GenomeNet

Database: RefSeq
Entry: NC_014423
LinkDB: NC_014423
Original site: NC_014423 
LOCUS       NC_014423             233397 bp    DNA     linear   CON 10-OCT-2017
DEFINITION  Encephalitozoon intestinalis ATCC 50506 chromosome IX sequence.
ACCESSION   NC_014423
VERSION     NC_014423.1
DBLINK      BioProject: PRJNA51607
            BioSample: SAMN03081424
            Assembly: GCF_000146465.1
KEYWORDS    RefSeq.
SOURCE      Encephalitozoon intestinalis ATCC 50506
  ORGANISM  Encephalitozoon intestinalis ATCC 50506
            Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
REFERENCE   1  (bases 1 to 233397)
  AUTHORS   Pombert,J.F., Selman,M., Burki,F., Bardell,F.T., Farinelli,L.,
            Solter,L.F., Whitman,D.W., Weiss,L.M., Corradi,N. and Keeling,P.J.
  TITLE     Gain and loss of multiple functionally related, horizontally
            transferred genes in the reduced genomes of two microsporidian
            parasites
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (31), 12638-12643 (2012)
   PUBMED   22802648
REFERENCE   2  (bases 1 to 233397)
  AUTHORS   Corradi,N., Pombert,J.F., Farinelli,L., Didier,E.S. and
            Keeling,P.J.
  TITLE     The complete sequence of the smallest known nuclear genome from the
            microsporidian Encephalitozoon intestinalis
  JOURNAL   Nat Commun 1, 77 (2010)
   PUBMED   20865802
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 233397)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 233397)
  AUTHORS   Corradi,N., Pombert,J.-F. and Keeling,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAR-2014) Botany, University of British Columbia,
            3529-6270 University Boulevard, Vancouver, British Columbia V6T
            1Z4, Canada
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 233397)
  AUTHORS   Corradi,N., Pombert,J.-F., Farinelli,L., Didier,E. and Keeling,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2010) Botany, University of British Columbia,
            3529-6270 University Boulevard, Vancouver, British Columbia V6T
            1Z4, Canada
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001950.
            Linear chromosome is missing portions of the telomeric regions.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..233397
                     /organism="Encephalitozoon intestinalis ATCC 50506"
                     /mol_type="genomic DNA"
                     /strain="ATCC 50506"
                     /db_xref="taxon:876142"
                     /chromosome="IX"
     gene            complement(<1..>1063)
                     /locus_tag="Eint_090010"
                     /db_xref="GeneID:9699392"
     mRNA            complement(<1..>1063)
                     /locus_tag="Eint_090010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073445.1"
                     /db_xref="GeneID:9699392"
     CDS             complement(<1..1063)
                     /locus_tag="Eint_090010"
                     /note="similar to ECU06_0090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073491.1"
                     /db_xref="GeneID:9699392"
                     /translation="MIWIYVVELLGLINVVWSSLEIGIEDIERRIGRKMNDAERKAGR
                     EVFENSPKILNYRKVILYPFAIHDNSFLVFPTTKYSEIEEGKREHVKKIIEGLPRLTL
                     WCMGFLNVPFCRESTMMLSDEVLQKSGLYKHFDSLSKKYEEDKMTFGDLAKKILEGCK
                     GTLEELGKLFVSKASEEIRKLKDLPNPDSEENKKKKEEFKEIKKHGELICNKREEKQI
                     FEVLNMAYDRCLSLWEREEYRENFIMKMRLKKLYVKEIKMEIKEPLSDYANNQISSIG
                     YLDHDLLIKIDREHGGEAVGELMKETFLEYKSDYKNEINRAVLEVEERKRREEKEKRK
                     EKRKEKEEKERKEKKANQNA"
     gene            complement(<2147..>2929)
                     /locus_tag="Eint_090020"
                     /db_xref="GeneID:9698322"
     mRNA            complement(<2147..>2929)
                     /locus_tag="Eint_090020"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073446.2"
                     /db_xref="GeneID:9698322"
     CDS             complement(2147..2929)
                     /locus_tag="Eint_090020"
                     /note="similar to ECU09_0030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073492.2"
                     /db_xref="GeneID:9698322"
                     /translation="MRLGTGVIGAMWIIDTVFSLRGREKYVCLNYSGRRERNVPREVF
                     ESIMRGEKIIELDISRNNIDRLPPYFEKLSFVKVLDASNNELKYISDSILGLASLEKL
                     NLNNNNLLYLPKEITLLEHLEELSVRNNQLRMLPEEIHNMDSLVRLDLGNNELAALPF
                     GIGALDNLRILNLEGNLFNTLPLILGYLENLEKIIFTKNKRLRKIPRKLIEILADSKS
                     LVLLDLRGNNRLREESSGDNVGWKELKNILGNKVKLSQEEEN"
     gene            complement(<3061..>3741)
                     /locus_tag="Eint_090030"
                     /db_xref="GeneID:9698323"
     mRNA            complement(<3061..>3741)
                     /locus_tag="Eint_090030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073447.1"
                     /db_xref="GeneID:9698323"
     CDS             complement(3061..3741)
                     /locus_tag="Eint_090030"
                     /note="similar to ECU09_0040"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073493.1"
                     /db_xref="GeneID:9698323"
                     /translation="MNFKKNKMSVLANSLGLASMLVPTAIHLSDKLTGTNTILQFVAA
                     VSSSSFTAFMLIYWIVRNWCVNVSSNGAKESFLYLTFIVLCMTGLFTCIGEVFLYGLY
                     NSNVNILKVFATFSSVSYIRFKSLGLLPRPVYRCSSIGKIISIGAIVMITSAIAFHAK
                     TGNALVVSWSFVLSGIALVLLSLWEETIPSETRDLWDISKAQLQAIDFIQLILFTLAY
                     YWPDRSKF"
     gene            <3937..>4716
                     /locus_tag="Eint_090040"
                     /db_xref="GeneID:9698324"
     mRNA            <3937..>4716
                     /locus_tag="Eint_090040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073448.1"
                     /db_xref="GeneID:9698324"
     CDS             3937..4716
                     /locus_tag="Eint_090040"
                     /note="similar to ECU09_0050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073494.1"
                     /db_xref="GeneID:9698324"
                     /translation="MEKTSTLNLEFQLFNLMAKSQSIEVLIVFGVIFGNMVFNNMKME
                     SLSFHLFGVVTVVLLTAYLLAIIGSTEFSENDDNTIFKSMAICSMVVTSIIAVIQSVC
                     SLMDLRKDRAKLFYSERGERLIIGGYAAIISILFLLIQISKMVSMKKIKKSVFVSVCI
                     MMVASVFYFLLSEEIDQEQILSLIIGLALIVGIIVLINIGGSKEIDMKEKGTLPYVMS
                     SIIVFFITSALGAKVVGDKVKLVEKLASVFTVIDKCILTKK"
     gene            complement(<4796..>6091)
                     /locus_tag="Eint_090050"
                     /db_xref="GeneID:9698325"
     mRNA            complement(<4796..>6091)
                     /locus_tag="Eint_090050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073449.1"
                     /db_xref="GeneID:9698325"
     CDS             complement(4796..6091)
                     /locus_tag="Eint_090050"
                     /note="similar to ECU09_0060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073495.1"
                     /db_xref="GeneID:9698325"
                     /translation="MTKTLSEVELFAATSITQLSILVYYLMLPRSAFLEFVFSAIPLY
                     FVVVFIGYSGLIYAGFSFMLIAYLLFTMFLEWKQRKSVWPWKSYAPSQYKQISSSVFQ
                     EKDLNTSIAIDRTRSLIITSVAITIFASDFSFYDGRKLGKSMDYGLKLMDIGVGSFVY
                     NAGFFSVKASKQRKIKNILSSFFFGALRYLSKVILKLDVKDAEFGVHLNFFFMLGILN
                     LASLFIDTYANFLVGFAMCLFHEIFLKFFGLEEVIYNSTRSNLITANIEGITFLLPQM
                     GMFLMASDISKAIFKRKNTNIIMFYNLLFFTIFLMTRTYSVPCRRIHNLSFAMIIMFL
                     HTTQGITFGIFNKAFRIEELKMHRFTSKYLLFILVWSNLLVFINKHFFSPKNIPNYLA
                     HGLCIAYLFLVFYVPYVLKNMGFRRNTNQKDIKLFSHRD"
     gene            complement(<6106..>8124)
                     /locus_tag="Eint_090060"
                     /db_xref="GeneID:9698326"
     mRNA            complement(<6106..>8124)
                     /locus_tag="Eint_090060"
                     /product="translation initiation factor IF-2P"
                     /transcript_id="XM_003073450.2"
                     /db_xref="GeneID:9698326"
     CDS             complement(6106..8124)
                     /locus_tag="Eint_090060"
                     /note="similar to ECU09_0070"
                     /codon_start=1
                     /product="translation initiation factor IF-2P"
                     /protein_id="XP_003073496.2"
                     /db_xref="GeneID:9698326"
                     /translation="MGKKNRKDDDYLNTLLGPTDKKSKEGCKDKEDLEEIDKSLEKMK
                     MNGENERNLKSAKETVEANTTNGENSEFKSPICCILGHVDTGKTKLLDKLRESNVQGE
                     EAGGITQQIGATFFPVSELFKKCGRKESKLPGILVIDTPGHESFANLRTRGSSLCNLA
                     ILVVDIVHGLEAQTLESIELLKKRKTPFVVALNKVDRLYGWKSTSFGEIKTTLKKQSK
                     PTIDDFKRRVNNTVLAFAEIGLNVKLFYENTNQKRFVSLVPTSAVSGEGIPDLVSLIL
                     ELSEKYMGSKMKIKDEVECTVLEVKSVEGFGVTLDAILSNGVLKEGDKIGVCGFHEPI
                     VTTIKALLMPQPLKELRVKNQYVMVKEVRASLGIKIAAGGLEKAIAGSRVLVIKNNEE
                     EVKNTLAADLESVFSSIELHQEGVHVVSSTLGSLEALVSFLKASNVLISGVSIGTVKK
                     KDMIIVASMVKKQKKYAAILCFDVVLDKEMKDMASSMGVRIFEAKIIYHLLDSYLRFV
                     NEEKEKDKKIHMEQAIFPVELSIVPKCIFNSRSPLVIGVHVKEGILKIGTPLCVFKES
                     ETVKLGIVTSIENNKEAVQEAPKGLKVAIKIEAKPNIPPRMFGRHFEQSDILYSVLTK
                     ESINVLKKHFSDELTEDLTDLLNRLENKFGIFYLLFHSINTSLFYLFY"
     gene            <8275..>8691
                     /locus_tag="Eint_090070"
                     /db_xref="GeneID:9698335"
     mRNA            <8275..>8691
                     /locus_tag="Eint_090070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073451.1"
                     /db_xref="GeneID:9698335"
     CDS             8275..8691
                     /locus_tag="Eint_090070"
                     /note="similar to ECU09_0080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073497.1"
                     /db_xref="GeneID:9698335"
                     /translation="MNQDMISKMVPFLSKKSILMLYGITRDPKYPVYIIRRYKARLNI
                     IPTGKAAMLIQRAVDMERNDLVMEYLCHVPPGRMTRILLKLAENIEPEKTQHMISDLK
                     KSNFCLMCSSNNRCEVIVARIENIVKNIRSYAYHCK"
     gene            complement(<8780..>12184)
                     /locus_tag="Eint_090080"
                     /db_xref="GeneID:9698336"
     mRNA            complement(<8780..>12184)
                     /locus_tag="Eint_090080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073452.1"
                     /db_xref="GeneID:9698336"
     CDS             complement(8780..12184)
                     /locus_tag="Eint_090080"
                     /note="similar to ECU09_0090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073498.1"
                     /db_xref="GeneID:9698336"
                     /translation="MKVIQQRNVYFLDLGKCVYRGFSETTIQREAGEDVLVYKSKDLA
                     VLSVDIIASSKLKTVNYTIKDATDAIDECERSFSRNMWKNINVDGTFEVRVPEEVREN
                     TFTVRILYEIGENNDSVEFYRPISPEDRHREVVACNRMFDSSSIFPSLSTPYKNKWEL
                     VYILPSSEEVKIISPGILKSIREEENVILYSYSVEMAHSGALNFCIGTFDSYEISTGD
                     DRKAVCIPKGSEGYKDCIREFCCDVENLIRYSEYFLQREYPFKALSIAFVFGDADKVY
                     GQNTAFLALSNLTSLNDIEPMFLLKRIVCDILSSQIFYFYFSIVEKIDFWIAEGMKGY
                     FQDYCARHFLGNNEFLYELKKDRDYVLDRDVAEYALYDPRRTFFSMRDKFFKTKAKVF
                     FHLLEGNLSRAFMEKILNYTIKRKGDVKEDYSFEFVKLVKDVTGKDLRFLFETYVFKP
                     GVVKVRLGFTINKKSNRVDFTAEQTPTSIFSNGNKTICGPVTICSYEMEGIFEHVFML
                     DRENHFYYHPKTKKKKKSEEEEEVMPLLWIRADIKGEHLARIVIEQPDYMFIEQLLDK
                     NVVGQMEALENLSIKPSVQVCEILERMLENTHIFYKIRVHILYILSRTTIGSYYGFQR
                     LIQYFVKKYCVQTSTIVKPNDFSFIPYFIQKHLVRALSLADPFIFRNYSGREVGSASI
                     ISAFIINILKFNDNSFNSYSDGWYISSVIESLSFPLSSMSFPEFYSGEHMKSKNKEHT
                     LHRPGKTEDDINDLFRAEGNSSKDFEKHGGLSLDDLSAGSDKGNMNSFDMNERYENRK
                     SPYLSIDKEEGKRQDGDLSSVYKGGQSIRTESSENPDYLQLSVSEIERFRILDMVFPS
                     HRNLVTKSCIYALGRLSLFGMMSLKKNALIQLSKHPNFCSVRVAALEVLLSLFYEDEE
                     VVNSIFEMLLQGTFTIKCVAFDVMTALGSSPKFNFKKVLKGKRKEIFKLLRLNQGNAI
                     VKEKIANLIYLIEDMELTRDEYHKAVVRIYERTLPNDLRKTINRLGREFMGDKRVTLR
                     LNSIDTLKRKLLQAEYLIRIPFSRTKKILGGFLERKEHIPSNPKPEADPTKKSFYRKT
                     PNRKGVDDLKKTRKWGTQDSPMDTSSVGSVIRIPNTCKIRLRHPEK"
     gene            <12255..>13835
                     /locus_tag="Eint_090090"
                     /db_xref="GeneID:9698337"
     mRNA            <12255..>13835
                     /locus_tag="Eint_090090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073453.1"
                     /db_xref="GeneID:9698337"
     CDS             12255..13835
                     /locus_tag="Eint_090090"
                     /note="similar to ECU09_0100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073499.1"
                     /db_xref="GeneID:9698337"
                     /translation="MKKIKVDCGSFANSKVVEQLWEMISREDISLHQKSSIFLEMTEY
                     KKMNEKLVKRNNELIEENASMVSILEAQKENPNNASSLGEEAKFDAGLKISELNYEIR
                     RLDSVICEMQKRIARDLLQKETKDTPELERTEEKKHVVADSTTVTNEVYKKITEDYGD
                     LKAKMAGLESKHNEELCERDQKIAKLQRELKEVMSNAKDMGERFTILNTESGKWKEGL
                     QTFIGKELVLNNEISGCVPRLEKIEKDMEEIAAGLDVWMKKIEQLDAEKKELWKITEN
                     YKSYERVRNGSGTCDQGSLEDEIINLVESLDKSLGENKALVLRLEAAHKKNRELESEM
                     ISLKMASSDLRSRNAKLESDIKHLGMENRYTTQGDLGDHGLKIRKLESSLAEYNKVAT
                     DYKKRLYTLSKEKEETEKILESIKKQNREMRDEMSRIAKTNSQIEAENKRLSGVLRAI
                     QNGGSEEDTDLAVQLERYRGLLRCTLCDTRFKDTAITKCMHCFCEECINSRIRMRDRK
                     CPSCNEPFAPNDVKKIYL"
     gene            complement(<14074..>14586)
                     /locus_tag="Eint_090100"
                     /db_xref="GeneID:9698338"
     mRNA            complement(<14074..>14586)
                     /locus_tag="Eint_090100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073454.1"
                     /db_xref="GeneID:9698338"
     CDS             complement(14074..14586)
                     /locus_tag="Eint_090100"
                     /note="similar to ECU09_0110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073500.1"
                     /db_xref="GeneID:9698338"
                     /translation="MGLSFPSGDVGSLYSSLRRRIEQKKRQGAMYKDFIRKIYDLEDE
                     LDFISSEEQKNMVEGTKRRRRSTTLDVDEILYITGDEIAKDLRRILEGEDLDVFVENN
                     TLNVKGSMFTKGDKIKATINGDEFVGTIISMSEEDIVLKTKHYKRLRILLEDMRLAKS
                     SIVAIGRTNH"
     gene            complement(<14690..>15292)
                     /locus_tag="Eint_090110"
                     /db_xref="GeneID:9698339"
     mRNA            complement(<14690..>15292)
                     /locus_tag="Eint_090110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073455.2"
                     /db_xref="GeneID:9698339"
     CDS             complement(14690..15292)
                     /locus_tag="Eint_090110"
                     /note="similar to ECU09_0120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073501.2"
                     /db_xref="GeneID:9698339"
                     /translation="MSSYLEKVEKIIGDFEGEDKEMLIKYYIEKSKSILLDEREVKRS
                     KFDLLSDLCAVGGEGTDNIMNDVLDHKILQIRALILDLVDDDYTSDRKVIGRPEKWIK
                     QITRDAEETFNFDDEFGKEVFSIYNRKLLSEFCKIFISENRKFGASGNQLLLNFCYYE
                     RFVRSKMEFNFQGFFNKITSFFKGHCYKSKEELERILDKR"
     gene            <15471..>16928
                     /locus_tag="Eint_090120"
                     /db_xref="GeneID:9698340"
     mRNA            join(<15471..15477,15511..>16928)
                     /locus_tag="Eint_090120"
                     /product="protein transport protein Sec61 subunit alpha"
                     /transcript_id="XM_003073456.2"
                     /db_xref="GeneID:9698340"
     CDS             join(15471..15477,15511..16928)
                     /locus_tag="Eint_090120"
                     /note="similar to ECU09_0130"
                     /codon_start=1
                     /product="protein transport protein Sec61 subunit alpha"
                     /protein_id="XP_003073502.2"
                     /db_xref="GeneID:9698340"
                     /translation="MSYNLLHIVKPLVPYIPDVQSPSRTITFHERFIWTTLAILIYLI
                     SSQVPLFGIISNDAADPLQWMRAMMASNRGTLMDLGTSPVVTSSLIMQFLTMSEILKV
                     DWSIKEDKNLHNATQRLISLIMTVGQAFVQVYTGFYGSPKSLGTIYCLLLVVQLIFSG
                     IIIILLDELLQKGYGLGNGVNLFIATNVCESIVWKAFSPKVLFTGRGIEFEGSVIALF
                     HLLVVRKNKFAAIYEAFFRQNLPNLFSLLSTVFLFAFVIYLQGMRVELPTESSQVRGH
                     VAKFPIKLLYTSTMPIIAQNYIVGHISSISSFLYKRWPQYLFVRILGVWNTSKTGRYT
                     PISGLSYYITSPESLLEGLKDPLRFVIYLSIMLLTSAILSTSWLELNELSPEKAAQKL
                     KESRMRLKGVRETNTVHVLSRYIPTAAFLGGILTSMVVIMSNLFDTIGSGTNIFLATS
                     IVNQYLEMFAKESIQKNSEIGFIE"
     gene            <16990..>17985
                     /locus_tag="Eint_090130"
                     /db_xref="GeneID:9698341"
     mRNA            <16990..>17985
                     /locus_tag="Eint_090130"
                     /product="O-sialoglycoportein endopeptidase"
                     /transcript_id="XM_003073457.2"
                     /db_xref="GeneID:9698341"
     CDS             16990..17985
                     /locus_tag="Eint_090130"
                     /note="similar to ECU09_0140"
                     /codon_start=1
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="XP_003073503.2"
                     /db_xref="GeneID:9698341"
                     /translation="MIAMGLEGSANKLGIGIMKDNEILANERLTYAPPPGEGFIPAKT
                     AEHHRSKILGLIAMSLEKAGINLNDIDIFCYTKGPGMGQPLAVVATVARTMSLYCNKP
                     LVPVNHCIGHIEMGRFITKAKNPVILYVSGGNTQIIAYYNKRYKIFGETLDIAVGNCI
                     DRFARALKLPNFPAPGLSVERYARLGKNYIELPYVVKGMDVSFSGILSNIKSKIVDDE
                     QLKYDLCYSLQETVFSALVEVTERAMAFSNSKEVLIVGGVGCNLRLQEMMNIMARERG
                     GTCYATDERFCIDNGLMIAHAGMLMAKSGASFSLDECFVTQRYRTDSIDVVWRDD"
     gene            complement(<18016..>20406)
                     /locus_tag="Eint_090140"
                     /db_xref="GeneID:9698327"
     mRNA            complement(<18016..>20406)
                     /locus_tag="Eint_090140"
                     /product="HrpA-like helicase"
                     /transcript_id="XM_003073458.2"
                     /db_xref="GeneID:9698327"
     CDS             complement(18016..20406)
                     /locus_tag="Eint_090140"
                     /note="similar to ECU09_0150"
                     /codon_start=1
                     /product="HrpA-like helicase"
                     /protein_id="XP_003073504.2"
                     /db_xref="GeneID:9698327"
                     /translation="MGYSKYRDTKRWEMRKMKAAGLSVEETYSDEDNHLAPDLVYKES
                     IDEFLGRKILDSTLKNRVEVEKPDTEIGKVAKRESVFLNMHPRSNTIPLIGEEISQEI
                     PKKLPIESFRSDLMKFIREHQVTVLVGETGSGKSTLVPKYLYQEGYGEKGIIGCTQPR
                     RAAAMNLASTLGSDMGSLVGYSIRFDNTVTRNTKIRYMTEGILLQELLGDKLLKKYSV
                     VILDEAHERSTNLDISMGLLKCVLKERKDLKLVIMSATIEAQKFSNYFGCSVFNIEGR
                     SFPVEIRYLSVNVDDYVEWAVKKILYIHENCDEGDILVFMTGKEDVEGVVGIVNHYAQ
                     NKRLSKEKEDGREMDLKALPFYSQLSEEAQSQVFLRERNVRRCIVSTNIAETSLTIPN
                     IGYVVDTGLQKISIYNYDTGESLVKIPVSRAGADQRAGRAGRTRPGVCYRMYTASTYE
                     NDLLPSSVPEIQRTNIHDVILLLLKHGVQDIFGFDFLDSLSRELIHNALFLLYRLGAV
                     CQKGLLTKSGEEMSELKLEPPLARMVINSINYGVVDEITSIVGMLSIYGLFDKDFDKS
                     SSLYHQSCDFITLLNIFNEFISSKNRNEWCNKVKVNGDALKKAMEIKKAVLMTLKGRG
                     IEISRARSLEQIQRCIVSSIYYNIAKRSNKGYVSLSNFRKCAIHPSSALKDNPCQYVL
                     FYKHLSTRAEYMYCCSDISPQVILEEAGDYYRDRNEILGAQKYPAYKSLGCEVYGEEN
                     LEYDLLGSLSSRARILDKKEISLGGSLYDRFEKWTEPEEDKEETVELPRKIRKPRL"
     gene            complement(<20449..>22992)
                     /locus_tag="Eint_090150"
                     /db_xref="GeneID:9698328"
     mRNA            complement(<20449..>22992)
                     /locus_tag="Eint_090150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073459.1"
                     /db_xref="GeneID:9698328"
     CDS             complement(20449..22992)
                     /locus_tag="Eint_090150"
                     /note="similar to ECU09_0160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073505.1"
                     /db_xref="GeneID:9698328"
                     /translation="MKNNGSEKDEDDFWKILSESDSEYEQEIGLLFRPRTEGVNPESK
                     IEGEGQKVEASNTSSEELEKNPGEIPWAEEDISDRSGKKEEEKKDPEETSSWEAKTQE
                     KSFSGDKLENKEEVMEMKEVRNESKFSRLEVSTKSEPVADSEVKISSVDEMDFLWDDD
                     EEFILEGVSNVKIEKEASNGKEDLQDTPLQEKPCIEEETIIKEEETPESCGESKQIDS
                     TNLFIGSPTGLQSTKMDPMKPKPLSKFVCGNLITVFMSSQKRFNIQGEAIQSYINVSE
                     WYRPDYILPDIKPSNFVSSLERNGDVKYMHVYELVQLKTISIDNISRIVSDTKPVYCS
                     KDINRSISAESMNKLIELCIEDPDKAFEYAMENEIWEVGILLPKWSKGVGNKFLEKFC
                     NSSCVQLISLALGFSKCSFKLNGNWKAYIREVLSTKSININNDFILQVFDRSIPDALF
                     VIIASHLLGIGDINKYLWMFSKNFEALRVLCYVEHIFGHIKDLDLLKYEFVSVGIEFD
                     RQKAEEYFKANRKCFRKELGSSLESVFDTRWSFGLKSVFDFGIKKILNVDSFEDDLEK
                     NGVSAPKETSLGPIPSEPSRKDESISETASFDKKNRVTCIDSHETSVNTKEERGVLES
                     RAPEIKENDGVLNREEWIKKSDARKKDGMYRLSQEETLLKYDNQELETSDRELSVNSA
                     PCEIKERSNLYMDTKQSKSFADFFESNKKEEEIRSEDDTSLFLSKFMDDELPTSESKK
                     KESKKSGSFFGFLNMFKKETVHKANIDVDDDFRYDPVEKKWVGGSSNEGKSGDSPAVK
                     PREIPKPKIGVGRPAKNELDTNVTSMYANRKSAGNKRIPGVLGKKNNEN"
     gene            complement(<23117..>23713)
                     /locus_tag="Eint_090160"
                     /db_xref="GeneID:9698329"
     mRNA            complement(<23117..>23713)
                     /locus_tag="Eint_090160"
                     /product="GTP-binding protein"
                     /transcript_id="XM_003073460.1"
                     /db_xref="GeneID:9698329"
     CDS             complement(23117..23713)
                     /locus_tag="Eint_090160"
                     /note="similar to ECU09_0170"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_003073506.1"
