
                     /old_locus_tag="ECL_00597"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005134442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_008502894.1"
                     /db_xref="GeneID:9123106"
                     /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNV
                     EFFEARRAELEAKLADVLAAANARAEAINALGTVTIASKAGDEGKLFGSIGTRDIADA
                     VSAAGVKVAKSEVRLPNGVLRTTGEHEVDFQVHSEVFAKLVVNVVAE"
     gene            588623..589552
                     /locus_tag="ECL_RS02875"
                     /old_locus_tag="ECL_00598"
                     /db_xref="GeneID:9123107"
     CDS             588623..589552
                     /locus_tag="ECL_RS02875"
                     /old_locus_tag="ECL_00598"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006178998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_013095309.1"
                     /db_xref="GeneID:9123107"
                     /translation="METALSTPVFARRNVAYACATLCCLLWGSSYPAIKSGYELFQIA
                     TDDIPSKVVFAGYRFLFAGALLLLFALAQRKPIARLTPTQFGQLTILGLTQTTIQYTF
                     FYIGLAYTTGVNGSIMNATGTFFSVLLAHFIYHNDKLSYNKTLGCILGFAGVMLVNFH
                     SGIRDFRFVWNGDGFVVLAAFILSAATLYGKRISQTVDPTVMTGWQLGIGGLALVAGG
                     YATGGTLEVHSLTAVAVLGYLTLLSSVAFALWSALLKVNRVSMIAPFNFVIPVAGTVL
                     SAIFLGENILEIKYAIALVLVCSGIWWVNKRSA"
     gene            complement(589599..590243)
                     /locus_tag="ECL_RS02880"
                     /old_locus_tag="ECL_00599"
                     /db_xref="GeneID:9123108"
     CDS             complement(589599..590243)
                     /locus_tag="ECL_RS02880"
                     /old_locus_tag="ECL_00599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418627.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="opacity-associated protein OapA"
                     /protein_id="WP_013095310.1"
                     /db_xref="GeneID:9123108"
                     /translation="MPGRFELKPTLAKIWHAPDNFRIMDPLPPLHRRGIIIGALLMIV
                     GFLLPSGGDNVDTAPVTRNAQLDLQSQTRPQPDTQTMQTQLVTPSNDPGQVAPVEPEP
                     IQEEQPQEQAAAPSEPQTQQPTGIEQQWRSYRVEAGKTLAQLFRDHNLPPTDVYAMAQ
                     VEGAGKPLSNLQNGQMVQIRQNASGVVTGLTIDTGNGQQVLFTRQPDGSFIRAR"
     gene            590438..591097
                     /locus_tag="ECL_RS02885"
                     /old_locus_tag="ECL_00600"
                     /db_xref="GeneID:9123109"
     CDS             590438..591097
                     /locus_tag="ECL_RS02885"
                     /old_locus_tag="ECL_00600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463258.3"
                     /note="FKBP-type; rotamase; catalyzes the cis-trans
                     isomerization of proline imidic peptide bonds in
                     oligopeptides; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_085929690.1"
                     /db_xref="GeneID:9123109"
                     /translation="MLPATLNVMEGKPMTTPTFDTIEAQASYGIGLQVGQQLSESGLE
                     GLLPEALVAGIADALEGKQPAVPVDVVHRALREIHERADAVRRARFEEMAAEGVKYLE
                     ENREREGVNSTESGLQFRVINQGDGAIPARTDHVRVHYTGKLIDGTVFDSSVARGEPA
                     EFPVNGVIAGWIEALTLMPVGSKWELTIPHNLAYGERGAGASIPPFSTLVFEVELLEI
                     L"
     gene            591409..592818
                     /gene="cycA"
                     /locus_tag="ECL_RS02890"
                     /old_locus_tag="ECL_00601"
                     /gene_synonym="dagA"
                     /db_xref="GeneID:9123110"
     CDS             591409..592818
                     /gene="cycA"
                     /locus_tag="ECL_RS02890"
                     /old_locus_tag="ECL_00601"
                     /gene_synonym="dagA"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-serine/D-alanine/glycine transporter"
                     /protein_id="WP_013095311.1"
                     /db_xref="GeneID:9123110"
                     /translation="MVDQVKVAATEEATSEQSLRRNLTNRHIQLIAIGGAIGTGLFMG
                     SGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYF
                     TGWTYWFCWVVTGMADVVAITAYAQFWFPGLSDWVASLAVIVLLLSLNLATVKMFGEM
                     EFWFAMIKIVAIVALIVVGLVMVLTHFQSPTGVQASFTHLWNDGGWFPKGISGFFAGF
                     QIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPVRIIMFYVFALIIIMSVTPWSSV
                     VPSKSPFVELFVLVGLPAAASLINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPSA
                     FAKLSKRAVPAKGLTFSCMCLLGGVVMLYVNPSVIGAFTMITTVSAILFMFVWTIILC
                     SYLVYRKQRPHLHEKSIYKMPLGKLMCWVCMAFFAFVLVLLTLEDDTRQALIVTPLWF
                     IALGLGWLFIGKKRMAGVR"
     gene            complement(592914..593576)
                     /gene="ytfE"
                     /locus_tag="ECL_RS02895"
                     /old_locus_tag="ECL_00602"
                     /db_xref="GeneID:9123111"
     CDS             complement(592914..593576)
                     /gene="ytfE"
                     /locus_tag="ECL_RS02895"
                     /old_locus_tag="ECL_00602"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster repair protein YtfE"
                     /protein_id="WP_013095312.1"
                     /db_xref="GeneID:9123111"
                     /translation="MAFRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAASRK
                     ELDVEVIEAELALLAEQPINKEWRTAPLAEIIDHIIVRYHDRHREQLPELILQATKVE
                     RVHADKPSVPRGLAKYLTMLHEELTSHMMKEEQILFPMIKQGMGSQAMGPISVMESEH
                     DDAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALA
                     GK"
     gene            593821..595470
                     /locus_tag="ECL_RS02900"
                     /old_locus_tag="ECL_00603"
                     /db_xref="GeneID:9123112"
     CDS             593821..595470
                     /locus_tag="ECL_RS02900"
                     /old_locus_tag="ECL_00603"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006179006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tar ligand binding domain-containing protein"
                     /protein_id="WP_013095313.1"
                     /db_xref="GeneID:9123112"
                     /translation="MFKRIKVITLLISVLLVLGIMQLVSAGIFINALNNDKDNFTVSQ
                     LSSKNVAEFTDAWISLNQARVTLNRGMLRLQSSMASQINGGQLNELVNTAKNLLANAQ
                     SHYDKYYALPNTPGLDPNLANRLEEQYRNYSATLTQMNVLLSQGNLEEMFKQNAEQKQ
                     TAMQNVYREWREAQAVLTDKGIKDNESDYKRILWILSAVMLLVIIVIISSWIAMRRVL
                     LLPLQDVISHIRAIAAGDLTQPIHAEGKNEMAVLAQNVQEMQTALANTVGVVREGADT
                     IYTGAGEISAGSNDLSSRTEQQAASLEETAASMEQLTATVKQNADNARQASRLALDAS
                     STAKKGGNVVEGVVRTMDEIATSSSKIAQITNVIDGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRTLAQRSAQAAKEIKALIDDSGERVNAGSQLVNEAGATMAEIVNAVT
                     RVTDIMGEIASASDEQSRGIDQVGQAVAEMDRVTQQNASLVEESAAAAAALEDQAARL
                     NDAVAVFKIARSQAVKAAPAKTYAPKAQPVASASEANWETF"
     gene            complement(595533..596498)
                     /locus_tag="ECL_RS02905"
                     /old_locus_tag="ECL_00604"
                     /db_xref="GeneID:9123113"
     CDS             complement(595533..596498)
                     /locus_tag="ECL_RS02905"
                     /old_locus_tag="ECL_00604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DMT family transporter"
                     /protein_id="WP_013095314.1"
                     /db_xref="GeneID:9123113"
                     /translation="MISGVLYALLAGLMWGLIFVGPLIVPEYPAALQSTGRYLALGLI
                     ALPLAWLGRTRLRQLNRQDWMTALALTMMGNLIYYVCLASAIQRTGAPVSTMIIGTLP
                     VVIPVFANLLYSQRDGKLAWSKMVPALICTGVGLVCVNIAELRHGLADFSVWRYGSGI
                     GLAFISVACWAWYALRNARWLRENPDKHPMMWATAQALVTLPVSLVGYAGACLWSGQQ
                     QPDFALPFGPRPWVFVGLMIAIAVLCSWVGALCWNIASQKLPTVILGPLIVFETLAGL
                     LYTFLMRQSVPPLLTACGIVLLVMGVVMAVRAKPEKPMVVPASEM"
     gene            complement(596574..597398)
                     /locus_tag="ECL_RS02910"
                     /old_locus_tag="ECL_00605"
                     /db_xref="GeneID:9123114"
     CDS             complement(596574..597398)
                     /locus_tag="ECL_RS02910"
                     /old_locus_tag="ECL_00605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003830431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013095315.1"
                     /db_xref="GeneID:9123114"
                     /translation="MQGVPEQFSDERDSARFRHLAQLPGLELYHAHIADYAFEPHTHE
                     AFGIGTIETGAERFRYRGTQHLAAEKSVVTMNPDEIHTGESATEGGWRYRMVYIEPAL
                     LEEVTGLRHWWFSDVTRHDPLRSQQIGQLIYGLWHTQDPLAQKGLLLDLIETFQPLAH
                     HAPIIKEGAHRFERVREYLHDNYMHAVTLDELANVVSLSPYHFQRQFKAHFHVTPHQM
                     LMAIRLWRAKGFLTHGMPAAEVAAATGLTDQSHLTRAFTRRYGITPVRYQKQVIGR"
     gene            complement(597448..598452)
                     /locus_tag="ECL_RS02915"
                     /old_locus_tag="ECL_00606"
                     /db_xref="GeneID:9123115"
     CDS             complement(597448..598452)
                     /locus_tag="ECL_RS02915"
                     /old_locus_tag="ECL_00606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013811840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_044159536.1"
                     /db_xref="GeneID:9123115"
                     /translation="MLSSGLSLPIEMWKSAASSYLAEQKTNANTDTPPAKRSRFRLCR
                     PESILKVNTIGINSLPIRTHSGFSITADTTLADDRHYDVIYIPALWRNPRAVVRQQPE
                     LLAWLSEQAARGTRIAAVGTGCCFLAESGLLNGKPATTHWHYFRQFSRDYPSVKLQTK
                     HFLTQAENIYCAASVKALSDLTIHFIETIYGKRVATHTQRTFFHEIRSQFDRQCYSEE
                     NKPHPDEDIVQIQTWIKANCASDISMQNLADMAGMSLRNFNRRFKNATDMSPLQYLLT
                     ARIELAMNMLQSTNLCIQEIANAVGYEDIAHFNRQFKHKTTVSPGDYRKTVRAKMFSA
                     "
     gene            598669..600567
                     /locus_tag="ECL_RS02920"
                     /old_locus_tag="ECL_00608"
                     /db_xref="GeneID:9123117"
     CDS             598669..600567
                     /locus_tag="ECL_RS02920"
                     /old_locus_tag="ECL_00608"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004949500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="WP_013095318.1"
                     /db_xref="GeneID:9123117"
                     /translation="MVKLPVITAFGGYGPAGRSSSHHAFRRMVIESLSEEERQQTLLS
                     LAILMGLLKYDEGGYCDISGKRFTPDQAAATIKNEALEGSLIRKITDDNFDVDAIVSH
                     AKLNMASDENGFSFNISSRQLPQPLPQGWHAEELTDQRVRITVRGDMDCRIETLLRTE
                     VQAAGLLPQGFRPGDYYNSQFHPRALQMAVVGASDAINALGIPWRDIQAKISPDKLGI
                     YSGNIMGQLDEYGFGGMLQSRLKGHRVSAKQCPLGLNSMCADFLNAYVLGSVGHTSAT
                     LGACATFLYNLNAAVEDIKAGRIRMAVVGSAEAPVTSEVIEGFDAMGALATESKLRHI
                     DQTETADWRNSSRPFGNSCGFVIAESSQYIVLMDDELAMQLGAEIHGSVGNVFINADG
                     YKRSIASPGPGNYITMAKAVASAVSMVGLETVQKGSFIQAHGSSTPKNCVSEADIFDR
                     VAQAFSIHNWPVTAVKSYLGHSLGPASGDQLISCLGVFRYGILPGIKSVSHIAPQVNN
                     ARLHIPVQDCKLEDEQGQIAFINSKGFGGNNATGVVYSPKLTQQWLRKRYGEPAFADY
                     QQRNRQVQRQARAYDEAASHGELNVIYLFGQQGINEDDINIDMNGITIPGFEKPISFA
                     REKEYSDF"
     gene            complement(600782..601630)
                     /locus_tag="ECL_RS02925"
                     /old_locus_tag="ECL_00609"
                     /db_xref="GeneID:9123118"
     CDS             complement(600782..601630)
                     /locus_tag="ECL_RS02925"
                     /old_locus_tag="ECL_00609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_013095319.1"
                     /db_xref="GeneID:9123118"
                     /translation="MIAITGATGQLGRLVIEQLLKTVPANQIVAIVRNPAKAEALSQQ
                     GIVVRQGDYTDQAALTTALKGVKKLLLISSSEVGQRATQHQNVINAAKAAGVIFIAYT
                     SLLHADNSPLGLHVEHVATEKALATSSIPYALLRNGWYTENYLASAPPALEHGVFIGA
                     AGEGKIASATRADYAAAAAKVVSEEGHAGKVYELAGDSAWTLSELAAELSKQSGKPVV
                     YQNMSEADFAAALKSVGLPAGLADMLADSDVGASKGGLFDDSHTLSKLIGRPTTSLAE
                     SVKTIL"
     gene            601720..602100
                     /locus_tag="ECL_RS02930"
                     /old_locus_tag="ECL_00610"
                     /db_xref="GeneID:9123119"
     CDS             601720..602100
                     /locus_tag="ECL_RS02930"
                     /old_locus_tag="ECL_00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007721351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_013095320.1"
                     /db_xref="GeneID:9123119"
                     /translation="MTIPTLSEQMRDGNLFAEQCPSREVLKHVTSRWGVLILVALRER
                     THRFSDLRRKMGGVSEKMLAQSLQALEHDGFVDRVSYPVVPPHVEYSLTPLGVEVSEK
                     VAALADWIEVNTPKVMANRDERAA"
     gene            complement(602198..604141)
                     /locus_tag="ECL_RS02935"
                     /old_locus_tag="ECL_00611"
                     /db_xref="GeneID:9123120"
     CDS             complement(602198..604141)
                     /locus_tag="ECL_RS02935"
                     /old_locus_tag="ECL_00611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2',3'-cyclic-nucleotide
                     2'-phosphodiesterase/3'-nucleotidase"
                     /protein_id="WP_013095321.1"
                     /db_xref="GeneID:9123120"
                     /translation="MIKFSATLLATLIAASVQAATVDLRILETTDLHSNMMDFDYYKD
                     TPTEKFGLVRTASLINAARNEVKNSVLVDNGDLIQGSPLGDYMAAKGLKKGEIHPVYK
                     AMNTLDYIVGNLGNHEFNYGLKYLHDALAGAKFPYVNANIIDVKTKKPLFTPYLIKET
                     EVVDQDGKKQTLKIGYIGFVPPQIMTWDKANLTGKVTVNDITETARKYVPEMREKGAD
                     VVVVVAHSGLSADPYQVMAENSVYYLSEVPGVDAILFGHAHAVFPGKDFASIKGADID
                     KGTLNGVPAVMPGMWGDHLGVVDLVLNNDSGSWKVTGSKAEARPIYDAAAKKSLAAED
                     QKLLDVLKHDHDATREFVSKPIGKSADNMYSYLALIQDDPTVQVVNMAQKAYAEHFVQ
                     GDPDLANLPVLSAAAPFKVGGRKNDPASYVEVEKGHLTFRNAADLYLYPNTLVVVKAT
                     GKEVKEWLECSAGQFNQIDPKSSKPQSLINWDGFRTYNFDVIDGVDYQIDVTQPAKYD
                     GECQAINPQAERIKNLTFKGKPVDPAATFLVVTNNYRAYGGKFAGTGDSHIAFASPDE
                     NRSVLAAWISAESKKAGEIHPAVDNNWRLAPIHSDTPLDIRIETSPSDKAAAFIKEKA
                     QYPMKKVATDDIGFAIYQVDLSK"
     gene            604332..605072
                     /gene="cysQ"
                     /locus_tag="ECL_RS02940"
                     /old_locus_tag="ECL_00612"
                     /db_xref="GeneID:9123121"
     CDS             604332..605072
                     /gene="cysQ"
                     /locus_tag="ECL_RS02940"
                     /old_locus_tag="ECL_00612"
                     /EC_number="3.1.3.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="WP_013095322.1"
                     /db_xref="GeneID:9123121"
                     /translation="MLDKICQLARDAGDAIMQVYDGAQPMNVVSKADDSPVTAADIAA
                     HGVIMKGLQALTPEIPVLSEEAPQSWDERQHWQRYWLVDPLDGTKEFIKRNGEFTVNI
                     ALIDKGKAVLGVVYAPVMKVMYSAAEGKAWKEECGVRKPIQVRDARPPLVVISRSHSD
                     SELEEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGA
                     HVHDWQGKPLDYTPRESFLNPGFRVSLY"
     gene            complement(605066..605623)
                     /locus_tag="ECL_RS02945"
                     /old_locus_tag="ECL_00613"
                     /db_xref="GeneID:9123122"
     CDS             complement(605066..605623)
                     /locus_tag="ECL_RS02945"
                     /old_locus_tag="ECL_00613"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YtfJ family protein"
                     /protein_id="WP_013095323.1"
                     /db_xref="GeneID:9123122"
                     /translation="MTLRNILAAACLLLPLWASAHNIEKGQRVPPVGIADRGELILDN
                     DKFSYKPWNSAQLAGKVRVVQHIAGRTSAKEKNANLVEAIKAAKFPHDRYQTTTIVNT
                     DDAIPGSGMFVRSSLESNKKLYPWSQFIVDSNGVTRKAWQLEEESSAIIVLDKNGQVQ
                     WVKDGALTQEEVQQVVDLLHKLLAQ"
     gene            605948..606154
                     /locus_tag="ECL_RS02950"
                     /old_locus_tag="ECL_00614"
                     /db_xref="GeneID:9123123"
     CDS             605948..606154
                     /locus_tag="ECL_RS02950"
                     /old_locus_tag="ECL_00614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015966176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1107 domain-containing protein"
                     /protein_id="WP_008501430.1"
                     /db_xref="GeneID:9123123"
                     /translation="MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILVPKV
                     KDKQHLSVMSEVNRQVMRLQTEMA"
     gene            complement(606226..607563)
