GenomeNet

Database: RefSeq
Entry: NC_014416
LinkDB: NC_014416
Original site: NC_014416 
LOCUS       NC_014416             175776 bp    DNA     linear   CON 10-OCT-2017
DEFINITION  Encephalitozoon intestinalis ATCC 50506 chromosome II, complete
            sequence.
ACCESSION   NC_014416
VERSION     NC_014416.1
DBLINK      BioProject: PRJNA51607
            BioSample: SAMN03081424
            Assembly: GCF_000146465.1
KEYWORDS    RefSeq.
SOURCE      Encephalitozoon intestinalis ATCC 50506
  ORGANISM  Encephalitozoon intestinalis ATCC 50506
            Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
REFERENCE   1  (bases 1 to 175776)
  AUTHORS   Pombert,J.F., Selman,M., Burki,F., Bardell,F.T., Farinelli,L.,
            Solter,L.F., Whitman,D.W., Weiss,L.M., Corradi,N. and Keeling,P.J.
  TITLE     Gain and loss of multiple functionally related, horizontally
            transferred genes in the reduced genomes of two microsporidian
            parasites
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (31), 12638-12643 (2012)
   PUBMED   22802648
REFERENCE   2  (bases 1 to 175776)
  AUTHORS   Corradi,N., Pombert,J.F., Farinelli,L., Didier,E.S. and
            Keeling,P.J.
  TITLE     The complete sequence of the smallest known nuclear genome from the
            microsporidian Encephalitozoon intestinalis
  JOURNAL   Nat Commun 1, 77 (2010)
   PUBMED   20865802
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 175776)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 175776)
  AUTHORS   Corradi,N., Pombert,J.-F. and Keeling,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAR-2014) Botany, University of British Columbia,
            3529-6270 University Boulevard, Vancouver, British Columbia V6T
            1Z4, Canada
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 175776)
  AUTHORS   Corradi,N., Pombert,J.-F., Farinelli,L., Didier,E. and Keeling,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2010) Botany, University of British Columbia,
            3529-6270 University Boulevard, Vancouver, British Columbia V6T
            1Z4, Canada
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001943.
            Linear chromosome is missing portions of the telomeric regions.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..175776
                     /organism="Encephalitozoon intestinalis ATCC 50506"
                     /mol_type="genomic DNA"
                     /strain="ATCC 50506"
                     /db_xref="taxon:876142"
                     /chromosome="II"
     gene            <590..>1357
                     /locus_tag="Eint_020010"
                     /db_xref="GeneID:9698729"
     mRNA            <590..>1357
                     /locus_tag="Eint_020010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072316.1"
                     /db_xref="GeneID:9698729"
     CDS             590..1357
                     /locus_tag="Eint_020010"
                     /note="similar to ECU10_1850, ECU02_1570, ECU03_0040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072362.1"
                     /db_xref="GeneID:9698729"
                     /translation="MNIQKTPKDLFDNKNEEKITKKLHPEYGVYFGALVSILIPAIMI
                     CLFEEDTIKKNPFFISLMVGFSFLYSMILNVYTFMKIRKCDWESLETYYYISKFFLLL
                     FSIISALSLISIPMGGNFPRNDQKLYTFGFFPCIVSTAYLLFFNLTPKSSPFMGPVTD
                     IFIILLFLTYSIGIWLCVALENSNFSFLIYLGVLFLALIPLKLLKDQYNPCRKDDKAS
                     TLQKQILFILILITAATIYGLLLFFDLHSLPFFNFND"
     gene            complement(<1844..>3895)
                     /locus_tag="Eint_020020"
                     /db_xref="GeneID:9698769"
     mRNA            complement(<1844..>3895)
                     /locus_tag="Eint_020020"
                     /product="DnaK-like protein"
                     /transcript_id="XM_003072317.1"
                     /db_xref="GeneID:9698769"
     CDS             complement(1844..3895)
                     /locus_tag="Eint_020020"
                     /note="similar to ECU02_0100"
                     /codon_start=1
                     /product="DnaK-like protein"
                     /protein_id="XP_003072363.1"
                     /db_xref="GeneID:9698769"
                     /translation="MQVRGLLLSLATIFCTGTENADLRESVAVGIDLGTTYSCISVYS
                     PSLKDTRFVLSPSGEETYPSVVFFKKLPEGDGKKSKYEAVAGWAGLQMYNSEGNANTY
                     FYAFKRGIGIEDLANIDRKVEDIKRNASVPIFVENVGGKKRVAYKIQEPNQSGYESVT
                     PEELSSHVLRMLKDQILKDYKIQGLTITYPAYFDPNQVAATIKAAEMAGLPTPLTWKE
                     PSAAAFAHTYDLIRKGITTKEEVDDMNICVFDLGGGTFDVSIVESSGGFMMVPCYEGN
                     NFLGGENVNDNLTKHFAAYIKSTTGFDVMENQNVKLRLRNLVEEMKKDLCDQVRKSPG
                     RKANPLITKNFIYDGEKSVTLELTNEKFNELNEAFYSKIKSIMNSLLSGDGKDNKGYD
                     KNLINRVLLVGGSTRIPKVIDIVEEIFGADKIHYEGINADTIVARGAALYTANELNML
                     SESEQIVTADSVPLSLGICTEEDHFEAIISKGALLPATGTKEFTTAQDNQTKVRIRVA
                     LGGLESFKDNVHIGDIELGLPGNQPRGVPRIAVTLEINTHGKIYVKAVDLQTDKTADA
                     YFSSAVANMTPEEIERFEERVHSEENQELVKKREVVKKLEYALEQAESPKFVEVIPEN
                     IKKDALEYVQKTRLWLEKHKEIAPRIHIEEKLQEFDNGIKEFLSSAKSGEEKEIGREE
                     L"
     gene            complement(<4021..>5016)
                     /locus_tag="Eint_020030"
                     /db_xref="GeneID:9698799"
     mRNA            complement(<4021..>5016)
                     /locus_tag="Eint_020030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072318.2"
                     /db_xref="GeneID:9698799"
     CDS             complement(4021..5016)
                     /locus_tag="Eint_020030"
                     /note="similar to ECU02_0110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072364.2"
                     /db_xref="GeneID:9698799"
                     /translation="MDLSTIQEARISNILRTTCKLMERLFQMYKCGRISREEYMQKLE
                     KLKEVIKLNIDEIEKNAKTIVARKEPVNVLNVFIMEHFEHMGYFDTAELMARKFSIGG
                     YSDSDFYKRIYEIRNQVETGSFEDALAFCREHRMELRSIKWEEAISLENDLKVEKFIE
                     MCHAQEFDKALEFINKEFKRVPEQIKSYLPVLVSNSNFRKYPFSRHTKTAEQFLRCAL
                     KLFRRGPKSRLMQRIEYGMMAYKTYRCIDTENDNCPACCKAFRLREDVPFNKHEISIL
                     LCRGSGEEMDDSNQPYVFENGFIYGAKYIESSEHICINSKAADNSLRYPRLCFIL"
     gene            complement(<5144..>6850)
                     /locus_tag="Eint_020040"
                     /db_xref="GeneID:9698774"
     mRNA            complement(<5144..>6850)
                     /locus_tag="Eint_020040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072319.2"
                     /db_xref="GeneID:9698774"
     CDS             complement(5144..6850)
                     /locus_tag="Eint_020040"
                     /note="similar to ECU02_0120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072365.2"
                     /db_xref="GeneID:9698774"
                     /translation="MILNGDNRKIFINGEVVYKVGENSIEEYCKKDLVLLRRRKFFKI
                     KVAREFDRKYYFLTRKKIFIYENLFEDPAHEVEVPSEKTFDFYVHHGQLFYLVQEMDR
                     YLGINEEQEMLFDFEAGTYFWDGVDFYICSNKSLIRFDIVKRRSSEVLRDVNIKYLAV
                     KNGMIAYTDDANVLNFLKGKSSLSYHYHARPITGIIITTLESLLVVCSSRKLVRIETK
                     RDEKTFLTTFEGDLVDFVQDESNVYILTVFCLLVYDLKVGSTKKQIFSLPNFEYCKSL
                     NGFENREEEIPGKEIFEHNIKKTKVKMPYVFQKEDFLFSSKNSIVAVRRDYIFIYDLE
                     KEEMQRIAYLEGFDFFYSSGFIIGLEHRREKGRRTAKVYKIESDGLLLIGKYNSVETL
                     ATPADMVFSKGKLFLYLDGSLIEVIGPGITKSLINQNIRQIEETKNGIFLLDECGIFR
                     VESEEWILREEKITSFRISGDTLFVSLPRDGVLSFEMKDGAAEENLISDSNVMDVFVE
                     DQVILTFSRVKDASVLKRYRKDGNSWKKNGEALVDKRPRRIFNKNIYLSITNKLHKVD
                     FS"
     gene            complement(<6925..>7794)
                     /locus_tag="Eint_020050"
                     /db_xref="GeneID:9698770"
     mRNA            complement(<6925..>7794)
                     /locus_tag="Eint_020050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072320.1"
                     /db_xref="GeneID:9698770"
     CDS             complement(6925..7794)
                     /locus_tag="Eint_020050"
                     /note="similar to ECU02_0130"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072366.1"
                     /db_xref="GeneID:9698770"
                     /translation="MDLVVYLENALENTEKTLQVASLSKEVEDRFKDYRDLIFYQRNI
                     DSQVEEKEKRIFMELEICKVLRKFHEWILEQSFGYIEAVYAKKKGILESEVGKPIKNI
                     EEEHYKKGVSALLSCLYNNTDMAAKLLSFQRSRKYSDHTKNVERKVGCSINRLGLNIL
                     KGAERGVEFHSKVMREREDVMLKYEDLKIKNLLGLLKQRFIEHEEAIKEEAISKILLV
                     LSQGSVENDIRFVKLIDETLERTEIYESPEIARMSVQFVIAKKYVEDMISLKEQPFFQ
                     RYLEQNGRKYEIR"
     gene            complement(<7909..>8568)
                     /locus_tag="Eint_020060"
                     /db_xref="GeneID:9698714"
     mRNA            complement(<7909..>8568)
                     /locus_tag="Eint_020060"
                     /product="Ran GTPase activating protein"
                     /transcript_id="XM_003072321.1"
                     /db_xref="GeneID:9698714"
     CDS             complement(7909..8568)
                     /locus_tag="Eint_020060"
                     /note="similar to ECU02_0140"
                     /codon_start=1
                     /product="Ran GTPase activating protein"
                     /protein_id="XP_003072367.1"
                     /db_xref="GeneID:9698714"
                     /translation="MAEVEKKEEQMGIEAVSGKKEEELQSDTKEETSLGDSKEKIETK
                     KTQQSPFLTNTVPRKDNSKGGEEKDKIDVTEVVEKQRKHLEENQSDDVLFKARCKLYY
                     FSEETKALEERAEGTMVIGMHTKSNLVKITVFRDQIGRLGCNHFINPRFKAQPHGKVS
                     NGWMWMSTEDTVETDAQRKKTQLFVVKFFSEEDFQKFGEEYDLGRSHNEKSLKTKANK
                     G"
     gene            complement(<8635..>9297)
                     /locus_tag="Eint_020070"
                     /db_xref="GeneID:9698715"
     mRNA            complement(<8635..>9297)
                     /locus_tag="Eint_020070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072322.2"
                     /db_xref="GeneID:9698715"
     CDS             complement(8635..9297)
                     /locus_tag="Eint_020070"
                     /note="similar to ECU02_0150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072368.2"
                     /db_xref="GeneID:9698715"
                     /translation="MFGNKHFLILLMGLAICSQGIGIRRVPVEVYISEAGRRKFLDKG
                     RSIEDIVGSVAEELEQKMNEHVYADRASTDKRKFHFDWSVSGMTSPEIDLDKCGKDTS
                     RFQYDLVQAARDKPGASIILLYTCESEGYSEDFILAGQKTPLVIQRKYPECSNDVATF
                     TETEPMKIESIIANALFITAGSPLNDMVEFEEVDNGRDGFKRDIRLKTTDFSLFSGGI
                     CH"
     gene            <9553..>10851
                     /locus_tag="Eint_020080"
                     /db_xref="GeneID:9698771"
     mRNA            <9553..>10851
                     /locus_tag="Eint_020080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072323.1"
                     /db_xref="GeneID:9698771"
     CDS             9553..10851
                     /locus_tag="Eint_020080"
                     /note="similar to ECU02_0160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072369.1"
                     /db_xref="GeneID:9698771"
                     /translation="MKILLLSPLVLAHVINLVILYEKTGLKEVKEMYHYVVERLLDKF
                     NEHLQRRGIRISLMDFLAYDDYLVKPGYQDISIMGGEESLDARIEALNGIPTNVILVA
                     SASPEEEREKFIPNSPCTSRFISNMVSNDIVDDELLTKIIYAVLDWMRGLFKVEVPSP
                     VKERSPEVFDKFAKDVTTPEFIENLKQCTKETRDKFEKFIRAMNWDEEKMLSLRMMSE
                     KTDHSQNEGVEISSPLKWVLSKSEKKTKDTETDHQCSEENKSKKEHSESSSEDEDSSS
                     KNDKKKPTKSHKPKEVPSKRIKKILSRKEESDDFTDLEETDKKERDKEYEKSQGNGSL
                     RYLDKNTNLHNMRRLKEDEETLMEEKIREELQKIISHEPHNTKKKFEDSIFTGIPPYS
                     DEEARNGPSRILFSSRATPVKGTSRLNRSLSYGRIPYRGG"
     gene            <11041..>11688
                     /locus_tag="Eint_020090"
                     /db_xref="GeneID:9698772"
     mRNA            <11041..>11688
                     /locus_tag="Eint_020090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072324.1"
                     /db_xref="GeneID:9698772"
     CDS             11041..11688
                     /locus_tag="Eint_020090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072370.1"
                     /db_xref="GeneID:9698772"
                     /translation="MKSRLLVFACFVFLVYAREPLKIGFLEGIFGKKSSDKETGKGNG
                     GGGGPLPPNPDEEEAIRKLRLQALMLGTEVEDLGKIINQQSRELEQRREEEGEKLKNS
                     SQGVIQASENIKSINEESKKGRRKIRRLQKRIKPHTSAIEKIINDEEGGEDRDDDDND
                     DDDDDDDDDDDDDDKKKKKSKKKSKKKNKKKDGKNKPKSGGLRGLLGLGKKGQKD"
     gene            <11828..>12274
                     /locus_tag="Eint_020100"
                     /db_xref="GeneID:9698773"
     mRNA            <11828..>12274
                     /locus_tag="Eint_020100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072325.2"
                     /db_xref="GeneID:9698773"
     CDS             11828..12274
                     /locus_tag="Eint_020100"
                     /note="similar to ECU02_0180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072371.2"
                     /db_xref="GeneID:9698773"
                     /translation="MRCLPHLFLTTFFRIYTMNLSHENLLEKESVKNAVSRLSGMIVN
                     KGSNLLNGYSKSLYLSKAKEEESEEESSKDDSSSDSEEEKDDSEKEEDNESDDDDEDE
                     DEDSSSGSSGGKKDLGKAALEGALTGLGDTPQGKMVNNVRKLFPFG"
     gene            <12455..>12877
                     /locus_tag="Eint_020110"
                     /db_xref="GeneID:9698699"
     mRNA            <12455..>12877
                     /locus_tag="Eint_020110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072326.1"
                     /db_xref="GeneID:9698699"
     CDS             12455..12877
                     /locus_tag="Eint_020110"
                     /note="similar to ECU02_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072372.1"
                     /db_xref="GeneID:9698699"
                     /translation="MKKGIIALCALAVSDAKSLHFPHEKESSKSRKEISRMEASSLIS
                     SLDKGGYLLPMSSYAKGKDNNSESDSSEGKKEKEKKEKKKKKKKKKKKKKKEKEKEKE
                     EEEGEGEKRKKDDSKEDDDEEEEEEKKKKKHKKKKDDD"
     gene            complement(<13011..>14798)
                     /locus_tag="Eint_020120"
                     /db_xref="GeneID:9698700"
     mRNA            complement(<13011..>14798)
                     /locus_tag="Eint_020120"
                     /product="plasmid maintenance protein"
                     /transcript_id="XM_003072327.1"
                     /db_xref="GeneID:9698700"
     CDS             complement(13011..14798)
                     /locus_tag="Eint_020120"
                     /note="similar to ECU02_0200"
                     /codon_start=1
                     /product="plasmid maintenance protein"
                     /protein_id="XP_003072373.1"
                     /db_xref="GeneID:9698700"
                     /translation="MGIVHKLITSVSGLYNNINPITLSGVNDVIVVEGRDGILRCTEF
                     QLRFGRLYFYGVNNQTVHLFINGKMCDIVMSITSQGELFFEKDTEDDLGMDYDIILEY
                     NKKLSTMFDSDDEMILSKRLEQLSLGNASDLSTLNFDFLAKFKEKNFNIEDIEFKKYL
                     RSERAENLKKRMYGQFLHQREYKDSYHDFEKKFVKFGNLINSTEHFDFLIGRYRSVLH
                     LIVGLHLYPPFNDKTCDGNTKGCVGASISFSLCYNKKIQESLDHTFNSFLVQEIRNIE
                     NLVVRVQGCKKCSFRFYLPYDIFCKIFFEIQGSRINKAKRIMKILENEHNKHLGWNIF
                     GTKKIIKRDVSFSLKLDSEELKMLNLKEGKNQAVFKISGLNKHLEGNIYLWKDDAKII
                     VSDIDGTITKSDVWGHLYGMIGKDWTHHGVASLYTKIVRNGYKIVYLTARSLGQSFST
                     KSYLKNVCQDGYKLPDGPVILSPDGVFAALYRELIIRRPEDFKIACLKTIQGLFCDSN
                     PFVAGFGNKITDVITYKAMEIPLSRIFTINHKGELYVELVKTLSGTYRTMNDFVDSMF
                     PYLSAKTIPFIDHSFSDFSWWSIQNKSHP"
     gene            <14961..>15551
                     /locus_tag="Eint_020130"
                     /db_xref="GeneID:9698790"
     mRNA            <14961..>15551
                     /locus_tag="Eint_020130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072328.1"
                     /db_xref="GeneID:9698790"
     CDS             14961..15551
                     /locus_tag="Eint_020130"
                     /note="similar to ECU02_0210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072374.1"
                     /db_xref="GeneID:9698790"
                     /translation="MEEDGPRLAKMRQAYKRAIQEILKEKEKIKEILIDPNTSAEDSF
                     FLNSSKATNTSRGNPERDTEAISKAIENVFQDLKSRLSSIFKKKLEVNDIENKLNRLD
                     RDVLENRTSFRDVTSKEYIKEIFESYLVDTKVKYIDYIEETKKEALERIKILKGELEK
                     ATEELRLLRERNVLFDNAYSDMITKFTEAVKNGNNR"
     gene            complement(<15654..>15929)
                     /locus_tag="Eint_020135"
                     /db_xref="GeneID:20314003"
     mRNA            complement(<15654..>15929)
                     /locus_tag="Eint_020135"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163554.1"
                     /db_xref="GeneID:20314003"
     CDS             complement(15654..15929)
                     /locus_tag="Eint_020135"
                     /note="similar to ECU02_0215"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161818.1"
                     /db_xref="GeneID:20314003"
                     /translation="MDTGDGRTAYMDFSTKVSGFDTDIKVLETSTHIFIYVSQCEETI
                     HLYDEALKKEITKNKIRPKKKLIVFCNMRVHEGFNDIKKVVLDILRK"
     gene            complement(<16026..>16433)
                     /locus_tag="Eint_020140"
                     /db_xref="GeneID:9698791"
     mRNA            complement(<16026..>16433)
                     /locus_tag="Eint_020140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072329.1"
                     /db_xref="GeneID:9698791"
     CDS             complement(16026..16433)
                     /locus_tag="Eint_020140"
                     /note="similar to ECU02_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072375.1"
                     /db_xref="GeneID:9698791"
                     /translation="MKNKPGLLPKWLFIYTMSKTIYIFIKYKNHLSISRHLDSGSMHT
                     YFALVLGATRLIASRKITMVEFYSSIAASFLAEGLFFVCLGFCGIYPIHRVLVETFLS
                     LFTLAWMVFLYPYYLLEDSEPPSKSKEKSVKHQ"
     gene            <16479..>17159
                     /locus_tag="Eint_020150"
                     /db_xref="GeneID:9698792"
     mRNA            <16479..>17159
                     /locus_tag="Eint_020150"
                     /product="isopentenyl-diphosphate-delta-isomerase II"
                     /transcript_id="XM_003072330.1"
                     /db_xref="GeneID:9698792"
     CDS             16479..17159
                     /locus_tag="Eint_020150"
                     /note="similar to ECU02_0230"
                     /codon_start=1
                     /product="isopentenyl-diphosphate-delta-isomerase II"
                     /protein_id="XP_003072376.1"
                     /db_xref="GeneID:9698792"
                     /translation="MDNYNRNVLLVNEEDKIVGIGKALKTHFGRHLMLHRAFSVFLFN
                     SRNELLVQRRADEKLLFPGRWTNSVCSHPFVNDLSFTDPILDVKVHAIKRIEHELGIR
                     GISIDNLKFVSRVVYKAAPTEKYGKVLLGNPTTQKIVRFSDPESIHDEPYSSSDFYEW
                     EVDYVILCVSDASPCPNPKEVSETKYVSKEEFQKMIAEDFVSPWLDEISKLIDVFDIV
                     KLCFPTDF"
     gene            <17190..>17369
                     /locus_tag="Eint_020155"
                     /db_xref="GeneID:20314004"
     mRNA            <17190..>17369
                     /locus_tag="Eint_020155"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163555.1"
                     /db_xref="GeneID:20314004"
     CDS             17190..17369
                     /locus_tag="Eint_020155"
                     /note="similar to ECU02_0235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161819.1"
                     /db_xref="GeneID:20314004"
                     /translation="MVQRPLKNVKLHKKPTKYKRVLKKITSESDIITREINKGIVEKY
                     MSLYKKKGKKNSDVR"
     gene            complement(<17453..>18682)
                     /locus_tag="Eint_020160"
                     /db_xref="GeneID:9698719"
     mRNA            complement(<17453..>18682)
                     /locus_tag="Eint_020160"
                     /product="WD40 repeat-containing protein"
                     /transcript_id="XM_003072331.1"
                     /db_xref="GeneID:9698719"
     CDS             complement(17453..18682)
                     /locus_tag="Eint_020160"
                     /note="similar to ECU02_0240"
                     /codon_start=1
                     /product="WD40 repeat-containing protein"
                     /protein_id="XP_003072377.1"
                     /db_xref="GeneID:9698719"
                     /translation="MKINTIYHKPEEICKERKKDVQYVSFSKDETYHPFMREREFVRA
                     LNATKIERMLSKPFVAALSYHKEGIHVLTRHPRRSLFASGSFDNQVVLWDMEERSLIE
                     RFECHCSIKGLGMDTEGNVYAGQGKQVKKLGSSQAYSCNSEVLGLDIMETLNVGTSGG
                     IEIFDIEREFSKQKISTKYPLCISTSPVIKNIIGVGEQGGLSLFDSRVGKIAYSVSVG
                     NKTNDISFSPMDGHIFASADEDFCIYLHDIRYLDEPKGIYRGHGNAVVSVSFNPLGTE
                     IASGSFDKTIRIFGINERKSRDTYYNRRMHNVFGVEYSHDSQFIVSGSDEGSIRLWKS
                     HASKKLGPLSRKEKDAFRYSEVLKEKYKEVHEISRISRHRFLPKPLKNTLKRIHESYE
                     GAERRRKAREESNQDNL"
     gene            <18731..>19474
                     /locus_tag="Eint_020170"
                     /db_xref="GeneID:9698720"
     mRNA            <18731..>19474
                     /locus_tag="Eint_020170"
                     /product="putative polyadenylate-binding-like RNA-binding
                     protein"
                     /transcript_id="XM_003072332.1"
                     /db_xref="GeneID:9698720"
     CDS             18731..19474
                     /locus_tag="Eint_020170"
                     /note="similar to ECU02_0250"
                     /codon_start=1
                     /product="putative polyadenylate-binding-like RNA-binding
                     protein"
                     /protein_id="XP_003072378.1"
                     /db_xref="GeneID:9698720"
                     /translation="MTCKLFVSNFPESYSEESIGLIFSPFGEIKSIKILREPRLFSIV
                     EFQELQDAKAAIDSLNGRKLHSQGLLLHVEMAFERRKRVVVSGIPPDSSKEELQRFFE
                     YYGSVENITHSDAMRTVFIDFSSHEDAESFLELNQKISFGKERDKLSIKPFTKKECKD
                     NTSSPERSLFIYNLPAKITKTDLDGLFARFGEVKSLGVLSGGKAFVNYERELSALKAI
                     RHMDGKNVGGKKIRIILKSMKKGLFRGPI"
     gene            complement(<19561..>20583)
                     /locus_tag="Eint_020180"
                     /db_xref="GeneID:9698672"
     mRNA            complement(<19561..>20583)
                     /locus_tag="Eint_020180"
                     /product="GATA zinc finger transcription factor 3"
                     /transcript_id="XM_003072333.1"
                     /db_xref="GeneID:9698672"
     CDS             complement(19561..20583)
                     /locus_tag="Eint_020180"
                     /note="similar to ECU02_0260"
                     /codon_start=1
                     /product="GATA zinc finger transcription factor 3"
                     /protein_id="XP_003072379.1"
                     /db_xref="GeneID:9698672"
                     /translation="MGCVNKESGGQKQIEDTWTKDFRDEEQKKSFHKDDMNVEMEDIK