                     /db_xref="GeneID:9698329"
                     /translation="MRSTYKIVFLGSSNVGKTTLMSQYLHQEVQRSYGPTIGLDFVST
                     TIVVSGHRVRLQLWDTAGQERFNSIIPNYTRNSFLAIIVFDMKDKASFERIDHWINTL
                     TKANDNPGSKVRILIVGNKKDLADEETQEWYKEVGSKKAKKHGGEYVETCAMKHEGIE
                     DLVKAVDRLIEEDLEDPAEDESTVRLESIKYVKGRRCC"
     gene            <23877..>25346
                     /locus_tag="Eint_090170"
                     /db_xref="GeneID:9698330"
     mRNA            <23877..>25346
                     /locus_tag="Eint_090170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073461.1"
                     /db_xref="GeneID:9698330"
     CDS             23877..25346
                     /locus_tag="Eint_090170"
                     /note="similar to ECU09_0180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073507.1"
                     /db_xref="GeneID:9698330"
                     /translation="MFLKKLLAIAAKNETLVHTTSAYTMYNTTFENKRATKLAFTQPP
                     VAYSFLRKIKHDNIVGIYKLNVEKGYLITKRLFPFCSVFRKETREFNKYISFKIAQAI
                     VFLHTQCGVVHGNIVKDSLFFNEEGGIVLGGFEKSRNSSVFDQDNIMFSNLVKELTNV
                     DTTLVKVAGDERFCSDIFLDLDIAFFGYKSFTTEQKLDFISKARKSKNEFVDIHKRRI
                     SWMILGDINSSTQKDFKILAVDFVLGFGVSDMEEFLPPLFSILDTGIRLYLLRNSDKY
                     ISRIVSLDPIIKSLSLGIKCKDKELREETIVFIKENINMISKKQQSEILETMHGYILD
                     DQGMQLVLKFLCDVRPVFKKTDVVYRILCKYLIQSKSKVKVLAAMEIFYETFDNFKMT
                     TELLPLLCGYLSNRHAQPAVFSLIEKVLEHLKEHKTEIVDKEWKIGNIKNIFKPRSPE
                     GQGTIPSGKVETPSEKSENELSQDHKEWKSPEDGWDDPW"
     gene            complement(<25462..>26724)
                     /locus_tag="Eint_090180"
                     /db_xref="GeneID:9698331"
     mRNA            complement(<25462..>26724)
                     /locus_tag="Eint_090180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073462.1"
                     /db_xref="GeneID:9698331"
     CDS             complement(25462..26724)
                     /locus_tag="Eint_090180"
                     /note="similar to ECU09_0190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073508.1"
                     /db_xref="GeneID:9698331"
                     /translation="MGNTQSSMNRDPVIARSNPSAPGVLRLYNLEDHVFPYKVAKSVE
                     SYPSVHLATSLSSFERLVSRHLPLSPRLEEITGKEMDIYHNVVNKEETAWEILTSGER
                     VTNIRHNSKEDRSQVYMCRQFVVEITEGIGEIRDLKILQACCNYLTRLPQHIGCLTNL
                     KVLVLSKNRIQKLPEEIGLLKNLRELNLSQNLLSSLPKGISALKALNALHIDNNLFVV
                     LPSVIGRLYGLKYLNVSNNKIQNIPLEILKLPFLIELAATSCNFTPEETVEYIGHVTL
                     KETCSRHLVRNNLNVRRSIDKPLIRYLLSVEECSFCGGPLFENYYLHRSMQTFDSERF
                     PIVYKLCVKHYVRHEDRITTLFLGPLKTYPQRLIKSNMPLVSELFNHFGYNDEQKRIF
                     NQGWSSEETDQMPLICLSKYAGMYIEKN"
     gene            <26976..>28175
                     /locus_tag="Eint_090190"
                     /db_xref="GeneID:9698332"
     mRNA            <26976..>28175
                     /locus_tag="Eint_090190"
                     /product="leucine-rich repeat-containing protein"
                     /transcript_id="XM_003073463.1"
                     /db_xref="GeneID:9698332"
     CDS             26976..28175
                     /locus_tag="Eint_090190"
                     /note="similar to ECU09_0200"
                     /codon_start=1
                     /product="leucine-rich repeat-containing protein"
                     /protein_id="XP_003073509.1"
                     /db_xref="GeneID:9698332"
                     /translation="MTEVTSADYSKQGYHEIPKTAYTTPINWLILSDNKIREVPESIK
                     ELKTLSRLALNDNRIEEIHPGIGSLVGLTWIDLTRNRLRSLPDEMSNLKRVSGLGLSE
                     NNFSEIPRCIFKMTNLRKFGFFSNKIRTIPKDIRFLINLIKIDLSNNEISSLPDEFCE
                     LKNLNWLNLSNNKLQKLPDGINNLVQLEELGLGANCLTELPDMSNLRKLRILPVFKNQ
                     LTHINQSISRLSSIEKLDFSDNNIIEFPGHVIGIPTLRYLNLKSNKISKIDPSTFRSR
                     VSSVSIIDVSDNLLSCIPLKFFKTFSNVTVIRVGENPFVYHESKPAPSPALTELCYNK
                     CLNMQYKCESWIRKRYPNVKSCDACSKLFTTQPHLGYSLSSVGDGSTFVVEKMLCSYG
                     CYKNEYK"
     gene            complement(<28199..>30349)
                     /locus_tag="Eint_090200"
                     /db_xref="GeneID:9698333"
     mRNA            complement(<28199..>30349)
                     /locus_tag="Eint_090200"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073464.1"
                     /db_xref="GeneID:9698333"
     CDS             complement(28199..30349)
                     /locus_tag="Eint_090200"
                     /note="similar to ECU09_0210"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073510.1"
                     /db_xref="GeneID:9698333"
                     /translation="MENLKRTKRTETQNKTFRMYLKLKEMPQGSCVDEDVLQHLVRNM
                     ELRKEVLDTLLGVIEVLRINAPRCFLSKEEKRRFFKLLIEVLPKEKINLETFITYRIP
                     SLLTDKDLISKLSGLIGVVSGTAKKYLKEIIIILIEEGTEDTTREVIRSVLLHIPKDP
                     EISSIIEVTKEISMPAVALIMENFEDKVYADVYSNLSFREHLCVRNIRGQGKLKYLTA
                     AMTEENFEKLCNFYIGDKDKRVIKILAENCSPKHDEIFHKILSNCNEDIRATLLEKTS
                     FKDIIEYSLDIYERILDTSHKVRAVAFNIFRSGMDLCRNLLLEIVESSEENQKNYTKA
                     GSERECLLRLIEFILRGVFTSQRKEYIDLLNEFDLPWEFYFRIKSFKGTDVFLEQSLE
                     KIKKEKGEPPECREKRRFYLKYFFCGELSKQKINELIRTDIQSALVYLQGKDIKEYRD
                     LLVGRALANNSTEEVLMIVDMIKAHLKDQVWPSCPKSDAELLVYAHSKHSSIFVRQVL
                     DFDVTFPMLYFLSYMRIPVDVLLPLLLKYKGSSKEHVEIQLGYNDKRLLQEFIEYFME
                     ISLDEDSKIKLVRSRTFVGSMIYFVNTGYVNIKNIDFFISSIYFICTSSNNEAKVKHI
                     YEIYSMKVDQGTFNRFYTVCLKLKGMSLNKEPYEIDDGTVLIKRNDRILFLICETVLG
                     VREGNVVDEKFNLQAFFHPISENVQSMISSGRVV"
     gene            <30410..>31207
                     /locus_tag="Eint_090210"
                     /db_xref="GeneID:9698334"
     mRNA            <30410..>31207
                     /locus_tag="Eint_090210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073465.1"
                     /db_xref="GeneID:9698334"
     CDS             30410..31207
                     /locus_tag="Eint_090210"
                     /note="similar to ECU09_0220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073511.1"
                     /db_xref="GeneID:9698334"
                     /translation="MPNSRGLKRLYDSFFCSRTIYLREEETLAIKSFLHSKRPVLHIC
                     GNPGTGKTHVTVNTIEGSFLYLNYYSESDIFSKIKNSNSPVVVIDEFDKYYNERRNEC
                     MQAMHYLRSRQKLITISNDLRMSGDVLFFRPYSSSDMEKILAQKTLKESAEAILSPIA
                     IKIVSKRIGPSGDLRQLFRYVQEIVGRKIMEGGSLEIDLEDIPLEKENLDSKPNNVHH
                     SIITSLISKNKKASRMEIYSKYLRECQEMKISSHDRTDFNIIYDIYT"
     gene            complement(<31231..>32058)
                     /locus_tag="Eint_090220"
                     /db_xref="GeneID:9698342"
     mRNA            complement(<31231..>32058)
                     /locus_tag="Eint_090220"
                     /product="DHHC zinc finger domain-containing protein"
                     /transcript_id="XM_003073466.1"
                     /db_xref="GeneID:9698342"
     CDS             complement(31231..32058)
                     /locus_tag="Eint_090220"
                     /note="similar to ECU09_0230"
                     /codon_start=1
                     /product="DHHC zinc finger domain-containing protein"
                     /protein_id="XP_003073512.1"
                     /db_xref="GeneID:9698342"
                     /translation="MGKIRPNFRMTLLISSLAFTYIAPLSEIILPAHFTFKGTYVVLL
                     LLSSTLSAIYLMLSILYRGHVESNSEAINLIDHDEIKRFCKKCRNHKPERAHHCSSCG
                     HCIKKMDHHCFWINNCVNYDNQGHFIRFLFFTALANWLIFLYMSIEFIAVLLFNKPLR
                     HRRDYYILVISGISSLVFLVMTSFFFYLQLRLALMNMTFIEEMKQEDMNKIQGLTTLR
                     SPYDRGIINNLIDTLGPPYALFLIGPFGDGMTFAKRHPIEHWKLQYDYHCIEDLIVI"
     gene            complement(<32150..>32968)
                     /locus_tag="Eint_090230"
                     /db_xref="GeneID:9698343"
     mRNA            complement(<32150..>32968)
                     /locus_tag="Eint_090230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073467.1"
                     /db_xref="GeneID:9698343"
     CDS             complement(32150..32968)
                     /locus_tag="Eint_090230"
                     /note="similar to ECU09_0240"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073513.1"
                     /db_xref="GeneID:9698343"
                     /translation="MEGTWNHNVKDEDGGKLNRSSGIDEKIDILSKVSDNPFDVLSRS
                     LYKKIKISNEECPVGDNRMEDAIFEELLVRNKEKPKVEDEKILYGIFTSMVLMADIEI
                     QAQEQKMYKFPFELETKNDGSPLFRRMYSEYLIAIKSAFREYKKNNTKFCVKLKNNFL
                     LFDSCLKATAGLKKELIRNEIVFEEEGSFLIIKGLEIALVFDYIVNIPISSSFCIPFI
                     LSQNPFENGILFSVKLQKKRAIREGKRILYSYELLGPFWADDYKDLIPFCTKIT"
     gene            <33061..>34317
                     /locus_tag="Eint_090240"
                     /db_xref="GeneID:9698344"
     mRNA            <33061..>34317
                     /locus_tag="Eint_090240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073468.1"
                     /db_xref="GeneID:9698344"
     CDS             33061..34317
                     /locus_tag="Eint_090240"
                     /note="similar to ECU09_0250"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073514.1"
                     /db_xref="GeneID:9698344"
                     /translation="MPGLVGGILEDYGNIPQKIGFFLGKRNGSTIEYIVQNTSLTYSQ
                     VMHGLSLMIQRRLVRYFQYEKKVHYVLDVDMVYRRMYFGIYCNLIEDMFGADAAEKFM
                     EVLIDGFSKADIFLEEKIREIIDAGMIIPIGRKEASLLVAGARDPTEWMRRARMEKEE
                     EKTERKNRKTEEIQRFYIVDFGLLDSILINNMLLSFVRKRYLSKAEKIYRSILKCNLV
                     SIDSIIGSFEEETSISRGDITSCIKYFSNCGLLQKSLDCSETYFKDEDSVKEILVVDI
                     LNRILSENSKEGQRIFNMMLEYKTLEDKDIVIKSLIPSYMVKKSLIMLHSKGFVVLKR
                     TESGESKPVLQWEVNTGRASKVVREEIKEMLEVSWASVNQRWKYIGLNGDGEDEGYKA
                     LDHMLGLSLDFFILGVRNMDFKSEMF"
     gene            <34353..>35555
                     /locus_tag="Eint_090250"
                     /db_xref="GeneID:9698345"
     mRNA            <34353..>35555
                     /locus_tag="Eint_090250"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073469.1"
                     /db_xref="GeneID:9698345"
     CDS             34353..35555
                     /locus_tag="Eint_090250"
                     /note="similar to ECU09_0260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073515.1"
                     /db_xref="GeneID:9698345"
                     /translation="MAKSLEQALLRISELEEKIENQQIIIDALVARMKKMAGSDTSIA
                     LEKCCKEQEECNPRKEISQDMVRLEFRKEEGKKDRKDGLSFEEEIEDLFRRDKVPKQF
                     KDTFTIEALISYSKESHSFSLNSRVDVKMKKSFHTNVKQQIDKISRHIMVNLNTYDLN
                     TICSTLNLISGDLEYQHKLVTAHDIILFIDDFSRIPFIISALFNNQGIRNDVLGETIK
                     EILLHQCMVDSDIHKNHPHIVSYYNKIVSNFELHPKEKSLKDICANLVVSFDVFENGA
                     FNPMIFPSMYSVRALCHYMDWDYAYNEFICTVLYPRLRETRDPLCAIYMSTVALNAMR
                     VFGAIESVELVFEKLKEFMNDASDLSITIYLFIKQIDPQRANVWYESQVERINHVDGE
                     YLKNLLLY"
     gene            <35613..>36530
                     /locus_tag="Eint_090260"
                     /db_xref="GeneID:9698346"
     mRNA            <35613..>36530
                     /locus_tag="Eint_090260"
                     /product="TAF4 transcription initiation factor TFIID
                     component"
                     /transcript_id="XM_003073470.1"
                     /db_xref="GeneID:9698346"
     CDS             35613..36530
                     /locus_tag="Eint_090260"
                     /note="similar to ECU09_0270"
                     /codon_start=1
                     /product="TAF4 transcription initiation factor TFIID
                     component"
                     /protein_id="XP_003073516.1"
                     /db_xref="GeneID:9698346"
                     /translation="MNKEAFERLPQEKKKIIETAYFSAVRKEISASQFFGVCKEALTK
                     DQFESLFSNNTPNKEQQEEMKTEHLQDIIQYSGVDLKEEAEHIVRETETNINFGEYEE
                     EDLNNQIGSLLNIPLFREFVARIGNSRRVGISEESFFLLFQVVKRKILDIVEKMEESS
                     KWRVEYNLSEFIIRINNDLSRQLWCLEQIEKAELEKFTIRKGEEEGRKKVKKTIQERE
                     DLVIKKRLSNTVALAALGIQQKSWMSAEDVRVNEESTTFNSIYSPFDEKALERKVVNR
                     TITMKDFLYVLERDRRYNKSIFTIQHYFR"
     gene            <36603..>36890
                     /locus_tag="Eint_090265"
                     /db_xref="GeneID:20314081"
     mRNA            <36603..>36890
                     /locus_tag="Eint_090265"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163627.1"
                     /db_xref="GeneID:20314081"
     CDS             36603..36890
                     /locus_tag="Eint_090265"
                     /note="similar to ECU09_0275"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161891.1"
                     /db_xref="GeneID:20314081"
                     /translation="MDKESLEKFEAQISVLSSKEIEKVMKRLSKDEFDVFIEILERHN
                     MDLDRDLEHGKNELLQRLENHRILFEDAWNAIPDGVRKHLTGYYQSMNDIL"
     gene            <36982..>38016
                     /locus_tag="Eint_090270"
                     /db_xref="GeneID:9698347"
     mRNA            <36982..>38016
                     /locus_tag="Eint_090270"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073471.1"
                     /db_xref="GeneID:9698347"
     CDS             36982..38016
                     /locus_tag="Eint_090270"
                     /note="similar to ECU09_0280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073517.1"
                     /db_xref="GeneID:9698347"
                     /translation="MEDYIGIRLLFETSKGVISGMLRAVDENSGKLIIEDMNEMKDVL
                     IEDIQRLEIAEESSPNLSVGHNSKEEKRLENTPSIDVDSKGMAGKVVSGKHLVGYSSR
                     KENLDLVSEKSKSGQTDESRTSYENDDNVRSSSKVGSDRRRDGYNLETSEEDYYRMMG
                     RAFSYFGPLEEEFCSIAARQTYRIFSTYFNNSSLRVEVFVAGDDVFSSIGFILGRLLL
                     HTGKMSSIICNENLLRNTRYRQSYLNSGGVITNRPAPEPSIHIYSCNKSLVPAWARNN
                     IRGSIYLDMPGHNSEEKETKIGLCFGSIPAYHRRFNGIVYFVDIEYPAPLYEEFGLQK
                     PTRSKIHKVK"
     gene            complement(<38022..>39722)
                     /locus_tag="Eint_090280"
                     /db_xref="GeneID:9698348"
     mRNA            complement(<38022..>39722)
                     /locus_tag="Eint_090280"
                     /product="Ca2+-binding actin-bundling protein
                     fimbrin/plastin"
                     /transcript_id="XM_003073472.1"
                     /db_xref="GeneID:9698348"
     CDS             complement(38022..39722)
                     /locus_tag="Eint_090280"
                     /note="similar to ECU09_0290"
                     /codon_start=1
                     /product="Ca2+-binding actin-bundling protein
                     fimbrin/plastin"
                     /protein_id="XP_003073518.1"
                     /db_xref="GeneID:9698348"
                     /translation="MTQQEEKEWQEVQKKTFTKWVNEKLVKGGHKEIGDIFEDLCDGV
                     KLAHLLTALQKDVVEYNPAPCTRIQKMENVERILSFIKGKKVKLINIGPADIVDGNPK
                     LILGLVWSLILRLSIAEITEAGELSIRNELLRWCKEVTNGYKNVNVVDFSRSWQDGLA
                     FNAIIHRFRPDLVPNFHELKPSKKAYNLSQAFRIAEKSLNIKKLLDVEDIAEVSIPDE
                     KSIMTYVSGYYRKFKEYEKEKLALNRVKGVLEAVDWSIQARNLYEVKARSLRSLIQDL
                     SNQKKEVCKMIRSLNKAFELMLETNSKAMHESTEIHSLFGSINAIHDLYRIKRYFPPE
                     DVSLDKLEFPSLHPESIANSIEIKKLFDPSFQSEFDALNRIFEFFKHVFAKGENMKEQ
                     MQGTSELKSRLMEMTFTHPLTKTQKEGFKNIAAKKLETLEKILSKREKEDKILESATA
                     LFNKAVKKNECGISPMDLCWCLSQLGLSVDEGMVPFGNPEGRISLEDYLLIVKEMHNT
                     LFDSVELKKAFEMFSVDDILDLKSLNIEGKDLRNLYDSNGEEEPSLSVSKFFENFIEN
                     "
     gene            complement(<39830..>40864)
                     /locus_tag="Eint_090290"
                     /db_xref="GeneID:9698349"
     mRNA            complement(<39830..>40864)
                     /locus_tag="Eint_090290"
                     /product="RhoGAP domain-containing protein"
                     /transcript_id="XM_003073473.1"
                     /db_xref="GeneID:9698349"
     CDS             complement(39830..40864)
                     /locus_tag="Eint_090290"
                     /note="similar to ECU09_0300"
                     /codon_start=1
                     /product="RhoGAP domain-containing protein"
                     /protein_id="XP_003073519.1"
                     /db_xref="GeneID:9698349"
                     /translation="MMLRDFPKKRKIFNIAEMKEIEETYSRTDESLPESRVSSSTCSQ
                     ECSPQVILQPISENDRILGKSLKDNSFPGSIRSFNARLYEDLFSSTTIQGRRKSSIFP
                     FIGVEGESREFRYDLLSTAQKIELNRFCCNAFRKRTTNTLFAWMNCFQKKRRIGHCRQ
                     INPMVFDVIESLKRRAISTKFIFRYEPDKLSAAKIARQLHENKCTDIESIDVLVLANA
                     LKNYIREHLDGLVPIEAFERIRSCIISNDRHAREALFSYMPFIFTDTERKLLVSLFEL
                     LSMIDRNSGVTEMNIDSLLGLFSLVLHPQAAFTTLDDLEYVKTITRELYRLDFETIPQ
                     AVVVHELIFV"
     gene            <41038..>43482
                     /locus_tag="Eint_090300"
                     /db_xref="GeneID:9698350"
     mRNA            <41038..>43482
                     /locus_tag="Eint_090300"
                     /product="telomerase reverse transcriptase"
                     /transcript_id="XM_003073474.1"
                     /db_xref="GeneID:9698350"
     CDS             41038..43482
                     /locus_tag="Eint_090300"
                     /note="similar to ECU09_0310"
                     /codon_start=1
                     /product="telomerase reverse transcriptase"
                     /protein_id="XP_003073520.1"
                     /db_xref="GeneID:9698350"
                     /translation="MPKLLKNFGFSSLRKFLAAYDIPDLPNIVDRVYIKADRKPSISS
                     FDCKLKEIELISKAIRMLLSRDKENHLCAGYKRWSSGPHDSDFRILCYSPSASSKILR
                     SHEWSHLMKSIGDELAFFILTECLVIQMLNGSYIFLAGDFKSLSKMAIERGSNAINRS
                     VIFYKHNQKISFSSLSAFEYVFEAHNSEKYKTIQRDTRDILESIEKRWKKIPIHSMFR
                     SFFKDELTLEGKGNILECSVKQSKLVNFLFLISKKLLKDAFDSHAFRILKSKLSLLVH
                     RNRYETVSKNEIAKYFRISRFKFFRAYRCRRSEFIFRSKISSRFLVYVMEKLMIPIIS
                     RHFHSTETSFSKFKVHYFPRPIWQHFSDIYIERFLKRFEQVEENKTYPYSELRCIPKM
                     SGARVISNMSRIRNGRPSINRNIYPEFCVLREETRGMLGNSILNHSGMYEKLIPYLIK
                     STKPLYILKVDLSGCFDNIPQDEVVNLVKRLLSKSRYCTRSFSTLGEANGELKNRYVC
                     KTTDVTEAIDRLTMESSVFGNRIVKENSNQRILSREEIEGTMINIIKRNYVRYKGKFF
                     IQKTGLAQGCVASTLLCSLYYKRIDDLYFDKVFKEGILTRYADDFLVVSPSLDEIMKF
                     LEVSQSISHLGVNFSKEKIESNFGLEEYFKNTSNISELSEHKNKMKITDKPIKWCGTK
                     IYPNKFSIKSCTMDPYLPFSTAHSSTRPGKALELRMRKLLRNRMSRIYIDPNNKKAYE
                     NLYDTFLFCGKKACLLLKRMDFINCSFAQRILECSKHFAFKVCRKNGISITKKKIEDI
                     ASKAFKKSGISKVISA"
     gene            complement(<43564..>44865)
                     /locus_tag="Eint_090310"
                     /db_xref="GeneID:9698351"
     mRNA            complement(<43564..>44865)
                     /locus_tag="Eint_090310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073475.2"
                     /db_xref="GeneID:9698351"
     CDS             complement(43564..44865)
                     /locus_tag="Eint_090310"
                     /note="similar to ECU09_0320"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073521.2"
                     /db_xref="GeneID:9698351"
                     /translation="MEDGIACLEVNFDDEIDVGMPVNYIYTSARKYVQKCISSYEDHE
                     EKAREKYTMEDENNYKRRAGHDTMARMNIERILFVKTNGWERKIRINYNIFKSSLHFV
                     MGFSDFLKELAILSEGLMVQIDGVDKSLFLGFLLDSFNLFGDVEEMIDGFRPVRLTPV
                     QRSGLTSQEMLRTLFLLQNPDDRMRLFLSFNVFAISIYHGDRYIGYLLDGLYRKIVAK
                     ILFEKKDFDGCLLEGGYRDSLHSGVRLDMKRYMGAKSLLNALYLLFDIFNVDDISLRN
                     ILHIVLMFMSKEKGTGLVNFLGLNDLFICAVRSICGDSVPSHLLMMACRDKLNMKYKV
                     GAMKLSIDYVYNWIYKPHLTIMMPRWFLHSRDGRRGVPVLGRPIETVSNKITMELTSD
                     DKEHSNARGPAYSPLSRRLSGGLRDKSPERFRSKQRLDFES"
     gene            <45127..>45855
                     /locus_tag="Eint_090320"
                     /db_xref="GeneID:9698352"
     mRNA            <45127..>45855
                     /locus_tag="Eint_090320"
                     /product="proteasome regulatory subunit alpha-3"
                     /transcript_id="XM_003073476.1"
                     /db_xref="GeneID:9698352"
     CDS             45127..45855
                     /locus_tag="Eint_090320"
                     /note="similar to ECU09_0330"
                     /codon_start=1
                     /product="proteasome regulatory subunit alpha-3"
                     /protein_id="XP_003073522.1"
                     /db_xref="GeneID:9698352"
                     /translation="MSNLDFCTIYTTTGQIDQLSYAQKAADSGDTCIGIKSRNGIVLL
                     AEKPRISPLYVLESDERIKRAGNSVAVVSTGLTPDVFYVGCAVKDHVFHHKENFNEDP
                     TPEIMKVYLNDIFHYFTRSINLRVLGVNSLASVYKEGRFSLLHTDCSGKTLSYKAACI
                     GKGTRRIKTELEKLDIDNMTIEEMVDTGVKVLYMAHDPSKDKEFDIEVGIVSTETGGK
                     LRKLESNEIQIFVDKHKHMSVDED"
     gene            <45907..>46689
                     /locus_tag="Eint_090330"
                     /db_xref="GeneID:9698353"
     mRNA            <45907..>46689
                     /locus_tag="Eint_090330"
                     /product="RING zinc finger domain-containing protein"
                     /transcript_id="XM_003073477.1"
                     /db_xref="GeneID:9698353"
     CDS             45907..46689
                     /locus_tag="Eint_090330"
                     /note="similar to ECU09_0340"
                     /codon_start=1
                     /product="RING zinc finger domain-containing protein"
                     /protein_id="XP_003073523.1"
                     /db_xref="GeneID:9698353"
                     /translation="MTSVINYRFRSNKNFSRIVFQGTGLPLWELKYEIINQRKMVSKD
                     FDLLFFDGETDEEINDEYQIISMNSHVIVNRIPLWMSKGGYNVKEKRLESQTHHHNTQ
                     RHGKTVPESYVCFRCGQKGHYIQNCHTNQDKAFDILRIRKPSGIPKDFLVPVSGESVP