                     /locus_tag="ECL_RS02955"
                     /old_locus_tag="ECL_00615"
                     /db_xref="GeneID:9123124"
     CDS             complement(606226..607563)
                     /locus_tag="ECL_RS02955"
                     /old_locus_tag="ECL_00615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyC/CorC family transporter"
                     /protein_id="WP_013095324.1"
                     /db_xref="GeneID:9123124"
                     /translation="MLNSILVILCLIAVSAFFSISEISLAASRKIKLKLLADEGNINA
                     SRILKMQENPGTFFTVVQIGLNAVAILGGIVGDAAFSPAFYSLFVQYMSAELAEQMSF
                     ILSFSLVTGMFILFADLTPKRIGMIAPEAVALRIINPMRFCLFVFRPLVWFFNGLANV
                     IFRIFKLPMVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTG
                     RESVIWFDLHEDEQSLKNKVAEHPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLA
                     LNSGVQIRNTLIVPDTLTLSEALESFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMG
                     DLVGQGLEEQIVARDENSWLIDGATPIDDVMRVLDIDEFPQSGNYETIGGFMMFMLRK
                     IPKRTDSVKFSGYKFEVVDIDNYRIDQLLVTRIDNKPTVLVPKLPDAEEKVSA"
     gene            608095..609915
                     /locus_tag="ECL_RS02960"
                     /old_locus_tag="ECL_00616"
                     /pseudo
                     /db_xref="GeneID:9123125"
     CDS             608095..609915
                     /locus_tag="ECL_RS02960"
                     /old_locus_tag="ECL_00616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000780215.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /db_xref="GeneID:9123125"
     gene            complement(610146..611693)
                     /locus_tag="ECL_RS02965"
                     /old_locus_tag="ECL_00617"
                     /db_xref="GeneID:9123126"
     CDS             complement(610146..611693)
                     /locus_tag="ECL_RS02965"
                     /old_locus_tag="ECL_00617"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003839533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013095326.1"
                     /db_xref="GeneID:9123126"
                     /translation="MVKPTERRVGYGVALGYGITDLFGGGAFAIIGTWLLFFYTTYCG
                     LSVVEAGSIFAIARVIDALLSPIMGYITDNFGDTWLGRKFGRRRFFLLLSSPLMFLYA
                     LLWMTDMGYWYYLGTYLSIELLSAMVLVPWETLAAEMTNRYEERSRLSGVRMICSQLG
                     GFLAVSVPGVIMQFTGKDNPFTYTLTGLIFSCVFCIAVFITWYTTWEAKDVQQPSTFK
                     VDKQRSSGLINHLKYLVLDLFSSFRIRAFRLHIIIYIFSFTAMDVFGSVFTYYVVYCL
                     SQDAAAVSGWLSIAAFASVPGTYGFMLLLNRLNVSPSAALRLSYGGIFFVLVFLFTVY
                     LTKTQVPTLLFTAVFILLGATRAGLYYIPWNIYSFIPDIDEMVTQQRREGIFAGVMVL
                     TRKSTVAIAIMIIGLVLQESGFVKGGGAQPESALGAIIGLMIFATAALLAVSFFTTYK
                     FKLTRETHKLLLKEIARRKLGGDYRDCDANTRVVIKQLTGYEYDQVWGGDAARRAVNK
                     LNLSSIK"
     gene            complement(611776..612795)
                     /locus_tag="ECL_RS02970"
                     /old_locus_tag="ECL_00618"
                     /db_xref="GeneID:9123127"
     CDS             complement(611776..612795)
                     /locus_tag="ECL_RS02970"
                     /old_locus_tag="ECL_00618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003839535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_013095327.1"
                     /db_xref="GeneID:9123127"
                     /translation="MKLLNTAVIGAGAIHGCHVNALRQLPNVALRALADIDSVKGLKL
                     ALGYQCRFYQDYREMLLDDAIDVVHICTPHFEHKSMILAALAAGKHVFCEKPVGMNSS
                     ELVDITRAADQATGLLGVCYQNRLNPTSLRIRQALDEGELGKMLSIKAVLTWSRSGAY
                     YTQSPWRGRLATEGGSLLINQAIHTLDLMQWFAGGVTRVKGVVDSGELADVTEGEDSA
                     MATLHFANGARGLFYASNCNTTDSPLLMEIHCEQGSLLLNDNTLWRVTPGERVRLTCD
                     DSPDGSVKSYWGLGHQQAIRRFYQAITHPGYTDYTDIREAGKSLTLVEAIYRSSQLRQ
                     WIEIN"
     gene            complement(612808..613875)
                     /locus_tag="ECL_RS02975"
                     /old_locus_tag="ECL_00619"
                     /db_xref="GeneID:9123128"
     CDS             complement(612808..613875)
                     /locus_tag="ECL_RS02975"
                     /old_locus_tag="ECL_00619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_013095328.1"
                     /db_xref="GeneID:9123128"
                     /translation="MNKNDGMNYAPVGKPQPVVREGEFVFAAAALDHGHIYGMSNGLI
                     EAGATLKWVYDPDPAKVDKFIQQYPQARVADSLDVILADDEVRLVAGAAIPAERCALG
                     LKAMAAGKDYFTDKAPLTTLEQLADAKAMVEKTGRKYAVYYSERLHVESAVFAGQLVQ
                     QGAIGRVVQTLGTGPHREGTGRPDWFYDRRYFGGILCDIGSHQIEQFLFYTGNSDATV
                     VASQVRNVKHPQYPAFEDFGDAMLKGENGASGYFRCDWFTPDGLSTWGDGRLTLLGTE
                     GYIEIRKYVDLTRGEQDVVYLVNNEGEFRYPVAGQVGFPFFGELILDCLHRTEHAMTQ
                     AHAFKAAELCVKAQMLANATA"
     gene            complement(613872..615056)
                     /locus_tag="ECL_RS02980"
                     /old_locus_tag="ECL_00620"
                     /db_xref="GeneID:9123129"
     CDS             complement(613872..615056)
                     /locus_tag="ECL_RS02980"
                     /old_locus_tag="ECL_00620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_013095329.1"
                     /db_xref="GeneID:9123129"
                     /translation="MLNVAIVGTGNISHNHIQGYLQFGQRCRIVALVDIYPEKAHEKK
                     ARYNLTDARVYESHEQMLASEPDIDIVDVCTPPHVHAEISINALNAGCHVLCEKPMAA
                     SLEECDAMIAAQQASGKLLAIIAQNRFTDAFWRLKAALDSGLAGKVCHAQVDSFWWRG
                     HCYYDLWWRGTWEKEGGGCTLNHAVHHIDAIQWMLGFPSEVVAMMTNVAHDNAEVEDL
                     SAAIFKYPSGALTQLTASVVHHGEDQKIIIQGEKARISAPWQAFASVSADNGFPQEDR
                     DRQREAQLNAVFHETPKLEWTLHTGQINDLLYAIEHGTAPLVDGLQGKRSLELITAIY
                     KSAVTRCVVSLPIQRDDPFYRTGGTNALAPRFYEKSASVANFSEVGAIPLGKDLDEGV
                     TP"
     gene            complement(615073..616224)
                     /locus_tag="ECL_RS02985"
                     /old_locus_tag="ECL_00621"
                     /db_xref="GeneID:9123130"
     CDS             complement(615073..616224)
                     /locus_tag="ECL_RS02985"
                     /old_locus_tag="ECL_00621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009675662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_013095330.1"
                     /db_xref="GeneID:9123130"
                     /translation="MEKVRFGIIGIGNIGTVHARYLLAGTVSDACLAAVCDNAPEKHP
                     AIRQLVGSLPLFSDAQEMLQSGLIDAVIVATPHYEHPRLSMLAMRHGIHTLCEKPAGV
                     YTAQVQEMNACARTCDVVFGIMYNQRPNPLYQKVKDLIDSGELGEIRRSNWIITNWYR
                     SQSYYNSGGWRATWKGEGGGVLLNQDPHQLDLWQWLVGMPIRLRAFCQFGKHRDIEVE
                     DEVTAYAEYANGATGVFITTVAETPGTNRLEIVGDRGKVVVEEGKLRYWRLRESETAF
                     NARWQNGFGEPECWEVTLPVGPECSEHHVITANFCGAILRGEPLIAPGLEGIHGLTLS
                     NAMHLSTWTDDWVDLPLNEKQYLRLLQQRISTSVAKETASVTLDASGTW"
     gene            616417..617475
                     /locus_tag="ECL_RS02990"
                     /old_locus_tag="ECL_00622"
                     /db_xref="GeneID:9123131"
     CDS             616417..617475
                     /locus_tag="ECL_RS02990"
                     /old_locus_tag="ECL_00622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_029882373.1"
                     /db_xref="GeneID:9123131"
                     /translation="MPGRLKMEEIATLTGYSVSTVSRVLSGKSYASDKARDAIVRTAR
                     ELGVLEAMASGRLLINGIAVFAPERTFQGRGDIFYLEVTKGIAEACAPHNVWVSCCGL
                     EEQHADVKLFMEKASHKNINAIIIIGTDDSTIFKLASTLNKPCVLINSVDRDRVLDAV
                     SPDHRAIGFTAMQYLFEQGHRRVLTLTCLRRETLYARLDGIKEAYRHFHVAFDPQRDL
                     LVTEWFTAEEAERALDAWLLSHDRSQWPEVIFPNSTSMTEGVIRALTRHGLRIPEDIS
                     LITTDFAWNLAHRLEKPITGVTVPCRELGIEAVHLLQTRLNRPQAPVYNLLLQGKVMD
                     YGSVSNATRHAARVALDQ"
     gene            complement(617476..618117)
                     /gene="msrA"
                     /locus_tag="ECL_RS02995"
                     /old_locus_tag="ECL_00623"
                     /db_xref="GeneID:9123132"
     CDS             complement(617476..618117)
                     /gene="msrA"
                     /locus_tag="ECL_RS02995"
                     /old_locus_tag="ECL_00623"
                     /EC_number="1.8.4.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase MsrA"
                     /protein_id="WP_014830428.1"
                     /db_xref="GeneID:9123132"
                     /translation="MSLFDKKHLVSQADALPGRNTPMPVATLHAVNGHSMTNVPEGME
                     IALFAMGCFWGVERLYWQLPGVYSTAAGYTGGYTPNPTYREVCSGETGHAEAVRVVYD
                     PSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAIYPLTPEQEAAALASKERFQQA
                     MRDAGDTREVTTEITTAKPFYYAEDDHQQYLHKNPYGYCGIGGIGVCLPPQLA"
     gene            618343..620076
                     /gene="tamA"
                     /locus_tag="ECL_RS03000"
                     /old_locus_tag="ECL_00624"
                     /db_xref="GeneID:9123133"
     CDS             618343..620076
                     /gene="tamA"
                     /locus_tag="ECL_RS03000"
                     /old_locus_tag="ECL_00624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter assembly complex protein TamA"
                     /protein_id="WP_013095333.1"
                     /db_xref="GeneID:9123133"
                     /translation="MTKIRQLCLVSVLLTSGVASAANVRLQVEGLSGALEKNVRAQLS
                     TIESDEVTPDRRFRARVDDAIREGLKALGYYEPTIDFDLRPPPKKGRQVLIARVSPGE
                     PVLIGGTNVVLRGGARTDRDYLDLLSTRPKIGTVLNHGDYDSFKKSLTSVSLRKGYFD
                     SQFNKSQLGIALGRRQAFWDIDYDSGERYRFGDVTFEGSQIREEYLQNLVPFKKGDYY
                     HSRDLAELNRRLSATGWFNSVVVAPEFEKARKTKVLPLHGVVSPRTENTIETGAGYST
                     DVGPRVRATWKKPWMNSYGHSLTTSASISAPEQQLDFSYKIPLLKNPLEQYYLVQGGF
                     KRTDLNDTESDSTTLAVSRFWDLSSGWQRAINLRWSLDHFTQANVTNTTMLLYPGVMI
                     SRTRSRGGLMPTWGDSQRYSIDYSNTMWGSDVDFSVIQAQNVWIRTLYDKHRFVMRGN
                     LGWIETGDFDKVPPDLRFFAGGDRSIRGYKYKSIAPKDDDGKLIGASKLATGSLEYQY
                     NVSGKWWGAMFVDGGEAVSDIRRSDFKTGAGVGVRWQSPVGPIKLDFAVPVGDKEEHG
                     LQFYIGLGPEL"
     gene            620073..623849
                     /gene="tamB"
                     /locus_tag="ECL_RS03005"
                     /old_locus_tag="ECL_00625"
                     /db_xref="GeneID:9123134"
     CDS             620073..623849
                     /gene="tamB"
                     /locus_tag="ECL_RS03005"
                     /old_locus_tag="ECL_00625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter assembly complex protein TamB"
                     /protein_id="WP_013095334.1"
                     /db_xref="GeneID:9123134"
                     /translation="MSLWKKISLGVLIFIVLLLGTVAFLVGTTTGLHLLFNAANRWVP
                     GLEIGQVTGGWRDLRLKNIRYEQPGVAVNAGEFHLAVRLGCLRDSKLCVNDLSLKDVN
                     VAIDSEKMPKSAPVEEEDSGPLNLSTPYPIALYRVALDNVNVKIDDTTVSVMDFTSGL
                     RWQEKNLTLTPTTLQGLLIALPKVADVAQEEIVEPKIQNPQPEEKPLGETLKDLFSKP
                     VLPEMTDVHLPLNLNIEAFKGEQLRLTGDTDLTVYNMLLKVSSIDGNMKLDALDIDTN
                     QGSVNASGHALLRDNWPVDITLNSALNIDPLKGEKVKVKVGGALRDKLDVGVNLSGPV
                     DMVLRAQTQLAEAGLPLNLEVVSKQLYWPFTGEKQFQADDLKLKLSGKMTDYTLSFRT
                     AVKGQDVPPATITLDAKGNEQQVNLDKLTVAALEGKTELTALLDWQQAISWRGELKLS
                     GINTAKEVPDWPSKLDGLIKTRGSLYGGTWQMDVPEIKLTGNVKQNKVNVEGSLKGNS
                     YLQWVIPGLHVALGRNTADIKGELGVKDLNLDATIDAPNLDNALPGLGGTAKGLLKVR
                     GTVDAPQLLADITASNLRWQELSIARVRVDGDVKSTDQIGGNLNLRVERISQPDVNIN
                     LVTLDAKGNEKQHDLQLRVQGEPVSGQLHLTGSFDRKAERWKGTLDNTRFNTPVGPLV
                     LSRAIALDYRNAEQKISIGPHCWTNPNAELCVPQTIDAGAEGRAQITLNRFDLAMLKP
                     FMPDTTQASGVFSGKADVAWDTTKDGLPQGSVTLSGRNVKVTQDVNNAPLPVAFDTLN
                     LSADLHNNRAELGWLIRLTNNGQFDGKVQITDPQGRRNLGGNVSIRNFNLAMVNPIFS
                     RGEKAAGMLNANLRLAGNAQSPQLFGQMQLNGVDIDGNFMPFDMQPSHITMNFNGMSS
                     TLNGSVLTQQGQINLSGDADWSQLDNWRARIAAKGSKVRITVPPMVRLDVSPDIVFEA
                     TPSLFTLDGNVDVPWARIVVHEVPESAVGVSSDEVMLDDNLKPINQQSAGIPINSNLT
                     VHVGNNVRLNAFGLKARLTGDLKVAQDRQGLGLNGQINIPEGRFHAYGQDLIVRKGEL
                     LFSGPPDQPLLNIEAIRNPEATENDVIAGVRVTGSADEPKAEIFSDPAMSQQEALSYL
                     LRGQGLDSGQSDSAAMTSMLVGLGVAQSGQVVGKIGETFGVSNLALDTQGVGDSSQVV
                     VSGYVLPGLQVKYGVGIFDSLATLTLRYRLMPKLYLEAVSGVDQALDLLYQFEF"
     gene            623852..624196
                     /locus_tag="ECL_RS03010"
                     /old_locus_tag="ECL_00626"
                     /db_xref="GeneID:9123135"
     CDS             623852..624196
                     /locus_tag="ECL_RS03010"
                     /old_locus_tag="ECL_00626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012907370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylcyclotransferase"
                     /protein_id="WP_028027890.1"
                     /db_xref="GeneID:9123135"
                     /translation="MRIFVYGSLRTKQGNSHWMTNALLLGNYNIENYQLYSLGHYPGA
                     VPGEGTVHGEVYRIDNATLAELDALRTRGGEYARQLIQTPYGSAWMYVYQRPVEGLTR
                     IVSGNWLDRDQY"
     gene            complement(624509..624979)
                     /locus_tag="ECL_RS03015"
                     /old_locus_tag="ECL_00628"
                     /db_xref="GeneID:9123137"
     CDS             complement(624509..624979)
                     /locus_tag="ECL_RS03015"
                     /old_locus_tag="ECL_00628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095337.1"
                     /db_xref="GeneID:9123137"
                     /translation="MNKKTHIVSLFILIIAAFIFGRSTYTEYLAWYYGSNNLIFSEVN
                     SALLSSLCNGFFFVLSACIIYASLTLLKRIPRNIVVSCLLQFCINIGLYTLFVAVERG
                     YSKLHTLGPGATDITYGYFLGALLTSTLLTVAIVSVIHAKFLSSKHKDGLHKGV"
     gene            complement(624976..625560)
                     /locus_tag="ECL_RS03020"
                     /old_locus_tag="ECL_00629"
                     /db_xref="GeneID:9123138"
     CDS             complement(624976..625560)
                     /locus_tag="ECL_RS03020"
                     /old_locus_tag="ECL_00629"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020882914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095338.1"
                     /db_xref="GeneID:9123138"
                     /translation="MSSINIDVARPTGIYFIIERLYSRDGLMPSFGEISPSLTQVHRT
                     VIQLKRKQDMFMDGVKVIPKDITLWQQIKYITGSKVTTKDTDTLVYTTDFIGSLVATT
                     PLGNIELENIPRFLTTESIHSLPQAVSYGRDPIPQVLLYGRKDIVFFMDNGGKGTPTA
                     IAKYNHNTRDLAIIKDQLEASKTMKELLSKGAKL"
     gene            complement(625779..626309)
                     /gene="ppa"
                     /locus_tag="ECL_RS03025"
                     /old_locus_tag="ECL_00630"
                     /db_xref="GeneID:9123139"
     CDS             complement(625779..626309)
                     /gene="ppa"
                     /locus_tag="ECL_RS03025"
                     /old_locus_tag="ECL_00630"
                     /EC_number="3.6.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002434187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic diphosphatase"
                     /protein_id="WP_008501423.1"
                     /db_xref="GeneID:9123139"
                     /translation="MSLLNVPAGKELPEDIYVVIEIPANADPIKYEVDKESGALFVDR
                     FMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGAVIRCRPVGVLKMTDESGE
                     DAKLVAVPHTKLSKEYDHIKDVNDLPELLKAQITHFFEHYKDLEKGKWVKVDGWDNAE
                     AAKAEIIASFERAAKK"
     gene            626619..627575
                     /gene="ytfQ"
                     /locus_tag="ECL_RS03030"
                     /old_locus_tag="ECL_00631"
                     /db_xref="GeneID:9123140"
     CDS             626619..627575
                     /gene="ytfQ"
                     /locus_tag="ECL_RS03030"
                     /old_locus_tag="ECL_00631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005134480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactofuranose ABC transporter
                     substrate-binding protein YtfQ"
                     /protein_id="WP_044158919.1"
                     /db_xref="GeneID:9123140"
                     /translation="MWKRLLLVTAVSAAMSSMAMAAPLTVGFSQVGSESGWRAAETNV
                     AKSEAQKRGITLKIADGQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKD
                     AEIPVFLLDRSIDVKDKSLYMTTVTANNVLEGQLIGDWLVKQVDGKPCNVVELQGTVG
                     ASVAIDRKKGFAEAISKAPNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYA
                     HNDDMVIGAIQAIKEAGLKPGKDILTGSIDGVPDIYKAMIDGEANASVELTPNMAGPA
                     FDALEKFKKDGTMPEKVTVTKSTLYLPDTAKEELEKKKNMGY"
     gene            627682..629184
                     /locus_tag="ECL_RS03035"
                     /old_locus_tag="ECL_00632"
                     /db_xref="GeneID:9123141"
     CDS             627682..629184
                     /locus_tag="ECL_RS03035"
                     /old_locus_tag="ECL_00632"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_013095340.1"
                     /db_xref="GeneID:9123141"
                     /translation="MTTEQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGEN
                     GAGKSTLIKALTGVYHADRGTIWLEGNAISPKNTAHAQQLGIGTVYQEVNLLPNMSVA
                     DNLFIGREPRRFGLLRRKEMEARATKLMASYGFSLDVREPLNRFSVAMQQIVAICRAI
                     DLSAKVLILDEPTASLDTQEVEMLFTLMRQLRNQGVSLIFVTHFLDQVYEVSDRITVL
                     RNGSFVGCRETRELPQIELVKMMLGRELESNALQRAGRTLLSEKPVAAFSDFGKKGVI
                     SPFNLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTAQIKGKPQTLRSPHQASC
                     LGVGFCPEDRKTDGIIAAASVRENIILALQAQRGWLRPIPRKEQNAIAERFIRQLGIR
                     TPSAEQPIEFLSGGNQQKVLLSRWLLTKPQFLILDEPTRGIDVGAHAEIIRLIETLCA
                     DGLALLVISSELEELVGYADRVIIMRDRKQVAEIPLDKLSVPAIMNAIAA"
     gene            629195..630220
                     /locus_tag="ECL_RS03040"
                     /old_locus_tag="ECL_00633"
                     /pseudo
                     /db_xref="GeneID:9123142"
     CDS             629195..630220
                     /locus_tag="ECL_RS03040"
                     /old_locus_tag="ECL_00633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224767.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /db_xref="GeneID:9123142"
     gene            630207..631208
                     /gene="yjfF"
                     /locus_tag="ECL_RS03045"
                     /old_locus_tag="ECL_00634"
                     /db_xref="GeneID:9123143"
     CDS             630207..631208
                     /gene="yjfF"
                     /locus_tag="ECL_RS03045"
                     /old_locus_tag="ECL_00634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003025736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease YjfF"
                     /protein_id="WP_014830436.1"
                     /db_xref="GeneID:9123143"
                     /translation="MIKRNLPLMITLGVFVLGYLYCLTQFPGFASTRVICNILTDNAF
                     LGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKAIGFWGISPLVAFPLVLVMGCAFG
                     AFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPVYDTLSSLAWKIPGGG
                     RLSAMGLLMLGVVVIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLST
                     GLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQG
                     LIQTYINFDGTLSSWWTKIAIGILLFIFIALQRGLTVLWENRQSSPVTRVNTSVTER"
     gene            631302..632873
                     /locus_tag="ECL_RS03050"
                     /old_locus_tag="ECL_00635"
                     /db_xref="GeneID:9123144"
     CDS             631302..632873
                     /locus_tag="ECL_RS03050"
                     /old_locus_tag="ECL_00635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tar ligand binding domain-containing protein"
                     /protein_id="WP_013095343.1"
                     /db_xref="GeneID:9123144"
                     /translation="MLKTLSIRTGLLSLLAVMTLLLLIVSGIGIYALTQSSSSLQRIN
                     HLQGEQMVQLNSGYTLILRARNEAGQAVRMMEIGLLDDAAKSVKSINQEIALAQKTLK
                     GVIDAGVADPQGQQLLDKVAASLAAYNQQGINPMLKALNEQSADSYYDLLESKLIPVA
                     KQFDNDMQAFQMWSDARGKAEVSAVQSSKTRVLVLIVVAALLTAGIIVLAWLVLRHML
                     LKPLSASIAQLENVAAGDLTHTLNAPASQEFNRLNAAIEGMRQSLMHSVLRVRDASSQ
                     IDTGSRELTAGNRDLAERTESTATSLEQTAASMEEITATVKLNADNAEQAHQLAKSVS
                     DTADHGSEMVCYVIEKMRDISGSSARIADILSVIDGIAFQTNILALNASVEAARAGEQ
                     GRGFAVVAGEVRNLASRSADAAKEIRSLISDSQTHVNEGSELAQQAGETMDEIATEVL
                     RMTKLMREIATASQEQSRGIEQVNIAVNQMDETAQQNAALVQQSSAATRSLEEQSRQL
                     MEAMSSFKLTTQSVA"
     gene            complement(632841..633203)
                     /locus_tag="ECL_RS03055"
                     /old_locus_tag="ECL_00636"
                     /db_xref="GeneID:9123145"
     CDS             complement(632841..633203)
                     /locus_tag="ECL_RS03055"
                     /old_locus_tag="ECL_00636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014068664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013095344.1"
                     /db_xref="GeneID:9123145"
                     /translation="MTKNYSRANTGIDLNLIPVFIEVVRCGSMAKASVRLEMSRPAVS
                     LALKRFSQLFAEPLFIRKGLYLEPTEKALTLTHHLEILLGNIHDNISAINLSENNTLV
                     QNVQGRGILCDTLRRQFK"
     gene            complement(633349..634347)
                     /gene="fbp"
                     /locus_tag="ECL_RS03060"
                     /old_locus_tag="ECL_00637"
                     /db_xref="GeneID:9123146"
     CDS             complement(633349..634347)
                     /gene="fbp"
                     /locus_tag="ECL_RS03060"
                     /old_locus_tag="ECL_00637"
                     /EC_number="3.1.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016233757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1 fructose-bisphosphatase"
                     /protein_id="WP_013095345.1"
                     /db_xref="GeneID:9123146"
                     /translation="MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAG
                     LVDILGASGAENVQGEVQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEH
                     AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGSQQVAAGYVV
                     YGSSTMLVYTTGCGVHAFTYDPSLGVFCLCQERMRFPEKGNTYSINEGNYIKFPTGVK
                     KYIKFCQEEDKATQRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYEC
                     NPMAFLAEQAGGKASDGKERILDIVPESLHQRRSFFVGNNHMVEDVERFIREYPDA"
     gene            634545..635918
                     /gene="mpl"
                     /locus_tag="ECL_RS03065"
                     /old_locus_tag="ECL_00638"
                     /db_xref="GeneID:9123147"
     CDS             634545..635918
                     /gene="mpl"
                     /locus_tag="ECL_RS03065"
                     /old_locus_tag="ECL_00638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_013095346.1"
                     /db_xref="GeneID:9123147"
                     /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLEK
                     QGISLIQGYDASQLDPAPDLVIIGNAMTRGNPCVEAVLERNIPFMSGPQWLHDFVLRD
                     RWVVAVAGTHGKTTTAGMATWILEACGYKPGFVIGGVPGNFDVSARLGESPFFVIEAD
                     EYDCAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRII
                     LPENDINLKQTMAMGCWSEQELVGEQGHWQAKKLNVDASEWEVWLDGEKVGEVKWGLV
                     GEHNMHNGLMAIAAARHVGVQPADAANALGSFINARRRLELRGEAHGVTVYDDFAHHP
                     TAILATLAALRGKVGGTARILAVLEPRSNTMKMGICKDDLAPSLGRADEVFLLQPQHI
                     PWQVAEVADACIQPAHWSADVDALADMVVKAAQPGDHILVMSNGGFGGIHQKLLDGLA
                     KKAEAAE"
     gene            complement(636021..636572)
                     /locus_tag="ECL_RS03070"
                     /old_locus_tag="ECL_00639"
                     /db_xref="GeneID:9123148"
     CDS             complement(636021..636572)
                     /locus_tag="ECL_RS03070"
                     /old_locus_tag="ECL_00639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated protein"
                     /protein_id="WP_008501414.1"
                     /db_xref="GeneID:9123148"
                     /translation="MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKQLGA
                     EMVELGKNALDKIPLDQDLRDAIELAQKIKKEGRRRQLQLIGKMLRQRDVDPIRQALD
                     KLKNRHNQQVALFHKLEQIRDRLIEQGDDAVPEVLNLWPDADRQQLRSLIRNAKKEKE
                     GNKPPKSARLIFQYLRELSENEE"
     gene            636668..638020
                     /gene="pmbA"
                     /locus_tag="ECL_RS03075"
                     /old_locus_tag="ECL_00640"
                     /db_xref="GeneID:9123149"
     CDS             636668..638020
                     /gene="pmbA"
                     /locus_tag="ECL_RS03075"
                     /old_locus_tag="ECL_00640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease PmbA"
                     /protein_id="WP_032618803.1"
                     /db_xref="GeneID:9123149"
                     /translation="MAFAMKVTSQVEAQRKILEEAVSTALTLASGKSDGAEVAVSKTT
                     GISVSTRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSPDAIARTVQAALDIARY
                     TSPDPYAGVADKDLLAFDAPDLDLFHPAEVTPDEAIELAARAEQASLQADKRITNTEG
                     GSFNSHYGIKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYAYTIGRALGDLQS
                     PEWVGKACAERTLSRLSPRKLSTMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFL
                     LDSLGKQILPEWLTIEEHPHLLKGLASTPFDSEGVRTERRDIVKDGILTQWLLTNYSA
                     RKLGLKSTGHAGGIHNWRIAGQGLNFEQMLKEMGTGLVVTELMGQGVSGITGDYSRGA
                     AGFWVENGEIQYPVSEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMKIAGQ
                     "
     gene            638061..638447
                     /gene="cybC"
                     /locus_tag="ECL_RS03080"
                     /old_locus_tag="ECL_00641"
                     /db_xref="GeneID:9123150"
     CDS             638061..638447
                     /gene="cybC"
                     /locus_tag="ECL_RS03080"
                     /old_locus_tag="ECL_00641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b562"
                     /protein_id="WP_013095348.1"
                     /db_xref="GeneID:9123150"
                     /translation="MRKHLLAIVAASTLVLGSSAFAADLEDNMDILSQNLKVVQKTDN
                     AAEMKSALTKMREAALDAQKATPPKLESKAADSAEMKDYRHGFDVLVGQIDGALKLAN
                     EGKVKEAQAAADQFVATRNTYHKKYR"
     gene            complement(638517..638672)
                     /locus_tag="ECL_RS03085"
                     /db_xref="GeneID:44145324"
     CDS             complement(638517..638672)
                     /locus_tag="ECL_RS03085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hok/Gef family protein"
                     /protein_id="WP_020688727.1"
                     /db_xref="GeneID:44145324"
                     /translation="MKRQSPIIRVLMIIALTIIILTLVTRKTLCEIRFRNGSLEVTAR
                     MECRSGQ"
     gene            639089..639427
                     /locus_tag="ECL_RS03090"
                     /old_locus_tag="ECL_00642"
                     /db_xref="GeneID:9123151"
     CDS             639089..639427
                     /locus_tag="ECL_RS03090"
                     /old_locus_tag="ECL_00642"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine dehydrogenase"
                     /protein_id="WP_109455529.1"
                     /db_xref="GeneID:9123151"
                     /translation="MSNGAVMNDVGDHAEQTEKLANTMLQQVYALLARHNIIPNAVQE
                     QMLTSHVRAMAHRSVTGEPLPEVEAELFDEISPDSMRLAREVVAHFGNLPDEEAWLLS
                     VHFEVAKDNL"
     gene            639438..639800
                     /locus_tag="ECL_RS03095"
                     /old_locus_tag="ECL_00643"
                     /db_xref="GeneID:9123152"
     CDS             639438..639800
                     /locus_tag="ECL_RS03095"
                     /old_locus_tag="ECL_00643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006179053.1"
                     /db_xref="GeneID:9123152"
                     /translation="MEQITVVIGDRLGKGQKVAAGVEKAGGRAVVVPGMAADMKLGDV
                     MKAENATFGISFCGSGGAGAITAQTKYGYKAKYGMRSVDEGVTAINEGCNVLGFGFMD
                     KEELGERLVQAWQKKHGA"
     gene            639803..640102
                     /locus_tag="ECL_RS03100"
                     /old_locus_tag="ECL_00644"
                     /db_xref="GeneID:9123153"
     CDS             639803..640102
                     /locus_tag="ECL_RS03100"
                     /old_locus_tag="ECL_00644"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005134212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4312 family protein"
                     /protein_id="WP_006810338.1"
                     /db_xref="GeneID:9123153"
                     /translation="MKEQFTTTVRVKGKGDAKARAFADALNHVQAAVMKASPHILLRI
                     EPQDVQVVQAQEAVRKEAFLFFFLRRERRTYSVELDVTVNVTAINLDQVDFVTQR"
     gene            640125..640901
                     /locus_tag="ECL_RS03105"
                     /old_locus_tag="ECL_00645"
                     /db_xref="GeneID:9123154"
     CDS             640125..640901
                     /locus_tag="ECL_RS03105"
                     /old_locus_tag="ECL_00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019080069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4311 domain-containing protein"
                     /protein_id="WP_006810337.1"
                     /db_xref="GeneID:9123154"
                     /translation="MFLIILIKSLIIGGLVGVGVGAGAARMFHAPTTQGMGAFRTLGE
                     LNSCEGDPASHFSFGLGFFFNAWASSVAAGAFTQDVDHRIIPNWGAAALMIKNRNVGE
                     TLHDPRKMAIACGIIGMIVVTFLNLTASSVPAALQVTAVKVLVPAANLLVNTVMPVIF
                     WLAAIDAGKKSGFWATIFGGAAQLIMGNAVPGLVLGILIGKGVEESGWNHVTKVMMAA
                     IVLLFVLSGFFRGFDMKMIESFHLTVPNWLDMIHNSLSGK"
     gene            640915..641556
                     /locus_tag="ECL_RS03110"
                     /old_locus_tag="ECL_00646"
                     /db_xref="GeneID:9123155"
     CDS             640915..641556
                     /locus_tag="ECL_RS03110"
                     /old_locus_tag="ECL_00646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4310 family protein"
                     /protein_id="WP_013095350.1"
                     /db_xref="GeneID:9123155"
                     /translation="MEQNKGFWYADWSFPIFVGLLSSGVFAGTHMYYLYGIGAFNEVA
                     FVAMLKAGIDTGVYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALLLG
                     AGIMFPVTNFIASLITGLVIGLAIGYVIILARKFTINQSNSTYGADVMMGAGNASGRF
                     LGPLIILSAMTASIPIGVGSLLGALLFYIWQKPITGGAILGAMILGWLFPVAL"
     gene            641599..642732
                     /locus_tag="ECL_RS03115"
                     /old_locus_tag="ECL_00647"
                     /db_xref="GeneID:9123156"
     CDS             641599..642732
                     /locus_tag="ECL_RS03115"
                     /old_locus_tag="ECL_00647"
                     /EC_number="3.5.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase/deacetylase family
                     metallohydrolase"
                     /protein_id="WP_013095351.1"
                     /db_xref="GeneID:9123156"
                     /translation="MFDLLLRRARLSDDTLTDIAILDGKIAATGDIDAPARKTVELNG
                     DVFVSAGWIDSHVHCYPNSPIYHDEPDSVGIATGVTTVVDAGSTGADDVDDFYEITRK
                     ASTEVFALLNISRVGLIAQNELANMANIDAEAVKQAVKRHPDFIVGLKARMSSSVVGE
                     NGITPLERAKAIQKENGDLPLMVHIGNNPPNLDEIAELLSSGDIITHCYNGKPNRILT
                     PSGELRASITSALKRGVRLDVGHGTASFSFEVAKRAIAMGILPHTISSDIYCRNRING
                     PVGSLSSVMSKFLAIGMSLPQVIDCVTANAADGLRLTRKGRIEPGLDADLTLFTLKRQ
                     PTVLTDAENDSLQAEHILVPLAAIRAGKGYMTEQGSTEHAFDL"
     gene            642716..643834
                     /locus_tag="ECL_RS03120"
                     /old_locus_tag="ECL_00648"
                     /db_xref="GeneID:9123157"
     CDS             642716..643834
                     /locus_tag="ECL_RS03120"
                     /old_locus_tag="ECL_00648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DgaE family pyridoxal phosphate-dependent
                     ammonia lyase"
                     /protein_id="WP_013095352.1"
                     /db_xref="GeneID:9123157"
                     /translation="MPSIYEKYHLKQVINTSGRMTALGVSTPRPEVVQAAMDGMNHYF
                     EMKDLVNKTGEYIAKLLDVEGATVVSCASAGIAQSVAAVLVKDSDWLLENLHVTPIEN
                     NEIVLPKGHNVNFGAPVGTMVALGGGKLVEAGYANECSADQLAAAITPRTAAILYIKS
                     HHCVQKSMLSVEQAAVVARKHDLPLIVDAAAEEDLHTYYRSGADLVIYSGAKAIEGPT
                     SGLVIGKTQYVEWVKRQTAGIGRAMKVGKEGILGLTCAIEHYLTATKESGAEMVAKMT
                     PFIDALNTLNGVTARVVWDSAGRDIARTEIKFDEAVTGIGTGELVNALKQGEYAIYFR
                     GYKANEGIIEADVRSVNADQLNIVYRRISEVLGQEKKA"
     gene            643831..644571
                     /locus_tag="ECL_RS03125"
                     /old_locus_tag="ECL_00649"
                     /db_xref="GeneID:9123158"
     CDS             643831..644571
                     /locus_tag="ECL_RS03125"