                     GYDKKAFDVEELRHGGEDPCNSSLQSLNETNNYTTNAQISQNLDRFNDRKGKYQELIS
                     EYGSMEMPKIAKELKRKAKQRICSNCATTSTPSWRRGDQGKSLLCNACGLYQKLHGRT
                     RPYTITAGGRTKALKGGHERIVCVSCNISFFTSESKNTPGYLCDGCLSYAKSRRGHPR
                     SNEERDCQSEFNEKILSNRYSRFYTREIPDQYNVPYHYVEKGEIDNGFRSYSSASIVY
                     PQSYGYYYLNEKHHTPPRFGEYEAPFPKKGLDSGFKSAYPGEMIGESDNGMDSCDPNV
                     NTPAGI"
     gene            <20850..>21947
                     /locus_tag="Eint_020190"
                     /db_xref="GeneID:9698673"
     mRNA            <20850..>21947
                     /locus_tag="Eint_020190"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072334.1"
                     /db_xref="GeneID:9698673"
     CDS             20850..21947
                     /locus_tag="Eint_020190"
                     /note="similar to ECU02_0270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072380.1"
                     /db_xref="GeneID:9698673"
                     /translation="MGNKKDKEMVRCELENYVAVEIKNTSPNARQVDAIQKMISLPER
                     NFDELVSDIVNEMRRRSNALSTTPETPMQRKLSRIHEDGFKSLILDLLLVMNQRSPEK
                     GCSSENVHGLIDNLDKLISELKEDMMNEDKMVQDIYSSRNISEKLIMFIEYTRNVFGR
                     NEEDVKIHEYMTKEVREYFDSQATDGPDLMAGVDVFLKKCDKSKYSNHPEYKYHRDNI
                     QKLESMELEQEVKRNLIKSEVSQIYSIFVAENTSLKSAGEKQLELKVHGLVDILSKIK
                     YEAEERRSVDAYDYLEEVINSSKDILELIESMKLKRNTHLDLLRAKIAALEQIHNRNG
                     NEEPLFAMFSTIEAVKKALMDISNNQNQGNA"
     gene            complement(<22026..>22436)
                     /locus_tag="Eint_020200"
                     /db_xref="GeneID:9698732"
     mRNA            complement(<22026..>22436)
                     /locus_tag="Eint_020200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072335.1"
                     /db_xref="GeneID:9698732"
     CDS             complement(22026..22436)
                     /locus_tag="Eint_020200"
                     /note="similar to ECU02_0280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072381.1"
                     /db_xref="GeneID:9698732"
                     /translation="MIYIYFFLAEIFCNGSILMSEVNSKTDTFRFNNMILNIEKSGAF
                     EKNTNKEFNRPGYVVRGEERKFQIEFFTSMSNLEVSKVSPFKIKVLYNSKNRSANDTY
                     LEISVKNLPIKNFKIFDFYELGKARLSSKLDIKI"
     gene            <22587..>23504
                     /locus_tag="Eint_020210"
                     /db_xref="GeneID:9698733"
     mRNA            <22587..>23504
                     /locus_tag="Eint_020210"
                     /product="DNA replication factor C small subunit"
                     /transcript_id="XM_003072336.1"
                     /db_xref="GeneID:9698733"
     CDS             22587..23504
                     /locus_tag="Eint_020210"
                     /note="similar to ECU02_0290"
                     /codon_start=1
                     /product="DNA replication factor C small subunit"
                     /protein_id="XP_003072382.1"
                     /db_xref="GeneID:9698733"
                     /translation="MQQPWTEKYRPESLQQVVGNREIVAALKSISSTNKIPNMLFYGP
                     PGTGKTTSIRAIANNLPRSCVLELNASDERGIATVRETIKEFASTYSKTTKLVILDEA
                     DMMSRDAQNALRRIIEDFSANARFCLIANHSRKIIPPILSRCTKFRFGPIEDTESRIK
                     EICKKENIKYSEEGIKGIAEISEGDMRKAVNDVQGISVSLGPISLENVRKFNGVAPID
                     VYEELFENLKTMSMADLRVKCEELKYEHGMDSDDLLKNLSKMVRKSNMKEKMRILKEM
                     GDIEYRRSIGCSEKVQTDAIISVFLLNRG"
     gene            complement(<23558..>24565)
                     /locus_tag="Eint_020220"
                     /db_xref="GeneID:9698734"
     mRNA            complement(<23558..>24565)
                     /locus_tag="Eint_020220"
                     /product="DnaJ-like N-terminal domain-containing protein"
                     /transcript_id="XM_003072337.1"
                     /db_xref="GeneID:9698734"
     CDS             complement(23558..24565)
                     /locus_tag="Eint_020220"
                     /note="similar to ECU02_0300"
                     /codon_start=1
                     /product="DnaJ-like N-terminal domain-containing protein"
                     /protein_id="XP_003072383.1"
                     /db_xref="GeneID:9698734"
                     /translation="MSLYDVLKVPKNATKESVEKSYRFLVRTYFQNKSEISPDKFAEI
                     NKAYTILKDRYKRDFYDIFGEVSVQLLLHNKDSYIVTRMFDRLNICFYLVTFAIYLGT
                     LLALPPMIAHGEYNSIAMSLPFGVSAITLTIPMIRSLSALYWIYGMGAELKSMIFRSM
                     EIIGATLHLFNYASYVDGLINTSFSGALFLGIEGLSTVNTIYYHSNKYKLFFETKKNI
                     MMGKLIRAILFGLVMVPAIPVFLKPFLLLMQILWGICGKKYSLKINACMLLLPLLYIA
                     TLSLVLAGFRSILIYLPLWIFGSIIMIVLALIASNIVNNIPKSKYDVREAEALPYYDI
                     L"
     gene            <24638..>24952
                     /locus_tag="Eint_020230"
                     /db_xref="GeneID:9698761"
     mRNA            <24638..>24952
                     /locus_tag="Eint_020230"
                     /product="U1-like Zn-finger-containing protein"
                     /transcript_id="XM_003072338.1"
                     /db_xref="GeneID:9698761"
     CDS             24638..24952
                     /locus_tag="Eint_020230"
                     /note="similar to ECU02_0310"
                     /codon_start=1
                     /product="U1-like Zn-finger-containing protein"
                     /protein_id="XP_003072384.1"
                     /db_xref="GeneID:9698761"
                     /translation="MPRSDTKKSKRRKNRNRLKTKRAQEFGPKGIDQVKEQIEGQKEI
                     DYDPELPGHGRFYCYECDRHFISEKVLIEHRRSGTHKKRVRDMREIPHSQKDAEWAVG
                     LI"
     gene            complement(<24997..>26502)
                     /locus_tag="Eint_020240"
                     /db_xref="GeneID:9698762"
     mRNA            complement(<24997..>26502)
                     /locus_tag="Eint_020240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072339.1"
                     /db_xref="GeneID:9698762"
     CDS             complement(24997..26502)
                     /locus_tag="Eint_020240"
                     /note="similar to ECU02_0320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072385.1"
                     /db_xref="GeneID:9698762"
                     /translation="MQEDEARGVLFILNESLVNEGGLSGEHEESLEKIISLTDEDPSL
                     LSLLDDWKFIERNFPYLIRNSKDRQKAFGLAIKILQLPNSRLPVLFMTRKGGFLLSEI
                     LYESMESPQYVISFCCEAIKKSSLFPGVLYDCGFFILLNSLVSSETARLYSLIFEYKV
                     YEARGKYEEDRGEGIMHEIKRRHFDSEVVFKDKMHFTFRKPSSLHKVGQPVLKNIFDD
                     IYNTTFFDLLDLGLDKNLHLMNYCEWDYLFLCGSSGLKELVNSGSYLAIRLYRKMLES
                     LGKSSKAILYLDKIEDSDLMIHVAKLLECKDTNIVMECGLVLYNYYYLFDWNLDKKQF
                     NENKIRKIFSLLEYSYVDCSCFQECAYSQSDCSVGGLREDEWMGKCFQDCNTAKILRL
                     LSNIYSFVDKRYFYKPSFLVLMKTWRDVFERHRCWNSAFFTTFFEDMVLFLRSNSYNI
                     ARIIFPFKRTRRKASNDVDEEGDKENSINLSILEGDGDIGWLEIEGLDELK"
     gene            complement(<26593..>29511)
                     /locus_tag="Eint_020250"
                     /db_xref="GeneID:9698703"
     mRNA            complement(<26593..>29511)
                     /locus_tag="Eint_020250"
                     /product="P-ATPase-V"
                     /transcript_id="XM_003072340.1"
                     /db_xref="GeneID:9698703"
     CDS             complement(26593..29511)
                     /locus_tag="Eint_020250"
                     /note="similar to ECU02_0330"
                     /codon_start=1
                     /product="P-ATPase-V"
                     /protein_id="XP_003072386.1"
                     /db_xref="GeneID:9698703"
                     /translation="MYNIYKEKPFYKRAYVAPLYFLPVLALKSNYPQVVIVFTLLLSG
                     TMFLSTFWSDRVHILFSMDLNTEGDYIQYLGSLCKLSDGAFEFEKSGYLLTGEKIVRL
                     RADTKRPFEYYEKWQERKEEFVESGLLKHFKKNRFDIVPPSFFQLFLQHAVSPLFVFQ
                     VFSGLLWCLDEYVYQAIFSLVMLVVLESGLVFQRMVTARHFKKMSHAKVNVEVLYDSR
                     SCRKSEDKTVSSEDLFPGDVIRIKSTMSVPCDLLLVKGSCAVNEAMLSGESVPLAKED
                     ISERNPKDTFDRSKDKKHILYAGTEIVMIKDSPLVCFVLHTGFETEKGGLVRKMMCTE
                     EVTVNDREAFIFIFALLVFAIIASFYAYKEGKKMGKSNYKLLLEVILILTNVVPTELP
                     MELSMAVNSCVRALIQKGVYCLEPFRIPYAGKVNVCCFDKTGTLTETVMEVAGIKHET
                     ENSTDVLSSCHSLLLLEGKVTGDPLETSTYEYLKNKKSLGSKCFEYQVLKTYSFCSEL
                     KRMTVVVEKEGKRFVGMKGAPEVVKEYLSSVPDFYDDYKEYAADGYRVLALGFKPTSK
                     QDKYVRKDMESGLSFAGFVLFDCKLKKDVRETIEALHISGHKVIMITGDNVLTARNVS
                     KKIGISTKAVEGAEIDKVLESDEFPSISIFARADPIHKEKIIEKYNKMGKYTLMCGDG
                     TNDVGALKSAHVGIALMEAPVIVRKEKKEKTKEENIMESLSKDIGEEKINLGDASVAA
                     PFTAKTGSLDSVLDIIRQGRSALVTTIQMYKILALNSLVSAFSLSVLDCMGVRYGDVQ
                     LTVSGLLIGFAFMFLTQSQPLKEISKKRPLTNIINSYIISSVVLQVIVHIASFFIMIR
                     RIRDVETPVYNEKFSPSLMNSALFFLSTTQQISTFLVNYIGRPFRESLVENKKLLGCL
                     TILLLFIHQLVMGNNDELRAKMEIVDMGNVKVFVYSVLVMDIVLCYLVEKTCFYMFML
                     "
     gene            <29575..>30195
                     /locus_tag="Eint_020260"
                     /db_xref="GeneID:9698704"
     mRNA            <29575..>30195
                     /locus_tag="Eint_020260"
                     /product="20S proteasome subunit"
                     /transcript_id="XM_003072341.1"
                     /db_xref="GeneID:9698704"
     CDS             29575..30195
                     /locus_tag="Eint_020260"
                     /note="similar to ECU02_0340"
                     /codon_start=1
                     /product="20S proteasome subunit"
                     /protein_id="XP_003072387.1"
                     /db_xref="GeneID:9698704"
                     /translation="MSADIETFYGGSILAIASDEAVAIMNDKRLGMSSITVSKDFTRI
                     HKIGPRLYVGLPVFVPDTQVLLRSIRKNYNLFKLEEQREMEPEELTSMISFLLYSKRE
                     APYITSPIVAGLRSDGKPYISGMDSIGSITSPRDFVAAGTSEENLMGICEALYRPGMD
                     EENLFVTCTQAFLNSIDRDALSGWGADCYIISRNKVTKRPIKGRCD"
     gene            <30265..>31107
                     /locus_tag="Eint_020270"
                     /db_xref="GeneID:9698705"
     mRNA            <30265..>31107
                     /locus_tag="Eint_020270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072342.1"
                     /db_xref="GeneID:9698705"
     CDS             30265..31107
                     /locus_tag="Eint_020270"
                     /note="similar to ECU02_0350"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072388.1"
                     /db_xref="GeneID:9698705"
                     /translation="MPRLGRILMYALIFIFRSYDVPSLCYNYYDPESCYQQEFLKPSP
                     IPTVYQVVPRKYFVYVSGVCDFIVSRLINSEKYFIYSSLLPADAISMENLLLVMLEKG
                     YRDIAGFFLANLSIFYVPILTASNLYVLSYLYPAYKKDYENAHKPSLSITWFFHLNIF
                     SQYSRYFYDMFYVLMIYLFSIVPEEQKMEIILLFKPSNYKSYLLYMAESPLFHFYTLI
                     FVLENYVQLLFRIYGIGNPNFLNWSYLAFTCLFIFERRWIMLMKEPYKNKDQEKASGC
                     SHQL"
     gene            complement(<31147..>31404)
                     /locus_tag="Eint_020275"
                     /db_xref="GeneID:20314005"
     mRNA            complement(<31147..>31404)
                     /locus_tag="Eint_020275"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163556.1"
                     /db_xref="GeneID:20314005"
     CDS             complement(31147..31404)
                     /locus_tag="Eint_020275"
                     /note="similar to ECU02_0355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161820.1"
                     /db_xref="GeneID:20314005"
                     /translation="MCPARQKKAAEKSKKELESEEETTSTTDVSDYTDEDTDGSSDSG
                     IGSDDSSDEDSGYSSVDDDMSEDDDDTDDLDEDSGVDEESS"
     gene            complement(<31523..>32350)
                     /locus_tag="Eint_020290"
                     /db_xref="GeneID:9698768"
     mRNA            complement(<31523..>32350)
                     /locus_tag="Eint_020290"
                     /product="transcription factor"
                     /note="involved in TATA site selection and in elongation
                     by RNA polymerase II"
                     /transcript_id="XM_003072344.1"
                     /db_xref="GeneID:9698768"
     CDS             complement(31523..32350)
                     /locus_tag="Eint_020290"
                     /note="involved in TATA site selection and in elongation
                     by RNA polymerase II;
                     similar to ECU02_0360"
                     /codon_start=1
                     /product="transcription factor"
                     /protein_id="XP_003072390.1"
                     /db_xref="GeneID:9698768"
                     /translation="MRDGYKSSGHVNFDREELYESEEDRKALLEMPETKREEILYRRH
                     VELQKFKEKKELEEKTQGLKRKVPSADKKSTSDIDDFSEFSLCIVNRDMIARNVFKPF
                     FDEFVGHFTRARINGLYLVVKIVGVSKGEVYSLRIDRKEVKTNRYLEISTGTRTYKNF
                     RIENISNSPLLREEYEDVWRSFKIGPMSKVKEGYEKLVKTMNRALSDEEISKMVTCKD
                     EVYPKRRGVTHLKIELIQKRDRAIEVKDKKMAIEYQKMIEEIEDRERTREEDVNERH"
     gene            <32421..>33443
                     /locus_tag="Eint_020300"
                     /db_xref="GeneID:9698735"
     mRNA            <32421..>33443
                     /locus_tag="Eint_020300"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072345.1"
                     /db_xref="GeneID:9698735"
     CDS             32421..33443
                     /locus_tag="Eint_020300"
                     /note="similar to ECU02_0370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072391.1"
                     /db_xref="GeneID:9698735"
                     /translation="MVLLAKKKTYICLHVLNTIILTAISAIHEKRSSLRNLQDKIEVR
                     KSIIDQKVYTKLFTKIAEGNYIVVQRDSKLLKYLGNTNPLSDLYLIGKYGIPKHISLE
                     DIPYLETEARYFFIEIKDIPIHRIFVKQNLHSFMYIKGFNLGPDKDEIDQMVKISQEC
                     LRAFDRIGNIEMAAKDMIVKIRKVNPFELFINHSEGFTIMKSIFNHRNEFLEDLKVHF
                     VKFMSSIFFGMKTSSFCDAYVKSIISYLERENILAIAPSIKEYPELIHRLFPYKIIST
                     SPNILHEELIVGGISLDGILQDKYLRELFNLGKIKEITRGGSRFIFTGHISIDNQKGK
                     YNVSFV"
     gene            complement(<33468..>34190)
                     /locus_tag="Eint_020310"
                     /db_xref="GeneID:9698736"
     mRNA            complement(<33468..>34190)
                     /locus_tag="Eint_020310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072346.1"
                     /db_xref="GeneID:9698736"
     CDS             complement(33468..34190)
                     /locus_tag="Eint_020310"
                     /note="similar to ECU02_0380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072392.1"
                     /db_xref="GeneID:9698736"
                     /translation="MNIKELIVRVLENRDIEAVGEMQYTEGDGEDLHELSTSDLLNCT
                     SPYIRGVVNDKVGNKYEGLKLFKEYCEDCEYLKLVEEETIELCRTSGRDNKIKLWRKI
                     REFRYDFIDWEDREWIMRLLEYFYIMSMKNIEHLNREIMLLQEKKDKESYKKKGIECI
                     KVDSQGRISDFLARRNSPTMTLDEFAEKIMLGMEKGPSTSSREEEPEDSSSNNLSREE
                     LLKRDEERDEKEINRGNTTRMG"
     gene            complement(<34273..>35853)
                     /locus_tag="Eint_020320"
                     /db_xref="GeneID:9698688"
     mRNA            complement(<34273..>35853)
                     /locus_tag="Eint_020320"
                     /product="M2 dsRNA satellite propagation-like protein"
                     /transcript_id="XM_003072347.1"
                     /db_xref="GeneID:9698688"
     CDS             complement(34273..35853)
                     /locus_tag="Eint_020320"
                     /note="similar to ECU02_0390"
                     /codon_start=1
                     /product="M2 dsRNA satellite propagation-like protein"
                     /protein_id="XP_003072393.1"
                     /db_xref="GeneID:9698688"
                     /translation="MPIRGLEEVRKHPGQNFFLKVPQKAFKKMRICIDGNWFLRKYVD
                     VPSICKGLVLGTEDAIKEPLLRLLEFRDENEVDLIWVWDGMGFNRQQGALSGNSDALL
                     NEGLREYKQENYRKAGKLWRNFITQKNEMDIANKILEENGVVVITAPYSATAQCAYFM
                     SAEACSYVFGKSDVLLFDGVDKIILDMSDGSGKPCLDVFHKSRFLEFFNLSPKMFAAL
                     GLLLGCDFCPTMPKCATDFSFNAVFSLIKESDDLLKMIKNTCDEGSGKKYTDQFLRGL
                     MLVTYLPVMKILGCVQPYSEDHVPRNLEKLVGAKLAPGFYESLFMNRISRDILQIMGK
                     IKNVDKDPQFIKLVESSLSRVRNEGQKEKESGKGLGSEESFGHVIHPDMTLTKDIDPS
                     VGILLLMSIEVGELEAPFVPKILCFHRQVSNEEKLNINGPTLRYYVSAIRLLNCAKEI
                     KEVYEVVLNKNLSELFSQGLSLFSASFHEEFGFSGDVGESNYKFLLNVRDFLRANERL
                     FSMIPDIVKEIESTLNEK"
     gene            complement(<35953..>36567)
                     /locus_tag="Eint_020330"
                     /db_xref="GeneID:9698689"
     mRNA            complement(<35953..>36567)
                     /locus_tag="Eint_020330"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072348.1"
                     /db_xref="GeneID:9698689"
     CDS             complement(35953..36567)
                     /locus_tag="Eint_020330"
                     /note="similar to ECU02_0400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072394.1"
                     /db_xref="GeneID:9698689"
                     /translation="MYTTIVESVQKTSSFFRLLFSPSQAEMKIFKPNKKGFFECLAAA
                     VVYMLQSSNPDSLSIAEVDISGKPHKCVFIDHGSFGRLSKGNWVVIVDVRGDGFYSHV
                     ARKISNLCDVAVLRVSSWKDAVVAVKLPLNIPKETIYLKHSMNRYISGREVAIDNAVD
                     IYLLSKLLWMRKHIRKIILSRFCMYMSFVEIMFFVIGKLLSLGW"
     gene            <36641..>37279
                     /locus_tag="Eint_020340"
                     /db_xref="GeneID:9698690"
     mRNA            <36641..>37279
                     /locus_tag="Eint_020340"
                     /product="Rho Ras-like GTP-binding protein"
                     /transcript_id="XM_003072349.1"
                     /db_xref="GeneID:9698690"
     CDS             36641..37279
                     /locus_tag="Eint_020340"
                     /note="similar to ECU02_0410"
                     /codon_start=1
                     /product="Rho Ras-like GTP-binding protein"
                     /protein_id="XP_003072395.1"
                     /db_xref="GeneID:9698690"
                     /translation="MVEGATADVSKQLTIIGSATCGKTSILTRHVKRTFGTEISPTVF
                     NSVSNTYKHKNNVVELRLWDTAGQDEYARFRHLALPSADYIMIVYAIDDRSSYAEVKN
                     SLIGQVKEKAPQAKYFLVGAKVDLREDSKRLEELARNGNSPITTSEGLELSQSIGALG
                     YFECSAKNNIGIDEIFEKISSYALKVYLRENKSFMGRILTSLWNFLCCRKIN"
     gene            <37310..>37861
                     /locus_tag="Eint_020350"
                     /db_xref="GeneID:9698730"
     mRNA            <37310..>37861
                     /locus_tag="Eint_020350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072350.1"
                     /db_xref="GeneID:9698730"
     CDS             37310..37861
                     /locus_tag="Eint_020350"
                     /note="similar to ECU02_0420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072396.1"
                     /db_xref="GeneID:9698730"
                     /translation="MKLEKVDANWTRTEDEVLKAGVMKYGINKWSKVSSMLPSKTPSQ
                     CRLRWLEYVSPLVNDLVWSSEEDEKLILMAKTFLPQWSLIGQTMGRSGQQCYERYNEL
                     VFGKISVFKYGELSGPCEGKDEEILKMASARMSECKSRKGLKKKALLDKKEKTLSRSC
                     EAKEGTIGPHKQRVCRKNDGTLQ"
     gene            <37929..>38117
                     /locus_tag="Eint_020355"
                     /db_xref="GeneID:20314006"
     mRNA            <37929..>38117
                     /locus_tag="Eint_020355"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163557.1"
                     /db_xref="GeneID:20314006"
     CDS             37929..38117
                     /locus_tag="Eint_020355"
                     /note="similar to ECU02_0425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161821.1"
                     /db_xref="GeneID:20314006"
                     /translation="MESKNRASASAFGFIGVFIAVLLCLSIVVDMMSFKRLSFLEVAE
                     SRHGIKMKEIMRNKEASE"
     gene            <38179..>39660
                     /locus_tag="Eint_020360"
                     /db_xref="GeneID:9698731"
     mRNA            <38179..>39660
                     /locus_tag="Eint_020360"
                     /product="Sec1-like syntaxin-binding protein"
                     /transcript_id="XM_003072351.2"
                     /db_xref="GeneID:9698731"
     CDS             38179..39660
                     /locus_tag="Eint_020360"
                     /note="similar to ECU02_0430"
                     /codon_start=1
                     /product="Sec1-like syntaxin-binding protein"
                     /protein_id="XP_003072397.2"
                     /db_xref="GeneID:9698731"
                     /translation="MDILDLLKKKIIEDVFEVYPDAEWSVLVYDSYGASILKNFFVKS
                     EFISHNIVTSQRIEEQRERVDFPVIYFVRGEESIVKMINRDFENRLYPSYAVCALEEC
                     EGLQPPIKVKKVDVDFLPFEQRVFKATAKQLYSVAKTLNTVFNVSYSGSVCRGLAEIV
                     EKTMGSEERKGELIILDRSIDLFTPFLHFFTFRTLLEDLSVENMEEFEKKYMRDKVWE
                     SVKNAHLGEVNSILRNQAQILSKVAQRLDTKVDNKDLMKMVLEAPAAAKTKESLSKIL
                     GLAQKCYDQFDYLSRFNEIEQLLATGYDKSGSKWKMKVEDVFEYLRSSGIERSDKIRI
                     LLLLKANGYQLQDNEVNLLKGMGFEDSEIEISFENHESFVPLRGSGNHKYEVSRYEPV
                     LGNVLRSFIGKQKGHLQINRLTSSRSHLKSLRKTHLLSVKKDISYQKLYCVYITGGIT
                     FEEIRVAYEISESLGVEIIVGSEDIITPKSYVEYLKSKCMSKS"
     gene            <39694..>40233
                     /locus_tag="Eint_020370"
                     /db_xref="GeneID:9698708"
     mRNA            <39694..>40233
                     /locus_tag="Eint_020370"
                     /product="glutathione peroxidase"
                     /transcript_id="XM_003072352.1"
                     /db_xref="GeneID:9698708"
     CDS             39694..40233
                     /locus_tag="Eint_020370"
                     /note="similar to ECU02_0440"
                     /codon_start=1
                     /product="glutathione peroxidase"
                     /protein_id="XP_003072398.1"
                     /db_xref="GeneID:9698708"
                     /translation="MDQNLESQTFYNLSARGWNGEEVNFSVFRGCVLIIVNVASSCKL
                     AEGNYKSFVGLLEKFYKKNLRILLFPCNQYLGQEPKPIERIHREVSEKYSDKFEVMDK
                     VEVFGENAHPVFKHLTSTKNGKGTFGNFIKWNFTKFLVDRSGHVVKRFGPSNIIKEDE
                     ECLLNIIGDEGEEQSPLMG"
     gene            <40258..>40599
                     /locus_tag="Eint_020380"
                     /db_xref="GeneID:9698709"
     mRNA            <40258..>40599
                     /locus_tag="Eint_020380"
                     /product="transcription initiation factor IIA subunit
                     gamma"
                     /transcript_id="XM_003072353.1"
                     /db_xref="GeneID:9698709"
     CDS             40258..40599
                     /locus_tag="Eint_020380"
                     /note="similar to ECU02_0450"
                     /codon_start=1
                     /product="transcription initiation factor IIA subunit
                     gamma"
                     /protein_id="XP_003072399.1"
                     /db_xref="GeneID:9698709"
                     /translation="MYEFYRQLMVGKALEKIIDEKVNSNMLSPNQGKYILEAFDLSVP