                     TNAAMLVTPEGGYVKAQPQVQEWKKYKQRTKMTVEIPDRLKCPLCHCLLVNPMRTNCG
                     HTFCDQCVGIDRKCYVCSKVVENFTQDIAMKVEVEKAIEQRR"
     gene            complement(<46785..>48128)
                     /locus_tag="Eint_090340"
                     /db_xref="GeneID:9698354"
     mRNA            complement(<46785..>48128)
                     /locus_tag="Eint_090340"
                     /product="nuclear pre-ribosomes export protein"
                     /transcript_id="XM_003073478.2"
                     /db_xref="GeneID:9698354"
     CDS             complement(46785..48128)
                     /locus_tag="Eint_090340"
                     /note="similar to ECU09_0350"
                     /codon_start=1
                     /product="nuclear pre-ribosomes export protein"
                     /protein_id="XP_003073524.2"
                     /db_xref="GeneID:9698354"
                     /translation="MDQQKSKIGSICTKIIENPQENLDMMEGIFEMLRNGSFEGKAKG
                     MVYLSLFKVFKAVIPLYKVRSLKDVVKDKRDALHLKDHDKNLLKWYTSYVKTMVDDIS
                     NESYISLCEVLQHFDHFNATDKIVSGVLRGSLGKGSVPMMCCNTIKLKLRSDCSGELI
                     ATILDQMLDFEYNPLILEYLLDIPFVNNSLKSDEEKAKEYWEANRGVSRRDKNSIFHR
                     KRIFNKKLKKMEKERLSLQSEVKDEEDIEGRIEEMKSCKRIYDAIQRLYFTVLKGDRY
                     ECYKYVFMGLVKYRKILRPGFMEGLYFLLNNSLSKIPSDAKVQGILSILTLYEDECYD
                     FNGLVDLLYSMIHPINPEIVDNDELVKVIRFLFIKIRQPIHRAHVLLKRLILCCCSRS
                     VPEFRSLIKDISAYYDIEFSDCTNPRCREFDQDSTHVDSIPDNPFFEYFLYKNIL"
     gene            complement(<48258..>48611)
                     /locus_tag="Eint_090350"
                     /db_xref="GeneID:9698355"
     mRNA            complement(<48258..>48611)
                     /locus_tag="Eint_090350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073479.1"
                     /db_xref="GeneID:9698355"
     CDS             complement(48258..48611)
                     /locus_tag="Eint_090350"
                     /note="similar to ECU09_0360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073525.1"
                     /db_xref="GeneID:9698355"
                     /translation="MEENTAENSIPNTEARPGDIRIGEVSGEDTLVLYLSQGTGNTGE
                     QCNQNGRCESDISKCKKHKASNCICLSKIHYEIDGDVLCIREMKPFIYISKISILCQC
                     SPSKQKIDNEARIEP"
     gene            <48771..>49448
                     /locus_tag="Eint_090360"
                     /db_xref="GeneID:9698356"
     mRNA            <48771..>49448
                     /locus_tag="Eint_090360"
                     /product="putative nucleic acid-binding protein"
                     /transcript_id="XM_003073480.1"
                     /db_xref="GeneID:9698356"
     CDS             48771..49448
                     /locus_tag="Eint_090360"
                     /note="similar to ECU09_0370"
                     /codon_start=1
                     /product="putative nucleic acid-binding protein"
                     /protein_id="XP_003073526.1"
                     /db_xref="GeneID:9698356"
                     /translation="MIAVIDTGYFIERQIPTDKVIRGYVTDSVINELKTAESEEYLKF
                     FSFMIEVRNPSEEYVEKVRRDLRKEVNNLSNTDIEVVALTLELKDEVSEMWVGPESQN
                     QEEVVCFTNDNGIKNALLRYTIYESSMFSSRKYKVRCYGCFSLFSENLDFCKKCGHRT
                     LTRIAVGDTENGEVMFFKKGYEYRKPKTLKNAKGVELRSADQREYVQYQKNLKSKSNR
                     SQRGLDF"
     gene            complement(<49458..>49772)
                     /locus_tag="Eint_090370"
                     /db_xref="GeneID:9698357"
     mRNA            complement(<49458..>49772)
                     /locus_tag="Eint_090370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073481.1"
                     /db_xref="GeneID:9698357"
     CDS             complement(49458..49772)
                     /locus_tag="Eint_090370"
                     /note="similar to ECU09_0380"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073527.1"
                     /db_xref="GeneID:9698357"
                     /translation="MGYRNNILTVCKKIKVDGGKQAPAKILDLQNVSDIAALINLSTE
                     ERRMKLISKYVSILSEFILNKAKEISGKRQKQEVSADDIKKVIVSEGLFFLYDIISLN
                     KQ"
     gene            <49877..>50806
                     /locus_tag="Eint_090380"
                     /db_xref="GeneID:9698358"
     mRNA            <49877..>50806
                     /locus_tag="Eint_090380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073482.2"
                     /db_xref="GeneID:9698358"
     CDS             49877..50806
                     /locus_tag="Eint_090380"
                     /note="similar to ECU09_0390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073528.2"
                     /db_xref="GeneID:9698358"
                     /translation="MKGKDLKEEIKESSGENRVMFGNPTKRLACIGMNWRNINVKDLF
                     KIFNSILLGSSPLSVKLCKTKIGRERLGDNNIFVKSCEEGRIDECYTAVAEFEDVDDS
                     KHIYTACDGVRLGNSGMVFDLRFVPDSLDLQNVCDEAFNDDGCEEKDFVVREKKEEED
                     DSEIESRLEKLFKEKEINFDLVSELVDMSDDENISGLQDHLPISSENEKSKFLESSSD
                     DFNDEISEDKEIENKKAKKKESSKKDIETIPRGKPIDECDGFMFDPKDKRFEAIFEDE
                     DFAIDPTHPEYKRKGGLKEILDEKRKRIKDNID"
     gene            complement(<50871..>51060)
                     /locus_tag="Eint_090390"
                     /db_xref="GeneID:9698359"
     mRNA            complement(join(<50871..51026,51058..>51060))
                     /locus_tag="Eint_090390"
                     /product="60S ribosomal protein L39"
                     /transcript_id="XM_003073483.1"
                     /db_xref="GeneID:9698359"
     CDS             complement(join(50871..51026,51058..51060))
                     /locus_tag="Eint_090390"
                     /note="similar to ECU09_0395"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="XP_003073529.1"
                     /db_xref="GeneID:9698359"
                     /translation="MGSRKTALVKTRLMRALKRNREIPAWKRMMKEHKGEYNKARRHW
                     RSKKLKIY"
     exon            complement(<50871..51026)
                     /locus_tag="Eint_090390"
                     /number=2
     exon            complement(51058..>51060)
                     /locus_tag="Eint_090390"
                     /number=1
     gene            complement(<51128..>52228)
                     /locus_tag="Eint_090400"
                     /db_xref="GeneID:9698360"
     mRNA            complement(<51128..>52228)
                     /locus_tag="Eint_090400"
                     /product="mRNA capping enzyme subunit alpha"
                     /transcript_id="XM_003073484.1"
                     /db_xref="GeneID:9698360"
     CDS             complement(51128..52228)
                     /locus_tag="Eint_090400"
                     /note="similar to ECU09_0400"
                     /codon_start=1
                     /product="mRNA capping enzyme subunit alpha"
                     /protein_id="XP_003073530.1"
                     /db_xref="GeneID:9698360"
                     /translation="MELLHLGNKVPSEEAEALRIGIYQKLCIAGAKKRERFPGCHPVS
                     LTLDNIDLLLSKDFLVCEKSDGIRALLLVTEKMGISKGYFYDRKNDFYELDMNFPFSS
                     TVLIDGEIFLEDGTVTTYAIFDCLIYEDAPQILKNLYKRLGYAQMFVDRMKGSVEKTK
                     ALKKEDEDGFEPKRIPIGAEGQEPGCISIHFYVKQMMKSYGFWEVYKKIPDLKHGNDG
                     LIFTPTDEPYSVGKRGVILKWKPTFLNTIDFKITKAKEFGHVYDLVCSGKRGKDVVFG
                     HFFCEDEEVDGKIGEFLYDNDGYYWDLDEFVLRKGGWKLYRIREDKDTPNNIRVVCSI
                     LESLKDSLTIEKLCTFYNAMRENSKKREQMKK"
     gene            complement(52281..52430)
                     /locus_tag="Eint_090410"
                     /db_xref="GeneID:9698361"
     rRNA            complement(52281..52430)
                     /locus_tag="Eint_090410"
                     /product="5S rDNA"
                     /transcript_id="XR_002670147.1"
                     /db_xref="GeneID:9698361"
     gene            complement(<52494..>54560)
                     /locus_tag="Eint_090420"
                     /db_xref="GeneID:9698362"
     mRNA            complement(<52494..>54560)
                     /locus_tag="Eint_090420"
                     /product="DNA repair and recombination protein"
                     /transcript_id="XM_003073485.1"
                     /db_xref="GeneID:9698362"
     CDS             complement(52494..54560)
                     /locus_tag="Eint_090420"
                     /note="similar to ECU09_0410"
                     /codon_start=1
                     /product="DNA repair and recombination protein"
                     /protein_id="XP_003073531.1"
                     /db_xref="GeneID:9698362"
                     /translation="MDCKAEDYEKSFVEKYLERAASSKIDELKKKIEAHKGKGDMGKV
                     KDLEREIEEVKSRLAADKSIMCKKDSRKEEVEEKRNIDFEWSGMEDDKDIEVFNERCE
                     KSIEKYCNHMGIMKNEFQENLRKESSICEGFEIPDFLWNSLFEYQRDGVAWMLGLYKR
                     EKGGVLADDMGLGKTIQMIVFLAVLFHNKSIEKALILCPATIVSQWMAEWKRFYPFVR
                     VFFGFPAEDCRGVYLMSYEKFKARAKDLLWDTLVLDEGHKIKNRNAQITLSVKKVRSR
                     SRFVLSGTPIQNNLGELWSMFDFVNPGLLGSHTSFHEEFEEIIRRGGYKSASNLQVEK
                     AYRHSLMLRSLIEPYILRRTKSQISHKLPSKEDKIIFCTLTPIQIELYNRILESKHIM
                     KVLIGKANLLSGISMLRKVCNHPRLFIPRKEDGSEDLSEEASGEKNNEETLGLLKKEE
                     SQYGLVSSSCKIKILMDLLKKWKSEGNKVLVFSQTIRMLDIIEKCVEKYAYLRMDGRT
                     STSSRSSLVDRFNKDDSIFMFLLTTKVGGLGLNLTGASRIVIYDPDWNPSTDTQAKER
                     AWRYGQRKGVEIYRFICKDTIEEKVYQKQIFKDLLGKKVLSNPGLSRFFNKSCINELF
                     SFTATRGFAEVKTHEEDNDGEETGVLKKIRDRDFEVFSRIKTLNEKRILSGSEVLEYI
                     RLREKE"
     gene            complement(<54615..>55397)
                     /locus_tag="Eint_090430"
                     /db_xref="GeneID:9698363"
     mRNA            complement(<54615..>55397)
                     /locus_tag="Eint_090430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073486.1"
                     /db_xref="GeneID:9698363"
     CDS             complement(54615..55397)
                     /locus_tag="Eint_090430"
                     /note="similar to ECU09_0420"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073532.1"
                     /db_xref="GeneID:9698363"
                     /translation="MESLVNKLNKWYELKKEHTRLMHERREREVRRIVEEAKKTQNIE
                     MLLEILTTDADKCKDLEGFLTSEFKRSIAFNSKERINQIIKCMCILGLKREKPRLMMI
                     DHLESVYSKTRKPSTVSRIELLKKLQEYDETNGLKIHEYIENRIDEEVDEYVRKIPLE
                     APKELDRWLNEMVGVGRYRPRLLQMYKDLEIKYFTMCLGIVMLGDKESAVEDIVYLVN
                     KIRLRSNTVGVSIDNEVMEKLNECKMLWEEEIKALFHHCEQL"
     gene            <55461..>55667
                     /locus_tag="Eint_090435"
                     /db_xref="GeneID:20314082"
     mRNA            <55461..>55667
                     /locus_tag="Eint_090435"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163628.1"
                     /db_xref="GeneID:20314082"
     CDS             55461..55667
                     /locus_tag="Eint_090435"
                     /note="similar to ECU09_0425"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161892.1"
                     /db_xref="GeneID:20314082"
                     /translation="MASGQRDREDTLYESTFYEKKNNEEQRKNNGNSHYFLTKLQLNF
                     KSIFEGGKRFHSVENMHQNEETNS"
     gene            <55741..>58665
                     /locus_tag="Eint_090440"
                     /db_xref="GeneID:9698364"
     mRNA            <55741..>58665
                     /locus_tag="Eint_090440"
                     /product="DNA polymerase catalytic subunit delta"
                     /transcript_id="XM_003073487.2"
                     /db_xref="GeneID:9698364"
     CDS             55741..58665
                     /locus_tag="Eint_090440"
                     /note="similar to ECU09_0430"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit delta"
                     /protein_id="XP_003073533.2"
                     /db_xref="GeneID:9698364"
                     /translation="MKEEIVFCQTHIDFYMSDSGLSYPHPVFAIFGNIESGEPIQVLV
                     KNFFPYFYIETVNGKEYKEEDIKDSIQRLDIKATVVEVEATMKQTILGYTEGKSRFYK
                     LTLNTPHVSGALRAFLESGITIRREKVRFRVYESSFPFVLRFMCDLGIVGMSYLKVRK
                     YEVLDGKYLTVSTSYESLEPLPPVGVYAILPPLKVLSLDIECVSIGNAFPSSKTDPII
                     QIGNTLTMFGSDKYLSQDIFCLKETTGIPGVNVHWYETEKELLESWKKYFMELDPDII
                     IGYNVKGFDLPYILGRGEVLGIENFSILGRSKKKARTRDTTMSSNMFGSIMTTEVEIE
                     GRLIIDMMVVIRRDFKLRSYSLNSVSIHFLKEQKEDVPYSSIGELQSKDKDTRRRIAS
                     YCLRDTVLPLRLFSKLNVLINYAELSRVTGVPIEYFFTRGTAIKIFALIYRTASKEGF
                     VVPETDPFESGKKYEGGFVIEPKKGFYGKPISVMDFTSLYPSIMISHNLCYTTLLTKD
                     QYRILGGIRTPTDNYFCSPERKKGLLPRILVDLLDSRKKIKEELKKEKDPAVKACLNG
                     KQLAVKLCANSLYGFTGASKGKLPCFEISQSVTGFGREMIMLTKKLIEENFSKKNGYT
                     HDSVVIYGDTDSVMINFDEEDIKKVFEMSKEISEFVTSKFMKPVSLEFEKVYYPYLLI
                     NKKRYAGLLYSNPNTASKIDTKGIEAVRRDNCGLVKETVETVLEMILHEKNVEKAKQF
                     VRDVVRDLYLGRIDLSLLVISKSLTKSGEKYGSRQAHVELAEKLRKRDETTAPVLGDR
                     VPYVIVKKGKGIAAYEKSEDPVYVLENNLPIDTEYYIEQQLSKPMERIFEPVMDNVDE
                     LFKGDHTRVVQRASLKGPMNTFLKLADVCVGCRAEGKIICSNCRKDFHIHLQKMQQEV
                     ENKKERLNSCWVECQRCQGSIHNQVLCVNRDCPIFYMRTKVRKELIPLNEKLGKLRSF
                     EW"
     gene            complement(<58797..>59108)
                     /locus_tag="Eint_090450"
                     /db_xref="GeneID:9698365"
     mRNA            complement(<58797..>59108)
                     /locus_tag="Eint_090450"
                     /product="histone H4"
                     /transcript_id="XM_003073488.1"
                     /db_xref="GeneID:9698365"
     CDS             complement(58797..59108)
                     /locus_tag="Eint_090450"
                     /note="similar to ECU09_0440"
                     /codon_start=1
                     /product="histone H4"
                     /protein_id="XP_003073534.1"
                     /db_xref="GeneID:9698365"
                     /translation="MNTQSISAKGKSKAAKGIAKRHRKQSGLTDSISKPAIRRIARRA
                     GVRRVGGGCFKEINNAAREYIRDTLSIACIYSTHAKRKTITCSDILHSLKRMGIKYIG
                     Y"
     gene            <59436..>59858
                     /locus_tag="Eint_090460"
                     /db_xref="GeneID:9698366"
     mRNA            <59436..>59858
                     /locus_tag="Eint_090460"
                     /product="histone H3"
                     /transcript_id="XM_003073489.1"
                     /db_xref="GeneID:9698366"
     CDS             59436..59858
                     /locus_tag="Eint_090460"
                     /note="similar to ECU09_0450"
                     /codon_start=1
                     /product="histone H3"
                     /protein_id="XP_003073535.1"
                     /db_xref="GeneID:9698366"
                     /translation="MSRTKQTASKALGGKAPRKGMSMKSVPSSGSSSAVPKGTRFKAG
                     ALALKEIRKYQKSTDLLIRKRPFQRMVRELCKSGEGIRFQASAIVAFQEAVENFLTNL
                     VEDAYRCVLHAKRVTLMPKDICLVYKIKYANILYAALD"
     gene            <59939..>60595
                     /locus_tag="Eint_090470"
                     /db_xref="GeneID:9698367"
     mRNA            <59939..>60595
                     /locus_tag="Eint_090470"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073490.1"
                     /db_xref="GeneID:9698367"
     CDS             59939..60595
                     /locus_tag="Eint_090470"
                     /note="similar to ECU09_0460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073536.1"
                     /db_xref="GeneID:9698367"
                     /translation="MGDVVYIVHRQLERIPTIPEHARTVDLRRNNISVMALNKAESVE
                     YLDLSDNRIKVISDLENVPNLKVLDLSYNLITEISIPRMGLSELYLISNDISTIHGLD
                     LPCIKKLDMAVNDICQIENLENCATLEELYLGSNRIRTVEGLSELKDLKVLDLQNNEL
                     EVVDCSAVPCNVEVLLLGENRNLQMIENLESLKNLRILGLEKTRVPSDLFEGCFTVWR
                     "
     gene            <60676..>60804
                     /locus_tag="Eint_090475"
                     /db_xref="GeneID:20314083"
     mRNA            <60676..>60804
                     /locus_tag="Eint_090475"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163629.1"
                     /db_xref="GeneID:20314083"
     CDS             60676..60804
                     /locus_tag="Eint_090475"
                     /note="similar to ECU09_0465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161893.1"
                     /db_xref="GeneID:20314083"
                     /translation="MEECFEKENKKGWISIQDSMKRSNDFWLKDDDATSYLNRFVV"
     gene            <60906..>61235
                     /locus_tag="Eint_090480"
                     /db_xref="GeneID:9698368"
     mRNA            <60906..>61235
                     /locus_tag="Eint_090480"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073491.1"
                     /db_xref="GeneID:9698368"
     CDS             60906..61235
                     /locus_tag="Eint_090480"
                     /note="similar to ECU09_0470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073537.1"
                     /db_xref="GeneID:9698368"
                     /translation="MIGGRSILKFPFVGIRKGISGNAVPGLALSMAVLKPISVVMPKV
                     LTDNLYKGAMALATRPFCVGDKIKIDKYDGLVRDISFWYVTLERGKGYVFIPMSHVYN
                     TVVELFK"
     gene            complement(<61298..>62824)
                     /locus_tag="Eint_090490"
                     /db_xref="GeneID:9698369"
     mRNA            complement(<61298..>62824)
                     /locus_tag="Eint_090490"
                     /product="T complex protein 1 subunit beta"
                     /transcript_id="XM_003073492.1"
                     /db_xref="GeneID:9698369"
     CDS             complement(61298..62824)
                     /locus_tag="Eint_090490"
                     /note="similar to ECU09_0480"
                     /codon_start=1
                     /product="T complex protein 1 subunit beta"
                     /protein_id="XP_003073538.1"
                     /db_xref="GeneID:9698369"
                     /translation="MNIFSHANLGTTEEKGDDAKRTILAGTDIVGDILKTTLGPKGML
                     KMLKGQSVHVTNDGAFILKNLMIDSPSARILINSSTGQDWEEGDGTTSVAILASLLVK
                     EASKLEMHPTKILKGYRMAQARCSEVLKRISFNPSKEDLVKLARTTLCSKVLKYDLEK
                     FCNICVNAIENLGGRNDLNLVQVIKCSGKLEDSYLDDGFLLKKDVRIEEVNDPKILIA
                     NTSMDQDKIKIFGAKINVSSVGELEEMEKVEKGKIQEKVERISQNGINMFINRQLIYD
                     YPLQLLKIKGIQAIEHADFDGVERLSNVLGGKILSTFDSMDETCYGTCKNVKNVYIGN
                     ERAIKFSGVKSGASTIVLCGSSKEMLDEAERSVHDALCVLSKIKQDPRVVYGGGSSEM
                     AMAVDLNTYAMEVPGIESEAILAFSNALQQIPKILADNGGYDGEGIRASLRAEHNSGK
                     TSYGVNVRSGSVGCMKESGVVDSFRIKHRVVTAASEAAQMIIKCDAIVKCKPRERTRE
                     "
     gene            <62858..>64669
                     /locus_tag="Eint_090500"
                     /db_xref="GeneID:9698370"
     mRNA            <62858..>64669
                     /locus_tag="Eint_090500"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073493.1"
                     /db_xref="GeneID:9698370"
     CDS             62858..64669
                     /locus_tag="Eint_090500"
                     /note="similar to ECU09_0490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073539.1"
                     /db_xref="GeneID:9698370"
                     /translation="MNEELPVAPLVMKPTRIYNYTQLIACLKAKQQKLSRYKASIPPS
                     PFKGILGPKQCQFDVEDIVNGFLHEKLRARQREHEKSMDKMFSQCVRRHIKELKREND
                     LFVVGNSKIGGRIKALEDVFDKDFEDKEGANIAEMEGKGKFFDDAFLLDMYMFLKRLK
                     PSDSFDQEIKFLGDEYLRYVERFLKENADKIKEPLWGEEDKISVFTKLRYSKEEYGLE
                     VYEGRYMFAELYTLFRCGLLDSAKGLLERFHVFFEHISHRFKTSFGSWITTRTKPAVP
                     VKIGGSDDLFKAFLLGLMDEKSRRMDERIIGSIEDFVWMNLISINEGRSASEILKMFR
                     NYQNPKGLFLAYVMLKDYDKAMSLMFKGDFSIIPSYFIMKALCPRCKNKKVFVDFVFL
                     AASRFSSTTRKVEIISSLKSVIEGYYEIVPEMIVKMGLYDVLGIDSGACLYLDKKVNQ
                     KVIEILKGKNEKKKLIKLYYLIDDETLVVDLINEAVTEAILSDTDIDEYLEIIEYYER
                     VECTRQTRMMSALKSFYLFKRNPSPSTLGETPLLDSDFDLTNFRYVVEKIFKPACDIV
                     EKMGDNEMARTLFKLCGVLGLGDEMSSYANRHLVLLI"
     gene            <64723..>65733
                     /locus_tag="Eint_090510"
                     /db_xref="GeneID:9698371"
     mRNA            <64723..>65733
                     /locus_tag="Eint_090510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073494.1"
                     /db_xref="GeneID:9698371"
     CDS             64723..65733
                     /locus_tag="Eint_090510"
                     /note="similar to ECU09_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073540.1"
                     /db_xref="GeneID:9698371"
                     /translation="MKFNSADFPIMKRMLVAREEGIYYEMEKNSLADTWDRLLEYYSE
                     KILEEHKEEIEEEELYRILCKARVEAETGRRVYELIDKDVLETHKVKPRSVDRCEFKT
                     YILDSCIRILRKGISELKDGIEKESRVWSKVEGASMPVRLVRGKVQVYVTETEYLVVN
                     EEGDYVYPSDWNAQGVTCKIRYMDVHLECSVLPRNSMDKIEMVKEYFLERSIIQKFIR
                     NDIEIEITPMENPSEREDIICKYVVCHLKRGKSIKEIFEKVNLYLSRKLVDIIVSGSK
                     KCTVLRYSGHVLEDGLPEVFFVLTDNKVVKAMRQQPGKFEIFVNEVPIRSFRNYISRE
                     EP"
     gene            <65901..>66248
                     /locus_tag="Eint_090520"
                     /db_xref="GeneID:9698372"
     mRNA            <65901..>66248
                     /locus_tag="Eint_090520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073495.1"
                     /db_xref="GeneID:9698372"
     CDS             65901..66248
                     /locus_tag="Eint_090520"
                     /note="similar to ECU09_0510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073541.1"
                     /db_xref="GeneID:9698372"
                     /translation="MIRCVYTMQKHKKLKTWMDGFIEQKGKRIHLYNTDMVKIDSLVA
                     SCLDNEMETPKYLLYIESFEDPEENEIKHQENPPSTSRTLKDRPEKDIEGNVKCSSPQ
                     GRSEEEIINLFQG"
     gene            complement(<66262..>67011)