                     /old_locus_tag="ECL_00649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="KDGP aldolase family protein"
                     /protein_id="WP_013095353.1"
                     /db_xref="GeneID:9123158"
                     /translation="MKLTPNFYRDRVCLNVLAGSKANASAIYEAAEGHVLVGVLSKNY
                     PDVPSAVADMREYAALIDNALSVGLGAGDPNQSAMVSEISRQVQPQHVNQVFTGVATS
                     RALLGQNDSVVNGLVSPTGTVGMVKISTGPLSSAAPDGIVPVETAIALLKDFGGSSVK
                     YFPMGGLKCRDEYLAVAEACARHDFWLEPTGGIDLENYEAILQIALDAGVSKIIPHIY
                     SSIIDKASGDTRPEDVRTLLAMTKKLVK"
     gene            644695..645834
                     /locus_tag="ECL_RS03130"
                     /old_locus_tag="ECL_00650"
                     /db_xref="GeneID:9123159"
     CDS             644695..645834
                     /locus_tag="ECL_RS03130"
                     /old_locus_tag="ECL_00650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013367880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactonase family protein"
                     /protein_id="WP_100168201.1"
                     /db_xref="GeneID:9123159"
                     /translation="MMHTRTLLVASLSLLANAAIAQPQYAWVGTYNPNGEGLYRFTVD
                     PNTGALGDKTLVSQLPNAAQLAVSHDGKTLYLASEVEQGVVQALRIDDNGELSELNQV
                     SSGGAGPVYLSLTPNGQHLLVANYVSGSIAVLPIKADGSLGDATDRHQDQGEPGAAKP
                     EAAAEGSFAISDHNGPHAHMIAADPSGKYVFSTDLGLDRIYQYRFDDRAGKLTPNDPP
                     FISASSKGAGPRHFVFTPKGDALWLINEEASTLTHYTLDSNGRLKEGKTLSALPEGYK
                     GTSFAAGLALSADGKQLYVANRLHNSIGHFTVTAEGTLTHQDDVWTRGDYPRTLTLDK
                     QGRWLYVMNQRSDNITRFRVGQDGKLSFESDYTPVGSPSQMVISP"
     gene            645854..647763
                     /locus_tag="ECL_RS03135"
                     /old_locus_tag="ECL_00651"
                     /pseudo
                     /db_xref="GeneID:9123160"
     CDS             645854..647763
                     /locus_tag="ECL_RS03135"
                     /old_locus_tag="ECL_00651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463309.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="BglG family transcription antiterminator"
                     /db_xref="GeneID:9123160"
     gene            647841..648083
                     /locus_tag="ECL_RS03140"
                     /old_locus_tag="ECL_00653"
                     /db_xref="GeneID:9127632"
     CDS             647841..648083
                     /locus_tag="ECL_RS03140"
                     /old_locus_tag="ECL_00653"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelB/DinJ family
                     antitoxin"
                     /protein_id="WP_008501400.1"
                     /db_xref="GeneID:9127632"
                     /translation="MATLNVRLDDKLKNEAYAVLEKLNITPTEAVRLLFQYVAETGRM
                     PVKTVTISDSEDALIQTVRERLANPQKGIKVSLDDL"
     gene            648073..648357
                     /locus_tag="ECL_RS03145"
                     /old_locus_tag="ECL_00654"
                     /db_xref="GeneID:9123161"
     CDS             648073..648357
                     /locus_tag="ECL_RS03145"
                     /old_locus_tag="ECL_00654"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="WP_013095355.1"
                     /db_xref="GeneID:9123161"
                     /translation="MTYELEFDPRALKEWSKLGETVKKQFKKKLAGVLVNPRIESARL
                     HNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGKREKLTVYHDANKRL"
     gene            complement(648361..648825)
                     /gene="nrdG"
                     /locus_tag="ECL_RS03150"
                     /old_locus_tag="ECL_00655"
                     /db_xref="GeneID:9123162"
     CDS             complement(648361..648825)
                     /gene="nrdG"
                     /locus_tag="ECL_RS03150"
                     /old_locus_tag="ECL_00655"
                     /EC_number="1.97.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate
                     reductase-activating protein"
                     /protein_id="WP_013095356.1"
                     /db_xref="GeneID:9123162"
                     /translation="MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSG
                     MPFTAEVEDRIINDLNDTRIKRQGISLSGGDPLHPQNVPEILKLVKRIRRECAGKDIW
                     VWTGYKLDELNAQQREVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR"
     gene            complement(648948..651086)
                     /gene="nrdD"
                     /locus_tag="ECL_RS03155"
                     /old_locus_tag="ECL_00656"
                     /db_xref="GeneID:9123163"
     CDS             complement(648948..651086)
                     /gene="nrdD"
                     /locus_tag="ECL_RS03155"
                     /old_locus_tag="ECL_00656"
                     /EC_number="1.17.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004128226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase"
                     /protein_id="WP_013095357.1"
                     /db_xref="GeneID:9123163"
                     /translation="MTPHVMKRDGCKVPFKSERIQEAILRAAKAAGVDDADYCATVAD
                     VVSRQMNERSQVDISEIQTAVENQLMSGPYKQLARAYIEYRHDRDVQREKRGRLNQEI
                     RGLVEQTNSALLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDVVSAHERGEIH
                     YHDLDYSPFFPMFNCMLIDLKGMLTHGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEVLAPFVTASFKKHRKTAEEWQIPDADGYAHSRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGTSWESRLIQQSILRNRISGLGKNRKTAVFPKLVFAI
                     RDGLNHKFGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYE
                     DENGEQVHDGRNNLGVISLNLPRIALEAKGNEDAFWALLDERLQLARKALMTRIARLE
                     GVKARVAPILYMEGACGVRLKADDDVSEIFKNGRASISLGYIGIHETINALFGNTHMY
                     DSDALREKGIAIVQRLRDAVDQWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGIVEG
                     VTDKGYYTNSFHLDVEKKVNPYDKIDFEAAYPPIASGGFICYGEYPNIQHNLKALEDV
                     WDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDAARVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRVKHLGNGQIG"
     gene            complement(651460..653103)
                     /gene="treC"
                     /locus_tag="ECL_RS03160"
                     /old_locus_tag="ECL_00657"
                     /db_xref="GeneID:9123164"
     CDS             complement(651460..653103)
                     /gene="treC"
                     /locus_tag="ECL_RS03160"
                     /old_locus_tag="ECL_00657"
                     /EC_number="3.2.1.93"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006179080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha,alpha-phosphotrehalase"
                     /protein_id="WP_013095358.1"
                     /db_xref="GeneID:9123164"
                     /translation="MNTLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVTQRLDYLKT
                     LGIDAIWLTPFYISPQVDNGYDVANYTAIDPAYGTLDDFDELVAQAHERGIRIVLDMV
                     FNHTSTQHAWFRESLNKASPYRQFYIWRDGTPEQLPNNWRSKFGGNAWRWHAESEQYY
                     LHLFAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVINLISKDQAFPNDDIGD
                     GRRFYTDGPRIHEYLQEMSRDVFTPRNLMTVGEMSSTSLENCQQYASLDGRELSMTFN
                     FHHLKVDYPGGEKWTLAKPDFVALKTLFNHWQQGMHNKAWNALFWCNHDQPRIVSRFG
                     DEGEYRVPAAKMLGMVLHGMQGTPYIYQGEELGMTNPHFSRITDYRDVESLNMFAELR
                     ANGRDPNELLAILASKSRDNGRTPMQWDASHNAGFTEGEPWIGVCDNYETVNARAALD
                     DPDSVFYTYQSLIRLRKTLPVLTWGDYQDLQPEHPSLWCYRRQWQGKTLVVVANLSHQ
                     SHEWESDVLSGEWQAVMSNYPAPHTATLRPFEAVWWLQA"
     gene            complement(653155..654576)
                     /gene="treB"
                     /locus_tag="ECL_RS03165"
                     /old_locus_tag="ECL_00658"
                     /db_xref="GeneID:9123165"
     CDS             complement(653155..654576)
                     /gene="treB"
                     /locus_tag="ECL_RS03165"
                     /old_locus_tag="ECL_00658"
                     /EC_number="2.7.1.201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_313244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS trehalose transporter subunit IIBC"
                     /protein_id="WP_013095359.1"
                     /db_xref="GeneID:9123165"
                     /translation="MMSKVKQADIDQLIVLVGGRENIATVSHCITRLRFVLNDPAKAN
                     PKAIEALSMVKGCFTNAGQFQVVIGTEVGDYYQALLATTGHNAADKEQAKKAARQNMK
                     WHEQLISHFAEIFFPLLPALISGGLILGFRNVIGDVPMSDGKTLAQMYPALKTIYDFL
                     WLIGEAIFFYLPVGICWSAVRKMGGTPILGIVLGVTLVSPQLMNAYLLGQQAPEVWNF
                     GLFTIAKVGYQAQVIPALLAGLALGFIETRLKRIVPDYLYLVVVPVCSLILAVFLAHA
                     FIGPFGRMIGDGVAFAVRHLMTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDMQMIQ
                     SLGGTPVWPIIALSNIAQASAVTGIILVSRKHNEREISVPAAISAYLGVTEPAMYGIN
                     LKYRFPMLCAMIGSGLAGLVCGLNGVMANGIGVGGLPGILSIQPAFWQVFALAMAIAI
                     IVPMALTTVVYQRKFRQGALQIV"
     gene            complement(654701..655648)
                     /gene="treR"
                     /locus_tag="ECL_RS03170"
                     /old_locus_tag="ECL_00659"
                     /db_xref="GeneID:9123166"
     CDS             complement(654701..655648)
                     /gene="treR"
                     /locus_tag="ECL_RS03170"
                     /old_locus_tag="ECL_00659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006810319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator TreR"
                     /protein_id="WP_013095360.1"
                     /db_xref="GeneID:9123166"
                     /translation="MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSERTRERVEAVMN
                     QHGFSPSRSARAMRGQSDKVVAIIVSRLDSLSENLAVQTMLPAFYEQGYDPIMMESQF
                     SPQLVEEHLGMLARRNIDGVVLFGFTGIKEEMLKPWQPSLVLLARDAHGFASVCYDDE
                     GAIITLMQRLYEKGHRHISYLGVPHADVTTGKRRHEAYLAFCKKHNLSAVASLPGLGM
                     KQGYEQVASVLTPQTTALVCATDTLALGASKYLQEQRIDDLQVASVGSTPLMKFLHPE
                     IITVDPGYAESGRQAAAQLIEQINGRAEPRQIVIPVHLS"
     gene            656040..658748
                     /gene="mgtA"
                     /locus_tag="ECL_RS03175"
                     /old_locus_tag="ECL_00660"
                     /db_xref="GeneID:9123167"
     CDS             656040..658748
                     /gene="mgtA"
                     /locus_tag="ECL_RS03175"
                     /old_locus_tag="ECL_00660"
                     /EC_number="7.2.2.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="WP_044159534.1"
                     /db_xref="GeneID:9123167"
                     /translation="MFKNITRQLQALLSRHLPHRLVQRDPLPNGKNFSGATIPASLTE
                     RCLNVAAMDENEVWRAFNGHPEGLNAAEVQKIRAVHGDNLIPAQKPAPWWVHLWICYR
                     NPFNLLLTVLGIISYATEDLFAAGVIALMVGISTLLNFIQEARSTKAADALKAMVSNT
                     ATVSRVINDLGENAWVELPIDQLVPGDLVKLAAGDMIPADLRIIQARDLFVAQASLTG
                     ESLPVEKVARSRDPQQMNPLECDTLCFMGTTVVSGTAQAIVIATGGNTWFGQLAGRVT
                     EQESEPNAFQKGIGRVSMLLIRFMMVMTPIVLLINGYTKGDWWEAALFALSVAVGLTP
                     EMLPMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENH
                     TDIAGKTSERVLHSAWLNSHYQTGLKNLLDVAVLEGVDEESARSLSGRWQKVDEIPFD
                     FERRRMSVVVSEQPDVHQLICKGALQEILNVSTQVHYNGDIVPLDDTMLRRIKRVTDN
                     LNRQGLRVVAVASKFLPAREGDYQRIDESDLILEGYIAFLDPPKETTAPALKALKASG
                     ITVKILTGDSELVAAKVCHEVGLDAGDVVVGSDIEHLSDDELAQLARHTTLFARLTPM
                     HKERIVTLLRREGHVVGFMGDGINDAPALRAADIGISVDGAVDIAREAADIILLEKSL
                     MVLEEGVIEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLM
                     YDVSQVAIPFDNVDDEQIQKAQRWNPADLGRFMLFFGPISSIFDILTFCLMWFVFHAN
                     TPEHQTLFQSGWFVVGLLSQTLIVHMIRTRRIPFIQSRAAWPLIVMTGIVMALGIALP
                     FSPLASYLQLQALPLSYFPWLVAILAGYMVLTQMVKGFYARRYGWQ"
     gene            658926..661310
                     /locus_tag="ECL_RS03180"
                     /old_locus_tag="ECL_00661"
                     /db_xref="GeneID:9123168"
     CDS             658926..661310
                     /locus_tag="ECL_RS03180"
                     /old_locus_tag="ECL_00661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="family 20 glycosylhydrolase"
                     /protein_id="WP_013095362.1"
                     /db_xref="GeneID:9123168"
                     /translation="MLRYSLLTAGLLLGASAFAAPAGDLPLMPWPAKVERPTTQGALV
                     LNNQLSVSVSGDDLGDAVNRLRQRIALQTGWTLQPQADKPEKPTIRIAIAKKVKPQPL
                     PDSDESYKLTVDANGVDISANTRFGALRAIETLLQLVQNGAENTSVPWVTIEDSPRFP
                     WRGLLLDSARHFIPLADIKRQLDGMAAAKLNVLHWHLTDDQGWRFSSKRYPKLTQLAS
                     DGLFYTPEQMREIVRYAADRAIRVVPEIDMPGHASAIAVAYPALMSAPGPYEMERHWG
                     VLKPVLDPTKEATYAFADAMVSELAAIFPDPYLHIGGDEVDDSQWKANPAIQQFMRDH
                     KLADSHALQAYFNRKLETILEKHHRQMVGWDEIYHPDLPKSILIQSWQGQDALGQVAQ
                     NGYKGILSTGFYLDQPQSTAYHYRNEIVPQALNGVDVIADTDSAQSWAFSMPRLKGKP
                     VEGSFTLVKGESGWRGFIDFAGKSRRAVDNIAWRDDNQVTFTVDTWMGETRPVVSVDN
                     DKLTGYFLVGNVRYPISGTRLDEVPKGTPPVVPDIAHQVNLLGGEAALWAENVVAPVL
                     DIRLWPRTFAVAERLWSAQDVTDVDNMYTRLQAMDSWSTVSVGLQQHTQQQVQFTRLA
                     GNADTLPLQILAQAVEPAQYYTRQHLKFQAGNYHQFEPLNRFADELNAESATVRQMNK
                     WADRLVSDAEDTESADALRHVFNRWQSNTSDALALSENSYQLKAIKPVIQEVDKLASI
                     GLRLTDLVARQGTLDDKEIASIQSELDNAAKVQDEVVIAAVYPLETLLRATRNQ"
     gene            complement(661400..662854)
                     /gene="gbpA"
                     /locus_tag="ECL_RS03185"
                     /old_locus_tag="ECL_00662"
                     /db_xref="GeneID:9123169"
     CDS             complement(661400..662854)
                     /gene="gbpA"
                     /locus_tag="ECL_RS03185"
                     /old_locus_tag="ECL_00662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-binding protein GbpA"
                     /protein_id="WP_013095363.1"
                     /db_xref="GeneID:9123169"
                     /translation="MKLSKIALAMATLTVASSALAHGYIESPASRAYMCKLGQNIDCG
                     SVQYEPQSVEKTSGFPGGAMPPDGQLASAGIANYSQLDKQSLNAWTKSPMTAGPHEFV
                     WYHTAPHKTTNWRYYITKQNWDPNKPLTRDQFELTPFCTVNGNGQAPAMRKAMTCNVP
                     ARTGYQVIYGVWEIADTSNSFYQAIDVDFGNGGNVTPDDGAGIESEWSKVLSGQIAGN
                     NLNVGDKVIARFFDAHGEVTSLRTEITIATAAQGDANQWSYDLAQKINTAHQDIRVGV
                     KDEGGDISPVHGANSVFVKEDSALQSVAISYEEQKAEVNETIAVSNLHYSKIENGNAT
                     VTFHVNTHGNVDFEAHVMNHHGAEKGYLKQEMNNANQDVTLTLTGVEAGHHMLKYYAT
                     NKDGTLFAQDVLNLMLEEEAAADNSTGQHDYIFPDNIASYKAGTVVLQPKDGKTYQCK
                     PFPYSGYCVQWSKYATQFEPGTGSHWKEAWVLKH"
     gene            complement(662986..663372)
                     /gene="ridA"
                     /locus_tag="ECL_RS03190"
                     /old_locus_tag="ECL_00663"
                     /db_xref="GeneID:9123170"
     CDS             complement(662986..663372)
                     /gene="ridA"
                     /locus_tag="ECL_RS03190"
                     /old_locus_tag="ECL_00663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_418664.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-iminobutanoate/2-iminopropanoate deaminase"
                     /protein_id="WP_006810315.1"
                     /db_xref="GeneID:9123170"
                     /translation="MTKVLATENAPAAIGPYVQGVDLGSMIITSGQIPVNPKTGEVPA
                     DVAAQARQSLENVQAIVESAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNASF
                     PARSCVEVARLPKDVKIEIEAIAVRR"
     gene            complement(663447..663908)
                     /gene="pyrI"
                     /locus_tag="ECL_RS03195"
                     /old_locus_tag="ECL_00664"
                     /db_xref="GeneID:9123171"
     CDS             complement(663447..663908)
                     /gene="pyrI"
                     /locus_tag="ECL_RS03195"
                     /old_locus_tag="ECL_00664"
                     /EC_number="2.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000148566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory
                     subunit"
                     /protein_id="WP_013095364.1"
                     /db_xref="GeneID:9123171"
                     /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTETDQRITI
                     GLNLPSGEMGRKDLIKIENTFLTDEQVNQLSLYAPDATVNRIDNYDVVGKSRPSLPER
                     IESVLVCPNSNCISHAEPVSSSFAVKKRADDIALKCKYCEKEFSHYVVLAN"
     gene            complement(663921..664853)
                     /gene="pyrB"
                     /locus_tag="ECL_RS03200"
                     /old_locus_tag="ECL_00665"