                     VVFNKSVTNSMSFKGKVDFYNHVDGVWRFQTKDFVMSLNNEYFSGGDVNIVACDADIN
                     MDAGRRRRRRG"
     gene            <40724..>42565
                     /locus_tag="Eint_020390"
                     /db_xref="GeneID:9698723"
     mRNA            <40724..>42565
                     /locus_tag="Eint_020390"
                     /product="nucleoporin autopeptidase"
                     /transcript_id="XM_003072354.2"
                     /db_xref="GeneID:9698723"
     CDS             40724..42565
                     /locus_tag="Eint_020390"
                     /note="similar to ECU02_0460"
                     /codon_start=1
                     /product="nucleoporin autopeptidase"
                     /protein_id="XP_003072400.2"
                     /db_xref="GeneID:9698723"
                     /translation="MDQNNNMNKFFNSSFFAQTPQKDNKPGQFSGIQQPSIFGQTQSG
                     FSGAQNPFLQGSGGMKSNTFGTSTPFGGTSTFGGATSNSGGFGQPFSTQQPSTSLTRF
                     GTGGTLGTGNNIFGGTANTIGTNPTQFGGSGNTSTFGTQQQVNNNTFGSGVPNSLQPF
                     SMGASTATQPSIWGQQTTSYNPFGSSQNSSFSNDRSNALGKGFPGLGGGNSGTRDHPY
                     MQRKIREDNGGEVTLMHINGNEGYTQKSVDELRAEDYILGRKPPTGSSLAEPKSIPGF
                     GSSFGGPVPSSIDSKPQSSNIFGATPSNNSFQPFISTGNSKVLQGPTNPGFGNTVAQQ
                     PFASQAISQSTPSQPFGTAAQALPSTNSNPFLQTPQQPQSLFGSAGTSPQTPASGGLS
                     FMQPPTAPVQQPFGGGMASLGTCGQQNTQQTKIDPSDPFLLKDIKFEKTEKEHLPLSK
                     VLPKPMFKEDLKPQKISLKFRPPKPPAKEKIYTIPPIEDIKHMKEVHNLIIGFEDKGR
                     IEYLDTVNGSDVTMANIQSKIYFSKESVVVNDPVGVGLNRRARVYVEGVFPYSRSLGD
                     YVRGEQKQFPLKGIQERFLYGLKNDTVKKFVGYEYERGTYVYDVNHF"
     gene            <42654..>44021
                     /locus_tag="Eint_020400"
                     /db_xref="GeneID:9698724"
     mRNA            <42654..>44021
                     /locus_tag="Eint_020400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072355.1"
                     /db_xref="GeneID:9698724"
     CDS             42654..44021
                     /locus_tag="Eint_020400"
                     /note="similar to ECU02_0470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072401.1"
                     /db_xref="GeneID:9698724"
                     /translation="MQVSYIEKETIDELRISTSIGDKIFFIRGMELVSKSIYAYDSEK
                     IHKTFEDRVDYICYFNEMILALCGNILYKHRVLGEEVILCGTCQLLEPPIKICVSGGP
                     EEKEGYAVCFLYRNKRIEVFSDDIERVVVRCKGDVAKEDEIIDFAIEDGVSWFLSQSG
                     RIYRTHSFVISRVVLLNRPVRMIPEPSYFDGTINKILAKRGRLYVCYEEGFEVYDIGK
                     DVLVLNYTYKTRDFELYAWENVYCLESNLLIVDEMPRVIASVRVHKMFGDIGISRDRI
                     LFIKRVEECKRADVKLLKEEDADKRTKEMFRIVENDIKIPEIELSENGREVSEKGFLI
                     VQKMINEFESKILDVYRRIYFELVTLNESFGEKITGLNAENDLILRKVEVLDRRKNDL
                     VERLQKLSEKMEDVVSRIQIDGSKTRRLAKMVDKAIDEISYKKYEKYSRILKLQREVL
                     NRKMV"
     gene            <44167..>46524
                     /locus_tag="Eint_020410"
                     /db_xref="GeneID:9698725"
     mRNA            <44167..>46524
                     /locus_tag="Eint_020410"
                     /product="proteasome regulatory subunit 2"
                     /transcript_id="XM_003072356.1"
                     /db_xref="GeneID:9698725"
     CDS             44167..46524
                     /locus_tag="Eint_020410"
                     /note="similar to ECU02_0480"
                     /codon_start=1
                     /product="proteasome regulatory subunit 2"
                     /protein_id="XP_003072402.1"
                     /db_xref="GeneID:9698725"
                     /translation="MQTIRILPNIKSLLKDGKVSEAIDVINMHVDVVAPYIKDDLQYI
                     KSDDPKTSLCLSKIYFVLGDYQKAIEYALLSGDLLVDDGSFYYTSIVYHMMDSADMSK
                     DSRARDFVLRAISSETVDGSLIGYLFSVKEYALLKEALVKYIDGGNDYKRLLDLLISL
                     GEEKGCLKEIYGMITEIGPRGKPFLFYVIDAYFYLEEIEKVKELIERLTKEDILLCYE
                     VAFYTEDNYSPEIEVSNQKVMSILSGEFKKKILGEFLLERNLTSFKFLESIARTRTHY
                     LGLANSLMNLGTSNDTFYRSNADIFSQSNEWAKFCEVSSIGMIHLFNSNPYEILKNYL
                     PSEVSQKEGGALMALGLIKAGTFSEEDTEYLLYFLDTQDTLTPELAYGVCLGLGLINM
                     GSTNSEILGKLKELSKVDRTLLVEASVYGIGMLGLNSWNVEILEDLRAIAGETEFERV
                     KRAVGISFSLVLMFSEEMFYDEDAETDGDFKNYINEFLSEKDSIMRASGVLSLGSSFV
                     GTGRLSVISTLLPYINDGDDDVKRAAVIAIGLVCCDDRDLLVGTLEPLSENHNFFVRA
                     AVAVVLGLFLSGTGDEVCTNILEALMYDSNNLVRQSACIGIGFITMQCNPTLIPNYKR
                     IIERLNKLVVDKKESGAVELGAVFGRGLSEAGGRNIIFSIRNMSGITSADRIAGAILF
                     LHYWYWYPLISMVSLCALPTAVFCFNEDLEEEEIEIPTSNRYDNLLIRLPDIKKTRRF
                     KQRPKEDKEVVTESPSVLTSGSRCTIKQREECGLDSPAILFVKKK"
     gene            complement(<46610..>46948)
                     /locus_tag="Eint_020420"
                     /db_xref="GeneID:9698665"
     mRNA            complement(<46610..>46948)
                     /locus_tag="Eint_020420"
                     /product="putative Zn-ribbon-containing protein"
                     /transcript_id="XM_003072357.1"
                     /db_xref="GeneID:9698665"
     CDS             complement(46610..46948)
                     /locus_tag="Eint_020420"
                     /note="similar to ECU02_0490"
                     /codon_start=1
                     /product="putative Zn-ribbon-containing protein"
                     /protein_id="XP_003072403.1"
                     /db_xref="GeneID:9698665"
                     /translation="MEDKEELRKLLRSTIRKNTDPRVKISDEYLTDEDKAETKTLRTP
                     AKKRACKDCTCGLKEKQEVEVRSACGNCYKGDAFRCSGCPSLGLPPYEPGEVVSFSTD
                     LDEGLQGQDG"
     gene            complement(<46968..>47552)
                     /locus_tag="Eint_020430"
                     /db_xref="GeneID:9698666"
     mRNA            complement(<46968..>47552)
                     /locus_tag="Eint_020430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072358.1"
                     /db_xref="GeneID:9698666"
     CDS             complement(46968..47552)
                     /locus_tag="Eint_020430"
                     /note="similar to ECU02_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072404.1"
                     /db_xref="GeneID:9698666"
                     /translation="MEISQFLKKILKKSTLSLEDIAHLLEEVGIPFEVSGCRILFYKN
                     MEKALEAHYLETYGINIPSRTYSINEIHGLALFLYIKKYGSPEVDSDLERFFEGLFFS
                     NTGEVDVGQLKEENERLVRENEELKERINEMNNLWIDRGFEEGELGSVDQEVLSKMEK
                     DLSALREQVDFEHPLILEAWYRLGEEHIKSRDFN"
     gene            <47630..>49378
                     /locus_tag="Eint_020440"
                     /db_xref="GeneID:9698804"
     mRNA            <47630..>49378
                     /locus_tag="Eint_020440"
                     /product="Mps1-like Thr/Tyr dual specificity protein
                     kinase"
                     /transcript_id="XM_003072359.1"
                     /db_xref="GeneID:9698804"
     CDS             47630..49378
                     /locus_tag="Eint_020440"
                     /note="similar to ECU02_0510"
                     /codon_start=1
                     /product="Mps1-like Thr/Tyr dual specificity protein
                     kinase"
                     /protein_id="XP_003072405.1"
                     /db_xref="GeneID:9698804"
                     /translation="MEGIFNSKDLYEYLEEQKHSGISKTRRISLYYKATSKSVGDDEY
                     SLRIWLDYIQLLMDGTKDTTEARETFKMIKMRFCKFYNYWEAYIRFEIETGNENLGKI
                     LQHSIDFVKVKEFPEKKNVLDYLECVISYVRNQQDLSVFCRSPEKSLDADGRFTSLFE
                     TQMGDRGGKILKKDQKEPRYEYEGGRGLFPRNDDIYSTPGECKENLSNRSKTDSSSQT
                     LLSSLDTKTGNHGSSFFGTIPVRFEKEDYSQGITAEINAALGKAGSEESSSSPRSGTI
                     RAREKISVKGKDIEILKQIGKGGSSKVYKILLGNSVYALKRVELVGDEKMLNSYINEI
                     NLLYKFKGAPEIVEIIDHEVNEDYLHILLEYGETDLSQIIKRGNLSINFIKDVWEQML
                     LIVKRVHMERIIHCDLKPANFLFVKGRVKLIDFGISKVIRNDTTSILSEEQCGTVNYM
                     SPEAVTQNKSKVARSSDIWSLGCILYEMVHSKPPLHEYPNLIQKIQKLQEYSEFKYSS
                     ENKLAVMVMKECLVRDPKKRPTIDNLLNHRFLTGEIHLEPLRELVTKILRISGKDKAD
                     PAYVDKITEQLWNDHG"
     gene            complement(<49462..>50916)
                     /locus_tag="Eint_020450"
                     /db_xref="GeneID:9698805"
     mRNA            complement(<49462..>50916)
                     /locus_tag="Eint_020450"
                     /product="T complex protein 1 delta subunit"
                     /transcript_id="XM_003072360.1"
                     /db_xref="GeneID:9698805"
     CDS             complement(49462..50916)
                     /locus_tag="Eint_020450"
                     /note="similar to ECU02_0520"
                     /codon_start=1
                     /product="T complex protein 1 delta subunit"
                     /protein_id="XP_003072406.1"
                     /db_xref="GeneID:9698805"
                     /translation="MATERLNQVRTSIFQASQSLLQTLSTSLGPRGLDKMIVKDKKTV
                     VTNDGATILKYLNQHPIHGILSNMSAAQDEECGDGTTSVVILAGCLLESVSNLVERNV
                     HPSVICDNLEISKKIGLKYIDKVKMECDRRDFINNVSTALCSKIASSTGEMAEAAIKG
                     MEYVNGDKRKIRVVKRTGGGLDDVKAYKSILLECDFKEIPKKAKLGVAQFCLSAPKTN
                     MDSKILVNDPALMEKIIQDERKYILEMCKKIKKSGCTLLVIQKSILRESLSDLASHFL
                     KQLNILVVNSVDRKDVDYICSTIGIQPVSEIDLLNPGSLVDVDIGEVEGMLEIKEHGC
                     TILLRGCDDMVVEEAERSLNDALCVVKCLEELPFLVPGGGSVEMGISLMLSESTEGNV
                     YVLREIAKAFEGVPYFLARNAGLYPVEIVSELRSELKQNDCAGISVRSGHAGDMVKED
                     SVVQPAKVSISIVTLAIETVSMILKIDDILPTRR"
     gene            complement(50967..51048)
                     /locus_tag="Eint_020460"
                     /db_xref="GeneID:9698680"
     tRNA            complement(50967..51048)
                     /locus_tag="Eint_020460"
                     /product="tRNA-Ser"
                     /note="tRNA Type: Ser, Anti Codon: CGA, Cove Score: 53.48"
                     /db_xref="GeneID:9698680"
     gene            complement(<51104..>51388)
                     /locus_tag="Eint_020470"
                     /db_xref="GeneID:9698681"
     mRNA            complement(<51104..>51388)
                     /locus_tag="Eint_020470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072361.1"
                     /db_xref="GeneID:9698681"
     CDS             complement(51104..51388)
                     /locus_tag="Eint_020470"
                     /note="similar to ECU02_0530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072407.1"
                     /db_xref="GeneID:9698681"
                     /translation="MEQIETQILFVRNLPKDISKDKIIELFGDYGRVIQIRIGVEKST
                     AGSAFVVYDRVSGARKAIKRMNGYYLDNMYLNVGYWQPFDKFRLMMKRKQ"
     gene            51507..51577
                     /locus_tag="Eint_020480"
                     /db_xref="GeneID:9698682"
     tRNA            51507..51577
                     /locus_tag="Eint_020480"
                     /product="tRNA-Thr"
                     /note="tRNA Type: Thr, Anti Codon: CGT, Cove Score: 65.16"
                     /db_xref="GeneID:9698682"
     gene            complement(<51614..>52624)
                     /locus_tag="Eint_020490"
                     /db_xref="GeneID:9698740"
     mRNA            complement(<51614..>52624)
                     /locus_tag="Eint_020490"
                     /product="clathrin coat assembly protein"
                     /transcript_id="XM_003072362.1"
                     /db_xref="GeneID:9698740"
     CDS             complement(51614..52624)
                     /locus_tag="Eint_020490"
                     /note="similar to ECU02_0540"
                     /codon_start=1
                     /product="clathrin coat assembly protein"
                     /protein_id="XP_003072408.1"
                     /db_xref="GeneID:9698740"
                     /translation="MIEEIFIVGEGDRVLYGDPSRYKKEARYPVDDVGGARMVQVGMN
                     DVKIGILHSLGCDFSVLEYIQRLCKKLEKKLGEINEKNVLENYFSLLRIINKQESVVL
                     FDGGKKLIPSITSNNVYLDVSEDLSAIIEKEKTILNRIDGRCYLNASFGEERTVEFDV
                     CSLKPCTIAYKNYQQVSEGLEGIRVSAKVQGSKLEAVRYWSSDAKDPLVMISKIDGGY
                     ILSCPSPTRFDRLEVCFPIPKMASKVVKSHRSGKSIYDEENDLLRWTFTKQVIRRERI
                     DYRVDLFEEYEDLRPIMVNFYIKEWKDSKVRVERAECVENPGVCFWIRYSMASGRYEI
                     RR"
     gene            complement(<52689..>54230)
                     /locus_tag="Eint_020500"
                     /db_xref="GeneID:9698741"
     mRNA            complement(<52689..>54230)
                     /locus_tag="Eint_020500"
                     /product="Spk1-like Ser/Thr protein kinase"
                     /transcript_id="XM_003072363.1"
                     /db_xref="GeneID:9698741"
     CDS             complement(52689..54230)
                     /locus_tag="Eint_020500"
                     /note="similar to ECU02_0550"
                     /codon_start=1
                     /product="Spk1-like Ser/Thr protein kinase"
                     /protein_id="XP_003072409.1"
                     /db_xref="GeneID:9698741"
                     /translation="MKKYKLHRVIGEGASSTVYGGVSAIGEEVAVKVASRRGRSGGMV
                     YREMKMLSSFHHENIVKVVDKFESANHVYIVEELCDLNLVSFLNEYEVDEDVALKILR
                     MILCGLRHIHSMGVIHRDLKLGNILLKGNTVKICDFGLSCYAEENSNEFCGTMDYLAP
                     EVIEGRKYSQGVDIWSAGIVFYVLLTKKKFYESLSSLECSKELKDLLGKLLEKDANKR
                     ISASEALMHESFSRFIPRCEDFRDLPNFEKNTRYGVMKKTRDLVELGDARIVARKKER
                     HGSGRRHGEEKCLCGEEFIYSVFIGNEETEPVFVTNGGLKALSLLTGHVKMMRERIPK
                     IIIDNGGNKFYYMFSGGFVYVTREFTLKTRGKGYEVIYLAGEKKYSEKIPDFLYETIM
                     GMKARCEAIDREVCWFLRESPVLVDCSSHQQFSMSYISQVSEMSIRNRTLYDYIENTG
                     WCIRNGLSFLFLMNDGERFEVLCEDLMVRYKERVFPIDNRLPQNLKHYLKRICSFFRG
                     IRDGL"
     gene            complement(<54341..>56149)
                     /locus_tag="Eint_020510"
                     /db_xref="GeneID:9698753"
     mRNA            complement(<54341..>56149)
                     /locus_tag="Eint_020510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072364.1"
                     /db_xref="GeneID:9698753"
     CDS             complement(54341..56149)
                     /locus_tag="Eint_020510"
                     /note="similar to ECU02_0560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072410.1"
                     /db_xref="GeneID:9698753"
                     /translation="MLRALFGYEKHFQMVDDVYKGRSGSEEKLSKLITYLKSRTSTIP
                     STLDYLKIRAGEEVYSTHRLKTGSKVLRLIIDQLRGVSICYESRIIRIFVGVIREILQ
                     LKRKGDFEYSDHQEFLDVFTYFFKTVPIRAYESERYIRKILFIATQAAKDVKNSDGIA
                     EGLSLDDEAEYNEKNVLETTNVWKDEGRQAGDFRMHGDEQGGEISNARFEYFFLEIIH
                     TLMGMEDILRIDYDEKYKWLVGSLMKHGEVNSSKRMEIFKAVAGKANIISGNSLIYYV
                     LKNASWMGKSCVGTLTEYLGPDLYPQIILQANMNILERGKRVHRDKKIGRSKAVGECE
                     FLVREALGVLNEYEVLHLNQKEIVVSFFSILEMFFSRDDSKLPFIIPYVRKYFEKCKP
                     ISDVFYRFLKKILQDKEVSGYTEDLRTTIFDEIQRYFVVHSDWIPNPKFMTLLLGAGT
                     GESAGFCCKILYLAKDYFMGRALKPFVKERVMRRLRVLFCETENRDIQYLLMDLVGDG
                     VSKDSHYKILCLFGAKKILNEELVKEMYKGRYLNVSEVLFGEFGCEALEPYDLDTEKR
                     MEEIESEKKKAQDCELDVKFRRHTRIALVDYEKHFR"
     gene            complement(<56229..>56441)
                     /locus_tag="Eint_020515"
                     /db_xref="GeneID:20314007"
     mRNA            complement(<56229..>56441)
                     /locus_tag="Eint_020515"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163558.1"
                     /db_xref="GeneID:20314007"
     CDS             complement(56229..56441)
                     /locus_tag="Eint_020515"
                     /note="similar to ECU02_0565"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161822.1"
                     /db_xref="GeneID:20314007"
                     /translation="MESDRLSESEKMIGMVESELLEEIKHKYKEIEESIEKTAAGLDK
                     VNKDLQDKVKAIYKEAEEGKLMYPKI"
     gene            <56489..>57901
                     /locus_tag="Eint_020520"
                     /db_xref="GeneID:9698754"
     mRNA            <56489..>57901
                     /locus_tag="Eint_020520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072365.1"
                     /db_xref="GeneID:9698754"
     CDS             56489..57901
                     /locus_tag="Eint_020520"
                     /note="similar to ECU02_0570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072411.1"
                     /db_xref="GeneID:9698754"
                     /translation="MTLIKRIISRNKSCYILQANEQTFLFDYPSSIYGTHFSFPSFAK
                     APKPLKLIFPKFVDNIDHILITRSDSLGVLFLEKDIPIYITEPVFEQILIKYKSLLKI
                     PAYYEDEEDEGVSVEDADVERFRRNARFVRFNERCYFDNVLITPHPAGTFIGWTNYLI
                     DIGDKRTIYYLTSLASKTRLSLEAGGISSDYLIINTDFPPPSHDIEEFSTYINDLGSD
                     VAIVPLEMTTMLIEVLLHTLFVTQAKGTIPIYVVSSEFGRLHTTISIENEWLSKPFSS
                     AKEPFPIRSYRRFYAVDTIDELSEISGPAVVFCDPLEFSLYSHPIFDNQKIISINNSV
                     PFADANYNLKLELDPEEISSIHTGTIIHNPNPGEYLYIEAMPGHYCLAVDARSIQVYT
                     NEIYLNGKLKFSDKHGFGKKMVFSQKKCKLSDLFSANRFFFSEGSYYFPQKGLKVTID
                     NKKAKIKKIIGLNKAKRTSK"
     gene            complement(<57936..>58679)
                     /locus_tag="Eint_020530"
                     /db_xref="GeneID:9698755"
     mRNA            complement(<57936..>58679)
                     /locus_tag="Eint_020530"
                     /product="hydroxyacylglutathione hydrolase"
                     /transcript_id="XM_003072366.1"
                     /db_xref="GeneID:9698755"
     CDS             complement(57936..58679)
                     /locus_tag="Eint_020530"
                     /note="similar to ECU02_0580"
                     /codon_start=1
                     /product="hydroxyacylglutathione hydrolase"
                     /protein_id="XP_003072412.1"
                     /db_xref="GeneID:9698755"
                     /translation="MGIEVVSIVIGDNYMHLFYEGDSAFCIDACNPRVLLKALGVDFK
                     KKIYSESEILGMEEDLEKRRKLVYLFTTHRHQDHSHGIPYIAENSPETKRISGFEGSI
                     CKCGDRFKFGEVEIECLYTPCHTVDSFCYYIGGEFLATGDTLFFLGCGKFFEGTPEQM
                     VQAIKKIMERVDQNAILLYGHDYNKQNIQFTEEFYCIPPEIKRKRFLRLRDEMEYNPF
                     FNLGKILTEDSESERMRELRRRKDYFNRM"
     gene            complement(<58752..>61097)
                     /locus_tag="Eint_020540"
                     /db_xref="GeneID:9698810"
     mRNA            complement(<58752..>61097)
                     /locus_tag="Eint_020540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072367.1"
                     /db_xref="GeneID:9698810"
     CDS             complement(58752..61097)
                     /locus_tag="Eint_020540"
                     /note="similar to ECU02_0590"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072413.1"
                     /db_xref="GeneID:9698810"
                     /translation="MEIELEVRRVESQKRITSTKIRHVFSSELVYLDDFTITIPVYGF
                     KDKEYEYTGSIFSRTKDLLGKIGGKGVLGVLYEDRMEVLKGLDRPILRCLYKDGDLIR
                     ICSLRRLVVVEPRSSVANVTFTRMVLQDQSKFAALKKLRMVNCNIKKIPDLSMMKLTH
                     LDLSHNNISGVVYVCGQFNTVNLSHNKITRVIRMKASNLDISYNEITRFFQESTYQNL
                     NLSHNPLEHYNAEARVLNLSHTMLKSLESQITKKLIVDGTKEIRLGTFENLVFLSVNF
                     CSLRLLSFNARKLRVLKARNNFIEEVPFFPFLEYLDISGNLIHGIASKGVRFLDASKN
                     QIMVFNLAKWKNLEHLNLSYNPLVSLENYGEMELKFLNLKGTNVIKDFRGNRIEKNVH
                     KCLEKKKEIERFIVHPKGINGRLLVISMGDFEAGVFEILETIQVRIQETSNSYEYFQK
                     FCSLLRKMIFARGARIGYALCMVTPKHVILNGRGIEVVFSNFAEIKILEGPDVVEVYD
                     NIGNWHFIPLFCSFKGSIARFDILDTVRNDLGLVLDFIGHQCPLSAVMAISNTSKLPK
                     NSKASVELISRIDLPSKISYETVIRSILRKKGNENGVQGSENYNFARKSSTRQFYGTL
                     LLNPNPIFAFCKLIPKDTSYRYVIGNVMNIMRMMSNVFSGTRIEFFSRIWIVAFHDRV
                     EACLWGIRIQEMLRCLGIDVGIGITCGTFYTRIMNNHVRFYGPVLNKASRIANLGIGV
                     FCCHCVWTKHSKIMYISQGRRIFRGFKEPHLIYTPQLSEKT"
     gene            <61326..>61892
                     /locus_tag="Eint_020550"
                     /db_xref="GeneID:9698811"
     mRNA            <61326..>61892
                     /locus_tag="Eint_020550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072368.1"
                     /db_xref="GeneID:9698811"
     CDS             61326..61892
                     /locus_tag="Eint_020550"
                     /note="similar to ECU02_0600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072414.1"
                     /db_xref="GeneID:9698811"
                     /translation="MDKFHSLAIKALLTFILTTGVFVNEGSFKMPLWIGLLPAVLFNP
                     AVAVYFYVKRMEYKKRFLRKTYNPGNRALLGFAFGEVLSIMPFYCISEYWKTMLLNIT
                     LVAILSILPMVDSSGRRTIQLERNEEFFKIGFLRVEHVEGGDVCLNKGEVVQILDHSG
                     GSTTVRKSDGRVFTIEDSYIDDGIDIVL"
     gene            complement(<61997..>62543)
                     /locus_tag="Eint_020560"
                     /db_xref="GeneID:9698674"
     mRNA            complement(join(<61997..62503,62529..>62543))
                     /locus_tag="Eint_020560"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_003072369.2"
                     /db_xref="GeneID:9698674"
     CDS             complement(join(61997..62503,62529..62543))
                     /locus_tag="Eint_020560"
                     /note="similar to ECU02_0610"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_003072415.2"
                     /db_xref="GeneID:9698674"
                     /translation="MASKKINPMREISIKKLSIHICARESGAKLDRAAKVLEQLTGQK
                     PVASKARMTIRNFGIRRNEKIAVHVNVSGKKAYELLNTALKVKEYELKESCFSNNGCF
                     GFGIEEHIDLGLKYDPNIGIFGMDFFVVLSRPGDRVSKRRRCRSKVGNKQRVYAEDAK
                     KWFVENFEGILVE"
     gene            complement(<62635..>62928)
                     /locus_tag="Eint_020570"
                     /db_xref="GeneID:9698675"
     mRNA            complement(<62635..>62928)
                     /locus_tag="Eint_020570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072370.1"
                     /db_xref="GeneID:9698675"
     CDS             complement(62635..62928)
                     /locus_tag="Eint_020570"
                     /note="similar to EBI_26858"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072416.1"
                     /db_xref="GeneID:9698675"
                     /translation="MHFLVKKPGWLVFDPNEYGDEEVRTFQVRHKESCSNTKLVKFED
                     GSWYLKNGSQMFSLKPVASKREVGVGAKDGNVVYIREILDKKWFIKMDKSSER"
     gene            <63083..>65239
                     /locus_tag="Eint_020580"
                     /db_xref="GeneID:9698676"
     mRNA            <63083..>65239
                     /locus_tag="Eint_020580"
                     /product="CAS/CSE chromosome segregation protein"
                     /transcript_id="XM_003072371.1"
                     /db_xref="GeneID:9698676"
     CDS             63083..65239
                     /locus_tag="Eint_020580"
                     /note="similar to ECU02_0630"
                     /codon_start=1
                     /product="CAS/CSE chromosome segregation protein"
                     /protein_id="XP_003072417.1"
                     /db_xref="GeneID:9698676"
                     /translation="MEHLLNDILQNPQGPSVKHVEERLDGIDGQREFVELLKSGNGIA