                     /locus_tag="Eint_090530"
                     /db_xref="GeneID:9698373"
     mRNA            complement(<66262..>67011)
                     /locus_tag="Eint_090530"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073496.1"
                     /db_xref="GeneID:9698373"
     CDS             complement(66262..67011)
                     /locus_tag="Eint_090530"
                     /note="similar to ECU09_0520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073542.1"
                     /db_xref="GeneID:9698373"
                     /translation="MTQTDNGVELEESYLSKIYTSQALTLPEDIQNYVLNPKDVDAEI
                     FYLEKYARTKNPDLSKITFMIEVLSKCLKKHSDFRDYIKLLVGIIETYKDYRYSIFCL
                     RAIKSVAGSKFYVPLSFYIIRILKNAISVKNLSVEGRKISYDMVNPDPSRTKSEEHQM
                     FVIEEAGSLLLQHMSVFSKSIGFPELAAVVVSELKKLRIGVFKEVMDNVISNINAQRE
                     HVLEKRNNLKLNGIDGKVVSSFESSIEKTLR"
     gene            <67530..>68315
                     /locus_tag="Eint_090540"
                     /db_xref="GeneID:9698374"
     mRNA            <67530..>68315
                     /locus_tag="Eint_090540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073497.1"
                     /db_xref="GeneID:9698374"
     CDS             67530..68315
                     /locus_tag="Eint_090540"
                     /note="similar to ECU09_0530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073543.1"
                     /db_xref="GeneID:9698374"
                     /translation="MQEKVSNFDDHMCDLEKKIKDIETAFQPILLSKESHKRSLPEDS
                     FLKNIYLVLIIVLCIQGVLWYTDNEKSSAGTVWNMVVYSVAVVGTILYMAWVWGFGGR
                     RWTSVASMVPMMVGFLNLGKRVSCEYGMEMAGLGFMMVCMESLARHGMSSWEILAGLI
                     GNGIVVMGWVSWATMRDRYGERMGQWMCGGLIVFGILMAVMMYMKEGRNVERSTGSYM
                     VFIMTVVVGTAVSYACGEDYRQLATKRLFQRPRIVESKCQNPI"
     gene            complement(<68361..>69281)
                     /locus_tag="Eint_090550"
                     /db_xref="GeneID:9698375"
     mRNA            complement(<68361..>69281)
                     /locus_tag="Eint_090550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073498.1"
                     /db_xref="GeneID:9698375"
     CDS             complement(68361..69281)
                     /locus_tag="Eint_090550"
                     /note="similar to ECU09_0600"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073544.1"
                     /db_xref="GeneID:9698375"
                     /translation="MRGFGGSEVLSGDDEDDERLGKELGRLRQENMRLTGEIMILRQN
                     MIALETQNFAMKEQKSRTVLDGLKRMEKLKKEVDVLRIESRIRENQSRVFKRQKANAG
                     IDIKWALSKSNCGIGFTLLPFEFNRLKFLKDFFYSDFCQLDSSSVIREMGKRISRFKE
                     FLDFYILFSCKAEVFREFFGMVLMNPLFPEEKMKVFNTLPLDWILNFNNEEVISLVKE
                     YIDKNYKQMVFFLLRVVEERPFLLNILVSKEMFTELAKTSSRATKKLTSEICRKGGLG
                     LIDHTNIHYISQDDLKILYKDLYFEVYFDV"
     gene            complement(<69304..>70305)
                     /locus_tag="Eint_090560"
                     /db_xref="GeneID:9698376"
     mRNA            complement(<69304..>70305)
                     /locus_tag="Eint_090560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073499.1"
                     /db_xref="GeneID:9698376"
     CDS             complement(69304..70305)
                     /locus_tag="Eint_090560"
                     /note="similar to ECU09_0610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073545.1"
                     /db_xref="GeneID:9698376"
                     /translation="MDFEIWPCDAYTGGVFKSCIKWRKCKETSKRPDFLAARIAGIVR
                     MDRKEIRFLESEPVELSMKEDSETVYRCIIPRDALPSMKLRSLEVVYTIIVEVYYGVT
                     REVRTKMFSVHPFGFKPLKKMENIIVHSDMIRVGNTDDTAFGEIVDFLRNKAGQDYGT
                     TEEMVGRKMHFLEDFPRFMREVVERYKLESKGDIYFYVSMEGSEVEEDRYKVTVQDDE
                     EEVATVEYGKLLVKEDTMMIWYKRNSKKTRIILEVTEFISGEVSNGEERLLKEFNSDM
                     CLYKAVPLRVEHDCFTFDCKLFSVKFSYRIELDNLVFVLPISKASPRASLSIGGECR"
     gene            complement(<70406..>72349)
                     /locus_tag="Eint_090570"
                     /db_xref="GeneID:9698377"
     mRNA            complement(<70406..>72349)
                     /locus_tag="Eint_090570"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073500.1"
                     /db_xref="GeneID:9698377"
     CDS             complement(70406..72349)
                     /locus_tag="Eint_090570"
                     /note="similar to ECU09_0620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073546.1"
                     /db_xref="GeneID:9698377"
                     /translation="MAGFYERIKEAWNSVKDALQPGKKVDLNSYKELCSRFESEKPIE
                     VSELDRIKELCKAISEPGCRKKLDEGFEELKRVEIERSERKAGAKWKGDLGAGDTKGG
                     EGKPKKHRKRGYQKKYALKKENDVSWGVLPKKYRVEGKTPMETIEKAICYDAEDNLFL
                     QLGEVSTDEEEEYFCERNIKKLNSEVVERKVRCNFGGEYNCKRCVEYEIRKEYERKEN
                     ERRKEERERAEKRRQMAKDRWESRVPKSYFYLEKDFGVERAVARYVTDDKFDMDDLED
                     EERKKLTRVLSEARKEQLFDIEKIKSRKASFDESRNEVTEIGGIKDDGEKNDKEAEPE
                     QVLNGSGQEDRKEVGIKTSNESESLPSKPYFILEPISETKENGSDDREAVEMSEDAKK
                     VEDAVQMQEPFVFGGEINESLENEKKEGPAVEEEPKKFGFWDGRTPNVQGDTSMFLFN
                     SGAPLPPAQDSPSTVNHENISSPFASDGKAPETKPFVFGGGSFPAQSGMGQESVELHS
                     PTPGSSLLKRKLGGYGEAVQDSGANFSFGEGGNIFLSGSSGIPGLQSFPVPGSTGQEQ
                     ARPQQQIDLTGSMGNIFGNGKSLFGGLFEGGSSQQPAKPSIGYVDSEERNDKGLGGLF
                     GGGGIFNAADDDPFERSKLDRRR"
     gene            complement(<72408..>72671)
                     /locus_tag="Eint_090580"
                     /db_xref="GeneID:9698378"
     mRNA            complement(<72408..>72671)
                     /locus_tag="Eint_090580"
                     /product="zinc finger domain-containing protein"
                     /transcript_id="XM_003073501.1"
                     /db_xref="GeneID:9698378"
     CDS             complement(72408..72671)
                     /locus_tag="Eint_090580"
                     /note="similar to ECU09_0625"
                     /codon_start=1
                     /product="zinc finger domain-containing protein"
                     /protein_id="XP_003073547.1"
                     /db_xref="GeneID:9698378"
                     /translation="MELCGICHWKISVKHETRCGQSFCYLCIKRHLKSDDRCPGCRRR
                     SCVTDVLRCREDNERFGGNDLEILNSLCRLKRYIKEEAKECKD"
     gene            complement(<72708..>72995)
                     /locus_tag="Eint_090590"
                     /db_xref="GeneID:9698379"
     mRNA            complement(<72708..>72995)
                     /locus_tag="Eint_090590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073502.1"
                     /db_xref="GeneID:9698379"
     CDS             complement(72708..72995)
                     /locus_tag="Eint_090590"
                     /note="similar to ECU09_0630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073548.1"
                     /db_xref="GeneID:9698379"
                     /translation="MLGSIVKSKVGIDYGSYGASMVGNLVVVEYLPHSQIAVIRCDAP
                     ACKYVLFTIATIGEISGLKCSMSILWISGILKRAMRRILKYVKMEKELERR"
     gene            complement(<73094..>74380)
                     /locus_tag="Eint_090600"
                     /db_xref="GeneID:9698380"
     mRNA            complement(<73094..>74380)
                     /locus_tag="Eint_090600"
                     /product="pyruvate kinase"
                     /transcript_id="XM_003073503.2"
                     /db_xref="GeneID:9698380"
     CDS             complement(73094..74380)
                     /locus_tag="Eint_090600"
                     /note="similar to ECU09_0640"
                     /codon_start=1
                     /product="pyruvate kinase"
                     /protein_id="XP_003073549.2"
                     /db_xref="GeneID:9698380"
                     /translation="MKASLTKIVCTIGPSSSSKEKIKDLIDAGMSVARLNFSHGSREE
                     HLEVIRNIKDAICSLGRYVSIALDTRGPEIRIRTPGDKNIEVNGGDILRFSSVSSGKS
                     IWIPWIDFRSLGMGDRISVDDGRIDLKVVDVEEDGFGCEVLSSGIIRSNKSMNFPNID
                     VGIKFLSDEDRSDIVFGLENGIDMIFASFVNSKKDVEEIRKVVGNRIPVVSKIESCLG
                     MKNLEEIVLCSDGVMIARGDLGAEVGLVDTFSAQKKILLETKRGKKPAICATQMMESM
                     TSRDTPSRAEISDVGNAVLEGCDCVMLSGESAVGMFPIETVKFMRNICIKAETYYQET
                     KKDLGFHKMFPYVKGIVVCTDSMEDVERLYLGRPGVPIILISEDKWILRRFSIWRGVF
                     PMDIKPPTDVDDVLRGLGLKGTFLVACKEEMKTINV"
     gene            <74503..>74973
                     /locus_tag="Eint_090610"
                     /db_xref="GeneID:9698381"
     mRNA            <74503..>74973
                     /locus_tag="Eint_090610"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073504.2"
                     /db_xref="GeneID:9698381"
     CDS             74503..74973
                     /locus_tag="Eint_090610"
                     /note="similar to ECU09_0650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073550.2"
                     /db_xref="GeneID:9698381"
                     /translation="MKTVAVVMKSLDEEIPLSKNSVGDGFLGSAKHVVMIFIEKNKMF
                     LFNDPHLMLESEKTLRMEQKLHRKAVVEHLEKAAQAVKKLNFKAEVSKLVINGDEKYK
                     IEKCLACLEVQAVMFIGRHKKKRFYECFVQSLEDYVFEAMKIPIIKIPASKHRS"
     gene            complement(<75007..>75675)
                     /locus_tag="Eint_090620"
                     /db_xref="GeneID:9698382"
     mRNA            complement(<75007..>75675)
                     /locus_tag="Eint_090620"
                     /product="putative membrane protein"
                     /transcript_id="XM_003073505.1"
                     /db_xref="GeneID:9698382"
     CDS             complement(75007..75675)
                     /locus_tag="Eint_090620"
                     /note="similar to ECU09_0660"
                     /codon_start=1
                     /product="putative membrane protein"
                     /protein_id="XP_003073551.1"
                     /db_xref="GeneID:9698382"
                     /translation="MYVCIECGNRAKHLFLKNSSAKQISRCQLCSKKMDRYFELNSLM
                     KLVDLLLLKRRIFRHYLFNNKKDLTRSALFMLIAKVLTGPILHHHGALRILFFGESSG
                     KVNLIATIATICRDALESLVETVLLLVLAFTVFHRHVRFLKLSSSLLLSSFYYLFIFI
                     MIMWKYQWEEYLLVIEFLCIASNSIVISEICLVRNEIAVGCICGCKLITALMCKRILG
                     SIRL"
     gene            <75747..>76778
                     /locus_tag="Eint_090630"
                     /db_xref="GeneID:9698383"
     mRNA            <75747..>76778
                     /locus_tag="Eint_090630"
                     /product="histone deacetylase"
                     /transcript_id="XM_003073506.1"
                     /db_xref="GeneID:9698383"
     CDS             75747..76778
                     /locus_tag="Eint_090630"
                     /note="similar to ECU09_0670"
                     /codon_start=1
                     /product="histone deacetylase"
                     /protein_id="XP_003073552.1"
                     /db_xref="GeneID:9698383"
                     /translation="MAVAYIFDEEVGMFHYGPRHPMKPFRMVVTHSLVKSFGLDKKMT
                     IVKPALFPLTYHPKEYLENLGKNETPDCPNFIGLSRFCELYGSASINSAMILSEGRYD
                     TVINWSGGLHHAHKAVPSGFCHVNDIVMAILELLKTYQRVMYIDIDVHHGDGVEEAFL
                     ECDRVLTLSFHKYGDGFFPETGTLVTTGHRAVNVPLLSGIDDASYRYIFEPIVESCVK
                     KFSPDAIVLQCGADSLGEDRLGCFNLSIEGHASCVRFVSSLGIPLLCLGGGGYTLTNV
                     ARCWAYETAVLCGEDPITDIPADNPFYTYFSPSYVVNPVFKRKYVNRNDREYLDMVMS
                     FILDKVDKF"
     gene            <76835..>77725
                     /locus_tag="Eint_090640"
                     /db_xref="GeneID:9698384"
     mRNA            <76835..>77725
                     /locus_tag="Eint_090640"
                     /product="small RNA-binding pol III transcript
                     stabilizing-like protein"
                     /transcript_id="XM_003073507.1"
                     /db_xref="GeneID:9698384"
     CDS             76835..77725
                     /locus_tag="Eint_090640"
                     /note="similar to ECU09_0680"
                     /codon_start=1
                     /product="small RNA-binding pol III transcript
                     stabilizing-like protein"
                     /protein_id="XP_003073553.1"
                     /db_xref="GeneID:9698384"
                     /translation="MPVEKLEKIKSQVEFYFSDANFRVDKFLREQSLVNDGYIPIKTI
                     VSFNKLRNLEATVEDVKKALEDSKVVELKDDMIKKVETEEYLSYVMEKDINKRVVYID
                     GFEKDATLEDIKEILSPHIIPVLIRMRRDKGKNFSGSVFAELKSEEEAQKALEEKIPV
                     KKQAEDEERSKKQKSEEKYLLIMAKDEYLKEKEKISGEKKEIEARKALEKEFVPKLFK
                     YECSEDLDIKTVKSLVKNTAFVDTKQKVIRMKHAEDFKEKKFEEEGKSLTLVKMEEDE
                     ALEYCKSIKIAPKGSKPGKK"
     gene            <77775..>78227
                     /locus_tag="Eint_090650"
                     /db_xref="GeneID:9698385"
     mRNA            <77775..>78227
                     /locus_tag="Eint_090650"
                     /product="putative peptidase"
                     /transcript_id="XM_003073508.1"
                     /db_xref="GeneID:9698385"
     CDS             77775..78227
                     /locus_tag="Eint_090650"
                     /note="similar to ECU09_0690"
                     /codon_start=1
                     /product="putative peptidase"
                     /protein_id="XP_003073554.1"
                     /db_xref="GeneID:9698385"
                     /translation="MTKYNVTLRVYPLGDETLKRFVASALKREEVHIWHTSIEVYGIE
                     YFFQNGIVKAVPGSTSHGTPLKTHDLGTTEIPEIVFEDFLLSITEDFAPHKYHLLRNN
                     CNNFTNIVALYLVEKSIPEYILELQNTALESEAVSSLVDMFFGSPGKI"
     gene            complement(<78230..>79363)
                     /locus_tag="Eint_090660"
                     /db_xref="GeneID:9698386"
     mRNA            complement(<78230..>79363)
                     /locus_tag="Eint_090660"
                     /product="splicing factor"
                     /transcript_id="XM_003073509.1"
                     /db_xref="GeneID:9698386"
     CDS             complement(78230..79363)
                     /locus_tag="Eint_090660"
                     /note="similar to ECU09_0700"
                     /codon_start=1
                     /product="splicing factor"
                     /protein_id="XP_003073555.1"
                     /db_xref="GeneID:9698386"
                     /translation="MEAKDAKVDYEVLVAPDGKTYYYNKKTGKSSFRKPDVLKDSDED
                     FDVDPWIECRSRQGKVFYHNTITKESRWERPGEKRKGKTLIKGIGMNMRITDHETSKY
                     LLYRLMEQYKVENMKDVFYKLSTEPIFRAIRMDVRESLVRKYFEDKEENNREEEVQRQ
                     KYYVDEVCKVDVGVSDFFGFNSVFSRHPYYSRIKDKFGCYEVYIEKHMGGTTAGKLEE
                     IFRACGIDLNSSASDVLKMKEMEGFDRKVVLFSFIRYFRRLEREFLLDIEKKKTSMAE
                     KIPHYREEFRQVLNSLYSRGLIYYKMKFKDAFYLFKNSEPFWNLLGSMESPKEVYFEF
                     VNDLENKLKRYEKERTEEISQIDKRAVDKYFEVVWEEKEEGEI"
     gene            complement(<79437..>80063)
                     /locus_tag="Eint_090670"
                     /db_xref="GeneID:9698387"
     mRNA            complement(<79437..>80063)
                     /locus_tag="Eint_090670"
                     /product="putative integral membrane metal-binding
                     protein"
                     /transcript_id="XM_003073510.2"
                     /db_xref="GeneID:9698387"
     CDS             complement(79437..80063)
                     /locus_tag="Eint_090670"
                     /note="similar to ECU09_0710"
                     /codon_start=1
                     /product="putative integral membrane metal-binding
                     protein"
                     /protein_id="XP_003073556.2"
                     /db_xref="GeneID:9698387"
                     /translation="MGNVLSRNVPLRESLVRLEEQISKKEKAAKDLSGALNSLRIKMF
                     LASCVVIVLSMAYSYADDQNMVLFGVGSALGCYIVRCVLIYLYEIRIQRLESSVEALK
                     EIQKEQIALLKKEESFEATKKVIDKYESESMRRHYFGSIKQRRRGMMDSVTDIVLGDD
                     PSTMYALICKRCNHHNGLVHPSEYDLNEFYCYNCNELNARSKNRNSNK"
     gene            complement(<80108..>80791)
                     /locus_tag="Eint_090680"
                     /db_xref="GeneID:9698388"
     mRNA            complement(<80108..>80791)
                     /locus_tag="Eint_090680"
                     /product="proteasome subunit beta type-7"
                     /transcript_id="XM_003073511.1"
                     /db_xref="GeneID:9698388"
     CDS             complement(80108..80791)
                     /locus_tag="Eint_090680"
                     /note="similar to ECU09_0720"
                     /codon_start=1
                     /product="proteasome subunit beta type-7"
                     /protein_id="XP_003073557.1"
                     /db_xref="GeneID:9698388"
                     /translation="MITKTGTTIVGMKYKTGVILAADTRSTQGPVVSDKNCEKIHRIS
                     DKIMCCGAGTAADAERVARMASRELRLFERKYFRAPLVSHFRKVCVNHLHKYGGQIGA
                     ALIVGGIDSEGCHLLDIHPHGSSNSTLFTSLGSGSLAAIGVLESKYRAMDKNEAIELA
                     CDAVQAGILNDLYSGSNIDVCVIDYSGVEFLRNYKRVGVCENTDTLVYPLDSVQIKKE
                     EVFDVVEEY"
     gene            <80892..>81695
                     /locus_tag="Eint_090690"
                     /db_xref="GeneID:9698389"
     mRNA            <80892..>81695
                     /locus_tag="Eint_090690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073512.1"
                     /db_xref="GeneID:9698389"
     CDS             80892..81695
                     /locus_tag="Eint_090690"
                     /note="similar to ECU09_0730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073558.1"
                     /db_xref="GeneID:9698389"
                     /translation="MVFKEITISLAYVAQITILLSLDVLFLLFTVQRSLYFFGKGMKR
                     KPDAIRVRLIPKSQSDLYLIDGISGIDLIYLPGNFVAVEEHIEFCKYLSKIFECNVIS
                     MVYRGVAGNGYSPSEKGIVEDLSPASRWLSRRSTRKVILGFSIGSAVGIRLAEKCRVD
                     ALVLINPFISLREVVGNVSFGRILKHLVIDEWNNLNRMKNINVPVYFVVSSNDEIVSP
                     SHTDELIKRTKHPKKIVIRNADHNEPMRNFTTHLCSLMDEVLRKTPSGG"
     gene            complement(<81724..>82677)
                     /locus_tag="Eint_090700"
                     /db_xref="GeneID:9698390"
     mRNA            complement(<81724..>82677)
                     /locus_tag="Eint_090700"
                     /product="putative divalent heavy-metal cation
                     transporter"
                     /transcript_id="XM_003073513.1"
                     /db_xref="GeneID:9698390"
     CDS             complement(81724..82677)
                     /locus_tag="Eint_090700"
                     /note="similar to ECU09_0740"
                     /codon_start=1
                     /product="putative divalent heavy-metal cation
                     transporter"
                     /protein_id="XP_003073559.1"
                     /db_xref="GeneID:9698390"
                     /translation="MNSQVVLFAAMVFSSSLIICLSPKVITSLKVVKRIFPFLTLLTA
                     GFLLGVQLLELSPHMVSDCHGGKEHDHNHGHHSHESPILGFFTAGLSFIFLLAIDSIV
                     LKHKHCEENEKKEHAHGGGCHGKDIHHVVDAKKNIKSPQISAKASSAHDSKKEGERLG
                     CCDPSEAIKNTSSKTQVFIYILGISIHSFFEGLAFNSIDKIGSMEMGLILHKILESFA
                     LGVPLFTSGFNFSSGLILAVFYSSLTPIGIMIGSAPGFFNQTIRGIFKGLALGSIMFM
                     VSIEMIPPMFNHPKVNRIHGILTLLAGYLTSAAVIHCSHPH"
     gene            complement(<82728..>83069)
                     /locus_tag="Eint_090710"
                     /db_xref="GeneID:9698391"
     mRNA            complement(<82728..>83069)
                     /locus_tag="Eint_090710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073514.1"
                     /db_xref="GeneID:9698391"
     CDS             complement(82728..83069)
                     /locus_tag="Eint_090710"
                     /note="similar to ECU09_0750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073560.1"
                     /db_xref="GeneID:9698391"
                     /translation="MLPFDREERALIEREYVKHRKDIKKAKMRERHFKMKDKGYCLSI
                     DLLGDSRDVVSMFLGYIEGLGISRRDVYEYIADAVLCGNNGISENLKRIVKLGIRDKN
                     SIGKEIAKTCS"
     gene            <83152..>85122
                     /locus_tag="Eint_090720"
                     /db_xref="GeneID:9698392"
     mRNA            <83152..>85122
                     /locus_tag="Eint_090720"
                     /product="5-3 exoribonuclease"
                     /transcript_id="XM_003073515.1"
                     /db_xref="GeneID:9698392"
     CDS             83152..85122
                     /locus_tag="Eint_090720"
                     /note="similar to ECU09_0760"
                     /codon_start=1
                     /product="5-3 exoribonuclease"
                     /protein_id="XP_003073561.1"
                     /db_xref="GeneID:9698392"
                     /translation="MGVPSLFRWLQLSHREAVHSIMEKPSVDCLYLDFNAIIHTCIKP
                     GLGSEEEIERDLYKTVGDFIDYILLRTRPRKLLYIAIDGVAPRAKLSHQRARRYKSAL
                     GKKEGKAPVSTGKTDPTASSISEKTEEATDVEFTGESSLYDKFIAEDLSESSSLAMDV
                     EAEKFDLNCITPGTPFMERLHNVLISYIQYKLSKDPEVSHLRIIYSSYLVPGEGEQKI
                     MSFIRNQIPAAKNDVHMIYSPDGDLIFLGLSLYKSRVLIMRDYFSPSKARKKKICTKC
                     GRTGHSNDECGVFDNYHFVYVNIAELRSRLIREFRKHTTQRFNEERLLSDWIFLCFLL
                     GNDFVPSIPCLDIRFHSIDTLTEIMMKNFSETKSYITCNTSINYQVLRNFYTILARKE
                     DGLYHRKSQSLDRLREELKDMPNIIYEKIPIHTKTGKIQYYTSKLNAKTDSDIKNICY
                     EYIKALYWVYSYYILGYTGWDWYYPHHFAPLAADLSKLSISEIRINSGLPLRPLEQLL
                     VVLPPMSKGMVPRELQPIFNNYKDYYPEDVETDMFDKVYLWQEVVLLPFMDFRSILSE
                     NASRFNSLGYEDLSRNLRSLDLFFTVDKKSTETILNMYSELKPMCFIKDPGYTGNLSP
                     YSSASFPGDMAEYNGTQFVNRTIAGLIEPKKN"
     gene            complement(<85140..>86417)
                     /locus_tag="Eint_090730"
                     /db_xref="GeneID:9698393"
     mRNA            complement(<85140..>86417)
                     /locus_tag="Eint_090730"
                     /product="DNA polymerase delta regulatory subunit B"
                     /transcript_id="XM_003073516.1"
                     /db_xref="GeneID:9698393"