                     /db_xref="GeneID:9123172"
     CDS             complement(663921..664853)
                     /gene="pyrB"
                     /locus_tag="ECL_RS03200"
                     /old_locus_tag="ECL_00665"
                     /EC_number="2.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012015860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_013095365.1"
                     /db_xref="GeneID:9123172"
                     /translation="MNPLYQKHIISINDLSREELELVLETAAKLKANPQPELLKHKVI
                     ASCFFEASTRTRLSFETSMHRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAI
                     VMRHPQEGAARLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNIAMV
                     GDLKYGRTVHSLTQALAKFNGNRFFFIAPDALAMPQYILDMLDEKSIPWSLHASIEEV
                     MGNVDILYMTRVQKERLDPSEYANVKAQFVLRASDLEGARDNMKVLHPLPRIDEITTD
                     VDKTPHAWYFQQAGNGIFARQALLALVLNRELAL"
     gene            complement(664888..665019)
                     /locus_tag="ECL_RS03205"
                     /db_xref="GeneID:44145325"
     CDS             complement(664888..665019)
                     /locus_tag="ECL_RS03205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013367865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PyrBI operon leader peptide"
                     /protein_id="WP_072093684.1"
                     /db_xref="GeneID:44145325"
                     /translation="MPDNLPGGSMVKRVRHNVLPRLKSDAGLPFFFPLLNLFPEPLI"
     gene            complement(665093..665572)
                     /locus_tag="ECL_RS03210"
                     /old_locus_tag="ECL_00667"
                     /db_xref="GeneID:9123174"
     CDS             complement(665093..665572)
                     /locus_tag="ECL_RS03210"
                     /old_locus_tag="ECL_00667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArgR family transcriptional regulator"
                     /protein_id="WP_013095367.1"
                     /db_xref="GeneID:9123174"
                     /translation="MTEYGDYSPKEQLQLTVCQRLIAEKSYLSQEEIRRDLQERGFET
                     ISQSTVSRLLKLLGVIKIRNAKGLKIYSLNPLLRPAPDAARTVSEMVVSVEHNSEFIL
                     IHTVAGYGRAVARILDYHQLPEILGVVAGSSIVWVAPRVVKRTALVHKQINYLLRTH"
     gene            complement(665648..667051)
                     /locus_tag="ECL_RS03215"
                     /old_locus_tag="ECL_00668"
                     /db_xref="GeneID:9123175"
     CDS             complement(665648..667051)
                     /locus_tag="ECL_RS03215"
                     /old_locus_tag="ECL_00668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000514417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfcC family protein"
                     /protein_id="WP_013095368.1"
                     /db_xref="GeneID:9123175"
                     /translation="MGKFKFPSAYTILFFLIAVVAVLTWIIPAGQYHMAMNEALGKDV
                     PVAGTYAHVAAHPQGLVSVLMAPIAGLYDPESGQAGAIDVALFILIIGGFLGIVTKTG
                     AIDAGIERVTTRLRGREEWMIPILMALFAAGGTIYGMAEESLPFYTLLVPVMLAARFD
                     PVVAASTVLLGAGIGTLGSTINPFATVIAANAAGIPFTNGIVLRVALLVIGWIICVAW
                     VMRYARKVRQDPSLSIVADKQEENRAHFLGNKDAQTLEFTPVRKIILVIFALAFAVMI
                     YGVAVLGWWMAEISAVFLASAIIVGLIARMSEEELTSTFINGARDLLGVALIIGIARG
                     IVVIMDKGMITHTILHSAEGLVSGLSTVAFINVMYWLEVVLSFLVPSSSGLAVLTMPI
                     MAPLADFANVNRDLVVTAYQSASGIVNLVTPTSAVVMGGLAIARVPYVRYLKWVAPLL
                     GILTVVIMVALSLGAVL"
     gene            complement(667099..668103)
                     /gene="argF"
                     /locus_tag="ECL_RS03220"
                     /old_locus_tag="ECL_00669"
                     /db_xref="GeneID:9123176"
     CDS             complement(667099..668103)
                     /gene="argF"
                     /locus_tag="ECL_RS03220"
                     /old_locus_tag="ECL_00669"
                     /EC_number="2.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_013095369.1"
                     /db_xref="GeneID:9123176"
                     /translation="MTINLKNRNFLKLLDYTPAEIQYLIDLAIELKAAKKAGREKQTL
                     VGKNIALIFEKTSTRTRCAFEVGAFDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMY
                     DGIEYRGYGQAIVEELGEYAGVPVWNGLTDEFHPTQILADLMTMLEHSPGKTLPELSF
                     AYLGDARNNMGNSLMVGAAKMGMDIRLVAPKSFWPEAGLVEQCRAIAKETGARITLTD
                     DVEEGVQGADFLYTDVWVSMGEPKEAWAERVSLMKPYQINAQVMKATGNPNVKFMHCL
                     PAFHNEHTKVGREIEMAYGLKGLEVTEEVFESPNSIVFDEAENRMHTIKAVMVATLGD
                     "
     gene            complement(668196..669107)
                     /locus_tag="ECL_RS03225"
                     /old_locus_tag="ECL_00670"
                     /db_xref="GeneID:9123177"
     CDS             complement(668196..669107)
                     /locus_tag="ECL_RS03225"
                     /old_locus_tag="ECL_00670"
                     /EC_number="2.7.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006810310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamate kinase"
                     /protein_id="WP_013095370.1"
                     /db_xref="GeneID:9123177"
                     /translation="MERKPTLVVALGGNALLKRGEPLEAEIQRKNIDLAARTIAGLTE
                     QWRVVLVHGNGPQVGLLALQNSAYDKVAPYPLDVLGAESQGMIGYMLQQALKNSLPQR
                     EVSVLLTQVEVDAADPAFSNPTKYIGPVYSEAQAKTLQAEKGWVFKADGSYFRRVVPS
                     PQPKRIVESDAIAALIQRDHLVICNGGGGVPVVENANGYHGIEAVIDKDLSAALLARQ
                     IEADALLILTDADAVYLDWGKPTQRPLAQVTPELLKGMAFDAGSMGPKVAACREFVEA
                     CNGIAGIGALADGAEILAGEKGTLIRN"
     gene            complement(669117..670337)
                     /gene="arcA"
                     /locus_tag="ECL_RS03230"
                     /old_locus_tag="ECL_00671"
                     /db_xref="GeneID:9123178"
     CDS             complement(669117..670337)
                     /gene="arcA"
                     /locus_tag="ECL_RS03230"
                     /old_locus_tag="ECL_00671"
                     /EC_number="3.5.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine deiminase"
                     /protein_id="WP_013095371.1"
                     /db_xref="GeneID:9123178"
                     /translation="MEKHYVGSEIGQLRSVMLHRPNLSLKRLTPSNCQELLFDDVLSV
                     ERAGEEHDIFANTLREQGVEVLLLTDLLTQTLDIAEAKAWLLETQISDYRLGPTFASD
                     VRGWLADMPHRELARRLSGGLTYGEIPAAIKNMVVDTHTANDFIMKPLPNHLFTRDTS
                     CWIYNGVSINPMAKPARQRETNNLRAIYRWHPAFADGEFIKYFGDENINYDHATLEGG
                     DVLVIGRGAVLIGMSERTTPQGVEFLANSLFKHRQAERVIAVELPKHRSCMHLDTVMT
                     HIDVDTFSVYPEVVRKDAQCWTLTPDGRGGLLRTQETDLLHAIEKALGINQVRLITTG
                     GDAFEAEREQWNDANNVLTIRPGVVIGYERNVWTNEKYDKAGITVLPIPGDELGRGRG
                     GARCMSCPLERDGI"
     gene            671010..671462
                     /locus_tag="ECL_RS03235"
                     /old_locus_tag="ECL_00672"
                     /db_xref="GeneID:9123179"
     CDS             671010..671462
                     /locus_tag="ECL_RS03235"
                     /old_locus_tag="ECL_00672"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YhcH/YjgK/YiaL family protein"
                     /protein_id="WP_013095372.1"
                     /db_xref="GeneID:9123179"
                     /translation="MIIGNIHHLQAWLPEPLRLAIEHVKAHVTDATPPGKHDINGNNL
                     FYLVSEDMTQPFAERRAEYHARYLDIQIVLKGQEGMTFSTLPHGTPDTDWLADKDIAF
                     LPEGEQEKTVVLSEGDFVVFWPGEVHKPLCAVGAPAKVRKVVVKMLVE"
     gene            671675..672583
                     /gene="yagE"
                     /locus_tag="ECL_RS03240"
                     /old_locus_tag="ECL_00673"
                     /db_xref="GeneID:9123180"
     CDS             671675..672583
                     /gene="yagE"
                     /locus_tag="ECL_RS03240"
                     /old_locus_tag="ECL_00673"
                     /EC_number="4.1.2.51"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414802.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate aldolase"
                     /protein_id="WP_013095373.1"
                     /db_xref="GeneID:9123180"
                     /translation="MPQSALFTGIIPPVSTIFTADGQLDKQGTAALIDDLIAAGVDGL
                     FFLGSGGEFSQLSAEERKTIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGA
                     DGIVVINPYYWKVSEANLIRYFEQVADSVTLPVILYNFPALTGQDLTPALVKILADSR
                     SNIVGIKDTIDSVAHLRSMIHTVKAAHPHFTVLCGYDDHLFNILLLGGDGAISASGNF
                     APQVSVNLLKAWRDKDVAKAAEYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPISTH
                     VLPPASALDEPRKAQLKTLLQQLKLC"
     gene            672598..674565
                     /gene="yagF"
                     /locus_tag="ECL_RS03245"
                     /old_locus_tag="ECL_00674"
                     /db_xref="GeneID:9123181"
     CDS             672598..674565
                     /gene="yagF"
                     /locus_tag="ECL_RS03245"
                     /old_locus_tag="ECL_00674"
                     /EC_number="4.2.1.82"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylonate dehydratase YagF"
                     /protein_id="WP_013095374.1"
                     /db_xref="GeneID:9123181"
                     /translation="MTIEKIFTPQDDAFYAVITHAAGPQGALPLTPQMLMESPSGNLF
                     GMTQNAGMGWDANKLTGKEVLIIGTQGGIRAGDGRPVALGYHTGHWEIGMQMQAAAKE
                     ITRNGGIPFAAFVSDPCDGRSQGTHGMFDSLPYRNDAAIVFRRLIRSLPTRRAVIGVA
                     TCDKGLPATMIALASMHNLPTILVPGGATLPPTVGEDAGKVQTIGARFANHELSLQEA
                     AELGCRACASPGGGCQFLGTAGTSQVVAEALGLALPHSALAPSGQAVWLEIARQSARA
                     VSELDNRGITTRDILTDKAIENAMVIHAAFGGSTNLLLHIPAIAHAAGCTIPDVEHWT
                     RVNRRVPRLVSVLPNGPDYHPTVRAFLAGGVPEVMLHLRDLGLLHLDAMTVTGQTVGE
                     NLDWWQASERRKRFRQCLREQDGVDPDDVILPPEKAKARGLTSTVCFPTGNIAPEGSV
                     IKATAIDPSVVGADGVYRHTGRARVFVSEAQAIKAIKQEEIKQGDIMVVIGGGPSGTG
                     MEETYQLTSALKHISWGKTVSLITDARFSGVSTGACFGHVSPEALAGGPIGKLRDNDI
                     IEIAVDRLTLTGSVNFIGTAENPLTPEEGARELAVRQTHPDLHPHDFLPDDTRLWAAL
                     QSVSGGTWKGCIYDTDKIIEVINAGKKALGL"
     gene            674790..676172
                     /locus_tag="ECL_RS03250"
                     /old_locus_tag="ECL_00675"
                     /db_xref="GeneID:9123182"
     CDS             674790..676172
                     /locus_tag="ECL_RS03250"
                     /old_locus_tag="ECL_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013095375.1"
                     /db_xref="GeneID:9123182"
                     /translation="MMQLTMKDKIGYGLGDTACGFVWQATMFLLAYFYTDVFGLSAGI
                     MGTLFLVSRVLDAVTDPLMGLLVDRTRTRYGQFRPFLLWGAIPFGIVCMLTFYTPDFS
                     AQGKIIYACVTYILLTLVYTFVNVPYCAMPGVITADPKERHALQSWRFFLAAAGSLAI
                     SGIALPLVSIIGKGDEQVGYFGAMCVLGLTGVVLLYVCFFTTKERYTFEVQPGSSVAK
                     DLKLLLGNGQWRIMCAFKMMATCSNVVRGGATLYFVKYVMDHPEMATQFLLYGSLATM
                     FGSLCSSRLLGRFDRVKAFKWIIVAYSLISLLIFVTPAEHIALIFALNILFLFVFNTT
                     TPLQWLMASDVVDYEESRSGRRLDGLVFSTYLFSLKIGLAIGGAVVGWILAYVNYSAS
                     SSVQPVEVLTTIKILFCVVPVVLYVGMFIMLSFYKLTDARVEAISQQLIKHRAAQGEA
                     VPDAATAASH"
     gene            676184..677794
                     /locus_tag="ECL_RS03255"
                     /old_locus_tag="ECL_00676"
                     /db_xref="GeneID:9123183"
     CDS             676184..677794
                     /locus_tag="ECL_RS03255"
                     /old_locus_tag="ECL_00676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="WP_013095376.1"
                     /db_xref="GeneID:9123183"
                     /translation="MEITNPILTGFNPDPSLCRQGEDYYIATSTFEWFPGVRIYHSRD
                     LKNWSLVSTPLDRVSMLDMKGNPDSGGIWAPCLSYADGKFWLLYTDVKIVDSPWKNGR
                     NFLVTAPSIEGPWSDPIPMGNGGFDPSLFHDDDGRKYYLYRPWGPRHHSNPHNTIVMQ
                     EFDPQTGTLSPERKTLFTGTPLCYTEGAHLYRHAGWYYLMVAEGGTSYEHAVVVLRSK
                     TIDGPYELHPDVTMMTSWHLPENPLQKSGHGSLLQTHTGEWYMAYLTSRPLRLPGVPL
                     LASGGRGYCPLGRETGIARIEWRDGWPYVEGGKHAQLTVKGPQVAEQPASIQGNWRED
                     FDGSTLDPELQTLRIPFDDTLGSLTARPGYLRLYGNDSLNSTFTQSTVARRWQHFTFR
                     SETRMQFSPVHFQQSAGLTCYYNSKNWSYCFVDYEEGKGRTIKVIQLDHNVPSWPLHE
                     QPIPVPESAESIWLRVDVDTLVYRYSYSFDGETWHTVPVTFEAWKLSDDYIGGRGFFT
                     GAFVGLHCEDISGDGCHADFDYFTYEPV"
     gene            complement(677799..678557)
                     /gene="xynR"
                     /locus_tag="ECL_RS03260"
                     /old_locus_tag="ECL_00677"
                     /db_xref="GeneID:9123184"
     CDS             complement(677799..678557)
                     /gene="xynR"
                     /locus_tag="ECL_RS03260"
                     /old_locus_tag="ECL_00677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional repressor XynR"
                     /protein_id="WP_013095377.1"
                     /db_xref="GeneID:9123184"
                     /translation="MPIIQSVERALQILDLFNEQATELKITDISKMMGLSKSTLHSLL
                     KTLQLHGYIDQNPENGKYRLGMKLVERGHFVVGSIDIRQKAKGWLTELSQRTGQTTHL
                     GILDGREGVYIEKIEGKLAAIAYSRIGRRLPVHATAIGKVLIAWLGETELNALLEGYQ
                     YTTYTPSTLASREALMAALAQTREQGYALDSEENEQGVRCVAVPVWNHESRVIAALSL
                     STLTSRVDDAGLANFREQLQQAGLQLSRALGYPA"
     gene            complement(678728..679732)
                     /gene="argF"
                     /locus_tag="ECL_RS03265"
                     /old_locus_tag="ECL_00678"
                     /db_xref="GeneID:9123185"
     CDS             complement(678728..679732)
                     /gene="argF"
                     /locus_tag="ECL_RS03265"
                     /old_locus_tag="ECL_00678"
                     /EC_number="2.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017694626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="WP_013095378.1"
                     /db_xref="GeneID:9123185"
                     /translation="MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLT
                     GKNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYD
                     GIQYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLV
                     YAGDARNNMGNSMLEAAALTGLDLRLVAPKACWPEESLVAECSALAQKHGGKITLTED
                     VAAGVKGADFIYTDVWVSMGEAKEKWAERIALLRGYQVNAQMMALTGNPNVKFLHCLP
                     AFHDDQTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENRMHTIKAVMVATLGG
                     "
     gene            679897..680322
                     /gene="rraB"
                     /locus_tag="ECL_RS03270"
                     /old_locus_tag="ECL_00679"
                     /db_xref="GeneID:9123186"
     CDS             679897..680322
                     /gene="rraB"
                     /locus_tag="ECL_RS03270"
                     /old_locus_tag="ECL_00679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_463330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease E inhibitor RraB"
                     /protein_id="WP_006810300.1"
                     /db_xref="GeneID:9123186"
                     /translation="MANPEHLEEQREETRLIIEELLEDGSDPDALYTIEHHFSADDFD
                     ALEKMAVEAFKLGYEVTEPEELEVEEGDTVICCDILSEGALKAELIDAQVEQLMNLAE
                     KFDVEYDGWGTYFEDPNGEDGEEGDDEDYVDEDDDGVRH"
     gene            680369..681127
                     /gene="miaE"
                     /locus_tag="ECL_RS03275"
                     /old_locus_tag="ECL_00680"
                     /db_xref="GeneID:9123187"
     CDS             680369..681127
                     /gene="miaE"
                     /locus_tag="ECL_RS03275"
                     /old_locus_tag="ECL_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006810299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA isopentenyl-2-thiomethyl-A-37 hydroxylase
                     MiaE"
                     /protein_id="WP_013095379.1"
                     /db_xref="GeneID:9123187"
                     /translation="MDYPQILAPVLNFLQCPTPQAWIDKARDPANLPLLLTDHMVCEL
                     KAAQTALLLVRKYVADESGADALLDWLKPYEQFTFRDGPEPDFIALHRQIGKSVMPKT
                     DDPWGQALIDSMVLLIKEELHHFWQVREAMLARDIPYVKITASRYAKGMLKEVRTHEP
                     LTLIDKLICGAYIEARSCERFAALAPFLDDDLQKFYLSLLRSEARHYQDYLTLAQQVS
                     DDDISPRIKLFGEIEATLISTPDNEFRFHSGVLV"
     gene            681158..681880
                     /locus_tag="ECL_RS03280"
                     /old_locus_tag="ECL_00681"
                     /db_xref="GeneID:9123188"
     CDS             681158..681880
                     /locus_tag="ECL_RS03280"