                     FTYMKTRCKEWTENPKRIEMIHRIHDVLFSLIFTSSEQNFGILCFFFETLYLCGNGWS
                     SLVEDLCANPNGRSVRVLNHMFNKYRVCSRSNALYGEIIRNIELCQDIFRKAYFESLS
                     EDENILGMFHSLVFQDIHPFFENNADRFLGSFCKLLRKQVLEKDVCEIFNLFVTKYPE
                     CVDMTRILGVVLTTITGFDYLKYTVLLNIVKRKSHPVLSKFSDALSNAVKMGAFVSEN
                     EIMEMNEDVLLYSRNLLKGYDVNRGIIIEMIGHLRKVFGEGWGSMLIEGTVATPIEEE
                     RLIFLCMALGIRLEEAVRKCSGIVQDSKSIGYLGVVSFRYLLSIGHYTVIDPGYINRG
                     NPGSFLAMVYLSRCIDNSGALESLESYSTRYGEGNPEACRKIGGPENCAKIMSHLMKF
                     LRDNIEDEFSSQLVQKVVRICPSSVSPEVVRFIDEFVWKNVRNINSPQAYGYLLDVQG
                     LVFLKTGDNTWILNLVQVVLSEEIFEIYSSSLFLLAIVVLHSSGDFSPVVEIIRQESL
                     WKTKELLLSMVCLTVSLFKTGNCSKEQVDYIVEYLLGVSIHHAYVLLTNTVVSGDYLK
                     WIKGENIEEEFVLACALKKRGLISEEMYKEIYTRSLQYFEKNFVSKRNARRVLRGLGY
                     GMESFGRSEAYGVMERNKHSIGYENIPFSVAVAFEL"
     gene            <65368..>66546
                     /locus_tag="Eint_020590"
                     /db_xref="GeneID:9698763"
     mRNA            <65368..>66546
                     /locus_tag="Eint_020590"
                     /product="WD40 domain-containing putative transcriptional
                     repressor for RNA polymerase II"
                     /transcript_id="XM_003072372.1"
                     /db_xref="GeneID:9698763"
     CDS             65368..66546
                     /locus_tag="Eint_020590"
                     /note="similar to ECU02_0640"
                     /codon_start=1
                     /product="WD40 domain-containing putative transcriptional
                     repressor for RNA polymerase II"
                     /protein_id="XP_003072418.1"
                     /db_xref="GeneID:9698763"
                     /translation="MFQPGIEAYLDAIKQQYDTVMAENRSLRKENIRLVEANGQYARK
                     IQYYTSILNRQKHMSLETEGSFIRPPKYLKRGSDWSVDGDKLCIVSVRDKIMVGGKIT
                     NAVISKCGKFVAFGCGYKVFIVMEKTIWFLDTSSEKMERYEEGMFEGETQEYRICPMD
                     FTCDSLYLYAADGKGAVRIWSLKSKAQEGLLRPCDPVALKITNNLVFTIEWDKTMNVY
                     DSNNKVLTLSSEEEFSGPMAVSPDGSFVYAVVGRTKILVFDIKTEMVHLANTNEDRIL
                     AIATSPEHAIMSIGGHGRNAYLYRIKKEKPLPRVQDSIDQRGTVFSLGFIGNHLLVGQ
                     PEGVMIWDLSEKRSMRIQLQESNVIGISTCKDSFATVDNNGVLRVWRYYNSVEWDNSS
                     "
     gene            complement(<66665..>68113)
                     /locus_tag="Eint_020600"
                     /db_xref="GeneID:9698764"
     mRNA            complement(<66665..>68113)
                     /locus_tag="Eint_020600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072373.1"
                     /db_xref="GeneID:9698764"
     CDS             complement(66665..68113)
                     /locus_tag="Eint_020600"
                     /note="similar to ECU02_0650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072419.1"
                     /db_xref="GeneID:9698764"
                     /translation="MGKDSLNSYLSPAAEEPEGKFRDARGLSMGSMDEKLRRINEEFK
                     ARACVGSGFVFNRNVKLESPANYFGKSKDFSNENGAADGIPKNNSGDVNSTKMRDGFI
                     GGVIPWKVNSSGAMNRSPAHKDISKGSMVGMDLYKKSSIDFSSYGMNKGSVEDSINRG
                     SKVGYVRSIASSSIFNREAPSNSGSFGNRRNRTSPSPFGKKEAQEEDLSVSKSVFSNP
                     LSNASSLSLSSKTSYQGPSFLYTRTGKSPTFAPIDVMYVKSMSKPENTIEKPEGNLKG
                     ASHSWSETRNSQMASNLYAPGRKLTIYPQIRISNTVLCYEGSAETTKYYITVESDIKW
                     IICKTIKDISTLFPGIRCATLANAMSPQDRRARDRAIEIALNSEMTDKQLQPFILSDI
                     SSTHLLRSSYLLMDKDGWKAYLFKFVGKALICYEKSRVYKIFLLSNCNVLPIGQVGFC
                     LERSGEGVELYTTCEKERDAWVSDIKEYISRL"
     gene            complement(<68199..>70397)
                     /locus_tag="Eint_020610"
                     /db_xref="GeneID:9698751"
     mRNA            complement(<68199..>70397)
                     /locus_tag="Eint_020610"
                     /product="muskelin N-terminus domain-containing protein"
                     /transcript_id="XM_003072374.1"
                     /db_xref="GeneID:9698751"
     CDS             complement(68199..70397)
                     /locus_tag="Eint_020610"
                     /note="similar to ECU02_0660"
                     /codon_start=1
                     /product="muskelin N-terminus domain-containing protein"
                     /protein_id="XP_003072420.1"
                     /db_xref="GeneID:9698751"
                     /translation="MLNDRRSYTVIPYEIHSYSTYASVYMPSNIKKNDPMDPNSRWST
                     STNDHLQYIILKIPPSLVVTITFGKYNKMHVSNVKKMRISVSGDGVEYKEVLCGGLKN
                     DSEMETFNLLVKDETYYIAQYVKIEPLAAWGVNFSYSLWFVELRGIADVEKFARYNEM
                     VIFGKSMRNCLKFLRDCGFRDVYEILEKRSSDKIEDEIVKHIRHLLESHKYEDTEEVL
                     DRLDPCVFQGFIDSSPYSLVWTEIPRAEVWPCERGGHQMVEMDGSLYLYGGWNGVEEL
                     EDFWRYRGGEWSEIKMNTVSPGKRSCHRMVSYGSKLYLMGKYICLSSRKVFSGKSDIW
                     VFDGNWRVINSDEEGGPGNIYDHQMVVVGDKLYVFGGRSTEKEDTYSGLYMFSLDERS
                     LGYGMEVLGKCGRTNEVGKPISETDGRYRTCGQFGGKEKRSPGMAEISPSFGTGISQE
                     NMLDESNSRHEPSTSSSSLFRSRWMVIRSDTMQPSSTPSLKSRLEHSMVFIPPDYIEG
                     SIYNNSLVVIGGQKNKSSMREMVFYRLDTDTVFQSVPFPISGEGRVVQRGLLYLNEIV
                     VLFCHGKEKEGRFENIDVYTFSLIKKKWTEVVVKSRTEAGVDIKPAPRSAHQFVEMDG
                     WFYLFGGNISEKVDRRVNDMWVFRLEKKTNKEIRHLSKFLVRKHKYLYLLGIDEEKAI
                     DYLRTSVLNMVVDDDTRELFEELCHEVYRRKIFVDPVEDICRLLTTAKEY"
     gene            <70547..>72055
                     /locus_tag="Eint_020620"
                     /db_xref="GeneID:9698752"
     mRNA            <70547..>72055
                     /locus_tag="Eint_020620"
                     /product="DEAD box ATP-dependent RNA helicase"
                     /transcript_id="XM_003072375.1"
                     /db_xref="GeneID:9698752"
     CDS             70547..72055
                     /locus_tag="Eint_020620"
                     /note="similar to ECU02_0670"
                     /codon_start=1
                     /product="DEAD box ATP-dependent RNA helicase"
                     /protein_id="XP_003072421.1"
                     /db_xref="GeneID:9698752"
                     /translation="MKLELHMVDEGGRNESVGFDRGKASKRLLWVGSDSEVRGRSSLR
                     KEKGGIARGPEKSNQHSGNDKNETVSQDSKEEEKAIATEDGDSKVRTSEKVKTLNSFK
                     DLSSPSLVKVLGREYTAPTVIQKYCIPSMVDGRNLLCRAPTGMGKTMCFLIPIIERYQ
                     QMNKPQACIISPTRELCEQIRTEASKLVVGSKIRVVSIYGKKQDLPSYAGVDIIVATP
                     GRLIDLLHKDKVDLSEVRMFVLDEADKLLDMGFEMPIREIHKFVPKNTQTCLFSATYS
                     PKLTRMINYFLPDDKVSIEIPSETLKNIRQDIVEVRNKKKMLLNILRSSEINLKGSWR
                     MEVQPDKVLVFVERKSECGEVEKTLKKNGILCVTLHGDKEQSDRNEALKGFRNGRFPV
                     MVATSVAARGIDIKDVKLVINYDIPKDIKEYIHRIGRTGREGKSGRSISFYDGGMSAD
                     FKKALIEVLKESKNPIPSFLSDTAEDFDARLQRLKVSADKEMSDDEEVGLWG"
     gene            <72134..>72988
                     /locus_tag="Eint_020630"
                     /db_xref="GeneID:9698748"
     mRNA            <72134..>72988
                     /locus_tag="Eint_020630"
                     /product="DNA replication factor C small subunit"
                     /transcript_id="XM_003072376.1"
                     /db_xref="GeneID:9698748"
     CDS             72134..72988
                     /locus_tag="Eint_020630"
                     /note="similar to ECU02_0680"
                     /codon_start=1
                     /product="DNA replication factor C small subunit"
                     /protein_id="XP_003072422.1"
                     /db_xref="GeneID:9698748"
                     /translation="MLWTEKYRPKSVDTFEGPEHLKSILRNSSERGHPNLLLYGPPGT
                     GKTTFAHLLATRKLELNASDERGISVIREKIKVYASTLEKDKTVILDECENLTSDAQH
                     CLRRVIEDSVNTRFIFITNYPSKIIGPLRSRLVGVKFTLADNRVLEGIGGNEGLGYDK
                     ELYRRLFKLCGNDLRKAINVLQGIAPLSSFCIEEAVGSIPQKTVDEFWKVGRAEVMDY
                     SKMFLRDGYSALQLVRQLAGCWKGSDAQSAKFHLLLSSLEEKAVLGCSDELVLYNLLG
                     GKVEIFSQ"
     gene            complement(<73029..>73451)
                     /locus_tag="Eint_020640"
                     /db_xref="GeneID:9698749"
     mRNA            complement(<73029..>73451)
                     /locus_tag="Eint_020640"
                     /product="HscB-like chaperone"
                     /transcript_id="XM_003072377.1"
                     /db_xref="GeneID:9698749"
     CDS             complement(73029..73451)
                     /locus_tag="Eint_020640"
                     /note="similar to ECU02_0690"
                     /codon_start=1
                     /product="HscB-like chaperone"
                     /protein_id="XP_003072423.1"
                     /db_xref="GeneID:9698749"
                     /translation="MGSPSRYFDIFGLKPSFAIDQNVLKERYYKMSRKFHPDKASPSG
                     EDISMEEINKAYDTLKNDLSRARYLNNPGNIDVGKEFLIDVLDYEQAISNAKNNEDRN
                     RIKEDLEKKIDQCKRNPSGEYLARWGYYARLMKMLNKR"
     gene            <73521..>74783
                     /locus_tag="Eint_020650"
                     /db_xref="GeneID:9698750"
     mRNA            <73521..>74783
                     /locus_tag="Eint_020650"
                     /product="Nucleic-acid-binding protein"
                     /transcript_id="XM_003072378.1"
                     /db_xref="GeneID:9698750"
     CDS             73521..74783
                     /locus_tag="Eint_020650"
                     /note="similar to ECU02_0700"
                     /codon_start=1
                     /product="Nucleic-acid-binding protein"
                     /protein_id="XP_003072424.1"
                     /db_xref="GeneID:9698750"
                     /translation="MGKSKGDDRKKEGRKSSRHKLPGKEGKTGSKKIVLRKKPCPIQG
                     IELQDATKIEKDLLMHGTIKDKIDVLTLLVERNPSPENYKALLAFCENQRNDVHYYVL
                     KNIQDLLISKREVENPYIKQRIIKSFDVNLRNQYIKKKVARLVHKLLEEGVLFVNLVH
                     LFINKLGDKRDMSDYVIDKLNLLVPGNEEMILDGIEDFYFKNDQFRSRHVVLKFLANI
                     DWENKVKAFEVFDTILRDFNENIPEEHRNILLEDLIVGLGKNMTDKNVCRTDIIRKSV
                     HTEKMIFYGAKALSNSKDPEILVFFKNAIKSHRMRGSKLLPEFLNMIHETASMHRDIE
                     FYRFLLETSLLYTPEYIISILIICSEARKEGLGGFDNIYSLRVLALHYHDVVRKLSLQ
                     LIGNEMILPFDPFDRMSLLNAEMMCGDL"
     gene            <74924..>75175
                     /locus_tag="Eint_020655"
                     /db_xref="GeneID:20314008"
     mRNA            <74924..>75175
                     /locus_tag="Eint_020655"
                     /product="DUF3317 domain-containing protein"
                     /transcript_id="XM_009163559.1"
                     /db_xref="GeneID:20314008"
     CDS             74924..75175
                     /locus_tag="Eint_020655"
                     /note="similar to ECU02_0705"
                     /codon_start=1
                     /product="DUF3317 domain-containing protein"
                     /protein_id="XP_009161823.1"
                     /db_xref="GeneID:20314008"
                     /translation="MGENKQRKDTGSRFHIHRRALGWMQKIYYRYSVETGICVLEWWE
                     SVLVNIYFLLLLSSLIKQIVRIGIYLADTLMKWHFLGRP"
     gene            complement(<75189..>77159)
                     /locus_tag="Eint_020660"
                     /db_xref="GeneID:9698806"
     mRNA            complement(<75189..>77159)
                     /locus_tag="Eint_020660"
                     /product="WD40 domain-containing putative histone
                     transcription regulator"
                     /transcript_id="XM_003072379.1"
                     /db_xref="GeneID:9698806"
     CDS             complement(75189..77159)
                     /locus_tag="Eint_020660"
                     /note="similar to ECU02_0710"
                     /codon_start=1
                     /product="WD40 domain-containing putative histone
                     transcription regulator"
                     /protein_id="XP_003072425.1"
                     /db_xref="GeneID:9698806"
                     /translation="MKISRTDIGHGTKRPKPIFSIDVSGTLMATASLDGEIKLWNEKH
                     EHVRTVKKHQGTVLCVRFSVDGKLLASGGDDGMVFVYRIDGDVVASACEHESDVSNVL
                     WTDRFLVSVGYDGYVVFYDLKSFEVVKKMKPHEGQIKGVSADRSFRYMCTQGDDGIVL
                     YEEFEEVGKIDASEGVILESFFSRTSWTPDGEFFASGLSFNRNYNTVEVFSKDLKNEC
                     SFIGHAAPCEVVAFNPRLYKEDRRYYVAAVSSQDLSLSLWCSLYSKPFLLVKNLTELP
                     VLDMCWNESGTKLFVCSYGGEVVQINVEEGEFGKVYEEEEDVSGEVFFSMENKDMFER
                     AKKEPAESNSKDGLAKSSKKVVRPVLISSDTPEEKDKIEGVEVETNHSYLAIFNYSCK
                     KLAKMATRSQMPKSFGDFKVEVGKDRTHVSVKRGPKEFYRIHGSIDMLCINKKYLCLY
                     TGKIQLYHLNTGILAMPFVCAGDVVAIDVLGSKLMYLQADGSFTILLINKCKVTFKGV
                     IPRTDGLLSLRLDRKYFLVAAFPSEEYFLGKKSGVWFLRTPVYNSIWTEDTDLTLDHD
                     ETLAHLENEFLISHFGGDKRRLMRVVKDITRAACKIRKMGDFIEFKLKNVIRILLGSG
                     ERTKAIRVLEKMNTNYALQPFVFKMLKEIGKI"
     gene            complement(<77243..>77629)
                     /locus_tag="Eint_020670"
                     /db_xref="GeneID:9698807"
     mRNA            complement(<77243..>77629)
                     /locus_tag="Eint_020670"
                     /product="histone H2A"
                     /transcript_id="XM_003072380.1"
                     /db_xref="GeneID:9698807"
     CDS             complement(77243..77629)
                     /locus_tag="Eint_020670"
                     /note="similar to ECU02_0720"
                     /codon_start=1
                     /product="histone H2A"
                     /protein_id="XP_003072426.1"
                     /db_xref="GeneID:9698807"
                     /translation="MAMVQGKGGKADPRVMGKDEEHQKSIVKLSQIKKIMKDRTRMRI
                     SKDALIGVSACVMYLISEITDGAKNVANTDGKKKVIPKHINHAICNDTELHFVGHDWL
                     IKNGGMKSYISPGDFSVSSKKGGSRD"
     gene            complement(<77720..>79237)
                     /locus_tag="Eint_020680"
                     /db_xref="GeneID:9698745"
     mRNA            complement(<77720..>79237)
                     /locus_tag="Eint_020680"
                     /product="poly (A) polymerase type 1"
                     /transcript_id="XM_003072381.1"
                     /db_xref="GeneID:9698745"
     CDS             complement(77720..79237)
                     /locus_tag="Eint_020680"
                     /note="similar to ECU02_0730"
                     /codon_start=1
                     /product="poly (A) polymerase type 1"
                     /protein_id="XP_003072427.1"
                     /db_xref="GeneID:9698745"
                     /translation="MEISERNYKYGVTGPLSMKESTEKEMKLSEEMDMYLQERGFFED
                     DKEGQTRERVLGKLNFMVREFVARMGKGRGSGDGEKAYGGKIFTFGSYRLGVHGKGTD
                     IDALCIVPRHVTRNDFFTHFYEELKGDPNIKEVTKIEDAFVPIIKFEFQGIPIDLVFA
                     RLNVPVVKDGINLLNDTLLKSMDEKCILSLNGSRVTDEMLNLVPNVNTFHSALRCIKY
                     WAKRRCVYGNPYGYFGGVAFSLCVARVCQLYPNASSFSIVCKFFELFSSWKWPTPVVL
                     RPVVDLNYNLKVWDPKVYPSDKYHRMPVITPAYPSMCATHNVSNSTQHVISMEFARAH
                     EILSSPEKNDFRKIFDLSDFFSRYKLFAEILAMSTEEEGFPKWEGYVESKVRILASKF
                     EAVDDILYAIPFPKAFRVAEENIGKIKYGMQDLKKCTAFFIAIDVIPVKGKKVVVEQQ
                     VKEFVDFMNEYEGKERSMRIEINSLKKKDVQNFLRVFYGKENLTSDETGKRRRVE"
     gene            complement(<79350..>79583)
                     /locus_tag="Eint_020690"
                     /db_xref="GeneID:9698746"
     mRNA            complement(<79350..>79583)
                     /locus_tag="Eint_020690"
                     /product="ubiquitin"
                     /transcript_id="XM_003072382.1"
                     /db_xref="GeneID:9698746"
     CDS             complement(79350..79583)
                     /locus_tag="Eint_020690"
                     /note="similar to ECU02_0740i"
                     /codon_start=1
                     /product="ubiquitin"
                     /protein_id="XP_003072428.1"
                     /db_xref="GeneID:9698746"
                     /translation="MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGY"
     gene            <79855..>80475
                     /locus_tag="Eint_020700"
                     /db_xref="GeneID:9698747"
     mRNA            <79855..>80475
                     /locus_tag="Eint_020700"
                     /product="60S ribosomal protein L7A"
                     /note="L8 in yeast"
                     /transcript_id="XM_003072383.1"
                     /db_xref="GeneID:9698747"
     CDS             79855..80475
                     /locus_tag="Eint_020700"
                     /note="L8 in yeast;
                     similar to ECU02_0750i"
                     /codon_start=1
                     /product="60S ribosomal protein L7A"
                     /protein_id="XP_003072429.1"
                     /db_xref="GeneID:9698747"
                     /translation="MVLGKVKKIPAMAPKLTKEQKMERELLIKKKISKLANAIRIPPA
                     INQFKTFLSEDDTKKFVDLFMKYRPENKKEKIARLSSEDPKKGPKPILVKFGLKHVTS
                     LIESKKAKLVLISASVDPIEVVIFLPTLCRKMGVSYAIVENSTILGRLVNLKSTSCVC
                     LCDARPEDEAAFKEIQGIANAIFLDNYETHLRTWGGGPKKQTSEEQ"
     gene            complement(<80514..>81041)
                     /locus_tag="Eint_020710"
                     /db_xref="GeneID:9698706"
     mRNA            complement(<80514..>81041)
                     /locus_tag="Eint_020710"
                     /product="S26 Type I signal peptidase"
                     /transcript_id="XM_003072384.1"
                     /db_xref="GeneID:9698706"
     CDS             complement(80514..81041)
                     /locus_tag="Eint_020710"
                     /note="similar to ECU02_0760"
                     /codon_start=1
                     /product="S26 Type I signal peptidase"
                     /protein_id="XP_003072430.1"
                     /db_xref="GeneID:9698706"
                     /translation="MLEYLISEKDIRMLKRMSIRQKLVQFVNAAYSVMGTYMIWKMFS
                     ILLNNDSPIVVVLSESMSPGFEKGDILWLANKDFSVGDMTVFKFGREIPCVHRCIKQF
                     GERYLTKGDNNLDDDVSLYPRGRNYLTRGEIKSIVVGYIPFFGWINLWINTIPGVKFA
                     ILAAVGMSVLFTREE"
     gene            complement(<81136..>81521)
                     /locus_tag="Eint_020720"
                     /db_xref="GeneID:9698707"
     mRNA            complement(join(<81136..81495,81519..>81521))
                     /locus_tag="Eint_020720"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_003072385.1"
                     /db_xref="GeneID:9698707"
     CDS             complement(join(81136..81495,81519..81521))
                     /locus_tag="Eint_020720"
                     /note="similar to ECU02_0770"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_003072431.1"
                     /db_xref="GeneID:9698707"
                     /translation="MGCVRNKIVKRAARTIAEKYFQRLDNTFDHNLLVVQDVAVVQSK
                     KLKNEIAGYLTSLYKKILKGTYNKVYIKSHEEERERKENVIPKESILDVDSVEVDNVT
                     MEMIKRYGYEGNFKIYGV"
     exon            complement(<81136..81495)
                     /locus_tag="Eint_020720"
                     /number=2
     exon            complement(81519..>81521)
                     /locus_tag="Eint_020720"
                     /number=1
     gene            complement(<81571..>82254)
                     /locus_tag="Eint_020730"
                     /db_xref="GeneID:9698693"
     mRNA            complement(<81571..>82254)
                     /locus_tag="Eint_020730"
                     /product="transcription initiation factor TFIIF subunit
                     beta"
                     /transcript_id="XM_003072386.1"
                     /db_xref="GeneID:9698693"
     CDS             complement(81571..82254)
                     /locus_tag="Eint_020730"
                     /note="similar to ECU02_0780"
                     /codon_start=1
                     /product="transcription initiation factor TFIIF subunit
                     beta"
                     /protein_id="XP_003072432.1"
                     /db_xref="GeneID:9698693"
                     /translation="MELNTNNKNTKIWLAKVPLFLAERILSLGGETTIGELDITKATS
                     TEPAVLSLKLSKEFCEGGFPSSFEVKVKPRDNSMYVIRAYENNADVEGVINNECYITP
                     EINGEYLRYKKEAGFKSDAKKSDVQVIDYLKEGKRGEKFGSLRELEYLARKRKKMLMD
                     KKRERLGKNEVIDMVFKAFEKYPSWTVKDLADFCGQPVAFIQEIVSDICVLNKKDLKN
                     AYELRPEYR"
     gene            complement(<82334..>82765)
                     /locus_tag="Eint_020735"
                     /db_xref="GeneID:20314009"
     mRNA            complement(<82334..>82765)
                     /locus_tag="Eint_020735"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163560.1"
                     /db_xref="GeneID:20314009"
     CDS             complement(82334..82765)
                     /locus_tag="Eint_020735"
                     /note="similar to ECU02_0785"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161824.1"
                     /db_xref="GeneID:20314009"
                     /translation="MKGIILSISIMLLIFQVPVYGSNEDGSLGRCNPGFTDNEEQHDG
                     GNDSGQSPQDGSSHGPVQDGDQPTDSGSGGQDPVTEQPGPSDGTDGGLSAEVIVASTS
                     TTNENGTETTERMCSCSCDCGALGDLVTAASSVLSSCFGRS"
     gene            <82818..>83369
                     /locus_tag="Eint_020740"
                     /db_xref="GeneID:9698781"
     mRNA            <82818..>83369
                     /locus_tag="Eint_020740"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_003072387.2"
                     /db_xref="GeneID:9698781"
     CDS             82818..83369
                     /locus_tag="Eint_020740"
                     /note="similar to ECU02_0800"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_003072433.2"
                     /db_xref="GeneID:9698781"
                     /translation="MKILVTRTVKIPEGCIVKQEGKVFTFEGPKGRIVEDCTRHPLTF
                     DIYEGNVRIRLWNGKRKAAALAITVESLLKNAVKAVTVGFAYTLKAAYNHFSINMEVK
                     EDGKVLLVKNFLGEKNIKVFRMRGVARVRLDERKDTIVIEGPSLPDVSQSAGTISNEC
                     KAKNRDSRVFLDGIFVTERGIMA"
     gene            complement(<83449..>83916)
                     /locus_tag="Eint_020750"
                     /db_xref="GeneID:9698782"
     mRNA            complement(<83449..>83916)
                     /locus_tag="Eint_020750"
                     /product="ribosome biogenesis protein RLP24"
                     /transcript_id="XM_003072388.1"
                     /db_xref="GeneID:9698782"
     CDS             complement(83449..83916)
                     /locus_tag="Eint_020750"
                     /note="similar to ECU02_0810"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP24"
                     /protein_id="XP_003072434.1"
                     /db_xref="GeneID:9698782"
                     /translation="MRIEKCWFCSSNIYQGHGTVYVRNDAKVFRFCRSKCRKLFERRV
                     NPRKVKWTKISRKMANKELCNDPILEFEHRLNEPRIYDRKEVQKTLSSIPKILDIRKR
                     REDFFIKDRILTGQEANKESDLEYIERHATLLESEVSFESHTTKAKKKEAQAN"
     gene            complement(<83969..>85297)
                     /locus_tag="Eint_020760"
                     /db_xref="GeneID:9698783"
     mRNA            complement(<83969..>85297)
                     /locus_tag="Eint_020760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072389.1"
                     /db_xref="GeneID:9698783"