     CDS             complement(85140..86417)
                     /locus_tag="Eint_090730"
                     /note="similar to ECU09_0770"
                     /codon_start=1
                     /product="DNA polymerase delta regulatory subunit B"
                     /protein_id="XP_003073562.1"
                     /db_xref="GeneID:9698393"
                     /translation="MDDLASVSYEHQFNRTYDARLAELKPYIIRSVRAQNGVPILDTI
                     LGVEEELDTSTCVIVGTLFVASDLKPSIFDKIDRKSKKLKEVETKTYYTEDIKYLLED
                     GSGRIELEFLDVGDIYRKHFVLCTGMCVGVQGRRAKKGKFLAEDIIFPFSNPRSLPLG
                     FSEVRPGKRLCFISGLSLDDGSKNKERMMVLCDYLRIVGVSEYVVIGSFFGESKEVSR
                     QMLSELDDVLGYAKAKINLVPNTGDFGSKILPLMPVHPKLFTFAVASHANPCRLDIDG
                     RKVLTTTRFVIEDILRYLPQDLKDVQGEAFEYKMHLDMEKIEDIRPKSMNSERNIINA
                     MRVLMKAGHVCPTAPDTVPSVPFSGKDLFVVADPIDYFCVGGTDEFLDGQSEDNSTLF
                     FTIPKFSKRHEVVVLDTGTRELEVVRFDMKDFD"
     gene            complement(<86509..>87372)
                     /locus_tag="Eint_090740"
                     /db_xref="GeneID:9698394"
     mRNA            complement(<86509..>87372)
                     /locus_tag="Eint_090740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073517.1"
                     /db_xref="GeneID:9698394"
     CDS             complement(86509..87372)
                     /locus_tag="Eint_090740"
                     /note="similar to ECU09_0780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073563.1"
                     /db_xref="GeneID:9698394"
                     /translation="MALTYKERLEFLESLRKAPIDLSVADRMVLYAHDRTLMRPTIQS
                     LVRELTNLDAYISVMHGILTQDEWDEVVSDYDTPIEGGHAKLREKIKLFLFAYENLDN
                     AIYDFKIDEVFKAFETSMLSRTRNIQFLLFKLCHRNPQAVFGFLLELVRKNPIAFLPY
                     LSSLIVRCKVDEGLKAMYVQDYQAYVRSYGKSLSIQSVAAHQCLLYISCFRRESVADA
                     KDIIERIFSSGMARYMNKNVVEMFCELFDYECKEFSSHDHDCLYFFPFDLPILEEVAG
                     SIHEFYIHFRR"
     gene            complement(<87441..>88493)
                     /locus_tag="Eint_090750"
                     /db_xref="GeneID:9698395"
     mRNA            complement(<87441..>88493)
                     /locus_tag="Eint_090750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073518.1"
                     /db_xref="GeneID:9698395"
     CDS             complement(87441..88493)
                     /locus_tag="Eint_090750"
                     /note="similar to ECU09_0790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073564.1"
                     /db_xref="GeneID:9698395"
                     /translation="MNQDKEISKDAFDVIIRTVQDRKDFGSKSMEDLPMNLFSYRFFH
                     LEEISLADGISAAIKTILRDSRFSLLGVSPETLDSFFSFSFFHMLPHKYHNLDHLINT
                     LYFGDFILQRLEKKYSLPIMDKMCLMIALVLHDIGHPGEKNREKIERLSSLYGNSDET
                     MSFELIHATICKRIISKYRHALFGDLEDEEMREKLNFIKEMIFATDLKMNKEIIEEFN
                     TKYFEERKGRKIRNKAAGEISEIELKMIVKIADLGSCYKDYRIFNKNSIAFWSEMYDD
                     DNYRRTLQDISEDVNLLEKISIPLADSFSLVFEDFRFLYNQALSNLEEHKKYYKRLEE
                     EWKSGPPPGRDKMSLK"
     gene            complement(<88624..>89193)
                     /locus_tag="Eint_090760"
                     /db_xref="GeneID:9698396"
     mRNA            complement(<88624..>89193)
                     /locus_tag="Eint_090760"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073519.1"
                     /db_xref="GeneID:9698396"
     CDS             complement(88624..89193)
                     /locus_tag="Eint_090760"
                     /note="similar to ECU09_0800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073565.1"
                     /db_xref="GeneID:9698396"
                     /translation="MRTGFFVSCRLNKETKGLKEVVGKLEGLIETPKKDTAGKSIRKI
                     LEEEIEEYKSSTKFRKHDGYRCILFLENRSSESSSALFSKLRESETRFEYVLPIRPLE
                     EFFRFDEGKVLESIRGLDENKSYKIMYEGRMCHPDTKEKVFDLITGNLSLKVDLKTPH
                     YIIAVQAFKNNLGISVIENERENFNFSAT"
     gene            <89240..>91093
                     /locus_tag="Eint_090770"
                     /db_xref="GeneID:9698397"
     mRNA            <89240..>91093
                     /locus_tag="Eint_090770"
                     /product="FusA-like translation elongation factor"
                     /transcript_id="XM_003073520.2"
                     /db_xref="GeneID:9698397"
     CDS             89240..91093
                     /locus_tag="Eint_090770"
                     /note="similar to ECU09_0810"
                     /codon_start=1
                     /product="FusA-like translation elongation factor"
                     /protein_id="XP_003073566.2"
                     /db_xref="GeneID:9698397"
                     /translation="MEGKSDVEIIEEYTELLGSHESLYRRKTLLAGVEERDLSYFNFI
                     GQNKCRKTVVGLFGFGGAGKTSLVKLLGSRSTIQATRECLSTETPYEAERRCTIHVHP
                     TTVFLQRKNGISHIMTLLDTPGHADLIPETIKTLEQVDTVVMVLDICRDLSLQYELLF
                     GAIEASKKPLIVVFNKMDLIGKEGIAVAASRIKYLRDIIEAYLNPRCWFVSSFKESKL
                     SKLDTTIGRLIEEYVDDFDSFIERIISKEPITHGDRDKMECLTGFLWVGGVLLCSLVP
                     KTDIGVGFQVEVYGTTLTIERLYLPFPGCLVKTQQIQSKIGVLAKFPEDMLQKVVIPG
                     FQRDPRLMKEVLKRKGVEYGNPEFLEVEDPLVRVQVSPDNEDHFSLGTWKLRLMYPSL
                     KIDGKILYGDGELFMDTVLYDLRNSLGIKFEVLSVSSNLKEIFGVSFTEEVDTGRGLV
                     VVKGGPTRTMGKIHDFGAVEKRILDRGLLAKDPFVHSYLEVSPVSEEVELECLKRLEN
                     SVIGHVSLLEPLYLVEIVYTSDSEDLVNEVITSSFGEIISRKPSPFNELKNILCYIPV
                     PESFGFETDLRVYSCSRADCVKIPFYWRPVADKDRTHRLARFIRKAKRPEP"
     gene            complement(<91130..>91933)
                     /locus_tag="Eint_090780"
                     /db_xref="GeneID:9698398"
     mRNA            complement(<91130..>91933)
                     /locus_tag="Eint_090780"
                     /product="septin"
                     /transcript_id="XM_003073521.1"
                     /db_xref="GeneID:9698398"
     CDS             complement(91130..91933)
                     /locus_tag="Eint_090780"
                     /note="similar to ECU09_0820"
                     /codon_start=1
                     /product="septin"
                     /protein_id="XP_003073567.1"
                     /db_xref="GeneID:9698398"
                     /translation="MIIRRQNRRFTIMAAGPKGSGKSSFFNTLIGKEIITSKGQEGID
                     LYMLNLDCEGIMQRITLIDTPGFGETFDDTEIQETICNFIKAQLDMFITEESKIRRNP
                     KYEDTRVHCLLYFIPSTSFGLKNRDIVFLKKISGLVNIIPVISKADGLSISERIEIKK
                     QVIRQLKYYKIPTFNLDDPELYSSPTAGNDLNSLVPFLIISADGENLDSRARNYQWGK
                     VSIDNPEHCDLPALRELLLSTHIYGLIDHTAGEIYESYRAAVLESGMKK"
     gene            complement(<91990..>92619)
                     /locus_tag="Eint_090790"
                     /db_xref="GeneID:9698399"
     mRNA            complement(<91990..>92619)
                     /locus_tag="Eint_090790"
                     /product="ribonuclease"
                     /transcript_id="XM_003073522.1"
                     /db_xref="GeneID:9698399"
     CDS             complement(91990..92619)
                     /locus_tag="Eint_090790"
                     /note="similar to ECU09_0830"
                     /codon_start=1
                     /product="ribonuclease"
                     /protein_id="XP_003073568.1"
                     /db_xref="GeneID:9698399"
                     /translation="MLVSEQGFREDGRKPKELRRVEARRRMVGDEGIVEIRQGNTQVS
                     AACRGSREVGKISIGVEFYVVSRQEPINERRALEYEGLLLDIFSSVLLPEGSADIKVI
                     VREDGGSLLSAMINCITLCLSYFGIPLRDMCYSATVSEGCIDLTSTEESLKTPVVTVA
                     YLMNKKNIAYLSLNGRIVQERLQSSILEGVDACHAISKCFKDFFSPCLE"
     gene            <92702..>93346
                     /locus_tag="Eint_090800"
                     /db_xref="GeneID:9698400"
     mRNA            <92702..>93346
                     /locus_tag="Eint_090800"
                     /product="cyclin-like protein"
                     /transcript_id="XM_003073523.1"
                     /db_xref="GeneID:9698400"
     CDS             92702..93346
                     /locus_tag="Eint_090800"
                     /note="similar to ECU09_0840"
                     /codon_start=1
                     /product="cyclin-like protein"
                     /protein_id="XP_003073569.1"
                     /db_xref="GeneID:9698400"
                     /translation="MGPEYAQCKDLLNSKNVRDIVNISRLLGMPQKATYFTLAIYYKY
                     IFMLKDREAIPIGAACILLSGKVNGSLRSLGQILRTSYKYYGMDPERFFQEDYKDAID
                     IELHACIAMDFNFEMEDPYGFLEKMCMDNDIDRSRAQTIWVMLNDTMYLPFVLSFSIK
                     SIVVSCIFISDIVRGNGEEDINGFKDKYKLAEIDSAEIGFISNEIVSFYERVLK"
     gene            complement(<93385..>93636)
                     /locus_tag="Eint_090810"
                     /db_xref="GeneID:9698401"
     mRNA            complement(<93385..>93636)
                     /locus_tag="Eint_090810"
                     /product="Elf1-like putative transcription elongation
                     factor"
                     /transcript_id="XM_003073524.1"
                     /db_xref="GeneID:9698401"
     CDS             complement(93385..93636)
                     /locus_tag="Eint_090810"
                     /note="similar to ECU09_0850"
                     /codon_start=1
                     /product="Elf1-like putative transcription elongation
                     factor"
                     /protein_id="XP_003073570.1"
                     /db_xref="GeneID:9698401"
                     /translation="MSRKRVKRKINAPKRQSKLEKRFNCPVCNHENVVQCTVKRPLMK
                     GFANCSVCDASFTCEANKLTTGIDVYSAWVDECCKNTMS"
     gene            <93704..>93988
                     /locus_tag="Eint_090815"
                     /db_xref="GeneID:20314084"
     mRNA            <93704..>93988
                     /locus_tag="Eint_090815"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163630.1"
                     /db_xref="GeneID:20314084"
     CDS             93704..93988
                     /locus_tag="Eint_090815"
                     /note="similar to ECU09_0855"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161894.1"
                     /db_xref="GeneID:20314084"
                     /translation="MDILDAEESDVDLIELQGEVENMEAFDGRLNKELVQLEFGTCVL
                     HGRKIDKEFNIIETDVCNGRPCLKVIKKVKCVYLFDKPPRYRSSGLGRGN"
     gene            complement(<93985..>94837)
                     /locus_tag="Eint_090820"
                     /db_xref="GeneID:9698402"
     mRNA            complement(join(<93985..94793,94819..>94837))
                     /locus_tag="Eint_090820"
                     /product="ubiquitin activating enzyme E1-like protein"
                     /transcript_id="XM_003073525.2"
                     /db_xref="GeneID:9698402"
     CDS             complement(join(93985..94793,94819..94837))
                     /locus_tag="Eint_090820"
                     /note="similar to ECU09_0860"
                     /codon_start=1
                     /product="ubiquitin activating enzyme E1-like protein"
                     /protein_id="XP_003073571.2"
                     /db_xref="GeneID:9698402"
                     /translation="MRIVLVGCGGTGMELLKLLGGRASKILVVDHDRIHLTNLHRLFM
                     FTKEDQGKYKSEKAAEFINKQYGGRASFLVRRIEEVPINVLNQYDVIFGALDNIEGRM
                     NLNLMFRKSECKLLIDCGISGYRAHAKAVYRGSSCLYCIRELYREDGPEICSLGSLPK
                     KITPENREKTLRSLVELRREEPGSREEKIKKIINEFNALAEENLKVNAFDVVGMFDEI
                     IPNVCFINSVCASLACGLIDATNLHYDFIFYSGEKNITLEKLILDRDEKCIVCNTDA"
     gene            complement(<94910..>96340)
                     /locus_tag="Eint_090830"
                     /db_xref="GeneID:9698403"
     mRNA            complement(<94910..>96340)
                     /locus_tag="Eint_090830"
                     /product="putative mitochondrial translocase"
                     /transcript_id="XM_003073526.1"
                     /db_xref="GeneID:9698403"
     CDS             complement(94910..96340)
                     /locus_tag="Eint_090830"
                     /note="similar to ECU09_0870"
                     /codon_start=1
                     /product="putative mitochondrial translocase"
                     /protein_id="XP_003073572.1"
                     /db_xref="GeneID:9698403"
                     /translation="MVGRKTSAFLAVTVMSGAILVWQGVRAWRRNRREKSIREYMDRG
                     LLLLKEKMYSEAAVLYLKCLNLMEECDERLVSVYNNLTICLAKIKAYKEAVAYAGRSL
                     QINILNNEKALRLRYECHRALEMRRETLCDAFLCGLVTKDEKYRKLAQEILKLEAEAE
                     ARKMAGTREACPSKISYENFFATFPDLFESESFVNDELVRLIRGGKYDEAFEKAEKRD
                     DSISRFVVAGIVHVRGKDMEAVSLLENEKMIFSISLREYLKTLHGDTPMDIEDFVSKN
                     SKSVSVLFYASKIHLNLKNHELYEKFIDMALECENHDFLYVDRIIYEVGHGRSERAQE
                     FLNRALEAHPLSISILSIACEYYIRNKDARLEMVMSTFEEHFQKDPRFLLLKGIAAQT
                     KNEAELAEKYFRLAIEADRRFFKPYVYLGGILLGRNDKDGRHVYEEALKCAVSYDELF
                     LVYQALILIDVQEKIMKMYPDVLKTF"
     gene            complement(<96375..>98363)
                     /locus_tag="Eint_090840"
                     /db_xref="GeneID:9698404"
     mRNA            complement(<96375..>98363)
                     /locus_tag="Eint_090840"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073527.2"
                     /db_xref="GeneID:9698404"
     CDS             complement(96375..98363)
                     /locus_tag="Eint_090840"
                     /note="similar to ECU09_0880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073573.2"
                     /db_xref="GeneID:9698404"
                     /translation="MAVVRDIGFYIETDRQKIIETTAGTSPPSIADILSIPDIYVRYF
                     LLVNLPISAEEGTSQIMKELKAFFKEFAEAEKIVEVDFDQKMSEFVKKAIIPVGMEDF
                     VGCISELGLSHIDLEYYRGYFGYSQTYSLYKSMIKRIFSCGFSHKEIGLVMLLLDNET
                     MCFKRLLPMFSRLTTYVTRNLLDKNIVACCIVLQSVLKYIPDTMNGRDEYVLSLISYL
                     VDIVSRHTSFMFINEKDAGEIISTIDLLSRFHFTTSVSKTSSGILKEVIFRLESLSSG
                     SMSLYEEVFAVVCVLETIPSICRLLEGSAGFNFSSAYSSLQGLTLQRVEQVGLDEWDR
                     IHNRFLVAKYRSLESLHPWKTSFDRIMFYNDIERARHPSKVLRVLESLKRDISWSDMI
                     VFACHPGLQEEWLAFMFDSLFVKNPEHLVYIELFVESIGSQPDLLLYSGYLLIKIFGH
                     IETEKKWNILVDLFLRNIQSLDQRTIRLRCIISDYISSLGSEEEKSIFLNAFVGRLQK
                     DFVCFNASVIGILHRLLNGVQRVSLETSRMVCLYIRGCAVCEWRREEASKDLEAMYMC
                     VGSRAMILSGATVDFGQTSSHLERYYELIISCLSWIEGRFPEEYVDRIKETMLYFLLD
                     ADREQVHELGLLIRGECSRFRDKFKELYGNQKSERTGI"
     gene            <98489..>99025
                     /locus_tag="Eint_090850"
                     /db_xref="GeneID:9698405"
     mRNA            <98489..>99025
                     /locus_tag="Eint_090850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073528.1"
                     /db_xref="GeneID:9698405"
     CDS             98489..99025
                     /locus_tag="Eint_090850"
                     /note="similar to ECU09_0890"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073574.1"
                     /db_xref="GeneID:9698405"
                     /translation="MSRIGDKSLGLEKKIHKAALLETVTVLNDVADGKKKRKSREDTS
                     VAEVREKKNKKDTRKKTDSQGIRPSKQKRNAARKNGEITKKKVEEKTNEDKDSTECLK
                     KMTRKERRLEKLRSKGKGLPSKEYFEKFIKKYKDDSPQEKATRGVLPSKRKEDFPKGD
                     GNKRKKGSFSKKRKGRDQ"
     gene            complement(<99019..>100872)
                     /locus_tag="Eint_090860"
                     /db_xref="GeneID:9698406"
     mRNA            complement(<99019..>100872)
                     /locus_tag="Eint_090860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073529.1"
                     /db_xref="GeneID:9698406"
     CDS             complement(99019..100872)
                     /locus_tag="Eint_090860"
                     /note="similar to ECU09_0900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073575.1"
                     /db_xref="GeneID:9698406"
                     /translation="MLPGLQIFDLHEPSKCKILNTIGKDFEDCSPKPISKYHSSECTS
                     ECNDHHLIVYLENALCRGTQVEYEDISRMLLHRNSKVRRISLMLHYRNFPDIIPPSFQ
                     DDPDHSVRAVYLSQRWNLRISSLIKQAEDENPDVRIAALHQLMRFSEDEKYKIKILRS
                     VCHRIHDRELTIRVFVSRAIGEFKDLSDEVVEKLLSKQVTSLDDQKLCGALIYGVEDE
                     YSDVRRNTISSVYSLVTPGIVSRAFDFIVDSLNDEDGDLRELSTLCLKKMSIKYTLVI
                     DREIVRQICESLKERRSKVKANILSLLANLKYEDVEIFDILVSHMDVNVRSRDVFRCI
                     RKIVSRNRKLFFANMDRFYKHTSIAQVESSLEDTFYIARLVVLRELKKANPGIRMSEV
                     IENHFLFLEIMECSEPDGCGGGYVFFRDILHQFLEELDGGEQREKNYRRLFRRMKKEN
                     DHRYWFIYYIYKGMAELLRKGKSNILQRIPFLFANTGFDPSMANNTKNIAEYIRSLDF
                     GSIRFLKYDVDVPSRVKVCGRMPVRFSASLLFEKDHQDVHLKVWSSDKTPIYFKARKT
                     IEVCILEDVSSIYCSVVKLHSGQDIPLSHTKAISIERKKPRKDLIPGIDLY"
     gene            <100919..>101920
                     /locus_tag="Eint_090870"
                     /db_xref="GeneID:9698407"
     mRNA            <100919..>101920
                     /locus_tag="Eint_090870"
                     /product="deoxyhypusine synthase"
                     /transcript_id="XM_003073530.1"
                     /db_xref="GeneID:9698407"
     CDS             100919..101920
                     /locus_tag="Eint_090870"
                     /note="similar to ECU09_0910"
                     /codon_start=1
                     /product="deoxyhypusine synthase"
                     /protein_id="XP_003073576.1"
                     /db_xref="GeneID:9698407"
                     /translation="MDGPKNVRDLCRKVKDELSFRKEVKGIDFEKEWDFMEIIKSFET
                     TGFQGTNLYKAIEEIERMRGSKIFFGCTSNIISSGLRDIIATLVKRKYVHVLVTTGGG
                     IEEDLIKTFKPTFCGDFNLKGKDLRDNGLNRIGNLVIPSENYEDFETWLNEVVNDITE
                     GYTKEHPRILTPSSFIKILGERINNESSVLYWAAKNNIPVYSPAVTDGSIGDILSFHP
                     RRNMLKLDIVEDTYRMNCEAVFNGETGAIILGCGIVKHHILNANLFKNGLNYCVLINN
                     AQEFDGSDAGANIDEAVSWGKIKSEAKGVKVFGDATILFPLVVAATFMKQDKACPER"
     gene            complement(<101943..>102401)
                     /locus_tag="Eint_090880"
                     /db_xref="GeneID:9698408"
     mRNA            complement(<101943..>102401)
                     /locus_tag="Eint_090880"
                     /product="tRNA methyltransferase"
                     /transcript_id="XM_003073531.1"
                     /db_xref="GeneID:9698408"
     CDS             complement(101943..102401)
                     /locus_tag="Eint_090880"
                     /note="similar to ECU09_0920"
                     /codon_start=1
                     /product="tRNA methyltransferase"
                     /protein_id="XP_003073577.1"
                     /db_xref="GeneID:9698408"
                     /translation="MEGVVCIKGDITSDSCLRSIVEALEGVLADLVMCDGAPDITGIH
                     EIDEYLQIELLMSALSASLRISKPGSSFVGKCLQGKYTEWMINHFRRFYNGVVLLKPR
                     ASRTESMECFLYCVGMKSTGDSSETDGAAYNASMKLCGYGKSFGLEYTVD"
     gene            <102702..>102941
                     /locus_tag="Eint_090885"
                     /db_xref="GeneID:20314085"
     mRNA            <102702..>102941
                     /locus_tag="Eint_090885"
                     /product="Yos1-like protein"
                     /transcript_id="XM_009163631.1"
                     /db_xref="GeneID:20314085"
     CDS             102702..102941
                     /locus_tag="Eint_090885"
                     /note="similar to ECU09_0925"
                     /codon_start=1
                     /product="Yos1-like protein"
                     /protein_id="XP_009161895.1"
                     /db_xref="GeneID:20314085"
                     /translation="MFSLMSVVYGVLFLLNSIVILDEKRFLSRVGLPLSPEARGILGP
                     SRKKVVDLIRAIKTVMKIPLIVLNIMCITYEVFLG"
     gene            complement(<102967..>103581)
                     /locus_tag="Eint_090890"
                     /db_xref="GeneID:9698409"
     mRNA            complement(<102967..>103581)
                     /locus_tag="Eint_090890"
                     /product="Rad52-like DNA repair and recombination protein"
                     /transcript_id="XM_003073532.1"
                     /db_xref="GeneID:9698409"
     CDS             complement(102967..103581)
                     /locus_tag="Eint_090890"
                     /note="similar to ECU09_0930"
                     /codon_start=1
                     /product="Rad52-like DNA repair and recombination protein"
                     /protein_id="XP_003073578.1"
                     /db_xref="GeneID:9698409"
                     /translation="MQEGEPRSWRPGTFSKKKAKKISKLLRQKLGPEFISYRPGFNMS
                     KIAYVEGWMAISLANRIFGFNGWSSEIRSMTIDYEEGGDKKIGLGVSCLVRVMLKDGT
                     YREDIGFGSSENQKSKAIAYEKAKKEAATDALKRALRQFGNSLGNCCYDKNYIKEIQR
                     IHKINEKALDSNDLFRNNAVVSEESDKDGDASFEIDCHDLSDTL"
     gene            <103651..>104166
                     /locus_tag="Eint_090900"
                     /db_xref="GeneID:9698410"
     mRNA            <103651..>104166
                     /locus_tag="Eint_090900"
                     /product="ER to Golgi transport membrane protein"
                     /transcript_id="XM_003073533.1"
                     /db_xref="GeneID:9698410"
     CDS             103651..104166
                     /locus_tag="Eint_090900"
                     /note="similar to ECU09_0940"
                     /codon_start=1
                     /product="ER to Golgi transport membrane protein"
                     /protein_id="XP_003073579.1"
                     /db_xref="GeneID:9698410"
                     /translation="MDPLMSAFKARESKTFYSPIPHKYEQMFKPKKYDLEHFGLTFFQ
                     RAVCFSACLGAGILSFLYSMIKIVRLSPSGFILPYTISNFLFFIMFGFLLGFRSYLEG
                     LFSKKKRIHSSWFIGCTLLTLYVVLKYDRYLLNLVFCFVQVTSFIMFSLTFIPGGTSG
                     MSSMVNMFFKK"
     gene            complement(<104239..>104502)
                     /locus_tag="Eint_090910"
                     /db_xref="GeneID:9698411"
     mRNA            complement(<104239..>104502)
                     /locus_tag="Eint_090910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073534.1"
                     /db_xref="GeneID:9698411"