                     /old_locus_tag="ECL_00681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003862944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095380.1"
                     /db_xref="GeneID:9123188"
                     /translation="MNKTWTRIVIVVIAAAAVAFWVFFDRQRAPERQMDNALNAMPAW
                     QVIKEQEPALHQRILDQMAALQKAGEPEQQIIDTIQPQILHLQMTRLQNAPDANVVNY
                     MTINMEQTAAIQKVSDDACFRFLYPMVKGGINPMRMLDKDLMARRMQADADMMRAAYG
                     KNRHIVTQAEREAAVEDVRPIMKALADKYGEDIQLLQMPEKAVGKEKLSCDMVQEMWA
                     KVLALPEQKAARVIRLAVSELD"
     gene            681986..682070
                     /locus_tag="ECL_RS03285"
                     /old_locus_tag="ECL_tRNA013"
                     /db_xref="GeneID:9123189"
     tRNA            681986..682070
                     /locus_tag="ECL_RS03285"
                     /old_locus_tag="ECL_tRNA013"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:682020..682022,aa:Leu,seq:caa)
                     /db_xref="GeneID:9123189"
     gene            682285..683406
                     /locus_tag="ECL_RS03290"
                     /old_locus_tag="ECL_00682"
                     /db_xref="GeneID:9127681"
     CDS             682285..683406
                     /locus_tag="ECL_RS03290"
                     /old_locus_tag="ECL_00682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_013095381.1"
                     /db_xref="GeneID:9127681"
                     /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKY
                     GSMEVPEVKRLKSLEEENARLKKLLAEAMLDKEAASGGSWAKVLTTDQKREAVMLMCD
                     ATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITELALERRRFGYRRIWQLLRR
                     EGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMDALST
                     GRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTC
                     RALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKIINDW
                     RQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
     gene            <683429..683791
                     /locus_tag="ECL_RS03295"
                     /pseudo
                     /db_xref="GeneID:44145326"
     CDS             <683429..683791
                     /locus_tag="ECL_RS03295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001522431.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /db_xref="GeneID:44145326"
     gene            complement(683846..684856)
                     /locus_tag="ECL_RS03300"
                     /old_locus_tag="ECL_00684"
                     /db_xref="GeneID:9123191"
     CDS             complement(683846..684856)
                     /locus_tag="ECL_RS03300"
                     /old_locus_tag="ECL_00684"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095383.1"
                     /db_xref="GeneID:9123191"
                     /translation="MTYITRESNETSTIKCEGKMKRNIRVIPKNVYSKLKRLGNTVVA
                     GTSIAITESQLKNGMLEHLGIYYDNGVNAYEASVIPDPLQGKYSLKNVFGEEIVRRDL
                     PKETHYTEIESPNWGDSSNGTHTVRLPHEKYPRDIIPPKLIAIEINHKQSSGSHFIFN
                     FRVTRILEKKSSTFDDDLLFDLNLLQENLGKCGVENADKPISTYADTLIVSWDIFPPG
                     SKEEVLSRIFRGKNITPDKKNVAENRYDFFMSLEPKKIVTGNSTFSNYLGAMLEDDLV
                     VFENIEYGNAIYILYDNWDEISKLSRIDLLSGRAGNNFDRIIHSGNWKDEVRKKVATG
                     RL"
     gene            complement(684807..685343)
                     /locus_tag="ECL_RS03305"
                     /db_xref="GeneID:44145327"
     CDS             complement(684807..685343)
                     /locus_tag="ECL_RS03305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004152200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_044158907.1"
                     /db_xref="GeneID:44145327"
                     /translation="MLKAIVGIVKYTRIYIAIFILSLLIISTSNINYVYNDFANYCTL
                     LVSVSGMVFTIMGIWLAFLYPNALQRIVNPKTIETVDFTEQLEDTRRLEAIVGSVLKS
                     SFVMITLLVIYLLKLVFFKSHLYIESQEVIKNTSLALIIAISYMQIEAVISVILANVM
                     FINDLHNKREQRDIDDQV"
     gene            685382..>685924
                     /locus_tag="ECL_RS03310"
                     /old_locus_tag="ECL_00685"
                     /pseudo
                     /db_xref="GeneID:9123192"
     CDS             685382..>685924
                     /locus_tag="ECL_RS03310"
                     /old_locus_tag="ECL_00685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 family transposase"
                     /db_xref="GeneID:9123192"
     gene            686015..687225
                     /locus_tag="ECL_RS03315"
                     /pseudo
                     /db_xref="GeneID:44145328"
     CDS             686015..687225
                     /locus_tag="ECL_RS03315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611134.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /db_xref="GeneID:44145328"
     gene            <687264..687704
                     /locus_tag="ECL_RS03320"
                     /old_locus_tag="ECL_00688"
                     /pseudo
                     /db_xref="GeneID:9123195"
     CDS             <687264..687704
                     /locus_tag="ECL_RS03320"
                     /old_locus_tag="ECL_00688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611102.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing N-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /db_xref="GeneID:9123195"
     gene            complement(687764..688843)
                     /locus_tag="ECL_RS03325"
                     /old_locus_tag="ECL_00689"
                     /db_xref="GeneID:9123196"
     CDS             complement(687764..688843)
                     /locus_tag="ECL_RS03325"
                     /old_locus_tag="ECL_00689"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095387.1"
                     /db_xref="GeneID:9123196"
                     /translation="MNVGHLNFFKVNKCGLYKVNDDNTYGLELSETFDLIQNWVGTKS
                     LALTIPWDPKEKPNRSKCYCKDIYKDANTGDFLIMLWKSDTDSTGSLLGASEDGEIGS
                     SSVVKYTNSYKGKKVIWGRPCFYWIIPEIETIVSIKFDHSVCDSELFQDYVHASITNR
                     VKHSKRVKNKTEKGYIRLSNTDDEDLYKYMYRFDMKLRSLETTHTELGKLVPKITHIV
                     RRETIIINPNDARADWLKTFSTLVPFVSGKKNTRTRQIEIKAEAKPSLKEVKEIIEKY
                     SAEDREKRLWDNVGFATDKGITWVDKYRMRDIINIPSEDYSTYSAAYIYEQISHKRKE
                     FISPILKELKALQSQSRKKKASGED"
     gene            complement(689251..689814)
                     /locus_tag="ECL_RS03330"
                     /old_locus_tag="ECL_00690"
                     /db_xref="GeneID:9123197"
     CDS             complement(689251..689814)
                     /locus_tag="ECL_RS03330"
                     /old_locus_tag="ECL_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005134158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage polarity suppression protein"
                     /protein_id="WP_013095388.1"
                     /db_xref="GeneID:9123197"
                     /translation="MTTLTLQKAFEACQANKSAWLQRRDELKQAEQAYREQLAGNDHS
                     GRSLQTLREIIDVKKWEINQAAGRYIRSHEEVQRISIRNRLNDFMQAHGAELAAALAP
                     ELMNYSGQHAAIQRCAMQHSLDYLREALLVWLTAGEKINYSVQDYDILTAIGFRPDAA
                     SRDDCREKFTPAQNLNYTRRRAELAAQ"
     gene            complement(689843..690061)
                     /locus_tag="ECL_RS03335"
                     /old_locus_tag="ECL_00691"
                     /db_xref="GeneID:9123198"
     CDS             complement(689843..690061)
                     /locus_tag="ECL_RS03335"
                     /old_locus_tag="ECL_00691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ogr/Delta-like zinc finger family protein"
                     /protein_id="WP_013095389.1"
                     /db_xref="GeneID:9123198"
                     /translation="MFHCPFCKTSAHARTSRYLSENVKQRYHQCVNVECSATFRTLES
                     VDGIIRSPVTEPVTPVPAPAATVNRAGA"
     gene            complement(690064..690807)
                     /locus_tag="ECL_RS03340"
                     /old_locus_tag="ECL_00692"
                     /db_xref="GeneID:9123199"
     CDS             complement(690064..690807)
                     /locus_tag="ECL_RS03340"
                     /old_locus_tag="ECL_00692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001572533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage capsid protein"
                     /protein_id="WP_013095390.1"
                     /db_xref="GeneID:9123199"
                     /translation="MKPETVITDLQNVAAQQSAESSQRITDKLSAFTAARDTHAASMQ
                     ELKEIDTSIERCKQERQTALSESAEAEQDWRSRFRTLRGNLTPEMKAEHSRRIASREL
                     ADEFTGLIAELETDRTRAMLNACSTASKYLSAHDDAFTTYAGAEWAQAVNTLPAALIR
                     AFLLRIRALEMQGDSAPQSVAIGELRDALSRQGSLYHFDMKQEPVLSVTGMHRPQING
                     VDMELLRSPVKRMMLARKLAGNGETKAEV"
     gene            691347..691613
                     /locus_tag="ECL_RS03345"
                     /old_locus_tag="ECL_00694"
                     /db_xref="GeneID:9123201"
     CDS             691347..691613
                     /locus_tag="ECL_RS03345"
                     /old_locus_tag="ECL_00694"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family transcriptional regulator"
                     /protein_id="WP_013095392.1"
                     /db_xref="GeneID:9123201"
                     /translation="MHTAFSSPSSAPAAPMMPVSDAVQERFIRLPEVMHLCGLSRSTI
                     YDLISREAFPKQISLGGKNVAWAQSEITAWMADRIAERNRGCDA"
     gene            691610..692167
                     /locus_tag="ECL_RS03350"
                     /db_xref="GeneID:44145329"
     CDS             691610..692167
                     /locus_tag="ECL_RS03350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004136111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ash family protein"
                     /protein_id="WP_044158902.1"
                     /db_xref="GeneID:44145329"
                     /translation="MMMTVQQTAPFSGLLPVAVSRYSFPAVAKSAAGIGVPRNSMATP
                     DAPCVFFFVVAQAHPFSGLWCLFLHHGSSKIMVVRAGQPSGWPVSIEAGYANPVRAAT
                     SEIGVSGGSSNRYSMEAAIMATILTPSHPQFVFVFAAVRRADRKPRICMLRTVAGDEH
                     AARLSLVRDYILSFAGRLPVTEVRP"
     gene            692164..692391
                     /locus_tag="ECL_RS03355"
                     /old_locus_tag="ECL_00696"
                     /db_xref="GeneID:9123203"
     CDS             692164..692391
                     /locus_tag="ECL_RS03355"
                     /old_locus_tag="ECL_00696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003827205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095394.1"
                     /db_xref="GeneID:9123203"
                     /translation="MKQTLITPHDIECLEHMRNVGQLIDELMKVQDSTSVCRDPAQQL
                     QLTSVIYLMTAQLDGVVERCKKRWLTGEDNV"
     gene            692388..692708
                     /locus_tag="ECL_RS03360"
                     /old_locus_tag="ECL_00697"
                     /db_xref="GeneID:9123204"
     CDS             692388..692708
                     /locus_tag="ECL_RS03360"
                     /old_locus_tag="ECL_00697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF5375 domain-containing protein"
                     /protein_id="WP_013095395.1"
                     /db_xref="GeneID:9123204"
                     /translation="MKKPLSPVLRAALYRRAVACAWLTVCERQHRYEHLTLDALENAI
                     ADELEGFYLRQHGEAKGRQIACALLEDLMEAGPLMAAPSLSFLGLAVMDELCARHITS
                     PVMH"
     gene            692723..695056
                     /locus_tag="ECL_RS03365"
                     /old_locus_tag="ECL_00699"
                     /pseudo
                     /db_xref="GeneID:9123206"
     CDS             692723..695056
                     /locus_tag="ECL_RS03365"
                     /old_locus_tag="ECL_00699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224853.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /db_xref="GeneID:9123206"
     gene            complement(695610..696479)
                     /locus_tag="ECL_RS03370"
                     /old_locus_tag="ECL_00701"
                     /db_xref="GeneID:9123208"
     CDS             complement(695610..696479)
                     /locus_tag="ECL_RS03370"
                     /old_locus_tag="ECL_00701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005134147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_013095399.1"
                     /db_xref="GeneID:9123208"
                     /translation="MASSKTLEQAIADITIWRKGEQRAPHKPLLLLYVLANYQQGHAR
                     LFDYGTEVHEQLLSLLERFGPQRKAHYPNMPFWRLKGDGFWDLKNTEFCSTNGSKQPP
                     VKELVEHNVAGGFDEEHFALLGKNKNLIGSLAQQILEAHFPESIQEELADEMGFDIQQ
                     IRKVRDPLFRQQVLRAYNYECAICGFNMRHDNASVGLEAAHIKWKQFGGPCEIPNGLA
                     LCAIHHKAFDKGSIGLDESMRVLVSEAVNGGGIVGRLFWDFAGKQIALPMVKGNYPRE
                     GFVEWHLREVFRG"
     gene            696780..697235
                     /locus_tag="ECL_RS03375"
                     /old_locus_tag="ECL_00703"
                     /db_xref="GeneID:9123210"
     CDS             696780..697235
                     /locus_tag="ECL_RS03375"
                     /old_locus_tag="ECL_00703"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008501359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I addiction module toxin, SymE family"
                     /protein_id="WP_013095401.1"
                     /db_xref="GeneID:9123210"
                     /translation="MAATNFKPEFTVCKTESDAFTGMIENRELVRKNSARRLHGNQPN
                     AAPVHPRAETPQDSAACCELYARIDMKYLLLGGDWLTRAGFINGMPVKIRAMKDCIVI
                     TPQHTRELWGCLEGMSVVNVNKQKIAQWLKTFPGALNDTGDIPVIKRNA"
     gene            complement(697279..698280)
                     /gene="trpS"
                     /locus_tag="ECL_RS03380"
                     /old_locus_tag="ECL_00704"
                     /db_xref="GeneID:9123211"
     CDS             complement(697279..698280)
                     /gene="trpS"
                     /locus_tag="ECL_RS03380"
                     /old_locus_tag="ECL_00704"
                     /EC_number="6.1.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003029254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan--tRNA ligase"
                     /protein_id="WP_013095402.1"
                     /db_xref="GeneID:9123211"
                     /translation="MNPQTILTGDRPTGPLHLGHFVGSLRQRVALQQTHNQFVLIADL
                     QGLTDNGSNPQKIRDNISEVLADYLAAGIDPNLTTICLQSALPALAELTMLYMNIVTV
                     ARVERNPTVKNEIAQKGFARSLPVGFMAYPISQAADITAFKAECVPVGDDQLPMIEQT
                     NEIVHKMNSLLPAPVLRHCKAMLSDTSRLPGIDGSAKMSKSLGNTLHLSASEETIHRA
                     VSAMYTDPNHLKVSDPGQIEGNVVFTYLDAFHPDKEKVAAMKAHYQLGGLGDRVCKNE
                     LEGCLQELIAPMRERRAMYMRDKGELMAMLKRGTERAQGVTQATLREVKVGLGVPVF"
     gene            698480..698905
                     /gene="fosA"
                     /locus_tag="ECL_RS03385"
                     /old_locus_tag="ECL_00705"
                     /db_xref="GeneID:9123212"
     CDS             698480..698905
                     /gene="fosA"
                     /locus_tag="ECL_RS03385"
                     /old_locus_tag="ECL_00705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_025205684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FosA/FosA2 family fosfomycin resistance
                     glutathione transferase"
                     /protein_id="WP_044158900.1"
                     /db_xref="GeneID:9123212"
                     /translation="MLQSLNHLTLAVSDLQKSVTFWHELLGLALHARWNTGAYLTCGD
                     LWVCLSYDEARRNVPPQESDYTHYAFTVAEEDFEPFSHRLEQAGVTVWKQNKSEGESF
                     YFLDPDGHKLELHVGSLAARLAACREKPYAGMVFTSDGA"
     gene            complement(698891..699898)
                     /locus_tag="ECL_RS03390"
                     /old_locus_tag="ECL_00706"
                     /db_xref="GeneID:9123213"
     CDS             complement(698891..699898)
                     /locus_tag="ECL_RS03390"
                     /old_locus_tag="ECL_00706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015584288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_013095404.1"
                     /db_xref="GeneID:9123213"
                     /translation="MKRKTKVTMNDIARAAGVSQATVSLVLNQSRNIKLSDDTRQRVI
                     NVATELGYDRLPAVHAPRNQEEIALLVSSMQSFDPFIDAISQAREAAWRNETLLTVYD
                     YGDDIELALNIIRQLEKRNCIGIILASPVTTLVDMTAFQDCTRIPLVLLNQRDPGSPL
                     LPSFIPDDYANAFQVTKHLIACGATRIAHITGESWMEASRQRLAGYQAALQQAGLACD
                     DSLVRQTNWQFSESFTATTSLLELAERPDAIFCASDWLAIGCYQALAVNGVRIPQDML
                     LAGYDDQKISEQLTPPLTSIQLPYSELGRLAVEYLCNQEDAATHVTLAGRLKARASSP
                     V"
     gene            700084..701172