     CDS             complement(83969..85297)
                     /locus_tag="Eint_020760"
                     /note="similar to ECU02_0820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072435.1"
                     /db_xref="GeneID:9698783"
                     /translation="MLDIGNPIGIINKFKSYRSVRIFIPDIPSSVCAAKIITEILHKE
                     LIRFEMDFQPEKVEHHSDQDLNVFIDLDPRECKNFLSLCGQENSSLQGSWFVCTCKPN
                     WIHSCMLAYSLAKAMNYVTTDVLWAMIVCFGFHRIFTKDLTPVDDLENESNFSDSICA
                     GCRELHADLVFEIQRAGVLTDTDGLYYVERPCISFLNFTSLFSALQNDIPFVVSNKIY
                     YKKNKSAEAQRICEYLARKGISREASYELYGNLGYSTKALIESHFRKRKCFVKKIGYG
                     IEVSPIENFFLICHHLLKGARVDAFLCLSSREVLGMKESIKIHHELIWIYRDSLANIR
                     KLGNILLFRINISETLKGMAIGVLVHLFEHYFDMYIRRRYSPSFRQMIIFQGYLEDRF
                     IVTTDDPPISSELFHRRERLGGYVVMNRNELFEIIAKVKTKTGEVSSIAV"
     gene            <85420..>85767
                     /locus_tag="Eint_020770"
                     /db_xref="GeneID:9698808"
     mRNA            <85420..>85767
                     /locus_tag="Eint_020770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072390.1"
                     /db_xref="GeneID:9698808"
     CDS             85420..85767
                     /locus_tag="Eint_020770"
                     /note="similar to ECU02_0830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072436.1"
                     /db_xref="GeneID:9698808"
                     /translation="MNRYFCREILLLEEITTELLGSKEMDEETTHKAKLLLTIKDKLN
                     EKMMEMEEYYMKRIEFYRENDGTRAKELEKQTEECNEKYLGLLIRAKELGHQIERLEI
                     KGLRNKSCAGNEL"
     gene            <85985..>87151
                     /locus_tag="Eint_020780"
                     /db_xref="GeneID:9698809"
     mRNA            <85985..>87151
                     /locus_tag="Eint_020780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072391.1"
                     /db_xref="GeneID:9698809"
     CDS             85985..87151
                     /locus_tag="Eint_020780"
                     /note="similar to ECU02_0840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072437.1"
                     /db_xref="GeneID:9698809"
                     /translation="MAGERAEYGGIAGGQELIYHFQEDSDDLGVEKEYEENEPNSLRL
                     RNFVEDELYQSDGQMQYRGEDEMRLRYGRKKKEKRKKKKNDENKRPSNRKIVNLPASP
                     PYVRFVDGEERLCFKYVTKVSESARDAMPKTDLEDNEFCVRFDLDSVDISKLNEKFKA
                     DNCVYPRANLPYEMYTGNRWGFETECNRLAWQFVSLNPVLLYGKKGLIQRAVDSYRTI
                     NKQSRNKRIVKEDRFPSDIEKRKHVSGAPSTITIQWTNRGILKKCKIQVNIENINYGK
                     IDDEFKSRFSVFMDDFDDKSFGKSKWESHNVDNELAVKIAFLNVENTSFWNAIKALDK
                     TTVLKKAIEAYKQKRDEYASSDDDTEMSDVIASALGSSLGNSKSCNVENFYFDN"
     gene            <87271..>88767
                     /locus_tag="Eint_020790"
                     /db_xref="GeneID:9698696"
     mRNA            <87271..>88767
                     /locus_tag="Eint_020790"
                     /product="protein disulfide isomerase"
                     /transcript_id="XM_003072392.1"
                     /db_xref="GeneID:9698696"
     CDS             87271..88767
                     /locus_tag="Eint_020790"
                     /note="similar to ECU02_0850"
                     /codon_start=1
                     /product="protein disulfide isomerase"
                     /protein_id="XP_003072438.1"
                     /db_xref="GeneID:9698696"
                     /translation="MLLVYLLGCLAEIVEQCKPINEGYVLSKYFAQWCPACQNMGPLI
                     EEISNKIDRHEANLKIRSVDCDECSCPNVKSYPTLEMSKDGETLGKLEGPQDYDEIIE
                     FIVNHTGIERSVFEGHAAQKEAEVRRLNKNDFLSGFDGPHIVLFYSREDDKYREIFKE
                     IAKIYNGKLNVGEIDSAESAEFVNRYDIRSYPSISGIYNGLVVPFIEKGKEPSMPNLI
                     EFCDKLIEQSFANLTLAKFGELASKLEPGEPIYVVFHKNLALANAYFQRMAHMYKFRA
                     SIYRSDDQALFEKASIFPKELGSGSDTTSSPNHEDVVILSVYKNGVFYRYSDTFGDET
                     KITDWIFHTHYRYLTRIDNHNFYSIFHGLKPVMILLTRGEELVNKMNEFSADRHLGVP
                     YTDMIFATMEIDEYPLFVPTLLPRLSTPALIVFEPWRNLFRHKKAKLTEDNFISTAMD
                     TYTLYQNNRLPLYPPKSHNVLKYCLLGGLVLGVGLYYSSKAGFAKKNK"
     gene            <88827..>90095
                     /locus_tag="Eint_020800"
                     /db_xref="GeneID:9698697"
     mRNA            <88827..>90095
                     /locus_tag="Eint_020800"
                     /product="serine palmitoyltransferase subunit 1"
                     /transcript_id="XM_003072393.1"
                     /db_xref="GeneID:9698697"
     CDS             88827..90095
                     /locus_tag="Eint_020800"
                     /note="similar to ECU02_0860"
                     /codon_start=1
                     /product="serine palmitoyltransferase subunit 1"
                     /protein_id="XP_003072439.1"
                     /db_xref="GeneID:9698697"
                     /translation="MKLIYILGDLLISYWKDILKVVIETLVIYLVVRFRYRSNKDVII
                     FPQNVIDKLVAEFDPDDLVKDVPSDVMLPSVYKEGMVDLANFDVFGLAMENKKEIVEA
                     IRKYGVGTCGPRGFYGTLDIHLDLERTISRELGAEASIVYPNSFIAVNSIIACFCKQQ
                     DIVFYHEDCNEAILRGIGLSKSKNIEFASISDLEIKLEYFTRPKVRNFVIIEGLSKNT
                     GKIVDIKKILELRDKYKFRIILDESYAIPLLNKRGVCGANGVSIKEIDITIGSLSGGL
                     CCGGAFSLGTYHAVDYQKLSGSSYCFSASLPGALAKAAILNIQREFDYEGLRNRVELF
                     HATFESKTYEIMSSPLSPIVIVVKKREVRRPMSREALLKEVLDIRSELLKNGIIVGFN
                     HNPYPSLRICLKAKIPRDDVTRLAVMLNKW"
     gene            complement(<90133..>90369)
                     /locus_tag="Eint_020805"
                     /db_xref="GeneID:20314010"
     mRNA            complement(<90133..>90369)
                     /locus_tag="Eint_020805"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163561.1"
                     /db_xref="GeneID:20314010"
     CDS             complement(90133..90369)
                     /locus_tag="Eint_020805"
                     /note="similar to ECU02_0865"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161825.1"
                     /db_xref="GeneID:20314010"
                     /translation="MHSSLVHLNSLIFSSNLSEVPEAADRCLYDILGQYDHSQMTIFT
                     GLMEILLDTEMSSLASKMLKIVDLIKFPAKKAMV"
     gene            <90424..>92313
                     /locus_tag="Eint_020810"
                     /db_xref="GeneID:9698698"
     mRNA            <90424..>92313
                     /locus_tag="Eint_020810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072394.1"
                     /db_xref="GeneID:9698698"
     CDS             90424..92313
                     /locus_tag="Eint_020810"
                     /note="similar to ECU02_0870"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072440.1"
                     /db_xref="GeneID:9698698"
                     /translation="MGICRNKDFVIVSEKNEILMMDIMTLSVFHRRECGVNSPVACSN
                     EYVFIGDGCGVMALGLLDLKEREVCRMKTPVTAIFHLDGFIYCGSEEGTIYVYGGGRK
                     EDGDVGEGKDSMDFLGSELSNEMFSMDDGGFKLVKTMKHPGPVTQICSDGTEVFVADM
                     RNKVTVYPSKKTYDIKNPKLAYKNYIFASERNMLYCKTRNAFATYLTTEKPISGYTFS
                     MNGGVLFAQCRDTVDVVDFNTKKVVKKVEVAGKFVYDDVRDRLVWFDGKRLVAVENVL
                     EREYKGMDGIMFREDGLVEKKIKIDEEMDENIVEKYREDGLWKKPPKRKYFRASSEGE
                     NGLGEGGEEKKEVVDPDEWVEEAKTKGKDSLGRSKLEAEPGSLLCYNTEGYMTCIGDE
                     ERGRIEINYHDVSRRRIEVDGIQGCTIGSFCQDNIIVGNGKKIFYIGPSSRWEKEVEA
                     SIVSVSEKMVVSFSGELRVFGLDGSEMLNCLIPDVSAICCRSDIIVVFSREIIVIDLF
                     KSTERFFLPSPVDFACFDEGEKVFYRINGKMYQLYKGLSVRVCEAPKQPLAVFKGNVI
                     SLGPSRRLFPSPHVEYTQFDVFDPCRSKEPMGSTEDEEVLCSEDYENKNVEVSKSKRY
                     NPLKK"
     gene            92384..92455
                     /locus_tag="Eint_020820"
                     /db_xref="GeneID:9698759"
     tRNA            92384..92455
                     /locus_tag="Eint_020820"
                     /product="tRNA-Pro"
                     /note="tRNA Type: Pro, Anti Codon: AGG, Cove Score: 57.82"
                     /db_xref="GeneID:9698759"
     gene            complement(<92521..>93074)
                     /locus_tag="Eint_020830"
                     /db_xref="GeneID:9698760"
     mRNA            complement(join(<92521..93038,93071..>93074))
                     /locus_tag="Eint_020830"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_003072395.1"
                     /db_xref="GeneID:9698760"
     CDS             complement(join(92521..93038,93071..93074))
                     /locus_tag="Eint_020830"
                     /note="similar to ECU02_0880"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_003072441.1"
                     /db_xref="GeneID:9698760"
                     /translation="MGINHRGDHKRRKTGAKAVISRKKRNNRAGSQPSATKIGERRVI
                     PVRVRGGNKKYKALRLDVGYFRFPSTGKTRASKLLQVVYHPSSNDLVRTNTLTKSSVV
                     KIEAEPFKEDIETIGSSTDPELHENFEKGHLYGIITSRPGQAGAALGHVLQGSELKFY
                     TEKFNKKSKETRK"
     exon            complement(<92521..93038)
                     /locus_tag="Eint_020830"
                     /number=2
     exon            complement(93071..>93074)
                     /locus_tag="Eint_020830"
                     /number=1
     gene            complement(<93076..>93333)
                     /locus_tag="Eint_020835"
                     /db_xref="GeneID:20314011"
     mRNA            complement(<93076..>93333)
                     /locus_tag="Eint_020835"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163562.1"
                     /db_xref="GeneID:20314011"
     CDS             complement(93076..93333)
                     /locus_tag="Eint_020835"
                     /note="similar to ECU02_0885"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161826.1"
                     /db_xref="GeneID:20314011"
                     /translation="MTLKMAFITTVFLASLTAFIMGLRRDKILKLDMETIKEAMEATG
                     NEMAELGKKTMEVLVPSTSQNPEEPNESEADSNKESRKNLP"
     gene            <93227..>93730
                     /locus_tag="Eint_020840"
                     /db_xref="GeneID:9698793"
     mRNA            <93227..>93730
                     /locus_tag="Eint_020840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072396.1"
                     /db_xref="GeneID:9698793"
     CDS             93227..93730
                     /locus_tag="Eint_020840"
                     /note="similar to ECU02_0890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072442.1"
                     /db_xref="GeneID:9698793"
                     /translation="MVSMSSFNILSLRSPMIKAVRDAKNTVVIKAIFSVIKKNIPSKD
                     KYFLSNHFSLFLTPEVSETDSSDFKNKDFFYGKARWIQKVEGISDVIVCWAPKIFACY
                     ACEYWFYTICCSFFSNSDQRISKGGFHCFYCRGVHYKDLPDPFPGGFLGQSTEGSSKT
                     RNSSLPG"
     gene            complement(<93912..>94253)
                     /locus_tag="Eint_020850"
                     /db_xref="GeneID:9698794"
     mRNA            complement(<93912..>94253)
                     /locus_tag="Eint_020850"
                     /product="60S ribosomal protein L35A"
                     /transcript_id="XM_003072397.1"
                     /db_xref="GeneID:9698794"
     CDS             complement(93912..94253)
                     /locus_tag="Eint_020850"
                     /note="similar to ECU02_0900"
                     /codon_start=1
                     /product="60S ribosomal protein L35A"
                     /protein_id="XP_003072443.1"
                     /db_xref="GeneID:9698794"
                     /translation="MSKPIMSEEVLSRTTIPATFVSFKRGLRRLHPRYALLKINNVGS
                     KIEAEKYVGNGVVCFKTSTEGEKYPVHGVVTRIHGNSGAVRAKFTRNLNPKQLGTHVF
                     VKLYKVEADEI"
     gene            complement(<94286..>94618)
                     /locus_tag="Eint_020860"
                     /db_xref="GeneID:9698795"
     mRNA            complement(<94286..>94618)
                     /locus_tag="Eint_020860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072398.1"
                     /db_xref="GeneID:9698795"
     CDS             complement(94286..94618)
                     /locus_tag="Eint_020860"
                     /note="similar to ECU02_0910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072444.1"
                     /db_xref="GeneID:9698795"
                     /translation="MKRNYIQELSTKHLVCDYERIKREYLRYKAKNIDTLEYVDDAML
                     AVYEHAFFFNFTKTKFSKKDLPKEVKPRILKAALEEVKKKYVPNKSTEEKGLVCNLYS
                     ITNTLSFQ"
     gene            <94676..>95272
                     /locus_tag="Eint_020870"
                     /db_xref="GeneID:9698796"
     mRNA            <94676..>95272
                     /locus_tag="Eint_020870"
                     /product="putative MAD domain-containing protein"
                     /transcript_id="XM_003072399.1"
                     /db_xref="GeneID:9698796"
     CDS             94676..95272
                     /locus_tag="Eint_020870"
                     /note="similar to ECU02_0920"
                     /codon_start=1
                     /product="putative MAD domain-containing protein"
                     /protein_id="XP_003072445.1"
                     /db_xref="GeneID:9698796"
                     /translation="MEELYRKFSETLRENTSLRHQIVDLESALSSKEQELLMAKESSG
                     LGQYLRRIESLERENKRLKDMVERAGQDNCEGENINPNAIMSEEKTENGTHRSETKDP
                     SGELRQYLKTIREYVTGLTGYKMEFRDGEIIFHSLYAFDSEDVFIFRYKSGNMELVNN
                     DFAASWATEVQNYLIAGKSIPAFLAAVTLELFNKKTFG"
     gene            complement(<95324..>96805)
                     /locus_tag="Eint_020880"
                     /db_xref="GeneID:9698742"
     mRNA            complement(<95324..>96805)
                     /locus_tag="Eint_020880"
                     /product="pre-mRNA 3'-end processing cleavage and
                     polyadenylation factor"
                     /transcript_id="XM_003072400.1"
                     /db_xref="GeneID:9698742"
     CDS             complement(95324..96805)
                     /locus_tag="Eint_020880"
                     /note="similar to ECU02_0930"
                     /codon_start=1
                     /product="pre-mRNA 3'-end processing cleavage and
                     polyadenylation factor"
                     /protein_id="XP_003072446.1"
                     /db_xref="GeneID:9698742"
                     /translation="MDVEEKTGIEMGSPSAIMEHARDLYTSKDYRSLESLFGKCLKKS
                     YNLELWMLYIEYVRKVSQKKFKLYEVYEFTLGQFENYWDSYGLYKEYIEELGKIEDEQ
                     TRIEKIRNGYMRALQTPMSSLSELWKDFENFELELNKITGKKIVSDTLPIFQSSFQRY
                     QQMQPLIRSWSVKNAAKLIDLEMENGMKLGGRTHESRMHFIYNYILDSFYYAEEAYFF
                     YSEYLIGIGQKEKAKKVIQRGIEMSDGMFLSLYYGLVMDEEEVYGDLKKKYFYQENED
                     GGKSSGREADLLRINHLNYVLKKRGLESFRKLFIEVGNEGIGPHVFIYCAFVEYYATG
                     SRTTPYNIFSSGLLKHPDSTLLKEQFFLFLLRIGDEENARALFKRLEKTSRMWDSMIE
                     YEFMIGSMELFRELVDQKMSSIKDNAILPALPEREKDIQMEGILGRYHCFLNSFNFLD
                     LKIKDNSRLLDEFMESLPKISQQNNVLSNLKPDKIVDLLKCIQ"
     gene            complement(<96861..>97793)
                     /locus_tag="Eint_020890"
                     /db_xref="GeneID:9698743"
     mRNA            complement(<96861..>97793)
                     /locus_tag="Eint_020890"
                     /product="thioredoxin reductase"
                     /transcript_id="XM_003072401.1"
                     /db_xref="GeneID:9698743"
     CDS             complement(96861..97793)
                     /locus_tag="Eint_020890"
                     /note="similar to ECU02_0940"
                     /codon_start=1
                     /product="thioredoxin reductase"
                     /protein_id="XP_003072447.1"
                     /db_xref="GeneID:9698743"
                     /translation="MENIVIIGSGPAAYNAALYTMRGNPLLFEGGYIGNNGPGGQLTT
                     TTSVDNYPGFPGGIEGPELTQLMKEHAVSRGLRVVKETVSDVRKEDEWFVVSSEKGEK
                     KARIVIVATGASARRLFVPGTGDDEFWQKGVSSCAVCDGFIYVNKVTCVIGGGDAAME
                     EGLYLSNIAKKVYIIHRRNEFRARSDMIEKARNTENIEIMTPYVLERAEGTNKIKEIV
                     VRNTETGETKTIPMDGVFFGIGHDPNTSFLKSVNVDLDSNGYIVVKDDACTSVPGLFA
                     AGDVCDRKYRQAVTAAASGAICGIKAMEFLDKNK"
     gene            complement(<97852..>98490)
                     /locus_tag="Eint_020900"
                     /db_xref="GeneID:9698744"
     mRNA            complement(<97852..>98490)
                     /locus_tag="Eint_020900"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072402.1"
                     /db_xref="GeneID:9698744"
     CDS             complement(97852..98490)
                     /locus_tag="Eint_020900"
                     /note="similar to ECU02_0950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072448.1"
                     /db_xref="GeneID:9698744"
                     /translation="MGGDVYSLDKAVKSKKKKGVPQDVIEEAERIEEQNYERAKGVRM
                     QLDESALKQKATTEELMRQGETLENAKRAAVGINVNARRGSEITEDIEREGRVFSCEL
                     PCVRAIKRWFRRDRGGIDDIVNRGQEEENDVEQAPKHVEFEEGEEYIKGQNKTDREMV
                     GVLNTVRQIRVEADKQNKEAARHKSIVNDISMINERSSKVIRETDKELKKVE"
     gene            complement(<98575..>99177)
                     /locus_tag="Eint_020910"
                     /db_xref="GeneID:9698721"
     mRNA            complement(<98575..>99177)
                     /locus_tag="Eint_020910"
                     /product="putative membrane integral protein"
                     /transcript_id="XM_003072403.1"
                     /db_xref="GeneID:9698721"
     CDS             complement(98575..99177)
                     /locus_tag="Eint_020910"
                     /note="similar to ECU02_0960"
                     /codon_start=1
                     /product="putative membrane integral protein"
                     /protein_id="XP_003072449.1"
                     /db_xref="GeneID:9698721"
                     /translation="MIFVLYLGIIFAEIFSVRRKRNIEVEFDVIENKICKGYLKPINC
                     KNSSFKAVLASESGSVYLSNENLPVDTETHFSFNISEPKVLSMVLTPIVIDETQPHTF
                     GEIELNFSAQFDTFKKDVAKKVSVEPAMAAMTKLDNLLYELNNESEYLAHRMGSVDYE
                     HRRMFSFVTVFSVITLVIYFGVNSYELYSLKKFFQKKKMI"
     gene            complement(<99251..>99748)
                     /locus_tag="Eint_020920"
                     /db_xref="GeneID:9698722"
     mRNA            complement(<99251..>99748)
                     /locus_tag="Eint_020920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072404.1"
                     /db_xref="GeneID:9698722"
     CDS             complement(99251..99748)
                     /locus_tag="Eint_020920"
                     /note="similar to ECU02_0970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072450.1"
                     /db_xref="GeneID:9698722"
                     /translation="MSREDGQKVNHDVFGLMYTSFINKVIKDGPEGSRERLFTIGKRI
                     GERMADDFFFTGKPEKPMGLGEVSKDISESFFPYYFSFHPTHNQGIISLGRLPLLQYT
                     GKEEECLEMICGILQSVYGYVSKDGIRFEAMKYKGEHCIVVRDGEHVEGPSAVRLREG
                     EFREI"
     gene            <99780..>100232
                     /locus_tag="Eint_020930"
                     /db_xref="GeneID:9698712"
     mRNA            <99780..>100232
                     /locus_tag="Eint_020930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072405.1"
                     /db_xref="GeneID:9698712"
     CDS             99780..100232
                     /locus_tag="Eint_020930"
                     /note="similar to ECU02_0980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072451.1"
                     /db_xref="GeneID:9698712"
                     /translation="MQSSSHRAGKDASQEGLESVEFLDHLADIQMHCTATSLPALYEV
                     AVKGMMSYAVRIPPAAQGTGRVELQEGSSEMNMVGLLTYFIDMMYGEGLVVSEVSVQL
                     KDGHLFCDYSVASGSECQSLCEIKAVTLCGLKIFEEENVFHLYCIFDV"
     gene            complement(<100302..>100961)
                     /locus_tag="Eint_020940"
                     /db_xref="GeneID:9698713"
     mRNA            complement(<100302..>100961)
                     /locus_tag="Eint_020940"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072406.1"
                     /db_xref="GeneID:9698713"
     CDS             complement(100302..100961)
                     /locus_tag="Eint_020940"
                     /note="similar to ECU02_0990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072452.1"
                     /db_xref="GeneID:9698713"
                     /translation="MRLLMVSMTLTFSVFCSAEDSSTKSTDNIFKKFLEVAVKDEHHR
                     LLPTKGKHSPSHSKDLENPAPRKKTVIVVEEDSGKKNVVLNSNAEQKLPSILSEVEKK
                     TTPSRYHESKTVSDDAPKPEVQSELTFETPISASFLLKPLSPKKEISLTRAEIKEIGE
                     ELKALEKISKDLESLRSRFQTTLKRLQGPEKEEKETKPPTDLLNYNFIEVTETGQPEK
                     K"
     gene            <101059..>101847
                     /locus_tag="Eint_020950"
                     /db_xref="GeneID:9698775"
     mRNA            <101059..>101847
                     /locus_tag="Eint_020950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072407.1"
                     /db_xref="GeneID:9698775"
     CDS             101059..101847
                     /locus_tag="Eint_020950"
                     /note="similar to ECU02_1000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072453.1"
                     /db_xref="GeneID:9698775"
                     /translation="MDFVPPAKQRELRSALEKIESGIVVVHGPPGSSKTYSIERTAQG
                     LGLSIEYIEDVGMYKSMLPIRNAICLTDMDDYEYLSRHRKRLEKMKNLVIETRTLFSI
                     GKILPNATIVNFGKISSRKIQKFYNLNEKEALKVGENLHAVGFCKYGIRSETVSIFHL
                     LGKLFHSKETDVPKAAEMINVYGRDRFIGYLIENCTSFMSIKDIHKLIDGISLEDIGE
                     MHLEHLIWVVLSSVKVGPRRFFSFRSWKGAVLSEHTCSNLCMNR"
     gene            <101910..>102590
                     /locus_tag="Eint_020960"
                     /db_xref="GeneID:9698776"
     mRNA            <101910..>102590
                     /locus_tag="Eint_020960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072408.1"
                     /db_xref="GeneID:9698776"
     CDS             101910..102590
                     /locus_tag="Eint_020960"
                     /note="similar to ECU02_1010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072454.1"
                     /db_xref="GeneID:9698776"
                     /translation="MSFSKIKPKSYEGKMEEWLSAISMKVTDLNSLVLDYLVHEGLGD
                     IAAEFARDVGLPFTASSFLSHRTRIRDAIEEGDIKKAISRINDLNTEIIDGNIELYYF
                     LMEQKACEQAQAIRSEGESTEEQKVFILLEEVLEFIRSELSPIVEENPALGPHFEDLL
                     EFVVFNSRKEAVVERRRRLAEYINRNILEKYEVTENELKKVLDGIVKGERLLTEKYKF
                     PTFNESFI"
     gene            complement(102630..102813)
                     /locus_tag="Eint_020965"
                     /db_xref="GeneID:20314012"
     ncRNA           complement(102630..102813)
                     /ncRNA_class="snoRNA"
                     /locus_tag="Eint_020965"
                     /product="small nucleolar RNA U3"
                     /note="expressed"
                     /transcript_id="XR_002670136.1"
                     /db_xref="GeneID:20314012"
     gene            <102931..>103152
                     /locus_tag="Eint_020970"
                     /db_xref="GeneID:9698777"
     mRNA            <102931..>103152
                     /locus_tag="Eint_020970"