     CDS             complement(104239..104502)
                     /locus_tag="Eint_090910"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073580.1"
                     /db_xref="GeneID:9698411"
                     /translation="MVKQISNRNQIQQYKKRQSKLNELLYNQPSRLLISPMQVLVISL
                     IFIANVFLLHILGKLVPSSSLPQAAIALMVVLLSIAFSFLSSK"
     gene            complement(<104574..>105623)
                     /locus_tag="Eint_090920"
                     /db_xref="GeneID:9698412"
     mRNA            complement(<104574..>105623)
                     /locus_tag="Eint_090920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073535.1"
                     /db_xref="GeneID:9698412"
     CDS             complement(104574..105623)
                     /locus_tag="Eint_090920"
                     /note="similar to ECU09_0950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073581.1"
                     /db_xref="GeneID:9698412"
                     /translation="MFKITGTRRTDKSFLDEIQGIPGKSGVDEVIGRLRKLKIFSAVA
                     KTCDGLSVTEEKRSISFSGDTTGKVPKGYLKMKLPNLFGRAENLEVSVSTSKDMSFQF
                     SKPVLAKSLSFLRIFGSRDTMKSPHEEYPHTRASLEVERETQRICVGRERIGYLDQAF
                     IELRKKLGAIDIKSKIGIFDSRPCRLFLKTQAEMILRKAFPRNLFTDIHLSTGTILGE
                     PHIAERYYLGENIRGYRGMSISPSNSGLKIGGNSFFEVSHRMGVSRWDAKGFFFWSLG
                     YVSEDRNITRSFKSIMESHSYKDSECLGASVGLGASVPVMKAKDGPVVGISFAIPLTN
                     NKQIQRLQFGFDMDF"
     gene            complement(<105716..>106171)
                     /locus_tag="Eint_090930"
                     /db_xref="GeneID:9698413"
     mRNA            complement(<105716..>106171)
                     /locus_tag="Eint_090930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073536.1"
                     /db_xref="GeneID:9698413"
     CDS             complement(105716..106171)
                     /locus_tag="Eint_090930"
                     /note="similar to ECU09_0960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073582.1"
                     /db_xref="GeneID:9698413"
                     /translation="MKTAGKRLSALVSFTFNPTVILLLSVFLFSFFVTKAPPVSDLRI
                     REYKAYGRTQVVLFEPSIDLSSQFHFNLKQVFVYVRAIYGGRTDKSEIIWSRIVGWND
                     PQKLRGVFRSTYDIAGDLSDKPCFELRGCYFPRVGWVKDILFCKTAVEI"
     gene            complement(<106316..>106714)
                     /locus_tag="Eint_090940"
                     /db_xref="GeneID:9698414"
     mRNA            complement(<106316..>106714)
                     /locus_tag="Eint_090940"
                     /product="Homeodomain-containing transcription factor"
                     /transcript_id="XM_003073537.1"
                     /db_xref="GeneID:9698414"
     CDS             complement(106316..106714)
                     /locus_tag="Eint_090940"
                     /note="similar to ECU09_0970"
                     /codon_start=1
                     /product="Homeodomain-containing transcription factor"
                     /protein_id="XP_003073583.1"
                     /db_xref="GeneID:9698414"
                     /translation="MKDSRWMMEGEAILGLIKLRRLSDKSYLGLSGYKYKTRVQVYVL
                     KQVFEITPYPPHDTRQNLAILLNMSPRTIQIWFQNSRSVSKDLKKDNSSKDQESQRPS
                     RIKIVSNWNVPIKYILWLVLSYISYPQIGN"
     gene            <107021..>107929
                     /locus_tag="Eint_090950"
                     /db_xref="GeneID:9698415"
     mRNA            <107021..>107929
                     /locus_tag="Eint_090950"
                     /product="serine/threonine protein phosphatase 2A"
                     /transcript_id="XM_003073538.1"
                     /db_xref="GeneID:9698415"
     CDS             107021..107929
                     /locus_tag="Eint_090950"
                     /note="similar to ECU09_0980"
                     /codon_start=1
                     /product="serine/threonine protein phosphatase 2A"
                     /protein_id="XP_003073584.1"
                     /db_xref="GeneID:9698415"
                     /translation="MKELVSKLLNLELLTEIEVENICNKVSEILICEPNIPNKKSPVI
                     VCGDIHGQFFDLVSLFRIDGVPSKKRYVFLGDYVDRGRNSLECILFLFLLKILYPENV
                     TLIRGNHEQSTINRVYGFYEEIMEKYGTPRIWRMINEVFNLMCIGCLIDGRILCVHGG
                     ISPKITSLNQIKRLDRLLPIREESEFADILWGDPYDGKGFQPSPRGSGYLYGEDVVIR
                     FLELNGLTSIVRSHQLVIEGYKFHFPGRNVITVWSAPNYMGKCGNPASILRINETLDI
                     SDKDFCIFKATPQRKEFLTKLEGLDL"
     gene            <107967..>108755
                     /locus_tag="Eint_090960"
                     /db_xref="GeneID:9698416"
     mRNA            <107967..>108755
                     /locus_tag="Eint_090960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073539.1"
                     /db_xref="GeneID:9698416"
     CDS             107967..108755
                     /locus_tag="Eint_090960"
                     /note="similar to ECU09_0990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073585.1"
                     /db_xref="GeneID:9698416"
                     /translation="MFSRLKSPEEERGVDVLKGYAVRTSKHEIKRFLRSMEYRRLPRH
                     LKRIKTWNEDLLVLVDIVEECDPIDSVANLVEEMVKEGFGSKLSGRRQESLIETVSIP
                     KYQPLTDSQYVESAKLWPCIRSCRFEEELDDDYIGSMVRVLKTKRSMAICTGACIIAD
                     GKQELSIHEDTDNVLGHSILKAVEEVSKAQILYLCTGFDAFILKEPCLSCSMALVHGR
                     IKRVFCLKRDPEGPFSRIKINYNKNLNHRYPVYFMDETCADCPM"
     gene            complement(<108841..>109992)
                     /locus_tag="Eint_090970"
                     /db_xref="GeneID:9698417"
     mRNA            complement(<108841..>109992)
                     /locus_tag="Eint_090970"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_003073540.1"
                     /db_xref="GeneID:9698417"
     CDS             complement(108841..109992)
                     /locus_tag="Eint_090970"
                     /note="similar to ECU09_1000"
                     /codon_start=1
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_003073586.1"
                     /db_xref="GeneID:9698417"
                     /translation="MSCRKFNAPRHGSLQFCPRKRSKTIRPSVGAFPADDISQPVHLT
                     GFMGYKAGMTHVIRTKTQVAKNKQLSREVMDAVTVVEAPPMVVYGIVGYERTVTGLHR
                     LPIVTVSYVNDGVLRRMFGNKYMEKEAAAQFCRGEVTESRVEEIKKRAECVRVLVQTQ
                     PEMVKTLGLKKAHIAEIQLNGGSICEKVEWALERLEKEIQIAEVFGENENIDVIGVTK
                     GKGFQGTVKRFGVRKQPRKSRKGIRKVACIGAWHPSRVMYSVARAGQMGFHRRTEKNK
                     RVYMIGNGSTKIKTEFDLTEKAISPMGGFPHYGEVKNDFIMVKGAVVGPRKRVVTLRK
                     SLTQQRPSEELVIKFVDTSSKIGHGRFQTSAEKKAFYGAKKAETVAEVH"
     gene            <110124..>110405
                     /locus_tag="Eint_090980"
                     /db_xref="GeneID:9698418"
     mRNA            <110124..>110405
                     /locus_tag="Eint_090980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073541.1"
                     /db_xref="GeneID:9698418"
     CDS             110124..110405
                     /locus_tag="Eint_090980"
                     /note="similar to ECU09_1005"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073587.1"
                     /db_xref="GeneID:9698418"
                     /translation="MSFHPEYKEYFKQGSTAKIYNGVFEDAGFYDEVDIKEFKYNKEN
                     KTFYYPCPCGDNFEISLEDLKNGEIAARCPSCSLIICTVYEAEDLKMYL"
     gene            <110499..>111248
                     /locus_tag="Eint_090990"
                     /db_xref="GeneID:9698419"
     mRNA            <110499..>111248
                     /locus_tag="Eint_090990"
                     /product="CCCH-type zinc finger-containing protein"
                     /transcript_id="XM_003073542.1"
                     /db_xref="GeneID:9698419"
     CDS             110499..111248
                     /locus_tag="Eint_090990"
                     /note="similar to ECU09_1010"
                     /codon_start=1
                     /product="CCCH-type zinc finger-containing protein"
                     /protein_id="XP_003073588.1"
                     /db_xref="GeneID:9698419"
                     /translation="MAKKQQETKQKSIRDIRKELEEKAFGLKNKKQKAAILKQIESLN
                     LKEQLEKKEKMKKEEKNVPVKQVIPVGVDPKTIQCVNFLNKICPDGDACKFAHKEVKK
                     VEKPKEENASEGPKRICQFLIDALNSGEYGDNWKCPFPKCVDIHRLVEIKENAQVELS
                     LEEYIELSRQSLPEKLTPLTEETFKQWKLRKQKEEKEHARKVKAIATGMKGIELFEAR
                     RELFKDDEEAEDLDYTERCYSESEDEEDHSK"
     gene            complement(<111263..>111649)
                     /locus_tag="Eint_091000"
                     /db_xref="GeneID:9698420"
     mRNA            complement(<111263..>111649)
                     /locus_tag="Eint_091000"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073543.1"
                     /db_xref="GeneID:9698420"
     CDS             complement(111263..111649)
                     /locus_tag="Eint_091000"
                     /note="similar to ECU09_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073589.1"
                     /db_xref="GeneID:9698420"
                     /translation="MYTTDKPEHLEDYRELHVDGRVFYKLKGKKQEAVRKRRYSDQFK
                     DPLFIQKDTNRKLRMMKQFRETHGDLESVIERWKDCVSECISILHTQYNIHPVEIFRA
                     FSLRKWGFDIEEYGCCEDDFLPCKEE"
     gene            <111781..>112431
                     /locus_tag="Eint_091010"
                     /db_xref="GeneID:9698421"
     mRNA            <111781..>112431
                     /locus_tag="Eint_091010"
                     /product="G2/mitotic specific cyclin 1"
                     /transcript_id="XM_003073544.1"
                     /db_xref="GeneID:9698421"
     CDS             111781..112431
                     /locus_tag="Eint_091010"
                     /note="similar to ECU09_1030"
                     /codon_start=1
                     /product="G2/mitotic specific cyclin 1"
                     /protein_id="XP_003073590.1"
                     /db_xref="GeneID:9698421"
                     /translation="MGWRKPERMMKRVFQDITNVSRKNIKLTIHRSSHRRKLVKWLYE
                     VMDDFGYSQVTFSTAVFILDRYTEVRGLDLGKYQLVGISSLFLSAKIEEKRCKEIDDY
                     VHVTDNTYSRREILDKEIEILEVFGFNLMFRLPHSFLKEKYLEKMSSEYTVKQCQEIF
                     FCAFSYVIEKNICGSSMYWIYLEGIKEAEKVLSGHKASEDFRFYLENNRRIKNIFM"
     gene            complement(<112453..>113508)
                     /locus_tag="Eint_091020"
                     /db_xref="GeneID:9698422"
     mRNA            complement(<112453..>113508)
                     /locus_tag="Eint_091020"
                     /product="pyruvate dehydrogenase E1 component subunit
                     alpha"
                     /transcript_id="XM_003073545.1"
                     /db_xref="GeneID:9698422"
     CDS             complement(112453..113508)
                     /locus_tag="Eint_091020"
                     /note="similar to ECU09_1040"
                     /codon_start=1
                     /product="pyruvate dehydrogenase E1 component subunit
                     alpha"
                     /protein_id="XP_003073591.1"
                     /db_xref="GeneID:9698422"
                     /translation="MEKEKYIQCNVQEILATIRVHEVRKEEIDMVHKLKIEEMIYIYK
                     QMMKIRFVDKLMDIEYKKENIRGFCHLSIGQEGIYTALEYMMDDDIVVSSYRCHGIAY
                     VSGCRTREIMQEVLGRQGGVSKGKGGSMHLYNSHFFGGHGIVGAQIPLGVGIAYAIKY
                     KERVLGSKSQKGKVSYVFYGDGAANQGQAWESFNMAMVWKLPIVFVCENNRYGMWTPA
                     ESVSADTNFYLRGGRIPGIRVPHNNIFGLISVLGYARKHSAEKGPIIVQIDTYRLCTH
                     STVDSKETYRSKEEVDRERKNDCMEDIRKRLLEFRSEEELGELERCVLEEVEKDMDAA
                     KKSKPTEESELFKDVFL"
     gene            <113596..>114210
                     /locus_tag="Eint_091030"
                     /db_xref="GeneID:9698423"
     mRNA            <113596..>114210
                     /locus_tag="Eint_091030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073546.2"
                     /db_xref="GeneID:9698423"
     CDS             113596..114210
                     /locus_tag="Eint_091030"
                     /note="similar to ECU09_1050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073592.2"
                     /db_xref="GeneID:9698423"
                     /translation="MASQRILSAVDSINNLLKALPFRPSVRRCHDSFVPKEMVGLLRK
                     RALESTLPILKEIIDGIKLGQKKEDIIDDREICSRREFATGQLRHLRLSMESEFEEGR
                     INKIKDLLNEIEYYEKIGVKPIKKINVGKEMTLKIFQMLSCSGEAPMDPYIGEYLGRR
                     ICFFHESPSEIEISSLRTMLRFLQESGGETAGRRGEDQAYEDLE"
     gene            complement(<114266..>114913)
                     /locus_tag="Eint_091040"
                     /db_xref="GeneID:9698424"
     mRNA            complement(<114266..>114913)
                     /locus_tag="Eint_091040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073547.1"
                     /db_xref="GeneID:9698424"
     CDS             complement(114266..114913)
                     /locus_tag="Eint_091040"
                     /note="similar to ECU09_1060"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073593.1"
                     /db_xref="GeneID:9698424"
                     /translation="MTTTAFKNVRSLSQLVSVLLIVINIPLPFFLIPHLMFVRMESEH
                     LRMGIRGVTTIFRSTSMANITLGLFASCGINSKTRLYMKLYLLTGVLLLFMLITMLLY
                     VRIGYQSDVSRQLGRLYNNASVRNIILYFMECTNQMTCTRIIMKNISMIKYYYITIAI
                     PSLCLNLLNLILIRIATSINIETPPPKRPNFVEKTRVGMNTASLRNKRVVVNGAG"
     gene            <115142..>115948
                     /locus_tag="Eint_091050"
                     /db_xref="GeneID:9698425"
     mRNA            <115142..>115948
                     /locus_tag="Eint_091050"
                     /product="glycosylphosphatidylinositol transamidase
                     subunit Gpi8"
                     /transcript_id="XM_003073548.1"
                     /db_xref="GeneID:9698425"
     CDS             115142..115948
                     /locus_tag="Eint_091050"
                     /note="similar to ECU09_1070"
                     /codon_start=1
                     /product="glycosylphosphatidylinositol transamidase
                     subunit Gpi8"
                     /protein_id="XP_003073594.1"
                     /db_xref="GeneID:9698425"
                     /translation="MSLVFLYALSVAAKNYAILMNSSRGFHNYRHMANVYIFYNVLKE
                     NGFKDDQILIISYENQIEDIRNVDRGGVYIDEDQRIPYSAFTPSSNALADLLNALEGR
                     NIKLKDADESSNVFIYLNGHGNETFLKFGNIHFMTKDDLMARILKLAERVNKILLVLD
                     TCQAEALIDREILPSNVFIVATSKTGQPAISSFSSSLICANVSDNFPYFFFKRFGKGI
                     DRKIRLPDLFSEIAKEPLGSELVFDEEKDFRFEDFFVQNNSAELLPFKER"
     gene            <116010..>116846
                     /locus_tag="Eint_091060"
                     /db_xref="GeneID:9698426"
     mRNA            <116010..>116846
                     /locus_tag="Eint_091060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073549.1"
                     /db_xref="GeneID:9698426"
     CDS             116010..116846
                     /locus_tag="Eint_091060"
                     /note="similar to ECU09_1080"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073595.1"
                     /db_xref="GeneID:9698426"
                     /translation="MEEEGNISASRGRPDKDRWDEYSILNDSSYKGGVTDKGNSLEWK
                     SFEKEECVFSEELPEKIEGLQEEEGSREKKKDWDGEIRKGNDNPIRPRKYVASNTEYD
                     RGEKGSPTSEEAKKEILLENLGVHQNISKQRYEEHIRKLRAASDKYTGEGEEVEDLVG
                     ARKAQTEKEENMRRALKIQENDLWIKDQEIVLLREKVARLEMKMEIEGKEYIEKCIQR
                     GEAAVKILEEEMKKERRELLERIGQETEKSRVLSRRVEGLKKIINELVRKIKRMKQRS
                     EG"
     gene            <116888..>117409
                     /locus_tag="Eint_091070"
                     /db_xref="GeneID:9698427"
     mRNA            <116888..>117409
                     /locus_tag="Eint_091070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073550.1"
                     /db_xref="GeneID:9698427"
     CDS             116888..117409
                     /locus_tag="Eint_091070"
                     /note="similar to ECU09_1100"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073596.1"
                     /db_xref="GeneID:9698427"
                     /translation="MFESEYFKNLLNETTALIANKVEEGNNREEMEARIESNVATLKY
                     LAREITDRDLQSKTLKRIDMLCLEPEEFEMSDVRNRTVGARGSEHSDRMERDILKYTK
                     RLRGKVKEFMESVDMDSRVLEEVTDKMSKNLAGTSSTLKSLKIEGCRIPILGLLTSVT
                     AVFVVMYFVIRFL"
     gene            complement(<117451..>117909)
                     /locus_tag="Eint_091080"
                     /db_xref="GeneID:9698428"
     mRNA            complement(<117451..>117909)
                     /locus_tag="Eint_091080"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073551.1"
                     /db_xref="GeneID:9698428"
     CDS             complement(117451..117909)
                     /locus_tag="Eint_091080"
                     /note="similar to ECU09_1110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073597.1"
                     /db_xref="GeneID:9698428"
                     /translation="MDECDALRYIFGGDLEHYTRDTEHVYKISAEGNSFEFRCSEGYP
                     NTIPEMSSDVEDNILAEVREETKKYISTPMIFDMVRIVVRKLEGSNIVSDVKRISISY
                     NIDDKQKITEEDFMNWKKGTPRAEKPRTGKTGKEIFLERRRSKEDFQDDI"
     gene            <118072..>119571
                     /locus_tag="Eint_091090"
                     /db_xref="GeneID:9698429"
     mRNA            <118072..>119571
                     /locus_tag="Eint_091090"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073552.1"
                     /db_xref="GeneID:9698429"
     CDS             118072..119571
                     /locus_tag="Eint_091090"
                     /note="similar to ECU09_1120"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073598.1"
                     /db_xref="GeneID:9698429"
                     /translation="MENTRWIKAEIKNVNDGSVAREVLANETNSFVRELNHYEKNLKD
                     ILEELENQNITNKEEGISSVKKALEVLETLEKDVSSAVPEETSIWTKDFFKAVDRLRD
                     SCNLSLKSLEEALEKFLAYIDNNSDLKGDLLQKAKLIPLLCASSKLKEFSSGIRKSGT
                     NAFTWFFKFVRRIPVENFKKNINSSLNGLKEKICRVSGSQRATGKQEIREAQKIVDSF
                     LRDVTELQDEYEKTLGLLIRSEISFSDAFETMQGKISNFDGHMSDLEKKIKDIETAFQ
                     PILLSKESHERSLPEDSFLKNIYLVLIIVLCIQGVLWYTDNEKSSAGTVWNMVVYSVA
                     VVGTILYMAWVWGFGGRRWTSAASMVPMMVGLLNLGKRVSCEYGMEMAGLGFVMVCME
                     SLARHGMSSWEILAGLIGNGIVVMGWVSWATMRDRYGERMSQWMCGGLIVFGILMAVM
                     MYMKEGRNVERSTGSYMVFIMTVVVGTAVSYACGKDYRQLASKRMSLKS"
     gene            <119835..>120620
                     /locus_tag="Eint_091100"
                     /db_xref="GeneID:9698430"
     mRNA            <119835..>120620
                     /locus_tag="Eint_091100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073553.1"
                     /db_xref="GeneID:9698430"
     CDS             119835..120620
                     /locus_tag="Eint_091100"
                     /note="similar to ECU09_0570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073599.1"
                     /db_xref="GeneID:9698430"
                     /translation="MISILFLGHAEAATGIPSDLWDSVNYYSLLLPKRPEVALILFVA
                     GLFVNFLGIRAKRCSLSMISFPLLRLSIGSIMNVLKEIVIDKYGSISEAPQMVRNGLE
                     ILKKVDENRFFMIFLSVVLGLVMVFFAKAVIYILMVYLAFHLWGILESSAQGTMEGKL
                     YYIYQTIMLCIGILVLVLVKPITFLIYILIFSVFGSLFIIVGANFGSGLNLHLNQYID
                     MLRKGDFYQDLVENKISVGYISLVTMGTICQILLRKKPTAKAN"
     gene            complement(<120683..>121795)
                     /locus_tag="Eint_091110"
                     /db_xref="GeneID:9698431"
     mRNA            complement(<120683..>121795)
                     /locus_tag="Eint_091110"
                     /product="putative integral membrane protein"
                     /transcript_id="XM_003073554.1"
                     /db_xref="GeneID:9698431"
     CDS             complement(120683..121795)
                     /locus_tag="Eint_091110"
                     /note="similar to ECU09_0560"
                     /codon_start=1
                     /product="putative integral membrane protein"
                     /protein_id="XP_003073600.1"
                     /db_xref="GeneID:9698431"
                     /translation="MPFATNIQGVIRLAAASRAFYIGISYVAYLLLPRFDKSTELIPS
                     NSCMKFLLSWDSIHFLEIMERGYRKTHEAAFFPLLPYLSRCIHKVLPLDPYTVGVLVS
                     CTAFVFSSALLYRITQKRYGNKIAAMSCILFIFNPASIVYTAMYSESLFMLLFLLGMY
                     FIENRDTVRGVLFLSLCGLCRSNAVLFAPFLMCPLSRYTFTKIAVFLLPLAAFQYYTL
                     LMINRANNTYKIFIPYSFIQRTLWEQGLFRFFTYKNIPNVLVGLPFILISLFILREYW
                     NKRCAGSSKAIGILQHFNTDMCAVVLLAQTLITVFLIHWNMYFRFVSFNPLIYWILAE
                     KYYTMNNGLWKKVLFRFYFGFGIAYAILFGCFYPPC"
     gene            <121862..>122683
                     /locus_tag="Eint_091120"
                     /db_xref="GeneID:9698432"
     mRNA            <121862..>122683
                     /locus_tag="Eint_091120"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073555.1"
                     /db_xref="GeneID:9698432"
     CDS             121862..122683
                     /locus_tag="Eint_091120"
                     /note="similar to ECU09_0550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073601.1"
                     /db_xref="GeneID:9698432"
                     /translation="MFVFLLHLLGCLCSEHVFIQEASLLSPYVDEIGRFLNWKTFGEQ
                     VIKVHGKDMFVQLGYSSPNSSGAVVASHPIGSERFGMDLIIEVDSGQKGDTNEGMAIW
                     ISDEETFKEGPCFGRSCSFKGLLVVIKPSGKSYVGVKAGDVMINTSNMAKNFDKVEYR
                     DFSSGEKFVLRIEQKDYELSIYIGEGEDFSLVHSYRYNLVKEGDLLGVSASTDRSSTS
                     FRLIGIESYHLKNMEGKGYAKEDVHSGGRLIWFILAVVVSITAYYLYNIQVKKDN"
     gene            <123022..>124545
                     /locus_tag="Eint_091130"
                     /db_xref="GeneID:9698433"
     mRNA            <123022..>124545
                     /locus_tag="Eint_091130"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073556.2"
                     /db_xref="GeneID:9698433"
     CDS             123022..124545
                     /locus_tag="Eint_091130"
                     /note="similar to ECU11_0260"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073602.2"