                     /locus_tag="ECL_RS03395"
                     /old_locus_tag="ECL_00707"
                     /db_xref="GeneID:9123214"
     CDS             700084..701172
                     /locus_tag="ECL_RS03395"
                     /old_locus_tag="ECL_00707"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cellulase family glycosylhydrolase"
                     /protein_id="WP_013095405.1"
                     /db_xref="GeneID:9123214"
                     /translation="MKEQWSREQAQAWYQQKGWLCGFNYLPSTAVNWTDIWQEETFDA
                     ATIERELGWAAEAGYNTLRINLPFIVWEHDRDGLMARIDRFLTIADGRGFSTMLTLMD
                     DCGFSGDEPYLGPQKPPVPGKHNSQAAASPGRDKVCDPDCWANIERYIRDVVRQFRDD
                     KRVLLWDLYNEPGNRGIFATGTQEVQYDAKLETCAHELMKLAFQWVREEDPTQPLTVC
                     AWRLPPEEEGETFFQHPLDQTALALSDVVSFHAYTHTGRMTAIIQQLQKLGRPLFCTE
                     WLARHVGSTIEEQLPLMYAAKVAPYQWGLVRGKTQTWLPWPVVMKESTDYCRLWFHDV
                     FEENGIPFSRREIALMQQLRKIAPKVQG"
     gene            701223..702644
                     /locus_tag="ECL_RS03400"
                     /old_locus_tag="ECL_00708"
                     /db_xref="GeneID:9123215"
     CDS             701223..702644
                     /locus_tag="ECL_RS03400"
                     /old_locus_tag="ECL_00708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013095406.1"
                     /db_xref="GeneID:9123215"
                     /translation="MAMTMKIPSRELWSYFGYGLGQCFSFGLVGSFINYFYTDVLGIS
                     ALAASTIFLIARAWDAVHDPLFASIMDTINSRFGKFRHFLLIAPLLITGVTLLSFYKI
                     EADMTTKILYAGVTYILWGTLYAISDIPFWSMSSVMTNDSAQRTRAVTAAMLGVNAGI
                     ACANIFFPKLAAFFAQYSNDKGYFMAALVMMLVGLPLMLNGFMQIKERVPPSPEKVTI
                     RDTFHNLRQNKPLFIVLLSFFFCVFHNVAGGLYIYFFINNLGDGSLQMAIGVMGIVAA
                     VLCLVAPMLTRRMQKRKLFMILCGLDVAVRVVMWFIGYQQVTMLFILLGLSTLFVMMT
                     NILTSSMIADTIEYAEYHTHKRCAAITFSGQTFTGKMSVAVGGGLIGVFLTMIGYVPQ
                     AQLQSEGVLSGLFFGICLLPAIGSLIRMGFMSRFTFTEEKHAEICRLLAERNASAKAP
                     GGSCALPGLQKITASSQTPADLR"
     gene            complement(702607..703428)
                     /locus_tag="ECL_RS03405"
                     /old_locus_tag="ECL_00709"
                     /db_xref="GeneID:9123216"
     CDS             complement(702607..703428)
                     /locus_tag="ECL_RS03405"
                     /old_locus_tag="ECL_00709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017456797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_013095407.1"
                     /db_xref="GeneID:9123216"
                     /translation="MATFKAKDGTQIYYKDCGAGKPVLFSHGWPLDGDMWDSQLNYLA
                     ERGFRAIAFDRRGFGRSDQPWNGYDYDTFASDINDLITTLDLQDVTLVGFSMGGGDVT
                     RYINNYGSARVAGLALLGAVTPIFGKSDTFPQGVDQSVFDGIRDGLRKDRAQFISDFA
                     TPFYGINAGQTVSAGALTQTLNIALLASLKGTIDCVTAFGETDFRPDMAKIDVPTLVI
                     HGSNDQIVPFESTGKLAAEMIKNATLKVYDNAPHGFALTHQDQLNEDLLAFVNSL"
     gene            complement(703459..705078)
                     /locus_tag="ECL_RS03410"
                     /old_locus_tag="ECL_00710"
                     /db_xref="GeneID:9123217"
     CDS             complement(703459..705078)
                     /locus_tag="ECL_RS03410"
                     /old_locus_tag="ECL_00710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013095408.1"
                     /db_xref="GeneID:9123217"
                     /translation="MTQVNDVRDAHVETTPAPTVSPWQPLSQPVFRMLWIATVVSNVG
                     SWMSDVGINWSMLSLSADPLDIALVQAASSLPMFLFALPSGVMADIVDRRKYLLFSQL
                     WVFIAAAGLAVLSFTGHVTPAVLLVTTFLLSVGAAMSSPPFQAVVPDLVSKPELGAAV
                     ALNSLGVNISRAIGPALGGFLLSLAGPWMVFALNALSVVGVAWVLWRWRPAPTVQRLP
                     PEHFFSAVRSGIRYVHAAPVLRNVLVRTVAFFVFGSAGWALLPLVARRELGLGPAGYG
                     VMLACIGLGAIAGAILLPRLRQRLNADRLMVAASLTFALTMLALAFVRHFWLLNLFEF
                     FTGFAWIAVLSTLNLGAQRSAARWVKARALAVYLTVFFGSMTAGSALWGQIASQFGTP
                     TSLVVATLGMVLASATVFRWKLEKDPDLNLDLSGQPLDGVEIDLPNERGPVLVSHEYI
                     IDPHNAKAFLQAVHELRRVRRRAGAMSWAVYEDIERPGLFIETFLMGSWIEHLRQQER
                     HTMNDLLLQSRVLAFHQGTTSPAIRYLVAPV"
     gene            complement(705075..705482)
                     /locus_tag="ECL_RS03415"
                     /old_locus_tag="ECL_00711"
                     /db_xref="GeneID:9123218"
     CDS             complement(705075..705482)
                     /locus_tag="ECL_RS03415"
                     /old_locus_tag="ECL_00711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="WP_013095409.1"
                     /db_xref="GeneID:9123218"
                     /translation="MKNTFAPPRVNLGLFFLRLTGSLLLLYVHGLPKVLHFSEELTRI
                     EDPFGFGPWASLIPAIVAEVICPLFIIAGVYTRLACLPIIAVLLVAMLAVHPNWSIAE
                     GQFGWLLLIIFTTLALTGPGQWRLQRKVTEKFA"
     gene            complement(705482..707353)
                     /locus_tag="ECL_RS03420"
                     /old_locus_tag="ECL_00712"
                     /db_xref="GeneID:9123219"
     CDS             complement(705482..707353)
                     /locus_tag="ECL_RS03420"
                     /old_locus_tag="ECL_00712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013196230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_013095410.1"
                     /db_xref="GeneID:9123219"
                     /translation="MVTLGKADLILVNGQFHTVDRENPVAEAVAVRDGKFLEVGTVAE
                     VMQHHCDGTKLVDLKGHTAIPGLNDSHLHLIRGGLNYNLELRWEGVPSLADALRMLQE
                     QALRTPSPQWVRVVGGWSEFQFAERRMPTLDEINDAAPDTPVFILHLYDRALLNRAAL
                     KVVGYTKDTPNPPGGEIQRDANGNPTGMLIARPNAMILYATLAKGPKLPLEQQVNSTR
                     QFMRELNRLGLTSAIDAGGGFQNYPEDYEVIAELHEKKQMTVRIAYNLFTQRPGHELE
                     DFEKWTDMLTPGQGSDFFRHNGAGEMLVFSAADFEDFLEPRPDLAPGMEDELERVVRH
                     LVEHRWPFRLHATYNESISRMLDVFEKVNRDIPFNGLHWFFDHAETVTQANIDRIKAL
                     GGGIAVQHRMAFQGEYFAERYGIEATRHTPPVAKMLETGVPVGLGTDATRVASYNPWT
                     ALYWLVSGRTVGGMQMYDHSARLDRDTALMLWTQGSAWFSSEQNQKGQIKVGQLADLA
                     VLSKDYFRVPEEEIKGIESVLTVVNGDIVYAAGSFGPLAPPAIPVLPEWSPVVKVPGH
                     YRSAPPQATRVGMNAVHHCSGPCGVHSHQHDFARTSEIPVSDDNAFWGALGCSCFAF"
     gene            707571..708257
                     /locus_tag="ECL_RS03425"
                     /old_locus_tag="ECL_00713"
                     /db_xref="GeneID:9123220"
     CDS             707571..708257
                     /locus_tag="ECL_RS03425"
                     /old_locus_tag="ECL_00713"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_013095411.1"
                     /db_xref="GeneID:9123220"
                     /translation="MTSSKLEVLTPANCQIIFIDHQPQMAFGVQSIDRQVLKNNTVAL
                     AKAAKVFNIPTIITTVETESFSGNTYPELLDVFPGQDILERTSMNSWDDQKVRDALKA
                     NGKKKVVVAGLWTEVCNNSFALCAMLEGDYEIYMVADASGGTTKEAHDFAMQRMIQAG
                     VIPVTWQQVMLEWQRDWARKETYTAVMDIVREHSGAYGMGVDYAYTMVHKAPSRQKSE
                     HRTLAPVPAR"
     gene            708318..708530
                     /locus_tag="ECL_RS03430"
                     /old_locus_tag="ECL_00714"
                     /db_xref="GeneID:9123221"
     CDS             708318..708530
                     /locus_tag="ECL_RS03430"
                     /old_locus_tag="ECL_00714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1427 family protein"
                     /protein_id="WP_013095412.1"
                     /db_xref="GeneID:9123221"
                     /translation="MSTGLISLAAGVLIGLMYAALKVRSPAPPALALIGLLGMLAGEQ
                     ATRHLLARDSVVSVPAVVHHPAGESS"
     gene            708527..708787
                     /locus_tag="ECL_RS03435"
                     /old_locus_tag="ECL_00715"
                     /db_xref="GeneID:9123222"
     CDS             708527..708787
                     /locus_tag="ECL_RS03435"
                     /old_locus_tag="ECL_00715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XapX domain-containing protein"
                     /protein_id="WP_013095413.1"
                     /db_xref="GeneID:9123222"
                     /translation="MKAWIISLVCGVLAGVIYALLNVHSPAPPVVALLGLFGMLVGEQ
                     LIPVGRRILNREPLTLAWFRHECVPKISGTAPPAPVKENRDV"
     gene            708810..709190
                     /locus_tag="ECL_RS03440"
                     /old_locus_tag="ECL_00716"
                     /db_xref="GeneID:9123223"
     CDS             708810..709190
                     /locus_tag="ECL_RS03440"
                     /old_locus_tag="ECL_00716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_013095414.1"
                     /db_xref="GeneID:9123223"
                     /translation="MTLPWRIAIIDDERSVRSGLSNLLESEGYATDTFDSAEVFLSHP
                     FALSGAALVITDIKLRGMNGLELFEKLRLLAAPPPPVLFISGHADENMQRYALDLGAA
                     AFLRKPINIDILLDHIQRELARRQ"
     gene            709200..714782
                     /locus_tag="ECL_RS03445"
                     /old_locus_tag="ECL_00717"
                     /db_xref="GeneID:9123224"
     CDS             709200..714782
                     /locus_tag="ECL_RS03445"
                     /old_locus_tag="ECL_00717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_013095415.1"
                     /db_xref="GeneID:9123224"
                     /translation="MNENELPAFWPAQGNLHDGRVFVLKEDVIFTVLAQEGGISWMNA
                     RHPHSGGSFIIATAVSDEEEERATRLLKNEFALRDHLQDSWAIRAVASTQYRGRFALV
                     YAPFSFELLARRAGRAISGIARFIELAIQICTPLRQMHLQNLIHGDIKPGNIFVHHDS
                     TCRLGSFGLSCSISGAFSQTRLAVSGGTPAYMSPEHTTRTQRAVDCRSDLYSLGIVLY
                     ELLTGRLPFELGENEQTNWAHYHIASEPLSPAVLRPDVPDMLSTIILKLLEKQPDNRY
                     QTVDGLIADLRRCQATLTSEGEIVAFTPGQQDRTPAIHLADSLFAAHPQANDVIAAFE
                     RVGQNIVPELVTIGGPSGIGKSSIIATALKTLQQRRVLLAVGKVDQFSPTLPYGVLSS
                     AFRTLTLHLLGLPAEEVAKWKIRLARALEGYEELAVSLVPELGLLLESKPRFSADTFS
                     IDARARFSHMVLALVKTFASQGCPLVLLLDDLQWSDAASLQTLKHLLATCGAIPLLLV
                     VAHRDIASLSDPALQQQLASLPASAQHAIEIIPQPLTVKAVARWLGTLFRVRSATTTD
                     LATLIHEKTGGNPLFVHEFFRRIVDDGLVVHNKYQDKWQYDLQAIRARHYTENVVTLV
                     LEKLEEMPDETRRLLGSIACLGGTGELEMLCRVVGMSVAEIRYALHPAVMAQLIVLTE
                     KAYAFTHDRVQEAAFALLDQRERSHLHLTTASLLAEAARQAAGNELLFRAVHHVTAAL
                     DSIQPAPQRQMFRELSLLAARRAKRTGDYHSALSYIQTSRALGNAGTVSDFMLDIEEA
                     GCEFALGHLERTRELCDAILGCPGGLTEKALAANLLVEVYIRQSDSRLALEAALCWLG
                     IFGIQISHYPEDSECDEAWKHFCNRVGDAPQQQFVQLSQMDNPQTEAVMNLLYSASIC
                     ASFICPRLHFLLLCRMMHLTLDHGITGASTTAMAWFGVLIGQRYAEYRLGFQYGTLAR
                     ELVNRHGYDAFEAKTLLPLDQLSVWTQPLSFTIECAKACFTAAVTHGDMTVACFAACH
                     QVINFLSRGDHLDGVLTSIDRGLAFVRKTHFQDIETILMLQRGYVEFLRTPVIGTWSA
                     AQVLPEAMLPAAPEQAPEQTSTMLFWYWLYRGMAHFTCGEYAAAQAELEQAGWFAWSA
                     PGHIHLLDYHLYSALSLSRQLTPETFSANHRRSIHAHYDKIALWARINPGTFADKEAL
                     IYAEIVRLDGMNSIALEQYEKAVRLSREGGFNPLNALAHELAGRFALACGYPTASDAH
                     FRGAIAAWGRAGAQAKARQLEQDFPHLLSSAQASAYDTVAFAQNEVIRDLQSVIKASR
                     ALSEEINLERLIENLMTLLLERAGAQRGLLLRVSDNHIPEIEASAWTSTDGVRVRILK
                     EVPMATDMPLSVLAAVIRTGQEIRTGKPEEFHPFSQDPYLVTSGAAVMCVPMFKQARL
                     VGVLYLENRLMPEVFTAEHSRVVSLLGAQAAVSLETARLYAELLAENIQRRRVEKELR
                     SSQTSLMLGEQISHTGSWRWELEQDLMFISEEYARILGLPEQQKKISMAEFLTFVHQD
                     DYARISTIVTQSVREGLSMRAEFRINRTDGSTRYILGIGDPVGVGSEVNEYYGIITDI
                     TSQRAAEDAMRVAQADLARVSRATTVGQLTSSIAHEINQPLMSIVSNAGASLRWLNRE
                     PARLDKVREGLEEIAAEGARAGEIIRSIQSLTRKQDPTFSRIDLHYLVHHIIALSRSE
                     LEQRHISVDYLLQAHDSFITGDSVQIQQVLLNLVMNAVEAMAEVKDRSCTITISTSNA
                     EGRVLVEIADTGSGIEPERLEKIFDSFYSTKAQGMGMGLTISASIIERHCGKLSARRR
                     EPHGTVFAFTLPLAAQEG"
     gene            complement(714786..715403)
                     /locus_tag="ECL_RS03450"
                     /old_locus_tag="ECL_00718"
                     /db_xref="GeneID:9123225"
     CDS             complement(714786..715403)
                     /locus_tag="ECL_RS03450"
                     /old_locus_tag="ECL_00718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator transcription factor"
                     /protein_id="WP_023620669.1"
                     /db_xref="GeneID:9123225"
                     /translation="MEHIVYVVDDDDAVRQSVTGLLESADLNAIGFSSAEAFLQHRFE
                     DLPSCVILDMQMPTISGFEVADALRDSGREIPIIFLTGHGTIPMSVRAIKGGAYEFLT
                     KPVESAALIDAIESALRLAENNAVRNKEHYALKQRHMSLTPREHEVLQLAISGLLNKQ
                     IAAELGVSEITVKVHRRRVMEKMQVRSVAELVRVVERLSKSLPTE"
     gene            complement(715583..715969)
                     /locus_tag="ECL_RS03455"
                     /old_locus_tag="ECL_00719"
                     /db_xref="GeneID:9123226"
     CDS             complement(715583..715969)
                     /locus_tag="ECL_RS03455"
                     /old_locus_tag="ECL_00719"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase/bleomycin resistance/extradiol
                     dioxygenase family protein"
                     /protein_id="WP_013095417.1"
                     /db_xref="GeneID:9123226"
                     /translation="MNIAHVALWTRSLKVQVQFWETVFNGRSNARYVSKNRPGFESHF
                     ITLDEGPTIELMTIPDLPDAPAHPEFIGWAHIAINVGGKAQVDSMAAQARANGTLLSA
                     PRMTGDGFYEAVIADPDGNRIELVGA"
     gene            716051..716821
                     /locus_tag="ECL_RS03460"
                     /old_locus_tag="ECL_00720"
                     /db_xref="GeneID:9123227"
     CDS             716051..716821
                     /locus_tag="ECL_RS03460"
                     /old_locus_tag="ECL_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020885337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR/GlpR transcriptional regulator"
                     /protein_id="WP_013095418.1"
                     /db_xref="GeneID:9123227"
                     /translation="MLDYAAFPEQRQARIRQILQKSGRVVCTELASQMNVSEHTIRRD
                     LHELSKEGYCKKVYGGAVLQLPDAGNFLSREQKISAEKHTIAQKAATLVQAGGCIFID
                     AGTTNLALAKALPADLNVTVVTNSPAIATELLRHPLCEVIITGGQIQRASGGSVGATA
                     AGQIQGIIFDQAFIGGCAMDPQMGLTGFDFADCEFKKAVIAQSNQTIVALTADKLPGV
                     ARFVVATCQDIDVLVVEEALEQGVVDAFAAQDIRIVCA"
     gene            716885..717481
                     /locus_tag="ECL_RS03465"
                     /old_locus_tag="ECL_00721"
                     /db_xref="GeneID:9123228"
     CDS             716885..717481
                     /locus_tag="ECL_RS03465"
                     /old_locus_tag="ECL_00721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014068719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease proteolytic subunit"
                     /protein_id="WP_013095419.1"
                     /db_xref="GeneID:9123228"
                     /translation="MHYTLKDGDKDKAEGTQSALQQKLLESRSIVISGEINQALAEKV
                     ITQLILLQSVSNDPIKLYINSQGGHVEAGDTIHDFIKFIRPDVHVIGTGWVASAGITI
                     FLAAKKEHRYSLPNTRFMIHQPLGGVRGQATDIEIEAREIIRMLDRVNKLIADATGQP
                     LEKVKKDTDRNFWMSPAEALDYGIVGKLITHYDDLKLD"
     gene            717618..718739
                     /locus_tag="ECL_RS03470"
                     /old_locus_tag="ECL_00722"
                     /db_xref="GeneID:9123229"
     CDS             717618..718739
                     /locus_tag="ECL_RS03470"
                     /old_locus_tag="ECL_00722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_013095420.1"
                     /db_xref="GeneID:9123229"
                     /translation="MAYQLNLNWPEFLEKYWQKKPVVLKNAFPNFVDPITPDELAGLA
                     MEPEVDSRLVSHFNGKWQASNGPFEHFDGLGETGWSLLAQAVNHWHMPAAELVRPFRV
                     LPDWRLDDLMISFSVPGGGVGPHIDQYDVFIIQGMGSRRWRVGDKLPMRQFCPHPALL
                     HVDPFEPIIDEDLAPGDILYIPPGFPHDGFTHETALNYSVGFRGPNGRDLISSFADYA
                     LENDLGGEHYSDPDLTCREHPGRIEQYELDRIRQMMIDMIGKPDDFTKWFGSFVSTPR
                     HELDIAAAEPPYAPEEVLDALQGGERLSRLSGLRVLNINGSFFINSEQLETVDAKAAD
                     ALCRYTELGQAELGDALNNPAFVEELTGLINQGYWYFDE"
     gene            complement(718840..720258)
                     /locus_tag="ECL_RS03475"
                     /old_locus_tag="ECL_00723"
                     /db_xref="GeneID:9123230"
     CDS             complement(718840..720258)
                     /locus_tag="ECL_RS03475"
                     /old_locus_tag="ECL_00723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008501334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_013095421.1"