                     /product="small nuclear ribonucleoprotein E"
                     /transcript_id="XM_003072409.1"
                     /db_xref="GeneID:9698777"
     CDS             102931..103152
                     /locus_tag="Eint_020970"
                     /note="similar to ECU02_1020"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein E"
                     /protein_id="XP_003072455.1"
                     /db_xref="GeneID:9698777"
                     /translation="MGGEPKSILPLEKIYAFLSRAADVEIWEKDIGVRHKGRIVGFDE
                     YMNIVMDSGAKRYLLKGDCISVVFGKDID"
     gene            <103386..>104903
                     /locus_tag="Eint_020980"
                     /db_xref="GeneID:9698800"
     mRNA            <103386..>104903
                     /locus_tag="Eint_020980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072410.1"
                     /db_xref="GeneID:9698800"
     CDS             103386..104903
                     /locus_tag="Eint_020980"
                     /note="similar to ECU02_1030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072456.1"
                     /db_xref="GeneID:9698800"
                     /translation="MFVLHLVVTLCSSLERALLEEGDIEHATRLCGTREGPLDYFYSY
                     FVKKVFMGKEKEALLDIVESDNYGDARNIVLGIMSMESGKTNEKAKLAADLLWNVATK
                     VSRRYLKNPHVFLATEPFGKLERNFLSKKGVENIVTMVYSGDDISARLFLSLLDNRKI
                     YIGDYVDVIEFLAKNDHARAFGYLGEIYYHGIRMKKSLDEAMYFFSRGREMQDTVGAC
                     GVGKVLMSDEYRDYKNAKSALLLANKLGQSGEAEYLMYLLMSRRPEYMHKASSHMDSA
                     LMYGYLPAICRDGMNYYTSGQYMNACIRFHPIIEYSDIVYNLRRRAEASFVSRRYRQC
                     VIALLMCAELGSVSSMRNAVYVLQRHSVFERQKEMLFGLYMRLLSKEDKDAINRIGDA
                     YFYGEGVEKSYNDAFAFYMSAALTGDPEGYYNVSYMYEHGYGIKKSLLLAFKYILKIS
                     PGDDTYLLLLYTHIRLFSKFVTYLLFNKYSISVWIGALVVRKMYISKRSTKDLKD"
     gene            complement(<105074..>105589)
                     /locus_tag="Eint_020990"
                     /db_xref="GeneID:9698801"
     mRNA            complement(<105074..>105589)
                     /locus_tag="Eint_020990"
                     /product="gluconate transport-inducing protein"
                     /transcript_id="XM_003072411.1"
                     /db_xref="GeneID:9698801"
     CDS             complement(105074..105589)
                     /locus_tag="Eint_020990"
                     /note="similar to ECU02_1040"
                     /codon_start=1
                     /product="gluconate transport-inducing protein"
                     /protein_id="XP_003072457.1"
                     /db_xref="GeneID:9698801"
                     /translation="MADIESFHGRIENESDCLVLIDLARRGLIPRIQRRLTSRERKKI
                     GHGSIFVYCEEESRIKRWTDDMSWTPSRVQGVFLVYKQLLSSSPMMKRTYSATCGDRS
                     FHIVGYLQIHSHHTLLPSVSILYKGIDFPTDIKIKKKLSFLEERCLKNSPKTMESQET
                     HEDFPFDIYWY"
     gene            complement(105688..105758)
                     /locus_tag="Eint_021000"
                     /db_xref="GeneID:9698716"
     tRNA            complement(105688..105758)
                     /locus_tag="Eint_021000"
                     /product="tRNA-Ala"
                     /note="tRNA Type: Ala, Anti Codon: TGC, Cove Score: 55.01"
                     /db_xref="GeneID:9698716"
     gene            <105838..>106311
                     /locus_tag="Eint_021010"
                     /db_xref="GeneID:9698717"
     mRNA            <105838..>106311
                     /locus_tag="Eint_021010"
                     /product="Gal4 DNA-binding enhancer-like protein"
                     /transcript_id="XM_003072412.1"
                     /db_xref="GeneID:9698717"
     CDS             105838..106311
                     /locus_tag="Eint_021010"
                     /note="similar to ECU02_1050"
                     /codon_start=1
                     /product="Gal4 DNA-binding enhancer-like protein"
                     /protein_id="XP_003072458.1"
                     /db_xref="GeneID:9698717"
                     /translation="MSRTLAPDELHIHKTIASKVDLEEMESVESVSVIAMNMRHSIVS
                     PAVYKIKGTDSLLIFGSIGNSIDLRELQKMYENSVKSSETEEHAGLYSSIGDNLQKED
                     EQKPEEVPVEVDNERLSEEDIKLISQQVKASRSEIIRALAESDYDVVNAMIKLTK"
     gene            complement(<106319..>107287)
                     /locus_tag="Eint_021020"
                     /db_xref="GeneID:9698718"
     mRNA            complement(<106319..>107287)
                     /locus_tag="Eint_021020"
                     /product="protein prenyltransferase subunit alpha"
                     /transcript_id="XM_003072413.1"
                     /db_xref="GeneID:9698718"
     CDS             complement(106319..107287)
                     /locus_tag="Eint_021020"
                     /note="similar to ECU02_1060"
                     /codon_start=1
                     /product="protein prenyltransferase subunit alpha"
                     /protein_id="XP_003072459.1"
                     /db_xref="GeneID:9698718"
                     /translation="MIIHNIEEGEYIEDKEALEGLLNLRLQEESIEKHKAIVQVVADD
                     YYSWNKLKDYLLLNPSDFRSQLKVCENALQGNPKSYQPWYHRKFMMENFKEQREKYLG
                     REDFLTKLLLDSDPRNFHCWSYRMFFLKTKTGRDVFNYSYLHHHPDSEDPLTIIYTDP
                     MDPTSWEYFYLWRERKRIRHGMYIRRFRNRLEILLDKPFCGELSFESGGTRKTMAFEL
                     HTRIVVIDESIRTSERWKVVINGEEMRFIPEEESFRFVREILEEEPECYEALLVLLDY
                     TEEEAERIAIIERIASLDPIRRGYYDTLKENFYCVYVPEIEGTPIE"
     gene            <107362..>108840
                     /locus_tag="Eint_021030"
                     /db_xref="GeneID:9698670"
     mRNA            <107362..>108840
                     /locus_tag="Eint_021030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072414.1"
                     /db_xref="GeneID:9698670"
     CDS             107362..108840
                     /locus_tag="Eint_021030"
                     /note="similar to ECU02_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072460.1"
                     /db_xref="GeneID:9698670"
                     /translation="MDRIERFLGRRPVKGRRKVQSQGKEFLITKEDVKLIRSYKKNIC
                     MDPDVDLYRPLNLSFSRKTMNEGMETRKKVVVPRAGGRPKKKERSIRKEVKKRDKNEI
                     VDIWEEEGLEELNSYEQDMVVKVGDAYTGAVEALRYGREDLEGSLRRIYLRLYEPRDG
                     KNYRLRDLIKELPKTETLRPFPEEIGLSFKFSKAIRVGISQDFKKFGVGEGRKLGIYE
                     FKNFVKLRHILFDSEIRKIMFARNGSICTLLADNTICVVDDIYGGDAESSKESFISKE
                     FPAWSRKEAEEGAERNAFVCTVINPEGKINDIEAHEDGKHIIAVCGKKIMVYNLKERI
                     GREVLRVRGATPLKAKFHRSLSTMIVSTTNSLIIYDLVSKEIVREAKEFSFVLDFFSV
                     EESKVAVVNNTNKIILYDWLKNNVQRTMLQEDVGMEVVQHGRLNLMCVAYPTEMVVFY
                     NDVTNDLVVPVKRIPGRYRDISFHPHLPWLYGVGGNRLDVFT"
     gene            <108922..>109380
                     /locus_tag="Eint_021040"
                     /db_xref="GeneID:9698671"
     mRNA            <108922..>109380
                     /locus_tag="Eint_021040"
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /transcript_id="XM_003072415.1"
                     /db_xref="GeneID:9698671"
     CDS             108922..109380
                     /locus_tag="Eint_021040"
                     /note="similar to ECU02_1080"
                     /codon_start=1
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /protein_id="XP_003072461.1"
                     /db_xref="GeneID:9698671"
                     /translation="MQIFVKTLTGKTITLEVEPGDTIENVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGAKKKKKDFSTPKKVKAPHAKKGLSW
                     LDNFTVTEDKVKVNLVSCEACGVEIFCRKTASGLKCGKCNRVYSEGVTSN"
     gene            <109482..>111518
                     /locus_tag="Eint_021050"
                     /db_xref="GeneID:9698685"
     mRNA            <109482..>111518
                     /locus_tag="Eint_021050"
                     /product="Rad3/XPD ATP-dependent DNA-binding helicase"
                     /transcript_id="XM_003072416.1"
                     /db_xref="GeneID:9698685"
     CDS             109482..111518
                     /locus_tag="Eint_021050"
                     /note="similar to ECU02_1090"
                     /codon_start=1
                     /product="Rad3/XPD ATP-dependent DNA-binding helicase"
                     /protein_id="XP_003072462.1"
                     /db_xref="GeneID:9698685"
                     /translation="MARIKISGVPIEMPFEPYPAQIVTMTKLISCLTTGTSGLVESPT
                     GTGKSLSIICAVLGYSEYLKRGAKSINVKRREGGSLKGEEAKEEKLKIIICSRTHKQL
                     DQLIEQLRKTHYRPRISILASRSQYCISPKLGDVTDKNTGCNELVKSGSCAYFTGKDR
                     LAKRVGDRIFDIEELKGEGRRCGGCPYYASRILNEDAEVIFAPYNYLIDSRIRENTGI
                     SLENSVVIVDEAHNIEDVCRSSGSIELSSRTIEIIQNEILGAIRRSGMLGEIKLDFVN
                     LMDFFRKLREGAESTDGFDRTTFGGKLRIRKGKEIKDELEKMGITKEFVLKIKNSIYA
                     IQKNEDAKDLLNMSTFHVLEGLDSVLSAIHFSGCDAYSFVFQKTNDENIRNSRLSKFS
                     YNFWLLDAGYTFRSFVGKVRSIVLLSGTLTPFSSFSSELGHDFTHSIVAPHLVTEKQV
                     FASCVRKGHLLKDLTGTYGVSDTPQYLDQLSRIIVDVSNKVKSHGGTLVFVPSYSFLE
                     NLQKRMGGESSGLLIEPKSGGGNEFEKVMKRYKNRIATKQRAIFMCVYRGKASEGIDF
                     KDSFARAVIAVGIPYPSLHDPQVELKKEFNDRYKSFNGRLWYEAQAFRAVNQALGRAI
                     RHKDDWGIVMLLDSRYSEKRVQTHLSKWVTDNIRVHDSYDTCASELSGFLSLIK"
     gene            <111627..>113696
                     /locus_tag="Eint_021060"
                     /db_xref="GeneID:9698686"
     mRNA            <111627..>113696
                     /locus_tag="Eint_021060"
                     /product="Hsp90-like protein"
                     /transcript_id="XM_003072417.1"
                     /db_xref="GeneID:9698686"
     CDS             111627..113696
                     /locus_tag="Eint_021060"
                     /note="similar to ECU02_1100"
                     /codon_start=1
                     /product="Hsp90-like protein"
                     /protein_id="XP_003072463.1"
                     /db_xref="GeneID:9698686"
                     /translation="MSSKQESLAEGTIKDKHPETHGFEVDVNQMMDTMIKSVYSSKEL
                     FLRELVSNSSDACDKLKSLYYELNSKGCDLDPVTSLSIEIIPNKTNRTLTIKDNGIGM
                     TKPDLMNFIGTIASSGTKKFREEMKEKGNAADASNLIGQFGLGFYSSYLVADRVDVIT
                     KHPEDEALVWTSTGRDVYTIEEYTGDSFSHGTSLVLYIKEGEEEFLDPKKISEIVKKY
                     SLFVFYPIYTYVEKEIEEPSEEKEEEKEEKATEETTEPKVEEAKEKRLKKVTQREQIN
                     AEKPLWKRNIKEVPEEELKSFYKTISEDWDDFLAVDFWRVEGLLSIDLLMFIPKRARF
                     DMFNRNKKNNNIKLYCKNVFVTDDFGDSIPEWMSFVSGVIASDDIPMNISREMIQGTN
                     VMKLVKKILPQKIFEMIGKLAMDAEKYKTFYKEFGNCIKMAIGEASEGQQDGYAKCLR
                     YFTTKSGEEMVSLDTYVERMAANQKQIYVITGLGKDQVKSNPALDAFQKYEVIYMYDV
                     MDEVMLRGLKKYKGHAIQRITSEGVELPEDEENNEEIVKSFEEFCKKAKDLLSNKVEK
                     VTVNPRLVSAPAVISTTKYSLSGTMENIMRSQPVTEANPFAAMTAVSKKIFEMNPHHK
                     LVKNLKTLFDNNEIEKMGKMLELFFETVLIHNGFMLSDPKTFCANVFEFLCSSEVKSE
                     ELVEEVQ"
     gene            <113770..>116280
                     /locus_tag="Eint_021070"
                     /db_xref="GeneID:9698687"
     mRNA            <113770..>116280
                     /locus_tag="Eint_021070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072418.1"
                     /db_xref="GeneID:9698687"
     CDS             113770..116280
                     /locus_tag="Eint_021070"
                     /note="similar to ECU02_1110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072464.1"
                     /db_xref="GeneID:9698687"
                     /translation="MEVKLCEDAWKVLSAIKQTIVSERMKDTPENVTEAAIETFLEMS
                     RRNDHSKVEELLQIILAHKNYITEKSSTELVRRILLSFKEKKVYLQGLRVIKHFVKSG
                     RYHMSHFKILVEDCFGRKSLKTRSVELAKRYLELEEFRKELLGYISKLEGTDLIRHIN
                     CFFDSIADGIDVVEKLDSFVNPDVFEGMETGEARALYSECCDMLYKYTLMEMEVGIPD
                     EKVFEYIVKKLQILFEIPFPRGGKLLETLSLLAEKDLVVSLRSKQHLMRWDKNLKREV
                     VKELCESNLKNDKIYEFIRSVRHVLVPEFMDLIRHMARNFVEGDDKYRFALGAVAGII
                     GIEDLFLVLEDMEIEIRTWAPIIRCSSNGDISFFIKILRDVEERKGVESIDRTILLNC
                     IPAFCNYATDRTGSIEGLLQIMKANLGNSNVFNSICTGLRKLMHSHENNIKNNLILRN
                     PIPPGESERILHSIRKSEIALDILSVGIGKCSDELDQTLFKLLETDDFGLSSRIFQYI
                     LLYPQIESVTVGKWNLSGISDVMKVARYFVPKMNSDFEIYSKLMEFCLSEDGGAQKRA
                     YQLLYHMKKHQKIDLCICDTLFSHETDEKTKDCSQKWRIALIYSVYTVGCKCFSERKK
                     EYLNRMLPVLVLGLKTGNAKARKVCQENLDELVSGFSSSEFDFYCRLMVAGTASENVV
                     LRCGILEASVALIESHRERLSQEFIQSMYDGCLSTSRLGRETVPHVLKFLNILVSTYA
                     VNPQGCLEVLELYADKFKRRYAEDVKSIVSRLIRRDVEIPKSLRLFLKERKRKGPRAT
                     LQITKKNNVMITQGKQKQESIPFSGHRRTVKRNKRHKK"
     gene            complement(<116353..>118164)
                     /locus_tag="Eint_021080"
                     /db_xref="GeneID:9698701"
     mRNA            complement(<116353..>118164)
                     /locus_tag="Eint_021080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072419.1"
                     /db_xref="GeneID:9698701"
     CDS             complement(116353..118164)
                     /locus_tag="Eint_021080"
                     /note="similar to ECU02_1120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072465.1"
                     /db_xref="GeneID:9698701"
                     /translation="MNWEDELMALGVPYTERKRNSPLRKKLSIIKKLKNINSESVEAI
                     KSDLEKEDMSKFTSEIVTSILLSKVQSTDDIKSVVRVTSALTSCSDFMRLLMSELGKI
                     INHGIEETEKYWLAAFFFDLQTLSRRTVDKEERRENLIRDLCNKISEKPRILFLGYIM
                     ENYKDELSQAEVSNQAKRIDPQTSEDRGGRLDVVARSLGIKVCDEGYDLKKMADVENE
                     EFHYYTGRTASLECYDGGLDIKEIRDYIIMHSGDTEKLDALSKSIKNVNNQKEVVFML
                     MQLKLNPNFISSIARILKNMGAVARKVVAVLFREIYQAKNPSHNDVISNCLLISEMCK
                     FREVSSDEMFGLLDYLFKTKNIEAYCMCLNGIGRYFLLNEATSHRIREFIERIRNYRA
                     SKVDFVHVNNCLSRLFSPSQSILCADYTGFFRYFFRKEAFDGDSLLWSCLIKSKATLM
                     SIFLHPWVFEDIDFLASVVHKAEISMQVMNVIIPSIEIMYGYSKHKSISLARLYSSLM
                     LLENKDTWAYLVDRALQLKVGASFRCKIAMMLLQKMPIDMQRQYFSVLRDCVNKEESL
                     DLKILFTNFCESIGMEAPTMDYDDSFDEELNFVRSYA"
     gene            <118224..>123647
                     /locus_tag="Eint_021090"
                     /db_xref="GeneID:9698702"
     mRNA            <118224..>123647
                     /locus_tag="Eint_021090"
                     /product="PI3/PI4 protein kinase"
                     /transcript_id="XM_003072420.1"
                     /db_xref="GeneID:9698702"
     CDS             118224..123647
                     /locus_tag="Eint_021090"
                     /note="similar to ECU02_1130"
                     /codon_start=1
                     /product="PI3/PI4 protein kinase"
                     /protein_id="XP_003072466.1"
                     /db_xref="GeneID:9698702"
                     /translation="MNRNYLKNLYLQQLESERYSDVFRESLHSLVSVEIMNTVILLAV
                     KDDDEDALIDLLELFLQHLETNPIFYEKLGKSNLHLLLLERPLRMQSYTKLKLVYDKV
                     RPKRTPLSFEHTEFLAKNFYNYCLYKYAYNDYQFDLEMSVEGFGPVEMNLFKDLLRKI
                     CIENRENEHLANYVRTLPMDTNVFLAIVEPDFKVDASKLEPEDLFVVYPAQVQRCNLG
                     LFTKPFLCSLNSKEGLCRVCGRRVLEYHFEEIDHEEYLESIAGNIKEICFAVSHWEKA
                     RTPRVLITVLRSLFKGCEDLECYKSLKYFPVKEESDMEDIVVKFLRYAASTLNIENIQ
                     VSLRMLPFTSHTPKVIFSYFVILFESLRKYPENGFLRSIVKNVVMRNKDKFMKIRAMI
                     FEYYMKGDEESVFDIPNREKEGRGLKDGKDFNTSISDRLERRLAPLSEFFSEECGSFV
                     KNNMFYIYPIIYSLWLPRCTQDLGFTQANNHFLVISLCLQGEESRIDEIGYEKDELYG
                     MGVDVIVPLLCNGYFKYDILERFFGDTRKYISIHLPKFLFALKKVYVERPFEFRVCVF
                     KVLKCIIDAISNNVKMLFNYLFPFVEFFMRKHEDSCGMDCKMIFIEYYSSFFENDCFI
                     RNMPRIFPYLDVEKIVKWSNAKNEEDYLDIVLGLLNTKGHFSQEMATSKAVELLTRVF
                     GSIDKDGVLDEESFVENILTRFFKSPTFRIKVGSIYRRLREVESDAAFLIGCISQEFL
                     EPEIHPSVCDVPIMGNTPEAIARVMIERYLLEIDPGKQDLHFFIIQETLKFIRGPLSD
                     SIEEVVDQFRNTQYLYEHVPTYSTEKLYEKTHTFKKFLERLYRHTLSEVERRNKKEYF
                     NLLRYGDLLGIPFLEFHCLSLCRLLLDSGDSRVAGIAQNISQDLEGGVDRKIARFVLK
                     LHRFTEGKYVPDLVILRISIFLKDHYNAIQVLEKMIRKERRRDLFDLLQYNYYWIKDY
                     DKVLGINSVFGRPTLINLFFGFCVDKNFAAARRCLEPEVILGNCTTESDDEEKGKDLI
                     IQSLDMKDRLSEIIDECQDDEVMKFMNDCKRIEKDFSEWRNLESRNEVFKHFVKDCEL
                     VSKSKNLLKTLDLIAGRREMAGDDRMLLECHESLMAGIRSMVDGRDDISCDEMFESLF
                     TLSKENVGESQDVGLEHREYFDDFASVDMVRAERHHERIGYIDRSRFGKTSGYNSLDE
                     FERDLKLGMIRSYMGDNDFNKCIQEIGSMLLKREWSALYELAKLNVLQGKVGDAKTSL
                     KKVLELFPRTSIFHKRALARYAEIVDTKTGYDSALSVLKDSGKLFLLGAKKFESTEPV
                     KAMEMYINSVVHDSQYSDEAIPRIFHLFSEMTPPGDINASSALIKKFLESCLSLLPPY
                     YNQILSRLSHPNRDVVDVVSNIVLELMENYPSKTFWRSLIMMNSQVPNTRKRMEGIIS
                     ELTLDNKVVLSNIRKISEGLMEISKSKKNELAMEEDFPGFIRMFPTNVMVPNTGILIN
                     GVKNEIKVFNSLQRPKRICFVGNDGKNYYWLCKNQDDLRKDSRFMDLNLIINSILRKQ
                     SNKKYIRTYAVIPFSHESGIIEWIKGLNSLKVICDSYYSKDGISISETACRFVQNKKI
                     GPREWHKVISKFGPKFHLWFSDNFPHPYSWLSARNNYTRTYAIMNIVGWFMGLGDRHA
                     ENILFDSNTGDTVHVDLNCIFGKGRELQVPEKVPYRLTQNIVDAFGVLGLEGSYNASL
                     CSTLDLFLKNKNILVSNLLSFVYDPLFEWRRKSTTTPKRIIEDLCRKMDDLDVSSKCD
                     VLNEEATKSENLCMMYIGWLPFI"
     gene            complement(<123732..>124241)
                     /locus_tag="Eint_021100"
                     /db_xref="GeneID:9698737"
     mRNA            complement(<123732..>124241)
                     /locus_tag="Eint_021100"
                     /product="Microsomal signal peptidase subunit SPC25-like
                     protein"
                     /transcript_id="XM_003072421.2"
                     /db_xref="GeneID:9698737"
     CDS             complement(123732..124241)
                     /locus_tag="Eint_021100"
                     /note="similar to ECU02_1140"
                     /codon_start=1
                     /product="Microsomal signal peptidase subunit SPC25-like
                     protein"
                     /protein_id="XP_003072467.2"
                     /db_xref="GeneID:9698737"
                     /translation="MDNLKAKYNKNPLRGDIYNLSELKIILDDVIRDFMENVGNSKQS
                     KVSTDIKIAIGLISTVIASAVAYFSLTSEFEYHKQVITILTLIYFVINILGEIYFRWT
                     GSSMVFKDRVVSTSVSAPDPTYVIMVYNKNKLIPSKYTKSMFDLFDSNGRLIHEEFLD
                     DLQGLLKSK"
     gene            <124292..>126418
                     /locus_tag="Eint_021110"
                     /db_xref="GeneID:9698738"
     mRNA            <124292..>126418
                     /locus_tag="Eint_021110"
                     /product="DNA replication licensing factor Mcm4"
                     /transcript_id="XM_003072422.1"
                     /db_xref="GeneID:9698738"
     CDS             124292..126418
                     /locus_tag="Eint_021110"
                     /note="similar to ECU02_1150"
                     /codon_start=1
                     /product="DNA replication licensing factor Mcm4"
                     /protein_id="XP_003072468.1"
                     /db_xref="GeneID:9698738"
                     /translation="MDSDQQSSAFSFYDASQENLLNFTPSQGDLSSTILPIVETERVK
                     VIWGTTINIQETSERFKEFIRKNRDYHDVLEQMDLTQEFVFDLNCEDLDPDLRSQLAT
                     YPQEMLPILQGSLQEIYVENFPSFNGTIRIRPFGIGKALSIRNINPNDIDRIVQITGM
                     VIRSSSVIPEIVRAFFRCSKCMDECFVESIRNVIEEPSKCKCGGKYSQQLVHNSSEFE
                     DKQISRIQELPEGIPDGTTPMAMTIVCRNEFVDGLVPGDRVKVIGILKATPVRLNPVM
                     KKIKSTFRTYLDLLSYEVMNKKVKERDPIYKIDELRKNPKVYEVLANSIAPSVCGMED
                     TKKALLLQLFGGVRKELGSSRLRGDINILLAGDPGISKSQLLSFIHRTSERGMYTSGR
                     GSSAVGLTASVAKDPDSGQFILESGALVLSDNGVCCIDEFDKMSDSTRSVLHEVMEQQ
                     TVSVAKAGIITTLNARCSILASCNPIESKYNPRKSIIENINLPPTLLSRFDVVCLLID
                     RSDEFQDRTIGDHIVSLYSEERGKTECVDADLLKAYVKEARKIVPRLTAESMRLLTQA
                     YVDLRQMDNGKTITATTRQLESLIRLSEAHARMRFSSTVEAKDVKEAVRIIRESLLMY
                     AIDPSTGKVDMDMIITGRSTFRNKMLESLKDAILLMMRDRIEVSEIVRKTGANEKMVK
                     EALEELAQEDKIMTSGHESCYERIRD"
     gene            complement(<126476..>127087)
                     /locus_tag="Eint_021120"
                     /db_xref="GeneID:9698739"
     mRNA            complement(<126476..>127087)
                     /locus_tag="Eint_021120"
                     /product="splicing branch point binding protein"
                     /transcript_id="XM_003072423.1"
                     /db_xref="GeneID:9698739"
     CDS             complement(126476..127087)
                     /locus_tag="Eint_021120"
                     /note="similar to ECU02_1160"
                     /codon_start=1
                     /product="splicing branch point binding protein"
                     /protein_id="XP_003072469.1"
                     /db_xref="GeneID:9698739"
                     /translation="MELFRHPEKVPFPKDVKSKSELKKLLCSMRSEEIDRRLRNAVAS
                     NNQQLVQWLKSRKQQILGLQIQGNVSISGNMYTNKIYIPVQEFPESNFVGLIIGPKGS
                     TQRQLERITKARIYIRGSYKDKYAEPLHCYISADTQENLMNASAVIENLIEDSILFGS
                     CKLKSSQLQAMKGSKGDSGRRLTDWEKFYYWWYFHNKIQKEVD"
     gene            <127127..>127750
                     /locus_tag="Eint_021130"
                     /db_xref="GeneID:9698765"
     mRNA            <127127..>127750
                     /locus_tag="Eint_021130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072424.2"
                     /db_xref="GeneID:9698765"
     CDS             127127..127750
                     /locus_tag="Eint_021130"
                     /note="similar to ECU02_1170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072470.2"
                     /db_xref="GeneID:9698765"
                     /translation="MASIPKSNEVIFVKNYYSMLCNRPSVIHQYYMKDSQLTISKEAS
                     KPEICTEDFGKYIKSKISSPVSKVFISHLSFQKIDNLKSAISVIGQFVYNDSSQVRIS
                     HQFIVSRIDSVLYIKNEILTFLDEEIAYDLDHDAKKVVVVEYGKNEMLQAINAISEFG
                     KIKSMKSEDDGKVVMTFDSIEDVENIKKNVPKIVSQGYKLEFDGLKV"
     gene            <127852..>128451
                     /locus_tag="Eint_021140"
                     /db_xref="GeneID:9698766"
     mRNA            <127852..>128451
                     /locus_tag="Eint_021140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072425.1"
                     /db_xref="GeneID:9698766"
     CDS             127852..128451
                     /locus_tag="Eint_021140"
                     /note="similar to ECU02_1180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072471.1"
                     /db_xref="GeneID:9698766"
                     /translation="MEEEGKLAERFVKAYNRRVELYRQRYALEDSINAKLVDQCALKK
                     AIEMNKELDKKDQPRPPDQGTMFGTGMHRLSLVDIGRLPTENLDMFHTETAIYPVGYM
                     CRKKYKKHDAYKKKAKDRILYICSVDPQKGPIITADDGRKWYGPSMWKDFVESIEGGT
                     EYKSVEEFFGLGNSALARKIESLGDLSAFKKYIPLNKRS"
     gene            complement(<128521..>129054)
                     /locus_tag="Eint_021150"
                     /db_xref="GeneID:9698662"
     mRNA            complement(<128521..>129054)
                     /locus_tag="Eint_021150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072426.1"