                     /db_xref="GeneID:9698433"
                     /translation="MIESPAIKKFIVNYFIEHSQENIDDIAARIDGCLRKRFVENEVV
                     SVVRSGEWGRISRVAGDRYVVSILSLDGGREERLHFSELARKDMAGRTEVKGYLLGIT
                     METPFGRVLKENAFRSIRDSGEVMKCKVPQSQCYEGSFVSRRGVGGTERRKWKTEKEG
                     QGSREKNEERETEGSRAKRASVRKEGTKETSVSSILLVGPSQALEIPGLRKEDIELVM
                     KIFGVVANFGGFFGIQEIDVLSLGRAIVDPWYEDDTICKIHLKLISGLRTEMDSVGME
                     EFVENSKACIEWAKEQGREEDLAGDGGEMEECLEQSLGCGEEGWKKDLRKLIESICDD
                     GDTDIFGIVRSISGRSRALGRGEIRKRLVVIELLMNMFFTTEQFREIIWEKMEESKDL
                     EKKKRELQTRLKRSVGWDGESKEAGEGSRAEMEKELGDTREKIFQLPVNTGVGTVDGV
                     GLLHLGRKIYAAWEGDYYLVGRDRLADLCKKYKAKNKEERHVLESIGQNIEGLKGHL"
     gene            <124808..>126010
                     /locus_tag="Eint_091140"
                     /db_xref="GeneID:9698434"
     mRNA            <124808..>126010
                     /locus_tag="Eint_091140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073557.1"
                     /db_xref="GeneID:9698434"
     CDS             124808..126010
                     /locus_tag="Eint_091140"
                     /note="similar to ECU11_0270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073603.1"
                     /db_xref="GeneID:9698434"
                     /translation="MFVTASLCLTVYLASNIDSIRSNKIPRLGVNFSSAALVIGGVFV
                     GREAISYAINFRKMVSIFYMYRYILERDMEEIRFKDVVSGMIKLEREVHNRDLEEKDV
                     RDIVNHNRLLLLLMMRKFPSIFRPACSRFLLHILHGYIHRIEEGPVEELGDEIRVVSI
                     GIFILSPAISIFFILYYIAKIIEKSQSNMFYVFKKSHRPWFKYMMAKRNEYPHETHRK
                     IQKGAGYLNGFFLSRKRDCIPRVCSGISFLLSCLVFLVGYLILSILVASKPNLSQSLS
                     QDITVFGRTTNIVYLSYLMGGISCCLRCLSIEYGVSNRRKMFAKWCVLMEQTEVLKYC
                     GRRGSLEAIMSKIFVPRIYLFLVEIVSPFIVPFQLEGMRRRLERIRQEFESVGEGEYD
                     RRVSILDL"
     gene            complement(<126038..>127102)
                     /locus_tag="Eint_091150"
                     /db_xref="GeneID:9698435"
     mRNA            complement(<126038..>127102)
                     /locus_tag="Eint_091150"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073558.1"
                     /db_xref="GeneID:9698435"
     CDS             complement(126038..127102)
                     /locus_tag="Eint_091150"
                     /note="similar to ECU11_0280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073604.1"
                     /db_xref="GeneID:9698435"
                     /translation="MITDVLFHPEVLKILHEWKRGREEEVPLDLIALLVEGKQKVDYY
                     WMDKILYSYKKTSKRRKDRVNSLKKAVESNFDVEVSGEGNIYFLKSLDGISKGVRSLL
                     KRARKKKAKDKGISGLERDTEKEEANTSGMLRFIQVEGIKKPSADMLGLFSPICFDKE
                     TAVSMPSSPLSSTIRIRKDIQDPRRLSFIKFSNQLRPPLYGFGGQKHYVKNSLTRLPQ
                     VLDYEEDSDWEDCEDAEVIESTEEESSEEESSCEWIELDSERMEPSRTCRKPCLGFPS
                     CKFTIFPSFCSSWISLPLVEREVFPEELLGELEKELLRCKDLGELVRRFGSKYVVKAS
                     VVSDKLRDLGVLEPHKEINL"
     gene            <127410..>128239
                     /locus_tag="Eint_091160"
                     /db_xref="GeneID:9698436"
     mRNA            <127410..>128239
                     /locus_tag="Eint_091160"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073559.1"
                     /db_xref="GeneID:9698436"
     CDS             127410..>128239
                     /locus_tag="Eint_091160"
                     /note="similar to ECU09_1530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073605.1"
                     /db_xref="GeneID:9698436"
                     /translation="MNHINRIRDILINLDSQSSLHEETVAECALVYYYNAVSKFLNGI
                     LFYEEKLNEVLESLNNKLNSQSEKGINAVKETLDTLRRLKETIQPKIECPFNQLSHPP
                     ELTNIEILEYNFKTFEEYFKAIDRMVSSEGQIPFEEFKDALRNVLPYVDYPLTHSTGS
                     HSIVLKNVFLQLLGEYNVSAVFENTCLNKYYENLRIIGRKVLQKHFESLIKSLVSENW
                     KNEIEKELSALEREVSLAYKHQRKRIEQGIQDARAVLNSLSQDVTELQDEYERIFGLL
                     "
     gene            complement(<128655..>129173)
                     /locus_tag="Eint_091170"
                     /db_xref="GeneID:9698437"
     mRNA            complement(<128655..>129173)
                     /locus_tag="Eint_091170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073560.1"
                     /db_xref="GeneID:9698437"
     CDS             complement(128655..129173)
                     /locus_tag="Eint_091170"
                     /note="similar to ECU09_1520"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073606.1"
                     /db_xref="GeneID:9698437"
                     /translation="MRKIIYEFEQCDPKKCSGKKLIKQNKIEPIKKNKNFKGVVLSPD
                     ADQSISPADRDVIERFGIGLIDCSWAQLDSVDFKRLPRKHNRLLPFMVAANPVNYGKP
                     FKLNCAEALSASLYICGFKEEAYEILNEFNYGNEFYKLNEDLLEEYSKCTSSAEVVEV
                     QNRFLESQSKKE"
     gene            complement(<129205..>130392)
                     /locus_tag="Eint_091180"
                     /db_xref="GeneID:9698438"
     mRNA            complement(<129205..>130392)
                     /locus_tag="Eint_091180"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073561.1"
                     /db_xref="GeneID:9698438"
     CDS             complement(129205..130392)
                     /locus_tag="Eint_091180"
                     /note="similar to ECU09_1510"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073607.1"
                     /db_xref="GeneID:9698438"
                     /translation="MDISDLLERCKDKAFVNDNKEQIRTKMIQQPLRDQVRSLLGTKR
                     NTAIVRLIEAVEAPADELVPSIEDRKNINQYVYSTYYYLYKMGLIRREKFEDVKKHFQ
                     CMKNYEKMFEDTENSFIISKIEADRRRDKMIKREFNKASDTKEEIKSLLIELPEITTK
                     EVCEIKDGLTSVRSVFVIDLDPIFGIGGLRCQAKEETSRRISEIRDILFCIDNSCSRI
                     ITLGSLGEEDGGEGHEATTLRNLKRDKYHRFERIFNSSERFKFTCTPLFYSVDRLLKS
                     RITRLYDSVVKLHRTKQTVYFVSARPLPQILAELLFFEYSSFDIRTVVSTKDVSFDVY
                     KEIQRKEDARVVAVGGEPSFYQEKGNIYKIGYENFRKMVEGILEPDESMERDSKNLSV
                     SSA"
     gene            complement(<130468..>131100)
                     /locus_tag="Eint_091190"
                     /db_xref="GeneID:9698439"
     mRNA            complement(<130468..>131100)
                     /locus_tag="Eint_091190"
                     /product="putative methyltransferase"
                     /transcript_id="XM_003073562.1"
                     /db_xref="GeneID:9698439"
     CDS             complement(130468..131100)
                     /locus_tag="Eint_091190"
                     /note="similar to ECU09_1500"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_003073608.1"
                     /db_xref="GeneID:9698439"
                     /translation="MEDPNEFEGEFVHKFYNENSREFSATRRKHWKMTETFLDRYWTA
                     DSIVLDAGCGNGRSFLVPGIVGLDYCWGLLRDGKAVKNYGLIRGDVLELPFVDCSFDL
                     VLSVGVIHHLSTDCRRKKAMEEMRRVLRDGGKMLVYVWGSSVSGKRKFSKIIGGSEQD
                     YFATWNLRDDAKRYYHLYGMEDLVELCKSSGFKVLDHGPEEESLFVVLEK"
     gene            complement(<131167..>132546)
                     /locus_tag="Eint_091200"
                     /db_xref="GeneID:9698440"
     mRNA            complement(<131167..>132546)
                     /locus_tag="Eint_091200"
                     /product="putative protein phosphatase"
                     /transcript_id="XM_003073563.1"
                     /db_xref="GeneID:9698440"
     CDS             complement(131167..132546)
                     /locus_tag="Eint_091200"
                     /note="similar to ECU09_1490"
                     /codon_start=1
                     /product="putative protein phosphatase"
                     /protein_id="XP_003073609.1"
                     /db_xref="GeneID:9698440"
                     /translation="MIDNEVSNLVEKLRGRMHLSVEKLELLVGVDPKLNELLVEYLAA
                     LAPDKGHLIICELLLIEEPERIVPVIRRIFESFPDEVDRFIKKLLKSPFYVQRQAIPS
                     LIVNMEYKEAKEALRRCLKDPVAAVARKAALSLEEYKTIPFDDDELVEIVNDLHGSYS
                     EWIQCASSCVIPLIKRQTKFVSEICTSKSWRRRYAIAKEIRRLNVSDRAAVYSHLSQD
                     PEEEIRICLAGNMEHVEGWDRLVPLFLKDSSPGVRALIIQMIGNREEFQEMLKDVITD
                     TSWEVKKALLCVQRVDTYKSIVIPLINTLNSTPNWRTRKEILESISCASKQDEKLLKE
                     FLGRHLLGYLKDKVYEVRAEASKVIGELVSIYPWTVEWLPEIEAISSSKSYLYRITSV
                     EAALSFDKAHGTGFGKKLLSDPIENVKLCTLERIDAQEMDEGIKEIVCRLCDSSDSEI
                     RRAAKGLLK"
     gene            <132663..>133505
                     /locus_tag="Eint_091210"
                     /db_xref="GeneID:9698441"
     mRNA            <132663..>133505
                     /locus_tag="Eint_091210"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073564.1"
                     /db_xref="GeneID:9698441"
     CDS             132663..133505
                     /locus_tag="Eint_091210"
                     /note="similar to ECU09_1480"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073610.1"
                     /db_xref="GeneID:9698441"
                     /translation="MKYKITSKRLDEKILAVHVNGAVYTGGTSRTLVNQDTGEVMCRC
                     RKSIRSIASHGRYICCASYDCTAVLFHDGKVVDVIEGPDTEIKCVGFSEDGRYLAMAT
                     RGKSVWVVKIDPEIEIDEIIEDHLHDVKGCVFHKGFLFTYGYDNTIKIYERFDYDDSW
                     ELVQSISEKNTVWCVIFHGDKMVCSTEEGTISSYVLRNGWELEACKKLSIFPIYSICS
                     VGRDMAYVLNRNNIGIIDSNLNLTTTIEDIHEDFINGIAYDEGRGRIISGGDDGILNV
                     IEMF"
     gene            <133551..>134183
                     /locus_tag="Eint_091220"
                     /db_xref="GeneID:9698442"
     mRNA            join(<133551..133654,133730..>134183)
                     /locus_tag="Eint_091220"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073565.2"
                     /db_xref="GeneID:9698442"
     CDS             join(133551..133654,133730..134183)
                     /locus_tag="Eint_091220"
                     /note="similar to ECU09_1470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073611.2"
                     /db_xref="GeneID:9698442"
                     /translation="MQLTRKTNQLAIPDLSGKVTVKDLLEAFSKYEKEITSVKLSKQR
                     RSRDEDLKVGYVEFETVEDTEKAYGEGSIKVGGEMKALHYAKRKDQRMRERVVVSNKK
                     VYISGIPEDTDKDELSALLGNCRISGGDKGKSYLFAEYDNSEEQEKALNRINNSKIKG
                     SKLFATQAYEKANIGRTGRKRSDSN"
     gene            <134268..>135131
                     /locus_tag="Eint_091230"
                     /db_xref="GeneID:9698443"
     mRNA            <134268..>135131
                     /locus_tag="Eint_091230"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073566.1"
                     /db_xref="GeneID:9698443"
     CDS             134268..135131
                     /locus_tag="Eint_091230"
                     /note="similar to ECU09_1460"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073612.1"
                     /db_xref="GeneID:9698443"
                     /translation="MSCFDSTLVVETDAVKDFKLPHTRQMILVKNVSSIQSSPFPKYL
                     HVFGRSCMSYQLAPFKLLRTFEYSEDVMDAVAIRGKMAVLSRDSIVVWNKGKEQVIAG
                     KFDGRLSEVDGCLGVQERAKLSVYSLETLEVMKVYKANAHCSIRDVLVTSLDNLVSLY
                     FKGGKILEISMPEAICKLCTDPLLTNIYCGTGSGTIFCCNTSNGEPSSMKYHRSQVVG
                     LGISFCGKYLYSADMEGLVCIWDTKFNTVVGKVSMESEIRRMKVVYVSEWRKALDTPE
                     DDLIIPGGTTK"
     gene            complement(<135213..>135821)
                     /locus_tag="Eint_091240"
                     /db_xref="GeneID:9698444"
     mRNA            complement(<135213..>135821)
                     /locus_tag="Eint_091240"
                     /product="GTP-binding protein"
                     /transcript_id="XM_003073567.2"
                     /db_xref="GeneID:9698444"
     CDS             complement(135213..135821)
                     /locus_tag="Eint_091240"
                     /note="similar to ECU09_1450"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_003073613.2"
                     /db_xref="GeneID:9698444"
                     /translation="MAAPRIDYRYKIIVLGESDVGKTCLLHKYKEDDFKQSLMTTIGV
                     DTVSKSIVLNGKNIMLNIWDTAGQERFFSITKSYYRNADGILLIFDISDERTFSCVDR
                     WFGRIREETGGVPLFLVGNKRDKVDSASYKAMEGRFREKADEMKARYYTTSAKTGENV
                     NNIFEDMAMILLKKQALGQKWDIDSPLSSRGNPNRKVNSKCC"
     gene            <136007..>139300
                     /locus_tag="Eint_091250"
                     /db_xref="GeneID:9698445"
     mRNA            <136007..>139300
                     /locus_tag="Eint_091250"
                     /product="phospholipid-transporting ATPase"
                     /transcript_id="XM_003073568.1"
                     /db_xref="GeneID:9698445"
     CDS             136007..139300
                     /locus_tag="Eint_091250"
                     /note="similar to ECU09_1440"
                     /codon_start=1
                     /product="phospholipid-transporting ATPase"
                     /protein_id="XP_003073614.1"
                     /db_xref="GeneID:9698445"
                     /translation="MTDLMGRFRHISKEQRRRYPPNIIRNQKYKWYTFIFAVLRLQFS
                     HFFNTFLFFVCMTQLKKEYLVSSLVASVGPWAMVLMFSLFKEGVEDYKRYERDKVTNN
                     QLYAKLTSQGFVRVPSSRIEVGDLILLEKNERVPADMVLLKASDVSGNVFVRTDQLDG
                     ETDWKLKLSIPRIQSATFDEVRRLSILAEQPNKNIYSFVGKIKIGRFSPEELEEVEEE
                     DGEKERFASWLERFLEFDFGREESEADEMEKPRDVSWVYSSSTQSSEENGSRENSLKT
                     PSEVSENSVSSETAEGLEVGNESNIGSEAGDIDASLRDQEGGENIAEVLNCENMLWMN
                     TVVATCSVLGCVVYTGKDAKAMLNTTQPRNKIGKIELELNGYMKVLGIGCMVLAGVFT
                     YMRGLESRPDIIFIRFLVLFSSVIPISLRITVDWARYCYGRYISRDEKIEGAMMRSNG
                     LPEELGRVSYFLTDKTGTLTKNEMEMKKIHLGTICYTKELNREISKNLAKVLNSRSDG
                     KKVFSRGKKNINARVYDLVQALSVCHNVTPVVSENEVSYQASSPDEVAIVQWTECVGM
                     KLYKRDRSTIVIRDPLNDEQEYRVLYTFPFTSETKRMGIIVRYNEEIIFFLKGADVVM
                     KKIVKGNDWVEEEADNMARDGLRTLVIAKKVLSKKEFETFEEMYNKAWMSLVDRAEAI
                     NKAMETIENDMSVLGITGVEDKLQEDVKVTLENLRNAEMKIWMLTGDKIETAISIARS
                     SRIFHRGTSYLVISNASSVGDVKTKLDLLRGSGYNSLVIDGQSLSFVIESCMDEFIEV
                     VSGLESVVGCRYTPTQKAAVARELKRKTKKCVCCIGDGGNDVSMITEANVGIGIVGKE
                     GNQASLAADFSINKFCHVSDLLFWHGRNSYQRTAKIAHLIIHRGLTLTVIQAIFCSLI
                     YFVPVGLFRGELLMMFITVYTFLPIFSIICSSDISRSVVVKFPELYKELVENKLLSFR
                     HFSVWILISFYQGTIMMITFYLLKQEFFIISTLTFTSLIINELLMVILTTTRMTSLVF
                     ISSGMSLAIYVVYFILRKGLLRYQKPFYLFLLKIVVVNALAILVSVIQKLWTKYMSPP
                     TYSKLEVLV"
     gene            complement(<139374..>139919)
                     /locus_tag="Eint_091260"
                     /db_xref="GeneID:9698446"
     mRNA            complement(<139374..>139919)
                     /locus_tag="Eint_091260"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073569.1"
                     /db_xref="GeneID:9698446"
     CDS             complement(139374..139919)
                     /locus_tag="Eint_091260"
                     /note="similar to ECU09_1430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073615.1"
                     /db_xref="GeneID:9698446"
                     /translation="MNTKLRISILPFFLMHVLCSDNMNEALSIIKNLEDLKICDLHDM
                     DLEFISPEMMEALKRNKKIRKLDLSDNKLKELPSDFGCLEWIEEVDASNNRIRRLPRS
                     MKNMKNLKVLNLSNNRLRFFPWYLLKLRKEGIGSLRMLDLRCNPFYRIYHTSIARFLL
                     NLFFGEIVKTGTEREQVSSTD"
     gene            complement(<139982..>140719)
                     /locus_tag="Eint_091270"
                     /db_xref="GeneID:9698447"
     mRNA            complement(<139982..>140719)
                     /locus_tag="Eint_091270"
                     /product="putative U2 small nuclear RNA auxillary factor"
                     /transcript_id="XM_003073570.1"
                     /db_xref="GeneID:9698447"
     CDS             complement(139982..140719)
                     /locus_tag="Eint_091270"
                     /note="similar to ECU09_1420"
                     /codon_start=1
                     /product="putative U2 small nuclear RNA auxillary factor"
                     /protein_id="XP_003073616.1"
                     /db_xref="GeneID:9698447"
                     /translation="MATGRDTCLFYSKTNACRYGLECTKAHRIPIRGKVVVVKGMYLY
                     PKNDPESTLSKESIQIHLDLFYEDWFSELSIRYGSIRRLVIASNSSSQLLGNIYIEFE
                     EEKTALRCVEEIGKRYYSGRRIAAELGNCYRIDDGMCTDNEKEKCEKGEKCGFIHSAR
                     VSTDLAEELFESQGLLYGEKGTKSTWFDGGAKASGENLRKGPIRNGNPHESYGMSRRR
                     LDGQGNHNHSKRTKGRRDEEYPRVRRW"
     gene            <140797..>141258
                     /locus_tag="Eint_091280"
                     /db_xref="GeneID:9698448"
     mRNA            <140797..>141258
                     /locus_tag="Eint_091280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073571.1"
                     /db_xref="GeneID:9698448"
     CDS             140797..141258
                     /locus_tag="Eint_091280"
                     /note="similar to ECU09_1410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073617.1"
                     /db_xref="GeneID:9698448"
                     /translation="MESEVKISITTLAKEIYSGVLGRYASGKYVILKNVVRRHPGSTD
                     NRRDVFVYPVMRFKIENIGEIGITWTPNSGGKENGLLVLESLGSKARILEAGGDKGIC
                     SRSSGSPEGLEGTRGEVVERILDTHRSPRIERLFRRLDLDCMPSRATRQIR"
     gene            <141399..>142133
                     /locus_tag="Eint_091290"
                     /db_xref="GeneID:9698449"
     mRNA            <141399..>142133
                     /locus_tag="Eint_091290"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073572.1"
                     /db_xref="GeneID:9698449"
     CDS             141399..142133
                     /locus_tag="Eint_091290"
                     /note="similar to ECU09_1400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073618.1"
                     /db_xref="GeneID:9698449"
                     /translation="MSTTNSDEDQKRILYESLCTVEAENLSEACTNAIEGKRTETGKK
                     AHIIRFIGEMCCCGDMFDTDAFINESVFSAMAYIEKDISGVKDVFISAESEENSNNCA
                     KLLELNEKIEYSSVHPKDVAMGFRIYTEENIKNVIPHNVRKKVIEAYRNNDEEKKKTI
                     IPRIPFVIGDSKRMFLKSLKSIFLAIEANNKDEGANVEKIYRIFGSLIIRRPDGMLDT
                     DGETLKMILMDLMKADFDEFPVSFYS"
     gene            complement(142202..142274)
                     /locus_tag="Eint_091300"
                     /db_xref="GeneID:9698450"
     tRNA            complement(142202..142274)
                     /locus_tag="Eint_091300"
                     /product="tRNA-Arg"
                     /note="tRNA Type: Arg, Anti Codon: CCT, Cove Score: 75.95"
                     /db_xref="GeneID:9698450"
     gene            <142365..>143645
                     /locus_tag="Eint_091310"
                     /db_xref="GeneID:9698451"
     mRNA            <142365..>143645
                     /locus_tag="Eint_091310"
                     /product="TIP49-like DNA helicase"
                     /transcript_id="XM_003073573.1"
                     /db_xref="GeneID:9698451"
     CDS             142365..143645
                     /locus_tag="Eint_091310"
                     /note="similar to ECU09_1390"
                     /codon_start=1
                     /product="TIP49-like DNA helicase"
                     /protein_id="XP_003073619.1"
                     /db_xref="GeneID:9698451"
                     /translation="MAKNSNIAIHSHVKSLGLDNLGRPLDVPDAVVGQEDAREAAGLI
                     VEMVRTKKMSGRAVLISGPAGCGKTALAVGISEELGPGTPFTSMSGSEIYSSEVKKTE
                     VLEEALRRSILVRMRELKDVYEGEIVDLRIVDEENPLSTHGRRVKEIFVTLKTSKESK
                     KLKLAPSLYEQIDKQRIVNGDVVYIEVNSGVIKKLGRSEAHMNDFDLEAEAYVPIPKG
                     EVLKRKEVVQSVTLHDLDMANARPSGQDMLSLVFRILSPKKTEITERLRSDVNKMVNE
                     YLEKGNAEIVPGVLFIDEVHMLDIECFTFLHKVIESPLSPTIVFASNRGMAPIKGSGG
                     LLGPFGITKDLLDRVVIISVKSNSSESNRKIIEMRLKEEGLEMDDDGLVFLASLSSSR
                     GLRYCISLIPLLKTYGRSVGVRDVEEVSELFHDG"
     gene            <143687..>144955
                     /locus_tag="Eint_091320"
                     /db_xref="GeneID:9698452"
     mRNA            <143687..>144955
                     /locus_tag="Eint_091320"
                     /product="nonsense-mediated mRNA decay protein"
                     /transcript_id="XM_003073574.1"
                     /db_xref="GeneID:9698452"
     CDS             143687..144955
                     /locus_tag="Eint_091320"
                     /note="similar to ECU09_1380"
                     /codon_start=1
                     /product="nonsense-mediated mRNA decay protein"
                     /protein_id="XP_003073620.1"
                     /db_xref="GeneID:9698452"
                     /translation="MILCCKCGILIEPRLMNMCDRCLVTEVTISSKVKRNLVVERCRG
                     CERYLQPPKSWEGFSWGSKELLLFLIKKNKTLNGLCIVDSNFVYTEPNSKRIVVALTV
                     SECGVEQPLEIKYVIKNMQCSDCAKVEAKQFWNSLVQVRHRGRHKRMMIYLEHLVLKN
                     NAYGDTSNIKQRKEGLDFYYIDRNAASRMVSFLQSVLPVKTKVSERLISKDVHTSKCN
                     YKFSYSVEIAPLCKDDLVVVGRSLSQSLGIGSLVLVQKIATSIVLFDVGLMKSVRIAG
                     SFYWSNQDEFKVLMSSKDFTKYSVVMRDERRRKGGIGYDLTVTSDGSVFSEARFHLGN
                     VEEDDEILGYDLRHLNLTVECEEKPEVVLVRKMPRDDVVWKIDVPQESQMEYRLFVED
                     VENDKEMVEGLCLVEEKGGIDKKIEAFRVS"
     gene            <145021..>145317
                     /locus_tag="Eint_091330"
                     /db_xref="GeneID:9698453"
     mRNA            <145021..>145317
                     /locus_tag="Eint_091330"
                     /product="glutaredoxin"
                     /transcript_id="XM_003073575.1"
                     /db_xref="GeneID:9698453"
     CDS             145021..145317
                     /locus_tag="Eint_091330"
                     /note="similar to ECU09_1375"
                     /codon_start=1
                     /product="glutaredoxin"
                     /protein_id="XP_003073621.1"
                     /db_xref="GeneID:9698453"
                     /translation="MKGGELEKALDKNENLIVSKEGCPFCLDAVEILNEWKIKFDEVR