                     /db_xref="GeneID:9123230"
                     /translation="MTRYQHLANLLAERIEQGLYRSGERLPSVRALSQEHGVSISTIQ
                     QAYQILENLQLITPQPRSGYFVSKRKAQPPMPAMTRPVQRPVDVTQWDEVMMLLDARA
                     DKEMISFGGGSPDVNQPSLKPLWREMSRIAQHNPAEMLSYDVLDGRLELREQIARLML
                     DGGSTVAANEIVITNGCHGALSIALLSVCKPGDIVAVESPSFHGTMQMLRGFDIKAIE
                     IPTDSQTGISIEALELALEQWPIKAVILVPNCNNPLGFIMPESRKKQVLALAQRHDIV
                     IVEDDIYGELAAEYPRPRTIHSMDIDGRVILCSSFTKTVAPGLRVGWIVPGRYYDRVM
                     HMKYAAGGFNVPGTQMAVAAFIRDGHYHRHVRRMRQIYQQNMETYTCWVRQYFPADIC
                     VTRPQGSFLLWVELPEKVDMVCVSKQLCRLKIQAAAGSLFSASGKYRNCLRINVALPP
                     TDKNREALKKMGEAIVIAMEEG"
     gene            720435..720596
                     /locus_tag="ECL_RS03480"
                     /old_locus_tag="ECL_00724"
                     /db_xref="GeneID:9123231"
     CDS             720435..720596
                     /locus_tag="ECL_RS03480"
                     /old_locus_tag="ECL_00724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015572572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1127 domain-containing protein"
                     /protein_id="WP_013095422.1"
                     /db_xref="GeneID:9123231"
                     /translation="MEFYENRSKRPFIVFVWIGKTICNWYRINRTRRILSQMSDEQLK
                     DVGLSRYDV"
     gene            complement(720683..722071)
                     /locus_tag="ECL_RS03485"
                     /old_locus_tag="ECL_00725"
                     /db_xref="GeneID:9123232"
     CDS             complement(720683..722071)
                     /locus_tag="ECL_RS03485"
                     /old_locus_tag="ECL_00725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_013095423.1"
                     /db_xref="GeneID:9123232"
                     /translation="MKPGYHDIYTRYRDNITRGVLKPGDKVPAIRVLAEELKVARKTV
                     ETAYAILIGEGYLMSQGARGTRVNPDLLLPATPAPADHTTGTLPASLISQRERAGFLR
                     PGIPSLDSFPYKKWLLLAGQATRSMRPEEMLNPPVLGWYPLRQAIARYLNISRGLSCT
                     AEQVLITSGYSGSLRLILDTLASRSDKVVFEDPGYFMGQQLLKRIVPRLHTVPVDRCG
                     IDTEYLLHHHRDARFAIVTPSHQSPLAVTLSLPRKQQLLDWASQNGAWIIEDDYDGEF
                     HYTRKVLPSLKSLDRHDRVIFMGTFSKTIMPSLRMGYIVMPASTVEAFTDCADIVASG
                     QPVLTQKILTTFLNEGHFFRHLKKMRALYQTRREWMIAALREVYGDLFFTEQNDGGMH
                     IVAFLAKGSNDREVACCWQAQQLQVNALSEWYRGSGKRYGLVMGYNNVRSYQEAVDLL
                     ERPKRQTLALLS"
     gene            722174..722653
                     /locus_tag="ECL_RS03490"
                     /old_locus_tag="ECL_00726"
                     /db_xref="GeneID:9123233"
     CDS             722174..722653
                     /locus_tag="ECL_RS03490"
                     /old_locus_tag="ECL_00726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymuconolactone decarboxylase family
                     protein"
                     /protein_id="WP_013095424.1"
                     /db_xref="GeneID:9123233"
                     /translation="MSTRVNHHKVTPALANALSALSMEVAKTSIDPALKHLIDIRVSQ
                     LNGCTFCLDMHSKEAKIAGERELRLYHLAAWRESPLFSAREKAALAFAEALTQIGVHG
                     VSDALYRSVAEHFSDVEISELNFAIVAINAWNRLGITSRMAPGSLDAAYGLNKANLE"
     gene            complement(722640..723542)
                     /locus_tag="ECL_RS03495"
                     /old_locus_tag="ECL_00727"
                     /db_xref="GeneID:9123234"
     CDS             complement(722640..723542)
                     /locus_tag="ECL_RS03495"
                     /old_locus_tag="ECL_00727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003863079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013095425.1"
                     /db_xref="GeneID:9123234"
                     /translation="MHRSGLTELEVVMAVVRRGSFRGAAQELGMSATAVSNAIAGLES
                     RLETRLFNRTTRSVALTDAGQRYVARIGPALQEIRQAGEEIHSDTGEPAGTLRLNVPN
                     NIGSLFLDQLLIDFMIRYPKMRVETVSEARMIDIVAEGYDAGIRLEEAVPQDMIAVPL
                     TGEIRQLVTATPDYFARHGVPQTPEDLLLHQGIGMRMAHGGIYRWELARRGVQYALAV
                     PPRFATSDLFASIRAVKAGLGIGFLPELYIRDELKSGELLSVLNDWTQPFAGLRLYYP
                     GHRHVPPGLRALVAMIRERGIIPG"
     gene            723643..725058
                     /locus_tag="ECL_RS03500"
                     /old_locus_tag="ECL_00728"
                     /db_xref="GeneID:9123235"
     CDS             723643..725058
                     /locus_tag="ECL_RS03500"
                     /old_locus_tag="ECL_00728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010427241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase family protein"
                     /protein_id="WP_013095426.1"
                     /db_xref="GeneID:9123235"
                     /translation="MHHIEQIFINGEFVTPHGTERFDLYNPATAQVIGQVRLADEVDA
                     ERAIAAAKVAFPAWSQTTKQERIAALTRMHAAVAARHDELLEAIIEEYGAPAARSAWM
                     ASYPTDVIAQAIEALEAFEFAFSAGAASVQMTPLGVAGLITPWNSDAGFICGKLAAAL
                     AAGCTAVIKPSEMSALQTQIITEALRDAALPAGVFNIITGRGETVGETISRHPDVAKI
                     SFTGSTNTGKAILHNAAEGFKRVTLELGGKSPTILLDDVDLARAIPLVIQAGFMNSGQ
                     ACVAGTRILVPQSRKAEMETALAQAVTAVKSGDPRESATEIGPMVSEKQWLRVQGYIR
                     KGLDEGARLLAGGEGRPDGTRDGWFVRPTLFTDVNNQMTIAREEIFGPVLCIIPYQDE
                     AEAVAIANDTEYGLSAMVLGRDTGRARRVAQQIVSGRVLVNTLAHEPKAPFGGFKHSG
                     VGREMGEWGIGAFMEPKSIVG"
     gene            complement(725108..725629)
                     /locus_tag="ECL_RS03505"
                     /old_locus_tag="ECL_00729"
                     /db_xref="GeneID:9123236"
     CDS             complement(725108..725629)
                     /locus_tag="ECL_RS03505"
                     /old_locus_tag="ECL_00729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008813541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_013095427.1"
                     /db_xref="GeneID:9123236"
                     /translation="MNNMKIGIFSDDVEYDLSHFDCGEESLNTFLTAHLKRQHRGKFL
                     RGYVLVASGEKPRVLGYYTLSGSCFEKAYLPSKTQQKRVPYKNVPSVTLGRLAIDKRF
                     QGQGLGELLVTHALKTVYLASFAVGIHGIFVEALNDSAKNFYLKLGFIALQAENENTL
                     FLPTKTIERLFAD"
     gene            complement(725633..725902)
                     /locus_tag="ECL_RS03510"
                     /old_locus_tag="ECL_00730"
                     /db_xref="GeneID:9123237"
     CDS             complement(725633..725902)
                     /locus_tag="ECL_RS03510"
                     /old_locus_tag="ECL_00730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001303459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1778 domain-containing protein"
                     /protein_id="WP_013095428.1"
                     /db_xref="GeneID:9123237"
                     /translation="MSALKKQRIDLRLTEDDKSLIEEAAAMTNQSISQFMVSTASERA
                     AEVIEQHRRLILNEASWNQVMDAISNPPTPNERLKRAARRLQDLE"
     gene            726117..726440
                     /locus_tag="ECL_RS03515"
                     /old_locus_tag="ECL_00731"
                     /db_xref="GeneID:9123238"
     CDS             726117..726440
                     /locus_tag="ECL_RS03515"
                     /old_locus_tag="ECL_00731"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014068727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_013095429.1"
                     /db_xref="GeneID:9123238"
                     /translation="MIAVIFEAKATPAHQARYLQLAAELKPLLADIDGFIDIERFQSL
                     TTDGKILSLSWWRDEEAIRNWKQNVFHQAAQAEGRESIFTYYRIRVAQLVREYSAENG
                     GHADV"
     gene            726433..726831
                     /locus_tag="ECL_RS03520"
                     /old_locus_tag="ECL_00732"
                     /db_xref="GeneID:9123239"
     CDS             726433..726831
                     /locus_tag="ECL_RS03520"
                     /old_locus_tag="ECL_00732"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid-binding protein"
                     /protein_id="WP_013095430.1"
                     /db_xref="GeneID:9123239"
                     /translation="MYDVHVIFNDMPGELARFGQLLGSKGIGLEGGGVFGVEAHFLVE
                     DGEKARHVLLEAGFNLKAVRQPIIRKLRQERPGELGEIAAALAARGVSIFTQYSDHAN
                     HLILLTDNDKLAAAITEPWATYVKDELTAR"
     gene            726803..727498
                     /locus_tag="ECL_RS03525"
                     /old_locus_tag="ECL_00733"
                     /db_xref="GeneID:9123240"
     CDS             726803..727498
                     /locus_tag="ECL_RS03525"
                     /old_locus_tag="ECL_00733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_013095431.1"
                     /db_xref="GeneID:9123240"
                     /translation="MLKTSLPPDNSAALEQAIAAVAAAMADPSRVKMLCALMDGRAWT
                     ATELSTAADVAPSTASGHLARLLDGKLITCLSQGRHRYYRLAGHDVAELVEQMMGLSW
                     HRISPPETSAPKALREARTCYDHLAGAVAVQIYDFMQAESWLEPDGSVLTLYGREQFL
                     KLGIPLSTHPRRKACCACLDWSERRFHLGGEAGAALLMHLESKGWIQRVAGYREVVLT
                     ASGKGAITRHFSR"
     gene            727702..728172
                     /locus_tag="ECL_RS03530"
                     /old_locus_tag="ECL_00734"
                     /db_xref="GeneID:9123241"
     CDS             727702..728172
                     /locus_tag="ECL_RS03530"
                     /old_locus_tag="ECL_00734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014882398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_013095432.1"
                     /db_xref="GeneID:9123241"
                     /translation="MSEEQLFCRRPMGMRMAMIVRQWRAVIDDAILDTGLTQSSWTVM
                     MQLHQLGDNVSVSELAEVQGIELPPLMRTLTQLEKQGYLLRTVSPYDKRIRLLTLTPE
                     GKAILKRLTQVIETYQTRVSQNIAPEHIEIFSATLNQIACNLRTIREEDNKTEK"
     gene            728169..729236
                     /locus_tag="ECL_RS03535"
                     /old_locus_tag="ECL_00735"
                     /db_xref="GeneID:9123242"
     CDS             728169..729236
                     /locus_tag="ECL_RS03535"
                     /old_locus_tag="ECL_00735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_095440265.1"
                     /db_xref="GeneID:9123242"
                     /translation="MMTPEQKFARWVRVSIASFLLMFVYFVVADIWIPLTPDSTVMRV
                     VTPVSPRVSGYVSAVHVHNNSQVTRGDLLFELDDTPFRNKVEAAQIALEQARLSNEQL
                     DAQIAAAQASLKTAVLTARNDKVTFDRYQKLSTLQNVSQADLDKVRTTWQSSEQSVSS
                     IQANIHNLRIQRGEREEHRNVTLQKYRNALDEAELNLGWTKVYAQADGTVSNLQLSPG
                     FYASSGSAALALVNNQTDIVADFREKSLRHTHQGTDAAVVFDAFPGQVFRAHVTSSDA
                     GILAGQEAVSGELSAPETSNRWVRDAQRMRIHVALDETLPKPLPTGARATVQLYNSEG
                     PFARFFSGMQIHLVSLLHYVY"
     gene            729226..730302
                     /locus_tag="ECL_RS03540"
                     /old_locus_tag="ECL_00736"
                     /db_xref="GeneID:9123243"
     CDS             729226..730302
                     /locus_tag="ECL_RS03540"
                     /old_locus_tag="ECL_00736"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2955 domain-containing protein"
                     /protein_id="WP_013095434.1"
                     /db_xref="GeneID:9123243"
                     /translation="MSISTLARVFTPHGNIVYTANDFRQTLRIVFAGMIALSISSFYN
                     TSYGVFYVVYPIMLLSLVPVFNRHVAKQFIFSASLNCVEMVIIIGYLSQWPVIMTLVV
                     FALYVMRFRFMSKGPLFLFGSMGVVCQSVMLNFMSYPTTDWHTLLFSNIEASVMAVCL
                     SALMNYLLPDVEPRKPPPLIEKDDARVRHESLLSGTVATMIFVIFQISDLSDSLSALM
                     AGVLILFPMHYRGAVMSSIWRVAGVVLGCLYILVVQLILYDHSSHMLLMMPLIGLGLA
                     FGARLHVMEKVGAGVGFASITTIGIMFGQNMHPDSDLVFSDLYRITSVTFSLVATLTM
                     VFLVHLILNRFEATRYVIAPPKTE"
     gene            complement(730272..731570)
                     /locus_tag="ECL_RS03545"
                     /old_locus_tag="ECL_00737"
                     /db_xref="GeneID:9123244"
     CDS             complement(730272..731570)
                     /locus_tag="ECL_RS03545"
                     /old_locus_tag="ECL_00737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006174140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF445 domain-containing protein"
                     /protein_id="WP_013095435.1"
                     /db_xref="GeneID:9123244"
                     /translation="MEKIAELKRAKLLALSLLLIAVAAFITTLFLPQTFWVRGVKAIA
                     EAAMVGALADWFAVVALFRRVPIPFISRHTAIIPRNKDRIGDNLGQFVQEKFLDTQSL
                     VALIRRYEPAQMIGTWFSKPDNAQRVGQHLIQVMGGFLELTDDGRIQRLLKRAVHKAI
                     DKVDFTETSAVMLESMTKNNRHQVLLDAIINRLITLIQRDSTREFISDQIVHWLKTEH
                     PRKAMVLPTEWLGDQSAEMVSNAVNTLLDDVSHDRTHQIRQAFDRATLKLIDNLKNDP
                     EMAAKAENIKHYLKNDDAFNRYLGEMWADLRQWLKADMQREDSRVKQRIANAGQWFGE
                     TLLGDDSLRASLNEHLEQAAHRVAPDFAAFLTRHISDTVKSWDAKDMSRQIELNIGKD
                     LQFIRVNGTLVGGTIGLILFLLSQLPAVLAHYSVLGGAMT"
     gene            complement(731554..732228)
                     /locus_tag="ECL_RS03550"
                     /old_locus_tag="ECL_00738"
                     /db_xref="GeneID:9123245"
     CDS             complement(731554..732228)
                     /locus_tag="ECL_RS03550"
                     /old_locus_tag="ECL_00738"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020885321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_013095436.1"
                     /db_xref="GeneID:9123245"
                     /translation="MELLFPSAFLALALAHFVALLSPGPDFFLLVGYAARYRVRGSAG
                     LCLGIAAGNGLYILLVIIGWSALRQFTWLFTLIEFCGALYLLWIGSHLVRSRPQALAL
                     NETHQRFPSLRKQILLGLGSALLNPKNALFYLALMTALLGPDVTLLQQSTCGVWMVMV
                     VLVWDLALVSLMGLPAVQQRLSRSLWLIERAAGAVLIGFGVWVLWRFLHFPPRLPLSL
                     THGKNR"
     gene            complement(732277..733020)
                     /locus_tag="ECL_RS03555"
                     /old_locus_tag="ECL_00739"
                     /db_xref="GeneID:9123246"
     CDS             complement(732277..733020)
                     /locus_tag="ECL_RS03555"
                     /old_locus_tag="ECL_00739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014830525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_013095437.1"
                     /db_xref="GeneID:9123246"
                     /translation="MTHTRQIRQTFNRLPGLELRSTWQSTVAYKRHCHPQLSIGAIVE
                     GQTCCRCNDTQYILHPGDLIVIPAHVPHSCNPVAGQPRSYHMLYIDTDYPLAEQVIRD
                     STLFALYQNVVENMSANSLNMLISALPRCASRTGELRTTSQHIQQAFLADLTSPPSLD
                     DLAHRFSLRKETLIRTFRQDTGLTPGSFLNISRVEYAKARLRAGDDIADVGYQSGFAD
                     QSHFHKTFVIYTAATPRQYATGRSISDNK"
     gene            733158..734528
                     /locus_tag="ECL_RS03560"
                     /old_locus_tag="ECL_00740"
                     /db_xref="GeneID:9123247"
     CDS             733158..734528
                     /locus_tag="ECL_RS03560"
                     /old_locus_tag="ECL_00740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005224918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_013095438.1"
                     /db_xref="GeneID:9123247"
                     /translation="MAYQTVNPATNQLIKEYPSHTDADIEAALKAADALYHSQWAKGD
                     IEQRLPVLHKLADLIDERTEELAKIASQEMGKLIEQSRGEVKLCAQIARYYADNAKQF
                     LAPVKYPSELGEAWVEHHPIGVLMAVEPWNFPYYQLMRVLAPNLAAGNPVLAKHASIV
                     PHCAETFAHLVREAGAPEGAWTNLFISSEQVANIIADDRVQGAALTGSEKAGSVVAAQ
                     AAKHIKKSTLELGGNDVFVVLDDADLDKAVKTGVNARLNNAGQVCTAAKRFILHEKIA
                     DAFLSKFTDAFKQVKIGDPLDESTTLGPLSSKDALETLTKQVNEAVKKGATLHYGGKP
                     VQRDGSFFEPTILTNISRDNPAYFEEFFGPVAQIYVVKNDDEAVALANDSHYGLGGAV
                     FSQDIERAKKMASRIETGMVYINWLTDTAPELPFGGVKRSGYGRELSDLGIKEFVNQK
                     LVVVRK"
     gene            complement(734570..734890)
                     /locus_tag="ECL_RS03565"
                     /old_locus_tag="ECL_00741"
                     /db_xref="GeneID:9123248"
     CDS             complement(734570..734890)
                     /locus_tag="ECL_RS03565"
                     /old_locus_tag="ECL_00741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008501314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013095439.1"
                     /db_xref="GeneID:9123248"
                     /translation="MKHRITALCVLSLTLLLTGCVQYKWVKPGVSDAEMNKKLTECEA
                     QALIDLPPDNVVTGSDSEKTDLKNKKKDISTSYTVEDANEDRRATLVDSCMFKSGWDK
                     IEVQ"
     gene            complement(734890..735435)
                     /locus_tag="ECL_RS03570"
                     /old_locus_tag="ECL_00742"
                     /db_xref="GeneID:9123249"
     CDS