                     /db_xref="GeneID:9698662"
     CDS             complement(128521..129054)
                     /locus_tag="Eint_021150"
                     /note="similar to ECU02_1190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072472.1"
                     /db_xref="GeneID:9698662"
                     /translation="MNEMTFSRRIDMLDNSIKELERGTHREDESKLPAMFQICDRLVE
                     CGQQPPRLVKRYNELKNRYKCISSPYKELDNEISACKMHMEALSRKSSIDEITRSVQE
                     VVAVSNYINYAINDARFPIDNVMEHLEEGEQYGMLVNEQLSITRRRKLWKAKIIQSIL
                     LLLFSLVGVFVLLKIVF"
     gene            complement(<129158..>129550)
                     /locus_tag="Eint_021160"
                     /db_xref="GeneID:9698663"
     mRNA            complement(<129158..>129550)
                     /locus_tag="Eint_021160"
                     /product="homeobox domain-containing protein"
                     /transcript_id="XM_003072427.1"
                     /db_xref="GeneID:9698663"
     CDS             complement(129158..129550)
                     /locus_tag="Eint_021160"
                     /note="similar to ECU02_1200"
                     /codon_start=1
                     /product="homeobox domain-containing protein"
                     /protein_id="XP_003072473.1"
                     /db_xref="GeneID:9698663"
                     /translation="MASEKTKNVRELEAALGLLKLSGFQMNRYCAGKQMRKTRLQTCV
                     LNRIFEISKFPSSKTIIDLALLINVHPKSIQKWFQNTRQAIRKKGHMKGILLLMEPEE
                     HNSMDIPLPILADIVEMEKRVMSRFGLE"
     gene            complement(<129930..>131858)
                     /locus_tag="Eint_021170"
                     /db_xref="GeneID:9698664"
     mRNA            complement(<129930..>131858)
                     /locus_tag="Eint_021170"
                     /product="glutamyl tRNA synthetase"
                     /transcript_id="XM_003072428.1"
                     /db_xref="GeneID:9698664"
     CDS             complement(129930..131858)
                     /locus_tag="Eint_021170"
                     /note="similar to ECU02_1210"
                     /codon_start=1
                     /product="glutamyl tRNA synthetase"
                     /protein_id="XP_003072474.1"
                     /db_xref="GeneID:9698664"
                     /translation="MNRKGEFKEELINYILLKKYGTKPEDPPVYSNALGKISKEIFPA
                     GLMDVLDSYTINPNREEGVNFLLSLNSFISCIDSDELRDILFGMININSTLTKLIKDK
                     KEMEKFPNVCEMYSEQFKANKNLLKEFNTSFKKEQGNLEIDGPSENVITRFPPEPNGR
                     LHIGHARAALLNWYFSSKGNGRLLVRFDDTNPEKEEERFEKGILKDLDLLGIREYTLS
                     HTSDYFEKIIDLAFFLIDEGKAYADNTPQEEMRDERGKGIESKCRNMSTEESKRIFEE
                     MISGEASGYCLRAKIDMSNCNKAMRDPVIFRMNKSPHHRTGDKYKVYPTYDFSCPIVD
                     SLEGVTLSLRANEYRDRNPQYYWFIENLQLSNRPKIHDFSRLNFENTVLSKRKLKYYV
                     DNGFVSGWDDPRLATVAGIRRLGMNMEVLREYILMQGVSQKTCTISWDKVWAMNKKRV
                     DPVAPRYFCVQQRNVVEVSVKNTSEYMMSVPRHKKNGDIGTKEVFYSSLILLSQEDGQ
                     ILQENEEFTLMNWGNAIVRSKSVQDGIVTKMEIILNPEGDFKQTKNKISWVSKRGSVV
                     VELIEYGSLMTDGDDEDLAARFNTDSIQKEYWYAESAVVDIKEGDVIQFERNGFYYCD
                     GFLVFNLLPFTKQKRTAN"
     gene            <131954..>133723
                     /locus_tag="Eint_021180"
                     /db_xref="GeneID:9698710"
     mRNA            <131954..>133723
                     /locus_tag="Eint_021180"
                     /product="DNA ligase"
                     /transcript_id="XM_003072429.1"
                     /db_xref="GeneID:9698710"
     CDS             131954..133723
                     /locus_tag="Eint_021180"
                     /note="similar to ECU02_1220"
                     /codon_start=1
                     /product="DNA ligase"
                     /protein_id="XP_003072475.1"
                     /db_xref="GeneID:9698710"
                     /translation="MSKILFVDFCTVLERINQTTKRLEIQSILTDYLKDVHKIDPPSL
                     APVLYLFTATVYPEYFNKELGVGENTLINVVAELTGKSAKNVKKEYSKEGDLGTIAMK
                     CRVSQLFVLKTQLEVMDVFLGMRKVANEGGQKSSASKKRIILGMMVKCSPLESKYLIR
                     LIEGRLKVGLALKTVLISLANAFSSDKADEVKAAFNRQPDIGRLAECILEYGVEGLPT
                     KFQVSPGVPLKPMLANPSKDLTSAFKKVENKNFTCEYKYDGERIQIHKFGNRIETFSR
                     NSEKTTEKYPDLMDLYNISDRDFIIDGEIVAYDRKERKILPFQILTTRKRKRVESSKI
                     DVQVCVFGFDLIYFDGKTYIDEPFEERRKILHSSFKEMDGKFQFTEFKDCETPEESEM
                     FFNESVEKGFEGMMIKILGSDATYLPSQRSNKWIKIKKDYLEGMSDSLDLVVMGAYYG
                     KGKRAGFYGGFLLGVYNDEEEKFEALCKIGTGFDDNILSRLYEQLSSNLCSAPKNYSY
                     KESVKPDVWVEAKYVWEVKAAGLSLSPIYNAGGNRNEKGISLRFPRFLREREDKDVKE
                     VTTSSQIYQMYLDSKVENSEEFY"
     gene            <133782..>135899
                     /locus_tag="Eint_021190"
                     /db_xref="GeneID:9698711"
     mRNA            <133782..>135899
                     /locus_tag="Eint_021190"
                     /product="Sec24-like protein"
                     /transcript_id="XM_003072430.1"
                     /db_xref="GeneID:9698711"
     CDS             133782..135899
                     /locus_tag="Eint_021190"
                     /note="similar to ECU02_1230"
                     /codon_start=1
                     /product="Sec24-like protein"
                     /protein_id="XP_003072476.1"
                     /db_xref="GeneID:9698711"
                     /translation="MEHMKSGFESPQPNEEDLSPRSIIDECNYYRSTLTAIPEKQDLV
                     RTSGIPFVINVILENYEEEEVPLCSDDIIRCERCKSYLNPFVEIIPPGLKWKCNLCLT
                     INDLATAFQVTSRGISRTSSLFDPKVNAMHNYSYYTRGELRSTVYELEAPPNYSLKTP
                     SPPLICFLIEVTFESMKYRSVDAVIRSILGGLNPRFFDPRSRMMFAFFDSCIYLLRKN
                     GDFSVISDATHIPFFLEEDFLLPLDHRFDVDGIERFFIENKSTRNNYGDALRIVQNIL
                     GTTGGCIISFLATYPNVGPGCVDSNQHELRCKSVFYKEISVYLSKQGISVTQFLFPRL
                     GIELPTLSVLSKYTGGMVYYYPNFDGTDPTFATKLANDLASHLDLNIGLYGMCRVRTS
                     KCVFIKEYFGSLHHRSEDLISFSTFFPPHSFSFEIDISKEEGTRGVCFQVAILRTLRT
                     GERRIRVVNFCIEKVSRSLYSVVDPYAVAHAFALKAFFFESRTKGGGNEYLNKSMKDI
                     VRLYKQLSNTTTLLPATLEVLPMLILSLCKSIPLRPASYTPMDYKSYYIYLISNSYPK
                     LVDTVIYPTLLALHRLDSIQPLNLTLNCLETNGLYLLDTGVTIFFFVARDCDPSLPNL
                     LFDSSIGSERFIFDPERNEFSDSVCKIIKELRSNRHLTPNYVLVRDDGTSSIYKDIFF
                     TYFVEDESHGLPSYSKYLELLRA"
     gene            <135968..>138736
                     /locus_tag="Eint_021200"
                     /db_xref="GeneID:9698778"
     mRNA            <135968..>138736
                     /locus_tag="Eint_021200"
                     /product="chromosome condensation complex Condensin
                     subunit D2"
                     /transcript_id="XM_003072431.1"
                     /db_xref="GeneID:9698778"
     CDS             135968..138736
                     /locus_tag="Eint_021200"
                     /note="similar to ECU02_1240"
                     /codon_start=1
                     /product="chromosome condensation complex Condensin
                     subunit D2"
                     /protein_id="XP_003072477.1"
                     /db_xref="GeneID:9698778"
                     /translation="MQRELEDLITKLKTMAIVDNHEDYNYLVSCTDKYDNKGKIFELL
                     RNRNNAPGEMAPLLFTFTSKLGTESDEGLLVRIIDFIRGCRRDSRETSEWMVKILFLI
                     LEKVKEKRKDSAIRLRLLECIRIYSQDIGLVNHMIDLMCTKSSSEIIGSILESIPSVS
                     HEFIECAMKQDNPALLKNLSLVLPSLSEKDISLFVNYESFEEFLESEHFFMRNCFLEI
                     CANLVEHFKKKGMVEKMNDLIGMVVERLSDTYFLTRYKALQVLECLFQRNSIGVGRRH
                     EIIREIGGRVLDKTVVVRKKAIGICSGLLMSHPFASEKSLEKKNFKPSEDENNSNYPD
                     NKKKEVERRYHEDLNEFHDIMREIQDNVIILLNGETKTEIAECVEFVKLSFYYKIDGS
                     KEAFESLFDLVWTQDQELLVLSFKDLIMQMKMSKISLFGFFKEFIRKEGNHSFERMIR
                     ELSTRRYIDKSFVGELYNTFLQGAYLFETSYLLRHIGRPVPVDMFHSLALSITNLLFS
                     IQEEKDLVEMLSVYKNIIQIKIRERVEFDGEIIEMLIKNLVKMTFFEHQVTEITVSVI
                     YSISRFPEKSIIMLLEKLCMMEKSMLKVISAVGYIGLKHMKYLEELERLVKSNRIKVK
                     VDKTVITPEIVERRRSINASRQSISTIIEEERDGNSTILSDPGFSNNISSRIGDKSEE
                     EIIDFFFYIKEKEMLYGKSILSIFKRIVEDGCHSNDEEIQVCSYVSLYRLMCISFEFF
                     TEHYDVFVRSMNHPVSRVRANAVVAMGDFLLNYNTVAEQHTYLLLESLSDADVDVRRN
                     ALLVIHNLLMKNILKIKGYGSKLAVLLIDEETEIREMAEHLLVQISKKENMMSVLLYE
                     TITAGNDQLSSVIGFFRDLVSEKVKESLFLKALKSKVEPETLRLLHSAFDLDEKMMEV
                     VRLLDGSK"
     gene            complement(<138782..>139228)
                     /locus_tag="Eint_021210"
                     /db_xref="GeneID:9698779"
     mRNA            complement(<138782..>139228)
                     /locus_tag="Eint_021210"
                     /product="transcription initiation factor TFIID subunit
                     TAF11"
                     /transcript_id="XM_003072432.1"
                     /db_xref="GeneID:9698779"
     CDS             complement(138782..139228)
                     /locus_tag="Eint_021210"
                     /note="similar to ECU02_1250"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     TAF11"
                     /protein_id="XP_003072478.1"
                     /db_xref="GeneID:9698779"
                     /translation="MNESNEEGEKDQNTKDVQSDTESDDLNLMTDDSTYKREDPGRLH
                     SITGTMTEEELHRYEKFRGSGFPKAAIKKYISSVIGQAVNPNFVIAVCGLAKVFVGEM
                     IEMAKIVQGEREETGPLLPSHIHEAYRRLHRKIPNIKVFKKAPWNT"
     gene            <139262..>140218
                     /locus_tag="Eint_021220"
                     /db_xref="GeneID:9698780"
     mRNA            <139262..>140218
                     /locus_tag="Eint_021220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072433.1"
                     /db_xref="GeneID:9698780"
     CDS             139262..140218
                     /locus_tag="Eint_021220"
                     /note="similar to ECU02_1260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072479.1"
                     /db_xref="GeneID:9698780"
                     /translation="MIIRIDRKHISSSIEEWFQLLKSNNDSLEDGKTSGCDPSMEYEI
                     EVKESIGKKIALVTVNRVGIKHEVSLDKIEETLLEVVGTLLGHELVVIHGFTVKDQSG
                     EKTKPIIPIFFRSTLGIQIPKRMGYLKNDGAGIPEIDESMMVPFVHTSPILKSLLNSR
                     PLRFSGEGVKALLVLYNGSTFIIPDTARIIPMIRGMLSREKMGEFLKLLKKFPFKFVE
                     TFIKAYMQPSSLEVNKELSGCFSEFQNNLTKLHIKCIHKIVSNAPVFLDARDKITERI
                     EKFYIYNAKGFKRKRGEYLKCREELYIDKNPIGSLKRYFRDL"
     gene            <140252..>140674
                     /locus_tag="Eint_021230"
                     /db_xref="GeneID:9698694"
     mRNA            <140252..>140674
                     /locus_tag="Eint_021230"
                     /product="Dim1-like protein"
                     /note="required for mitosis entry"
                     /transcript_id="XM_003072434.1"
                     /db_xref="GeneID:9698694"
     CDS             140252..140674
                     /locus_tag="Eint_021230"
                     /note="required for mitosis entry;
                     similar to ECU02_1270"
                     /codon_start=1
                     /product="Dim1-like protein"
                     /protein_id="XP_003072480.1"
                     /db_xref="GeneID:9698694"
                     /translation="MVSVLTSVDDVNKVVGDTSCRLVVIRFGDKEDPLCTHTDALLEK
                     ICPLLSNYVDIYVCERNSVKELEEVMRLDSPLNIMCFFNRRHIKIDCSSGDNDKINFL
                     VENEEMLVEIFTLAYKAGVRGKGIIKSPFKVQELQGEL"
     gene            complement(<140705..>141229)
                     /locus_tag="Eint_021240"
                     /db_xref="GeneID:9698695"
     mRNA            complement(<140705..>141229)
                     /locus_tag="Eint_021240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072435.1"
                     /db_xref="GeneID:9698695"
     CDS             complement(140705..141229)
                     /locus_tag="Eint_021240"
                     /note="similar to ECU02_1280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072481.1"
                     /db_xref="GeneID:9698695"
                     /translation="MDEKLKEISRLVSEVKRKLEVIIQSSSHIKEFNYKVEALLAAFD
                     AYTIRGVEHNLDLDKTSQTIVFPKKVIPKEKTKEETTSSFSNIRGEESLQEFIERMGS
                     TTTGNKLFRNNAAKIARFLYDNREGAVLEEIIKNTGISRYRCVDILNTMLRADPPLVS
                     KKFDKGFIYSIVLL"
     gene            <141310..>142641
                     /locus_tag="Eint_021250"
                     /db_xref="GeneID:9698667"
     mRNA            <141310..>142641
                     /locus_tag="Eint_021250"
                     /product="chromosome condensation complex Condensin
                     subunit H"
                     /transcript_id="XM_003072436.1"
                     /db_xref="GeneID:9698667"
     CDS             141310..142641
                     /locus_tag="Eint_021250"
                     /note="similar to ECU02_1290"
                     /codon_start=1
                     /product="chromosome condensation complex Condensin
                     subunit H"
                     /protein_id="XP_003072482.1"
                     /db_xref="GeneID:9698667"
                     /translation="MSNDDLGTWLKAAAENKITTKNTWKSTLIDHFTNIDEFREKQGI
                     NFQKASFTLDGCAKVYSTRVDDVSENAMRLLEGFGREEGKKRQAKKNKTTIEKNILNL
                     NIKVSASRRLVDPKFLYLSSLAENALMIDALGISSDGMFRMTSSRDWETVVVDDLKLS
                     VNLPQGLQISPSINEDKEIKDIIIDPIVGNDDESSGGSGGFGIDNHPDFSEFPPTADN
                     QNLAYKETSFSYFKGWAGPNHWKVQAKKGKGGSQKPKETSFLDFTEIIDHEGILEAGN
                     TLFEPSLIVERRENHHVLPQDFRLEVEDLYRYLVRDGLFHRKDQSHMDEISFDYSPDP
                     CIVEEPEDEFITDAPSQGNQRSTVPLRKTSKKINIKKLKDNVFDFVREGSTSLLSIFK
                     SVPKIYDSEESKDISMHLCFISLLHLANEKNIQLKDVGDDVKVWISPDSRT"
     gene            complement(<142658..>144670)
                     /locus_tag="Eint_021260"
                     /db_xref="GeneID:9698668"
     mRNA            complement(<142658..>144670)
                     /locus_tag="Eint_021260"
                     /product="dolichyl-phosphate-mannose-protein O-mannosyl
                     transferase"
                     /transcript_id="XM_003072437.1"
                     /db_xref="GeneID:9698668"
     CDS             complement(142658..144670)
                     /locus_tag="Eint_021260"
                     /note="similar to ECU02_1300"
                     /codon_start=1
                     /product="dolichyl-phosphate-mannose-protein O-mannosyl
                     transferase"
                     /protein_id="XP_003072483.1"
                     /db_xref="GeneID:9698668"
                     /translation="MAKSKYLEISTVLLIFTLSIVMKTYRIENGDFVVWDEAHFGKFS
                     EKYLSRKFYFDVHPPLGKILTSLGGYLFNQPLDFEFKSGEKFPKGFDYSGMRRFHSAI
                     ASFMPVLGYLMLKEMKYSYKRRILLSLIFIFENGFTSIGRLILLDSHLLTFTAAVAYF
                     MTRMYFRSKEKIDLASISLLGITLGCVLSIKWIGFLTMSLVGLFTIYCLWCNITSKES
                     ILGFAKLFLMKAFFLICIPASLYVLLFYIHFEMVNRSSSDDGHMSSLFQATLKGSDIG
                     NNRKYPLFGTKVTIKSSKTGGGYLHSHDHKYPNGENNQVTIYHHKDENNAWVLQKVTD
                     DLEDAEFISSGDTVVLLHMETRKYLDIPGNHSLMSSGLRAESSGSHLSDTNLFKIEIV
                     EDAIKKEGRVKTLTTKFRLFSTKHNCYLKPSSRKYPSWGFEQGEVICGAKKGEATLWN
                     VEENTSAKLSEEKNPVYKEITRYPFSKKFVEHNKAMFITNASFIQDEDLEPERIVSKP
                     YEWFILKRGLRMTAWDGQNEKFYMFGNPLVWYSSGICVILSPIVLLCRVISRKRKGKP
                     LAFLRNEGYMVFLSCCGWLLHYIPFFFVKRVLYFHHYYPALFFALFSLCYIMKFARLG
                     FVAVFTFFVIVFFFLYSRLTYGFGEETEFLRRISIIPTWDFIEKGQ"
     gene            complement(<144738..>145313)
                     /locus_tag="Eint_021270"
                     /db_xref="GeneID:9698669"
     mRNA            complement(<144738..>145313)
                     /locus_tag="Eint_021270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072438.1"
                     /db_xref="GeneID:9698669"
     CDS             complement(144738..145313)
                     /locus_tag="Eint_021270"
                     /note="similar to ECU02_1310"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072484.1"
                     /db_xref="GeneID:9698669"
                     /translation="MIKEAIERKKTAWKNLAKRDIYGYDKLVSILDPGMDFGPEISLK
                     RKIMGMLKSSANRENTSDERRIINGILKSEKGITGDISFALRVHYDFCTRNKTTSSLS
                     SLDREYGKMLNFILYDRPEEEMDLCNIDHPFYNEVALFNLFVKCKDNVLELDREALKK
                     NVFHTINERGIRDFIGGKVERLSAAREDRGD"
     gene            complement(<145652..>147313)
                     /locus_tag="Eint_021280"
                     /db_xref="GeneID:9698726"
     mRNA            complement(<145652..>147313)
                     /locus_tag="Eint_021280"
                     /product="Rad4-like protein"
                     /transcript_id="XM_003072439.1"
                     /db_xref="GeneID:9698726"
     CDS             complement(145652..147313)
                     /locus_tag="Eint_021280"
                     /note="similar to ECU02_1320"
                     /codon_start=1
                     /product="Rad4-like protein"
                     /protein_id="XP_003072485.1"
                     /db_xref="GeneID:9698726"
                     /translation="MDFEIQSTFKPNVFVCTTGISRDEQDLIRSQLPKHVILEDTLST
                     TTDYLVSYKAMMTEKYIQALKWNIKILHVRWLYDTDENTKKYEMTPLSGSSFTISGVT
                     DDSLINYHCLLGASFTENLTAWTDFLITNSQCNEKTEFCKKYGIPVVTSHSVFGNDYG
                     AYKKEPHFKAIDSAGEPLFNGKVFFLDSKLPKILFNRLRRLIISNGGTRVSVVDRDVD
                     FIVAESHGEFKRHDGKVFHYQYVFDCVETDSILLPGPYKVYFGRSNAILSEAVCCIDA
                     SLRELKVEVFNKLRALGAIVKEEVDASCTHLIIRDRKEYTGNRHTPYKVVLLSWVDQC
                     LHRMRYVNEDKYRIGIEPSNLFIENKKDEMSRKTGIFASRFMLFQFTGLSPILKSKAI
                     ERFEKLRVRYSDGDRYEKCTHLIMGSVCTSEKFLSCLCNGGWILRPDFIDNFDNSANF
                     DFGKYEWTADENTPEKERKIVASIKKWRERVASKGKPAFHRWIVRLYCDEQKRESYAR
                     VIVNGGGTITEGNEYTHCFVSKNYKGEVSAEKKYSTDYIFSHLFR"
     gene            complement(<147385..>147702)
                     /locus_tag="Eint_021290"
                     /db_xref="GeneID:9698727"
     mRNA            complement(<147385..>147702)
                     /locus_tag="Eint_021290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072440.1"
                     /db_xref="GeneID:9698727"
     CDS             complement(147385..147702)
                     /locus_tag="Eint_021290"
                     /note="similar to ECU02_1330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072486.1"
                     /db_xref="GeneID:9698727"
                     /translation="MSVESIKRLVQCENDAKEKLEMARRELEEMRAQARRDAGLMVED
                     LRKENESRLLLLEKEVEEYIKVVDERLKSEFEMKVKKLRDVRNKGDVVSALVEHVSGG
                     SEK"
     gene            complement(<147814..>149091)
                     /locus_tag="Eint_021300"
                     /db_xref="GeneID:9698784"
     mRNA            complement(<147814..>149091)
                     /locus_tag="Eint_021300"
                     /product="SUMO ubiquitin activating enzyme E1 subunit
                     UBA2"
                     /transcript_id="XM_003072441.1"
                     /db_xref="GeneID:9698784"
     CDS             complement(147814..149091)
                     /locus_tag="Eint_021300"
                     /note="similar to ECU02_1340"
                     /codon_start=1
                     /product="SUMO ubiquitin activating enzyme E1 subunit
                     UBA2"
                     /protein_id="XP_003072487.1"
                     /db_xref="GeneID:9698784"
                     /translation="MIRGRVLVVGCGGIGCELLKLLATKNLESITLIDCDNVDLSNLN
                     RQFFFGRKDIGKSKAIVAAKVFRKMNKKCKVFPICADITEFDARFFAEYETVYSCLDS
                     IEVRSYVNQRCFISKTPLVDGGSGGFKGQAYYFDYNSECFDCIPKRISREHLVCTIRS
                     RPTSFEHCISWAKYVFLEMKLKVDGEQDFYPRHLKDIIENCEDMSTPGELEKFRSSED
                     YKEKTKKIVEILGSSDLISFDKDKRDVLEYIYNVAYIRGMCAGIKPLSFDDAVTIAGN
                     IIPSLSTINSIIASLMILSVKNKCNYYCVDNGNIIRKLETCERNPGCRTCSYHWYGVL
                     YDGTLTFKRLMECFETRNLKLIAYSDKRLFFTPDMAEYLDKDIEFENNNIAEVVCMGR
                     RKRKIRVFLYFLRRGETLYFGRIHRVVYGRRRK"
     gene            complement(<149178..>149768)
                     /locus_tag="Eint_021310"
                     /db_xref="GeneID:9698785"
     mRNA            complement(<149178..>149768)
                     /locus_tag="Eint_021310"
                     /product="E2F/DP transcription factor"
                     /transcript_id="XM_003072442.1"
                     /db_xref="GeneID:9698785"
     CDS             complement(149178..149768)
                     /locus_tag="Eint_021310"
                     /note="similar to ECU02_1350"
                     /codon_start=1
                     /product="E2F/DP transcription factor"
                     /protein_id="XP_003072488.1"
                     /db_xref="GeneID:9698785"
                     /translation="MARKSTSDRLSSIRSENSLYNLTKRFLKLVSMAPDHNISIHQAS
                     IELNVGKRRIYDITNVLEGLGLLSKWSVSNAKWIGGNIDRYLLDDEEKENQENSYLNP
                     ENVLKGDDLDETLFRLNEEISMLSQSEKNLANAYVTYSDLQNLPSLDGNLVFAVKAPS
                     ETIMEYPRYEKGFYKLKLSSEQGTINIFYVSDEKKD"
     gene            <149957..>151459
                     /locus_tag="Eint_021320"
                     /db_xref="GeneID:9698786"
     mRNA            <149957..>151459
                     /locus_tag="Eint_021320"
                     /product="prolyl-tRNA synthetase"
                     /transcript_id="XM_003072443.2"
                     /db_xref="GeneID:9698786"
     CDS             149957..151459
                     /locus_tag="Eint_021320"
                     /note="similar to ECU02_1360"
                     /codon_start=1
                     /product="prolyl-tRNA synthetase"
                     /protein_id="XP_003072489.2"
                     /db_xref="GeneID:9698786"
                     /translation="MTKQKFGLTAKKEEDFSEWYVQVITKGEMIDYYEIKGCYVMRPQ
                     GQFVWKCIQKWFTEKIEELGVQECYFPMLVPKSTLEKEKNHVENFSPEVAWITKCGNE
                     VLGDPVAVRPTSETIIYPSFSKWIRSHRDLPLKINQWCSVLRWELHGTLPFIRGKEFL
                     WQEGHTAFLTKEESDVEVFAILDLYSRIYSELLAVPVIKGRKSESEKFGGADYTTSIE
                     AFIPGSGRGIQAGTSHSLGQNFSKMFDIKVDTEEGSENSSFVYQNSWGLTTRSIGIAI
                     MIHSDNLGLVLPPRVAMIQVVVIPCGITASSSEEDVESLRTYISKIHAQLKNFVRVHV
                     DDRNNVTVGFKFNHWEIRGVPLRLEVGFKDMANSEACLVRRDTRAKKQVSVEDIGQTV
                     MEEIDTMHNDMLSRATTERDRRISYVRSFEEFMSSLENKKMIMAPWCGVDKCEANIKS
                     KTTKFGPNGNVVSTGAKTLCIPYEAKSCNGMECINCNQKAIHYALFGRSY"
     gene            complement(<151609..>153525)
                     /locus_tag="Eint_021330"
                     /db_xref="GeneID:9698797"
     mRNA            complement(<151609..>153525)
                     /locus_tag="Eint_021330"
                     /product="alpha-alpha-trehalase precursor"
                     /transcript_id="XM_003072444.1"
                     /db_xref="GeneID:9698797"
     CDS             complement(151609..153525)
                     /locus_tag="Eint_021330"
                     /note="similar to ECU02_1370"
                     /codon_start=1
                     /product="alpha-alpha-trehalase precursor"
                     /protein_id="XP_003072490.1"
                     /db_xref="GeneID:9698797"
                     /translation="MEMASGVKLRYIFLAACTIIPVRASGIMDPGSRMSSELLEVSFV
                     SKITKDSKILVDKVFTKPPEEIDEILRNMLRENRSFEKEEDFWRFVDENSFEPETELI
                     FGKDDKELQADMPKNTSSYIIKLEEKLSDGSNPLFQTSQYKQSIANLIRIGKELENAW
                     GKIYVRQNRLKRGQYSTMIKVKNPFIIPGDRFKEAYYWDSSWILEGLVRSGMEKIAVG
                     MVENFIGLIEQFGFIPNGLRTYYLNRSQPPYFPQMLLTLYKHLPWEKIENTIKRGLDA
                     AVTEHTFFMTQKVERVEKNGKSYVLNVYKVNDTTPRAESYSEDRETAEQNKSRDEKYR
                     RRAEDIYADLKAGAESGWDFSSRWLGLSGQLDSIRVSKRIPADLNSVMYANECIISKL
                     YEIIEGKNSKNSKYFKEKSEERKDAINNVLWNDQQGVWNDFDIETREHTSPGFYASNL
                     MPMCYGIPPPKDKGVSVYHILNMFAEDIFGHPGGMPASGSKNKDSTLQWDFPNMWPPL
                     VHIVAFFLERVGEREMALHMVRSYLENISVSTSVVDETKRGIFEKYSCEMVGSPGYKG
                     EYTAQVGFGWTNGIAIHFLDRFSSEIVSPKSHEESYKEIKALLEKRILDKAEPKNHTP
                     EGCLLLEERFQVLA"
     gene            <153741..>154976
                     /locus_tag="Eint_021340"
                     /db_xref="GeneID:9698798"
     mRNA            <153741..>154976
                     /locus_tag="Eint_021340"
                     /product="CAAX prenyl protease 1"
                     /transcript_id="XM_003072445.1"
                     /db_xref="GeneID:9698798"
     CDS             153741..154976
                     /locus_tag="Eint_021340"
                     /note="similar to ECU02_1380"
                     /codon_start=1
                     /product="CAAX prenyl protease 1"
                     /protein_id="XP_003072491.1"
                     /db_xref="GeneID:9698798"
                     /translation="MAGNFLLSISIMNYVFMVYLKIRELRQLFKPPSKTYLRLATMDQ
                     IKKTKEYNRDKLFMSVFELTILLGRDIYLIKKGVLEEVYSIKYFMNSYYGDTLFLLGF
                     AHFQRLFDLPLDLISTFYIEAKHGFNKTTFPTFLLDFVKMTAIITVIFAPFSHIVMSI
                     IRKYQKTFFCIYLWIFIAIFQIVLVIIYPIAIQPIFNKFEEMEESDLKTKIQELAEKV
                     GFRANKILIMDASKRSGHSNAYFIGITKEKRIVLYDTLLKQANEEEVLAILCHEFGHW
                     KHSHVIKMASMVLLIQLFYLFILNVLMNSRSFGNFILGKDLPLLIRCVYFLMIIGALS
                     VPIDMIKNSVSRYFERQADRFSVSLGYGKELSSGLIKLFEKNSSNMDPDPLYSAVMHT
                     HPTLIERINLIEGEMNKIK"
     gene            <155012..>156466
                     /locus_tag="Eint_021350"
                     /db_xref="GeneID:9698787"
     mRNA            <155012..>156466
                     /locus_tag="Eint_021350"
                     /product="Ercc4-type nuclease"
                     /transcript_id="XM_003072446.1"
                     /db_xref="GeneID:9698787"
     CDS             155012..156466
                     /locus_tag="Eint_021350"
                     /note="similar to ECU02_1390"
                     /codon_start=1
                     /product="Ercc4-type nuclease"
                     /protein_id="XP_003072492.1"
                     /db_xref="GeneID:9698787"
                     /translation="MKMAEACIDLAPLVKSAVNFLYRLSLSKNMKSRHCYKKMAQELE
                     KIEGPLYSLDYLKNIKWAGAKTIEKIQELIDRRILEDIKTEEDFEKYLNVLSPRAYEE
                     SKRKLWKEGTEKSDSKDKQYKKEKDNISKKRKYIPGYRTGSYGIMKALWIREGIGRHE
                     IARIGRNYCDSEFDFGSRHSAWSSMKTLVRKGFVYKEGRSKFYLTDEGRELAATMFAN
                     TSVVEEEDEITLLVDTREVKSRRSRLFFQEYFESQQIRHETRALEVGDFLWVRGERVC
                     SSIIERKRGSDLVSSIVDGRFKEQKNRLKNTGIRKIFYIVEGLKNSHMQNVGKETIVS
                     CMAATRLEGFIVMETEDIGQTGSVIRMIDYEVKKEQEKKKKTSNKLDHCEESSECLED
                     PDEEMEMSYESFIDKSTKSKGKTQTYLLYMSLLSIKGIGHKKALILAERYKTIGGLIS
                     RVKADGVNKLYDFEINGKKISRKNGNDIIDFFLK"
     gene            <156502..>156684
                     /locus_tag="Eint_021355"
                     /db_xref="GeneID:20314013"
     mRNA            <156502..>156684
                     /locus_tag="Eint_021355"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163563.1"
                     /db_xref="GeneID:20314013"
     CDS             156502..156684
                     /locus_tag="Eint_021355"
                     /note="similar to ECU02_1395"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161827.1"
                     /db_xref="GeneID:20314013"
                     /translation="MGGISEKLKGLKFMQRAERKNNGDGEVSFSTYFCKKGIFSYCSK
                     QKIHDKEDEAQKKARN"
     gene            <156763..>157989
                     /locus_tag="Eint_021360"
                     /db_xref="GeneID:9698788"
     mRNA            <156763..>157989
                     /locus_tag="Eint_021360"
                     /product="WD40 domain-containing protein"
                     /transcript_id="XM_003072447.1"
                     /db_xref="GeneID:9698788"
     CDS             156763..157989
                     /locus_tag="Eint_021360"
                     /note="similar to ECU02_1400"
                     /codon_start=1
                     /product="WD40 domain-containing protein"
                     /protein_id="XP_003072493.1"
                     /db_xref="GeneID:9698788"
                     /translation="MNEDGVNIKELINARFQNPKFVYDGKRMRVLQERKVVDYTSGIC
                     VQRVKRRIDPLQVNTSFELSSQILNLKSPELCYNDLSSLFTTKIEHVSVNKVKCPVNI
                     VRWTPDGRRLMSGTATGEFTLWNGYGCNFETILQAHESPVRGMAWSPSGSFLISSDNF
                     GIIKYWHPSMNNIQIIQGHAEAVRDLSFSHNDSKFCSASDDSTIKIWDSIEAKEESVL
                     RGHNWDVRAAQWHRYKSLIASAGKDNLVKMWDPRTAEELCTLHHHKNTILALKWMGDE
                     NYLLTGGKDQVIKMVDIRTMADVFTYKNHKKEVTSIGIHPCIPDMFVSGGTEGGIYFW
                     QAYTQVPLEVIEEGHEGTVWSLDYHPVGHILASGSVDQSVRFWVRPRPDENAESTVGG
                     FVDEENNSDGGAIPGL"
     gene            <158123..>159409
                     /locus_tag="Eint_021370"
                     /db_xref="GeneID:9698789"
     mRNA            <158123..>159409
                     /locus_tag="Eint_021370"
                     /product="RAB protein geranylgeranyltransferase component
                     A"
                     /transcript_id="XM_003072448.1"
                     /db_xref="GeneID:9698789"
     CDS             158123..159409
                     /locus_tag="Eint_021370"
                     /note="similar to ECU02_1410"
                     /codon_start=1
                     /product="RAB protein geranylgeranyltransferase component
                     A"
                     /protein_id="XP_003072494.1"
                     /db_xref="GeneID:9698789"
                     /translation="MITEYEYDFVILGTGLVECAVGCILAGKNKKVILIDRNPMYGSD
                     FATLRYTELETYFRSSNMVPELKTYDSEFSVDLTPKLFLADSKMLKMLVRYGIDEYLE
                     FCRIPGSFLWKRKLYSVPTNEAQSMTTGLIGIWQKPKVMRFFWNVRDYARAAMKGKSY
                     QFKSTMREEFKEYGLTEESMELIGHGIALNLDDSYLDRHPKETFDKILTYVRSIICYE
                     NSMESPYLYPRYGLSEIAQGFARSCCTKGGEIMINAEMLEIDEAKMELLVREPVNKEI
                     LKIKAGKIISDQSYFQKSVVLYEVIRGICIVRGDSVDITKGASSAQVIFLKGELGRKN
                     DIFVVVLGSEEKSTPEGYKAVIISTVRETDNPEKEIEVVLERLGDVVRYFIDVKPVYE
                     AEDMENIVFTKGVDESPHFEDIYEEIERICKKLDVC"
     gene            <159498..>160058
                     /locus_tag="Eint_021380"
                     /db_xref="GeneID:9698691"
     mRNA            <159498..>160058
                     /locus_tag="Eint_021380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072449.1"
                     /db_xref="GeneID:9698691"
     CDS             159498..160058
                     /locus_tag="Eint_021380"
                     /note="similar to ECU02_1420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072495.1"
                     /db_xref="GeneID:9698691"
                     /translation="MEIKTGMISGALSSCYLKTNKTSVICCIYLEQKGETEPQTEVHF
                     SEGLPLQIRSGVSSIVKSLFSTKTRSTRIKVTFHAVRCGEDLFSCLVNSFSVCAILSG
                     IGIIDTICSSTVYADKNNISLTSQLNSFPLHMVYMIHKKRIMQVHFDGCLDSSLFVKA
                     TERLVQTCVEQADMLRLTIEEITRTG"
     gene            <160117..>160938
                     /locus_tag="Eint_021390"
                     /db_xref="GeneID:9698692"
     mRNA            <160117..>160938
                     /locus_tag="Eint_021390"
                     /product="conserved hypothetical ATP binding protein"
                     /transcript_id="XM_003072450.1"
                     /db_xref="GeneID:9698692"
     CDS             160117..160938
                     /locus_tag="Eint_021390"
                     /note="similar to ECU02_1430"
                     /codon_start=1
                     /product="conserved hypothetical ATP binding protein"
                     /protein_id="XP_003072496.1"
                     /db_xref="GeneID:9698692"
                     /translation="MSLIESEKKEEDGTRRKIFVVVGMAGSGKTTFCQRLYSWISQDN
                     CTIDPATGLNSHIYSINTDPAVVNTKMPLNLDIRDVVDYHETMEKYELGPNGGINTCL
                     NLFLLNIGEYIDRIKEEYIIIDTPGQIEAFTWSSPGYVLIEALKTVGEVILVYVVDSV
                     SSHKHAVFMSNMMYAASLMCRYEVETLCLFNKKDLSGSELLEEWISDYESFRDSLNDE
                     DMFSPILGSMALHFEEFYNSIKTVSVSSSTGSGKSDFFDAVNQIMNEKYPENKFE"
     gene            <161013..>162644
                     /locus_tag="Eint_021400"
                     /db_xref="GeneID:9698677"
     mRNA            <161013..>162644
                     /locus_tag="Eint_021400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072451.1"
                     /db_xref="GeneID:9698677"
     CDS             161013..162644
                     /locus_tag="Eint_021400"
                     /note="similar to ECU02_1440"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072497.1"
                     /db_xref="GeneID:9698677"
                     /translation="MKAKDRRNRTKMKSIDSISRIKESKIAYSLPHGPYRVVSIVSLG
                     GGCGNYFDKYLHENRGLFFSPEYKINYLFKETCGVSEFHIGYLCRASDIVVFFINSDE
                     IDDSKLKIIKKFVPSCLFCISNQRFKDVARKVVKKHFPKERIVEIDGLMGVLSNVRVK
                     NTSVCKRPYIVPSNAYSDGEYFYVEGFLKRGFLSDKVVVNGRYEMTIEEIFTDRLYKG
                     EDLCVSVDIEKTSLAEGEELESDCNSESLESGCDEYEEKENDESEEFTTDESSTEDRP
                     SLIDKYSEYRGIRNLSTCSFKSYNFPSHYKSLVFFDDFRRAEKLITEQDSIIPNDQMV
                     KIKLRYEGLIEEQIYVVFGCYEYEKRKTIHNFHFEGIEPLKEESMVVDLGHRIIDIRP
                     MITRNLNHRVFKKQEELESGVVSFIGPMAFGLSRVLLYKKSALGELSKETLVAVGMNG
                     FTGDRIIFEEVVLQGIPFRNKKRYSLVKRMFNSKEEVMYFRNIQLYMRSGKITGFIKK
                     PIGTKGMFKGYFTHPIKSGDKVMMSLYKRAFLEDQ"
     gene            <162690..>163616
                     /locus_tag="Eint_021410"
                     /db_xref="GeneID:9698678"
     mRNA            <162690..>163616
                     /locus_tag="Eint_021410"
                     /product="Kin28-like Ser/Thr protein kinase"
                     /transcript_id="XM_003072452.1"
                     /db_xref="GeneID:9698678"
     CDS             162690..163616
                     /locus_tag="Eint_021410"
                     /note="similar to ECU02_1450"
                     /codon_start=1
                     /product="Kin28-like Ser/Thr protein kinase"
                     /protein_id="XP_003072498.1"
                     /db_xref="GeneID:9698678"
                     /translation="MKTYIKEKRLGEGTYAVIYLGYRCLPQDKPLVDSGTKIEDTPVA
                     IKKIKLNKYTQGHEISAIREIKALKRISCKYVVKLLDTFIYDKCIHIVLEYVETNLEN
                     VIRNPDKIIMPGDIKAWMLMVLRGVYECHKLFIIHRDIKPNNILITAEGMVKLADFGL
                     TRGIGNKMTPQAVTRWYRAPELLLGSRDYGSPIDMWSVGCVFAELFLRVPLFAGDTDI
                     QQLDMIFRALGTPKEKEWPGLSTLPSFLEFHQYEKTSLRPLFSAASSDAIDLLERLLT
                     LNPGNRISCDDAIKHPYFKSFPSPTPMGKLPV"
     gene            <163752..>165893
                     /locus_tag="Eint_021420"
                     /db_xref="GeneID:9698679"
     mRNA            <163752..>165893
                     /locus_tag="Eint_021420"
                     /product="Vesicle coat complex COPII subunit Sec24"
                     /transcript_id="XM_003072453.1"
                     /db_xref="GeneID:9698679"
     CDS             163752..165893
                     /locus_tag="Eint_021420"
                     /note="similar to ECU02_1460"
                     /codon_start=1
                     /product="Vesicle coat complex COPII subunit Sec24"
                     /protein_id="XP_003072499.1"
                     /db_xref="GeneID:9698679"
                     /translation="MHSRDFASQAMHQTSKQFPKAFEGQRRPKMKIPDFPSELEKDQA
                     SFFSFDTSVQPPPLSTTNCFITETTNTDPNLLRSTMYTLPTDTDTFESMEIPFGLVLN
                     PFNQKAMATELDKSISMKCWQCQSYVNIFTKIEGNTFYCNICNSKNQAKEKISSEVTR
                     YSTIEYVDRVKEERITRPEAGNIVSESLFRTTMIDGPAFIFGIDTTASPLMEHAFKAM
                     KLLINDENFRFLFKKVGVILFSSTVSLIKPSGGMITEVLLSDRLQLPFISPEFLMDSE
                     DDGLMKSLMEYVMGKSEDKGKFKNGFEDCLRVAISIAGYCKGSKMAVFSNIQDKVEYE
                     EVAKQLIEVGCSLNVFSTQKTSATKLCASTTGKCFIYSLESLSKLGPDLLNLGVTKSS
                     YKVQVEAKTSDAIRKLSFYGNTVFEHLGFQDFAHMDDKTAFGMTFSLEEPLQNKSKVY
                     VQVILRFYSFDGSSRVLVMNSSFEGSSRISEVYASLSFDTLACIYAKYIAMDESTAKE
                     HCKKVENSISRSLKYYRDNCCKEASSSQFVLPESIKLIPLIYQAMVKNSCFSNNISTD
                     TMSRVTGFTVEENLRFFYPRLFAFTDFYIDKSLEKVKALRLNVESLNSEEIYILDNSQ
                     KIYIYIGKDVDISLKEAIFRDKTEENEVLDKMIDEFYTYYDSELPVIFVEEGKGGSEV
                     EFVGYMVEDRLNDIPSYSDYICELHFKVKNA"
     gene            complement(<165972..>166442)
                     /locus_tag="Eint_021430"
                     /db_xref="GeneID:9698683"
     mRNA            complement(<165972..>166442)
                     /locus_tag="Eint_021430"
                     /product="prenylated rab acceptor 1-like protein"
                     /transcript_id="XM_003072454.1"
                     /db_xref="GeneID:9698683"
     CDS             complement(165972..166442)
                     /locus_tag="Eint_021430"
                     /note="similar to ECU02_1470"
                     /codon_start=1
                     /product="prenylated rab acceptor 1-like protein"
                     /protein_id="XP_003072500.1"
                     /db_xref="GeneID:9698683"
                     /translation="MQGGMHEEKTFQKNIKEALGDKNAARDFFSIRKASIPRDFSVAK
                     RRILVNLDRFKFHYLAMSSAFALIYVLYRLELVILIGIIAVTAYAYQTKPTLFNVELE
                     PRSVCIAGAVGILIFFIFSREAIVGLLAISAVCGMMTLAHSMLLEEDLQRDDEV"
     gene            complement(<166579..>167130)
                     /locus_tag="Eint_021440"
                     /db_xref="GeneID:9698684"
     mRNA            complement(<166579..>167130)
                     /locus_tag="Eint_021440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072455.1"
                     /db_xref="GeneID:9698684"
     CDS             complement(166579..167130)
                     /locus_tag="Eint_021440"
                     /note="similar to ECU02_1480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072501.1"
                     /db_xref="GeneID:9698684"
                     /translation="MEEAKTLLQDLCEKFKNPAEKNILMALDSQRKEERLKMETVTRT
                     LQENVQLFKKKNMQLEGEVRKYSYTHSKKNDAFVEINNEKLRLAKKIVELEDENEKIK
                     AGIITTDKRIQEKEEKLRALSRPSFNEIYLEIVKGFGTEFIEGDGRKYCRIKSKKMGD
                     VFTIDIGSDVSLFEITNSIWEKI"
     gene            167214..167295
                     /locus_tag="Eint_021450"
                     /db_xref="GeneID:9698756"
     tRNA            167214..167295
                     /locus_tag="Eint_021450"
                     /product="tRNA-Leu"
                     /note="tRNA Type: Leu, Anti Codon: AAG, Cove Score: 52.86"
                     /db_xref="GeneID:9698756"
     gene            complement(<167401..>169995)
                     /locus_tag="Eint_021460"
                     /db_xref="GeneID:9698757"
     mRNA            complement(<167401..>169995)
                     /locus_tag="Eint_021460"
                     /product="alanyl-tRNA synthethase"
                     /transcript_id="XM_003072456.1"
                     /db_xref="GeneID:9698757"
     CDS             complement(167401..169995)
                     /locus_tag="Eint_021460"
                     /note="similar to ECU02_1490"
                     /codon_start=1
                     /product="alanyl-tRNA synthethase"
                     /protein_id="XP_003072502.1"
                     /db_xref="GeneID:9698757"
                     /translation="MMWTTEKLRRSFLDYFASKSHKIVSSSSVIPFEDDSLLFTNSGM
                     VQFKKNLLGERDDLRRACSVQRCIRAGGKHNDLDDVGKDTYHHTYFEMMGNWSFGDYF
                     KEEAIGFAWEFLVDVLKLNKDKLYVTYYEELDKESGNIWLKYLPSERVLSASYKDNFW
                     EMGDTGPCGPCTEIHYDRIGNRDASELVNKDDPNVIEIWNIVFIEYNRTISGLVPLER
                     KCIDTGIGLERLLSILIDVRSNYLIDSFAVIIKAIEDRCNFKYNDTEESIDVAFRVVA
                     DHCRTIAVCTYDKVDFSNDGVGYVLRRILRRAVRYAHEVLGLKEGVLGELVGIAAHAI
                     GIELKSVDCVNKEELQFMKTLKKGIERFHKLAENNGKISGEDLFLLYDTYGFPVDLTE
                     IMAKERNIKIDYTNFESFKQKAVEISKMSKGMKLNIDAGLQSKFPRTDDSFKYTKNSI
                     NATFFFGIEGKEIITKPNEIPEGRELGLVFDKTCFYAECGGQVGDTGKIIFYDGEKDV
                     GVFNVMDTQAIKGFVVHKGILEGSASYQALQMYDQELRKKIMKNHTGTHLLNFFLRTI
                     IQTEQRGSLVDPEKLRFDFEGRKLTNQELEEVEKKVNEFIQSNTDVEAITLDREQAME
                     SPNIVRMRNEEYPEKVRVITMKANGLTIEEMCGGTHVTNVSDIGKFRIISETGVSANT
                     RRIVAVTGKKAQELDMEAEIYLSKLSIGEVVNVDKTIPLFYRQKVEVLNQKNKKKGEE
                     LSRAQYAKNKKEILELIAKAKNTSNLDDKTVVYYYQPTDSCTRKDLVRFIGLLCGEAL
                     KSSVQCLVYVFVNEETILAGNVSDNKGLIEKITSRYPNSHVRASKGIVQGSIHTKMNY
                     EDAKGLLR"
     gene            complement(<170096..>170266)
                     /locus_tag="Eint_021465"
                     /db_xref="GeneID:20314014"
     mRNA            complement(<170096..>170266)
                     /locus_tag="Eint_021465"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163564.1"
                     /db_xref="GeneID:20314014"
     CDS             complement(170096..170266)
                     /locus_tag="Eint_021465"
                     /note="similar to ECU02_1495"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161828.1"
                     /db_xref="GeneID:20314014"
                     /translation="MEDGYKDILEFAKELKLHFGEDTIDQMYKLLDSGMSPKNLIQLL
                     KEIRNELSGRIR"
     gene            complement(<170339..>170644)
                     /locus_tag="Eint_021470"
                     /db_xref="GeneID:9698758"
     mRNA            complement(<170339..>170644)
                     /locus_tag="Eint_021470"
                     /product="putative transcription initiation factor TFIID
                     subunit TAF12-like protein"
                     /transcript_id="XM_003072457.1"
                     /db_xref="GeneID:9698758"
     CDS             complement(170339..170644)
                     /locus_tag="Eint_021470"
                     /note="similar to ECU02_1500"
                     /codon_start=1
                     /product="putative transcription initiation factor TFIID
                     subunit TAF12-like protein"
                     /protein_id="XP_003072503.1"
                     /db_xref="GeneID:9698758"
                     /translation="MNIEHHFLCPKKLLKLCNKKIDKDVIRNLQLLTEKFLSDIIHRS
                     ALLCKHKGKNIVDNGDIRFIIEKDFDYSFGGREIQGSKSLPTSEHLERMAEISRQNK"
     gene            <170691..>171791
                     /locus_tag="Eint_021480"
                     /db_xref="GeneID:9698802"
     mRNA            <170691..>171791
                     /locus_tag="Eint_021480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072458.2"
                     /db_xref="GeneID:9698802"
     CDS             170691..171791
                     /locus_tag="Eint_021480"
                     /note="similar to ECU02_1510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072504.2"
                     /db_xref="GeneID:9698802"
                     /translation="MVEIIDKIREIKYADEMDYIVEGLVNNEIEESLRLILDLTNDEK
                     FKSYMKESRYLDEIIQVISEKGVLETTSGMVLEILSRTFNPYSLVDFKGLFKVLAMAF
                     NRCEVENISAESSICVQREANFITEILEKIPIKWYSKFSNHTELRKVVFSLQMCTSRK
                     VIEWNKFLISLLMKHPELGIIDDFASILLKKGRNYEVIANYTMFRENAEKLFLSENFR
                     QCLRRVVIKEFIKDKDYKRPRYMLKGLTPKSLVLPVPETKKKESLGGIEKDSKSLSRK
                     RFLIIILINLLFRDFHLDIPLSLIERAYYSVDEITRCYIAILLLSIEYSEKNTVQSIH
                     VEDLKKDARHLLSISNTCLCEEILNRLIKISS"
     gene            <171876..>173150
                     /locus_tag="Eint_021490"
                     /db_xref="GeneID:9698803"
     mRNA            <171876..>173150
                     /locus_tag="Eint_021490"
                     /product="ATP-dependent RNA helicase"
                     /note="involved in mRNA export from the nucleus"
                     /transcript_id="XM_003072459.1"
                     /db_xref="GeneID:9698803"
     CDS             171876..173150
                     /locus_tag="Eint_021490"
                     /note="involved in mRNA export from the nucleus;
                     similar to ECU02_1520"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_003072505.1"
                     /db_xref="GeneID:9698803"
                     /translation="MADKSLIQDDKEVARELFAMIKQDTTAIETGLDGNVSGVVTDRG
                     KLLVAEHFSDMGLSDELLKAIYNRGFEKPSLIQKSAVPHILKGHNIVVQSKSGTGKTI
                     AFTCGILGNVNAGEGTQALVVTPTRELSTQVTEVISGFAESLGMKVFSALKNKTTDIV
                     REEVVVGSPGTILKLIDLGKLNHKEIKMVVLDEADILLDKDMMGTQTFRILKLVSGAQ
                     IIFFSATYSDQVKQTIEFYTPDAVKMYEERNGKPEEIKLFYIEAEGDNKRKALKSLYE
                     YLSISQMIIFVSTKATVNYLRKRLEDDLHSVSCLHGDLEIEEREKAVEEFRTSKTKIL
                     LTTDVFSRGMDIPQVNLIVNYDLPIYKGVASTQTYIHRIGRSGRFGRTGFVVDFVRDE
                     ELEAYLKFQKELKFASKKFTIKALEEVAEEID"
     gene            <173280..>175397
                     /locus_tag="Eint_021500"
                     /db_xref="GeneID:9698728"
     mRNA            <173280..>175397
                     /locus_tag="Eint_021500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003072460.1"
                     /db_xref="GeneID:9698728"
     CDS             173280..175397
                     /locus_tag="Eint_021500"
                     /note="similar to ECU02_1530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003072506.1"
                     /db_xref="GeneID:9698728"
                     /translation="MEGLEDDFIPDFTHLSVAGEVADRNSLVRQEGDVVYISVGNRLN
                     GWNLRFSEIEKSIPTLKKRITHFDFSDGVLVIGYENGAIQVHSSEIISFRPHSRRVTK
                     VSKIGDYILSSSADGSIILYDLIGEEIRISYEGNDICVEKFFSDSSVVIGICSDNALR
                     IWNLEEKHVKSVHIFGKAIKDVFAVNEEALIFFKDGECIFYNLVEKTSRPFNKFKKLR
                     NIKVRGNKMFLQNKNKLHIYEIDSKDKIVLRDLEAEKISDRYTDFDVMPDGGLLFATI
                     DNSWECLKDGKIYPFGFHRSEILGLETCEDKIVTMSKESIIFWVIDKKEMKRVGNIQI
                     KNGKCMCIWNGHVVIGGSEGLSCYSGLNYLLVKEENIGPISSVFATRQELLVGKDNSL
                     LFYDNRWVVSRTLEVEDPISSIEASQDGSLLCIGLLNSKVHIYGMNELNLRITLYGHA
                     LPVRSMKLSPDNSEILTCGSDKTVKMWGTQFGECRKSFIGDSRSIEYWNKDLFMFTSG
                     VIQYFKRYEKLKEFKNRESNLVKIRKDMMISCGKFNVDLYTMNKYEFQKEDEEESNEE
                     EVMRVAKIMNYKMYDRFLTELEELSKDFSSDNIKTFFNVLMDIDFCELDKFLCLMNSS
                     DIIQVMNVLHECCNWNAILVARVFISLVRLHKDICISHPKFKVFLQTITDKTKEVRTQ
                     VSRNQGLLLTRKSINKEQSFSVE"
CONTIG      join(CP001943.1:1..175776)
//
DBGET integrated database retrieval system