                     NIENEELSKEIERRYGISTFPKIFLKRRFVGGASDLRKYVTKKEFVDAFGSERK"
     gene            <145380..>145865
                     /locus_tag="Eint_091340"
                     /db_xref="GeneID:9698454"
     mRNA            <145380..>145865
                     /locus_tag="Eint_091340"
                     /product="translation initiation factor 5A-like protein"
                     /transcript_id="XM_003073576.1"
                     /db_xref="GeneID:9698454"
     CDS             145380..145865
                     /locus_tag="Eint_091340"
                     /note="similar to ECU09_1370"
                     /codon_start=1
                     /product="translation initiation factor 5A-like protein"
                     /protein_id="XP_003073622.1"
                     /db_xref="GeneID:9698454"
                     /translation="MENLRFEETPTSPKDIRPGNYIKVEVNGQMRSAQVVDTSSVKNG
                     KHGAAKTTIASKILCTGSNHKGIYTANDSIIVCRPEKVQLKLIDISGSTITFSDSNGS
                     FDSVDVSGKMSSEDISKIAQSVEGSSSESFDLSLRVLPDFYKLESIRKSGGPSGSTAG
                     G"
     gene            <145977..>148061
                     /locus_tag="Eint_091350"
                     /db_xref="GeneID:9698455"
     mRNA            <145977..>148061
                     /locus_tag="Eint_091350"
                     /product="DNA replication licensing factor Mcm7"
                     /transcript_id="XM_003073577.1"
                     /db_xref="GeneID:9698455"
     CDS             145977..148061
                     /locus_tag="Eint_091350"
                     /note="similar to ECU09_1360"
                     /codon_start=1
                     /product="DNA replication licensing factor Mcm7"
                     /protein_id="XP_003073623.1"
                     /db_xref="GeneID:9698455"
                     /translation="MNQVSELRKFETSINYQLDKDRLSKFLLFHEEDGELTYVNRIRE
                     SEGCVEIDTEDIAVYDDSGLVSRIEGNAMSYMNLLYTVIDEILLENGEAFGGEEPEDV
                     FFHHRVSRLKERFPEKNVMDVFPPFLLRRYSLVLKPRRNSRVYSVRGLKSMHIGSLVR
                     VSGVVTKASQVKPSIRVATYICENCGAETYQQVEGDVFDLLEECGSEKCRIRNVRGTL
                     VLVTRGSKFIKHQTVYIQELTGDIPRGCIPRTLVMECYSSLAEKCRPGDVVVAGGVFM
                     PKPYHGIKKLKAGLLADTYLHATSIERVGTSAPKLSGKVKKYPVEQMVRSIAPEIFGM
                     EDIKKILLLMLVGAPGKVRSDGMRIRGDINVLLVGDPGIAKSQLLKTCVKISRRGVYT
                     TGKGSSGVGLTASVTKDQITGEMVLEGGALVLADGGICCIDELDKMNEVDRISIHEVM
                     EQQSVSISKAGINTSLNARCCVLGAANPVRGKYDIRQSVEYNIGLPCALLSRFDVVAI
                     LRDEPDLERDESLANHITSLHLEEETESISYDEIRQVIDEAKRIDPVLPLHLSNRLTD
                     AYVKARKESPYVTPRYLLSLIRLSLAHCRLRLSTEVEEDDINEALRLMEVTKIPIPKK
                     KREEVSSKREIYNLILSLAIEEGNKRYVKLARLWEATKNKYSTSEVEDVISDFASCGI
                     WIRNNEELVIFN"
     gene            complement(<148087..>148473)
                     /locus_tag="Eint_091360"
                     /db_xref="GeneID:9698456"
     mRNA            complement(<148087..>148473)
                     /locus_tag="Eint_091360"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_003073578.1"
                     /db_xref="GeneID:9698456"
     CDS             complement(148087..148473)
                     /locus_tag="Eint_091360"
                     /note="similar to ECU09_1350"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_003073624.1"
                     /db_xref="GeneID:9698456"
                     /translation="MSAELANMCKAINNASRAGKRQLLLKFSTEEMRMFLLQMLKYGY
                     ISGFSYIHDKRSGKSIIDLNGRLNRCGAISPNYIVKRDGIENFRERLLPARQFGHVLF
                     NTSKGILDHKECLTENVGGRILGYFY"
     gene            <148563..>149006
                     /locus_tag="Eint_091370"
                     /db_xref="GeneID:9698457"
     mRNA            <148563..>149006
                     /locus_tag="Eint_091370"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073579.1"
                     /db_xref="GeneID:9698457"
     CDS             148563..149006
                     /locus_tag="Eint_091370"
                     /note="similar to ECU09_1340"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073625.1"
                     /db_xref="GeneID:9698457"
                     /translation="MIFLLIFTVVLAIFIRIVAHLITRRGPRVIKFVGPRGAGKTKTL
                     NALMGIHGRTVPTLESYKVIYKGMEIHDVIPKDGSFFERYGIDDPSATYFFFLRSMDD
                     SYGIPGAKGLNVRLVYCQPYDGKEALERGVLVLDKDLTHIEKYFS"
     gene            complement(<149032..>149961)
                     /locus_tag="Eint_091380"
                     /db_xref="GeneID:9698458"
     mRNA            complement(<149032..>149961)
                     /locus_tag="Eint_091380"
                     /product="replication factor C"
                     /transcript_id="XM_003073580.1"
                     /db_xref="GeneID:9698458"
     CDS             complement(149032..149961)
                     /locus_tag="Eint_091380"
                     /note="similar to ECU09_1330"
                     /codon_start=1
                     /product="replication factor C"
                     /protein_id="XP_003073626.1"
                     /db_xref="GeneID:9698458"
                     /translation="MDLLVNKYRPNEVQDVIGNQMTVELVSLIIDSKDMPHLLFAGPP
                     GTGKTTCAKILARKLLPSKEGLLELNASDERGIETVRTTIKSFAQRRIKDCSFKVIIL
                     DEADSMTTAAQQAMRRVMEVHSSECRFILICNTLTKIFEPIQSRCAILRFDRIENSMI
                     LERLREISKDEGIKISKEALDLIVELSDGDMRQSLNILQACISSSETIDQGYIIKIIG
                     LPSPKRIERVLERLLRNEAEEALKMFDEIWDEKFDPLDLINSFFRAAKNMENYELLKV
                     IGLANLRISEGVNSRLQFYGMFHDILDMGNKKP"
     gene            <150146..>152005
                     /locus_tag="Eint_091390"
                     /db_xref="GeneID:9698459"
     mRNA            <150146..>152005
                     /locus_tag="Eint_091390"
                     /product="endochitinase"
                     /transcript_id="XM_003073581.1"
                     /db_xref="GeneID:9698459"
     CDS             150146..152005
                     /locus_tag="Eint_091390"
                     /note="similar to ECU09_1320"
                     /codon_start=1
                     /product="endochitinase"
                     /protein_id="XP_003073627.1"
                     /db_xref="GeneID:9698459"
                     /translation="MLVFFLGLTFAKDACVSGSAECVANTLRVCGIKNQWIYVDCPSG
                     TECAVKGSEISCVPNGGKGELESHDKKKPKKRDESEASQSLEEKQDSGDDLGESPEDN
                     RQSEDDKPEEPNEEQKKKVHGKKGDEDQEGKKKTKKEKDSDEKTKDKHLGLGEDKKKN
                     TKGNKKKEPKVVTKTVSVLKKETTTTVTVLKTVVQKQQPTEIKLEYTSSDIESKVKPV
                     GSSSPGQGQALQGSSRNVSKAGHPTSLPGIESMGGASSPGKAGQGATPAAPSSSGSPS
                     SGKGTSVGSSSSSAPSSPTSNKSSSAPSSQGSTPESQGKAQTAGGGTGGATPSTGSQG
                     GKGAESGKSSGGSAGKTTGGTSSSAGSQEKKETGGSAGGSTQASGGSQGQKESEGSKQ
                     PEGGAGGTSPSTESQGGKKTESGKSSSSEGKGGSLLSADKLTKVMTNLGYSPNSEYID
                     AVVLGVNERFSDLNQAVMFVAQCAHESGGYQYIEEIACAGGTGCAGQYGTGAPGKSYH
                     GRGFIQLSWPENYKAAGEALGRGDELYNNPEKVVENPSLAVDVSIFYWESRVADAPGV
                     KENHFGATTKAINGALECTGSNIDKSKKRYEIYTALVEEFGVSNPADESGCYS"
     gene            complement(<152056..>152922)
                     /locus_tag="Eint_091400"
                     /db_xref="GeneID:9698460"
     mRNA            complement(<152056..>152922)
                     /locus_tag="Eint_091400"
                     /product="histone acetyltransferase"
                     /transcript_id="XM_003073582.1"
                     /db_xref="GeneID:9698460"
     CDS             complement(152056..152922)
                     /locus_tag="Eint_091400"
                     /note="similar to ECU09_1310"
                     /codon_start=1
                     /product="histone acetyltransferase"
                     /protein_id="XP_003073628.1"
                     /db_xref="GeneID:9698460"
                     /translation="MDLNDGEIDMLKKDPEFREYFDTIKRKNQSTEPIPPMKFQGRSV
                     EVTQAVFGDNLLDFPNRVWLFSDKNTIYICDRCLLQCWDSMSFASHRRSCSLEIPGKC
                     IYSDREEDISVIEIDGEKERVLCQRICIIGKAFIKRKTLYLDVDGYLFYVLFSEGKAT
                     GFFSKEKESIEHNLSCLLILPPYRAKGYGSLMVDLSYILEAGTPEKPLSGRGRALYKR
                     YWRNKVLETLQNKNGQEVSISNISAESGLSVNDTIHGLELLDIDPESHTYDVIGKAPI
                     PSRKCKRNCLIL"
     gene            <152970..>153380
                     /locus_tag="Eint_091410"
                     /db_xref="GeneID:9698461"
     mRNA            <152970..>153380
                     /locus_tag="Eint_091410"
                     /product="DNA repair protein Mms21"
                     /transcript_id="XM_003073583.1"
                     /db_xref="GeneID:9698461"
     CDS             152970..153380
                     /locus_tag="Eint_091410"
                     /note="similar to ECU09_1300"
                     /codon_start=1
                     /product="DNA repair protein Mms21"
                     /protein_id="XP_003073629.1"
                     /db_xref="GeneID:9698461"
                     /translation="MEEHITRRAEALKIAKSIIMKSDNPPEELVRKILIHQELLSNRD
                     IILNDDFYSILTSKANVRPEMVGLARKKEQVECVRVEKKMICPISQKEVTEAYVGECG
                     HVLEEKEAIKYIRNNSRAICPQIGCNKRLVRKKR"
     gene            <153451..>153942
                     /locus_tag="Eint_091420"
                     /db_xref="GeneID:9698462"
     mRNA            <153451..>153942
                     /locus_tag="Eint_091420"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073584.1"
                     /db_xref="GeneID:9698462"
     CDS             153451..153942
                     /locus_tag="Eint_091420"
                     /note="similar to ECU09_1290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073630.1"
                     /db_xref="GeneID:9698462"
                     /translation="MREKMYRERRQPKNRRMYGRLEKKKDLVKRLSKIGKQKEEIRRA
                     KEEIKNKSGQEYFFGYYSVERNGANIYKIDRPTLEELRKMKAYVDNEIQRSRMKLERY
                     IPRPCGTHIKFEEDSSSKNDTDIGFEHNEETRKEFEKYLEDLIGKRREIQERIDELKN
                     QKI"
     gene            complement(<153996..>154511)
                     /locus_tag="Eint_091430"
                     /db_xref="GeneID:9698463"
     mRNA            complement(<153996..>154511)
                     /locus_tag="Eint_091430"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073585.1"
                     /db_xref="GeneID:9698463"
     CDS             complement(153996..154511)
                     /locus_tag="Eint_091430"
                     /note="similar to ECU09_1280"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073631.1"
                     /db_xref="GeneID:9698463"
                     /translation="MSLSDRIIHTLKEMDRPSDFQIYRDILAAKPKLPPGKWNDLCRL
                     AKTSKIYNILRLDLSRKEAEVLGSALKKVSLNHVDDMIDILVKKRDENTPVLLRYILE
                     KKKKISIDPVQRYFCGELNRMVTLKHLKLLYVMHRNYPASINPTILDFCRSNGHPICK
                     EVLESAMDVIE"
     gene            <154558..>154755
                     /locus_tag="Eint_091440"
                     /db_xref="GeneID:9698464"
     mRNA            <154558..>154755
                     /locus_tag="Eint_091440"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_003073586.1"
                     /db_xref="GeneID:9698464"
     CDS             154558..154755
                     /locus_tag="Eint_091440"
                     /note="similar to ECU09_1275"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_003073632.1"
                     /db_xref="GeneID:9698464"
                     /translation="MEDQQEFFGKVTQVLGRTGGSGLLTQVKMELIHNKRMIQRAIKG
                     PISEGDFVEILECEREHRRTR"
     gene            <154863..>155855
                     /locus_tag="Eint_091450"
                     /db_xref="GeneID:9698465"
     mRNA            <154863..>155855
                     /locus_tag="Eint_091450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073587.1"
                     /db_xref="GeneID:9698465"
     CDS             154863..155855
                     /locus_tag="Eint_091450"
                     /note="similar to ECU09_1270"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073633.1"
                     /db_xref="GeneID:9698465"
                     /translation="MCRQNEIYGKQSEEEGHLNYGEIERKRRERVDELAYRLLVEREK
                     ANRSIEEELQRLFELEKDPVDTETHSSEEPAKEIETYSPVILEEHGLSEELSKNNSGM
                     QPLCSTNVPFTDELVSRFILNKAYVSIEEKIWRERQTMPKNIQMQTKIQVNKRLTQVS
                     GKAGQVDRIFNVLREYSHSYVFVETFTVKIIEQGRLQVSSCPESYKEFAELFCRFYSS
                     ELMEYFRVILFTREASSSTIKGVYSIYFGVLEIQGNSDEAWFFIASMLNSRQSELSCY
                     VVECFFSILGNLLFRTCRGPFFKLIEYVKRYYFREMNNEPCKIRISSMFERYGA"
     gene            <155917..>156903
                     /locus_tag="Eint_091460"
                     /db_xref="GeneID:9698466"
     mRNA            <155917..>156903
                     /locus_tag="Eint_091460"
                     /product="RIO-like serine/threonine protein kinase"
                     /transcript_id="XM_003073588.1"
                     /db_xref="GeneID:9698466"
     CDS             155917..156903
                     /locus_tag="Eint_091460"
                     /note="similar to ECU09_1260"
                     /codon_start=1
                     /product="RIO-like serine/threonine protein kinase"
                     /protein_id="XP_003073634.1"
                     /db_xref="GeneID:9698466"
                     /translation="MKLITDGVWSLSRTHLRILRTAEQCMKSHVVIPFDVLKTRSQIK
                     GNFMEHVIDLCKLKFLSYVENGYKLTYSGHDCLAINTLRSRGLEAMGEKIGIGKESDI
                     YLGVYKGKDSILKLHRLGRSSFRNVRRNREYAGEKTDWLALSRTSCRREVEYLEKFKD
                     MNVPAVLDHDRHAIVQELLDYLPLYKTRVENVKTIFYLMIDFIKDLWKRGYVHGDFNE
                     FNVLVKDDIKVIDFPQCIQSNDERAVSYLRRDFECVLTYFKKKYRYEPENGCSKFMRE
                     LGIEDFLDEPETYGTDSEDSSLYSTDEVGSQKEMELLETKMEKTFISDTQSA"
     gene            complement(<156971..>157063)
                     /locus_tag="Eint_091465"
                     /db_xref="GeneID:20314086"
     mRNA            complement(<156971..>157063)
                     /locus_tag="Eint_091465"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163632.1"
                     /db_xref="GeneID:20314086"
     CDS             complement(156971..157063)
                     /locus_tag="Eint_091465"
                     /note="similar to ECU09_1255"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161896.1"
                     /db_xref="GeneID:20314086"
                     /translation="MDSFEKSLEEVLDRYNDILQVSEFPLTLGI"
     gene            <157114..>157764
                     /locus_tag="Eint_091470"
                     /db_xref="GeneID:9698467"
     mRNA            <157114..>157764
                     /locus_tag="Eint_091470"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_003073589.2"
                     /db_xref="GeneID:9698467"
     CDS             157114..157764
                     /locus_tag="Eint_091470"
                     /note="similar to ECU09_1250"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_003073635.2"
                     /db_xref="GeneID:9698467"
                     /translation="MSDDQVLKRFMKNGLMNAELKEFFEKALVNEGFNTMELRMQETP
                     IKIILKVAKPHEAIGEKKYRLKQFQHLVAQRLEVPDENVEIIVEKVHEKGLCALIQAN
                     FIREKMLGGVQYRRSVNMALKAVRHSGAQGCQIIVSGKLKGQRAKSVKFQDGVLIHSG
                     NPVKDYIDTGYATVETKQGVIGIQVRIMLPYDPEGVLGPSYPLPDRITILEPNEIQ"
     gene            complement(<157806..>158393)
                     /locus_tag="Eint_091480"
                     /db_xref="GeneID:9698468"
     mRNA            complement(<157806..>158393)
                     /locus_tag="Eint_091480"
                     /product="S1-like RNA-binding domain-containing protein"
                     /transcript_id="XM_003073590.1"
                     /db_xref="GeneID:9698468"
     CDS             complement(157806..158393)
                     /locus_tag="Eint_091480"
                     /note="similar to ECU09_1240"
                     /codon_start=1
                     /product="S1-like RNA-binding domain-containing protein"
                     /protein_id="XP_003073636.1"
                     /db_xref="GeneID:9698468"
                     /translation="MLTKIKNVLPGDDVPSNGSKSLGIHGTKATIVGTLCKTSNHLFV
                     VSKTNRYHPCIDDIVIGKAILTSQDMHRIDLGGVVGALPSLSFTNATKRNKPEINKGD
                     YLLCKIARTGTEPLLTCVGEGFGKLSGVVLPLEPWKVRLLYLSTTLATIGKKYRFRIA
                     LGLNGFVWIDAEKDTDIRDIYHLLSEDSKLEFPNP"
     gene            <158446..>158862
                     /locus_tag="Eint_091490"
                     /db_xref="GeneID:9698469"
     mRNA            <158446..>158862
                     /locus_tag="Eint_091490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073591.1"
                     /db_xref="GeneID:9698469"
     CDS             158446..158862
                     /locus_tag="Eint_091490"
                     /note="similar to ECU09_1230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073637.1"
                     /db_xref="GeneID:9698469"
                     /translation="MNVRPRKSASKYSFEPKIPQNQELFEVEESKEKKEFVLGDQGEY
                     APKSMDQGVVEYPFILGKEDGVVLTLPSNALTSKIIVYEDGSCGLKIGDEIHPIATRF
                     IGESLAIEHKDMAYNIGSAKFQLTPQVQDSLKDKSP"
     gene            complement(<158878..>159300)
                     /locus_tag="Eint_091500"
                     /db_xref="GeneID:9698470"
     mRNA            complement(<158878..>159300)
                     /locus_tag="Eint_091500"
                     /product="calmodulin"
                     /transcript_id="XM_003073592.1"
                     /db_xref="GeneID:9698470"
     CDS             complement(158878..159300)
                     /locus_tag="Eint_091500"
                     /note="similar to ECU09_1220"
                     /codon_start=1
                     /product="calmodulin"
                     /protein_id="XP_003073638.1"
                     /db_xref="GeneID:9698470"
                     /translation="MEETKRLQKVYQLFAESPTERVPTDRLGDILRFAGYIISESYAE
                     ELMASVPGEMFDFSQLVEICEKIREREITREELQKSFRRLDAENTSHIDAGRLVQILS
                     SGENKFSQEEIEELLNILNPDGDGKICYDLIIKNIFGY"
     gene            <159490..>160716
                     /locus_tag="Eint_091510"
                     /db_xref="GeneID:9698471"
     mRNA            <159490..>160716
                     /locus_tag="Eint_091510"
                     /product="GPI-anchor biosynthesis protein"
                     /transcript_id="XM_003073593.2"
                     /db_xref="GeneID:9698471"
     CDS             159490..160716
                     /locus_tag="Eint_091510"
                     /note="similar to ECU09_1210"
                     /codon_start=1
                     /product="GPI-anchor biosynthesis protein"
                     /protein_id="XP_003073639.2"
                     /db_xref="GeneID:9698471"
                     /translation="MKRLSIAMVSDFFYPVMGGVETHIRYLSEELISMGHKVIVITHK
                     IGDLVGCRAVGNIKVYFLDIPVLCRNTTFPSLYSNLPLFKEVFDNEKIEIVHGHQTMS
                     NMCIEALFHARTLNLKTVITDHSIFEVGPFENIVVNSLCRLALKNIDRCICVSYTSKE
                     NTHIRTMIPLEKIHVIPNGIVSDIFYPREKKQSDERIVVVASRLMFRKGIDLLIGAIP
                     LICKGDPEVRIIIVGDGPMKEGIEQVLDENELYDRVEIICEVDHGEVGDIMRRGDVFL
                     NTSLTETFCIAIVEAASCGLHVVSTNVGGIHEVLPPDMITFSKITSEDLAEKVLMALK
                     KNNHNPQDYNKRLRNIYSWERVAKMTEKVYVDIKETSLSYLDRRKEFKGATGFISRFM
                     ITMEYIFLFFLGGKSR"
     gene            complement(<160750..>162027)
                     /locus_tag="Eint_091520"
                     /db_xref="GeneID:9698472"
     mRNA            complement(<160750..>162027)
                     /locus_tag="Eint_091520"
                     /product="eukaryotic translation initiation factor 4A"
                     /transcript_id="XM_003073594.1"
                     /db_xref="GeneID:9698472"
     CDS             complement(160750..162027)
                     /locus_tag="Eint_091520"
                     /note="similar to ECU09_1200"
                     /codon_start=1
                     /product="eukaryotic translation initiation factor 4A"
                     /protein_id="XP_003073640.1"
                     /db_xref="GeneID:9698472"
                     /translation="MKQALEREEDFEDLKSSNVEVRDFEDLRSDSSQIRMFDTWEDYG
                     LKEDLLKGIYGIGFETPSFIQKAAIQPIIDGRDIRAQAQSGTGKTGAFAVAALQICDM
                     SQDVTQILVLASTREIAAQNAARFEDLGCFMGARVALLSGGSPISADKIALEKRPHIV
                     VGTPGRVEHMININELNMDNIKLFVIDEADEMLKAGFQEQVKSIFRRITNKDEVQIAM
                     FSATYDEEELRVSEEILINPVIIDLRYNDQTLKGIRQYFIDLKKEPPFRKGREDYLLP
                     KLVTLYDIFRKQRLGQSIVFINSKEDARIVYDWLIKHEWECELISAELTQAERERTLN
                     RFRGGTGRCLISSGLLSRGIDIQNLSVVFCLDVPSFERKSTYIHRIGRSGRYGRKGIA
                     INIVYEHELKNLKAIERFYNTTIKELPADFSFQ"
     gene            <162123..>162305
                     /locus_tag="Eint_091525"
                     /db_xref="GeneID:20314087"
     mRNA            <162123..>162305
                     /locus_tag="Eint_091525"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163633.1"
                     /db_xref="GeneID:20314087"
     CDS             162123..162305
                     /locus_tag="Eint_091525"
                     /note="similar to ECU09_1195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161897.1"
                     /db_xref="GeneID:20314087"
                     /translation="MSLSLHERKERILKRLEFTLENTHSIICDINTRLEKIVDNSKVL
                     ERVVDAYEIWSRKNSF"
     gene            <162402..>163565
                     /locus_tag="Eint_091530"
                     /db_xref="GeneID:9698473"
     mRNA            <162402..>163565
                     /locus_tag="Eint_091530"
                     /product="transmembrane amino acid transporter protein"
                     /transcript_id="XM_003073595.1"
                     /db_xref="GeneID:9698473"
     CDS             162402..163565
                     /locus_tag="Eint_091530"
                     /note="similar to ECU09_1190"
                     /codon_start=1
                     /product="transmembrane amino acid transporter protein"
                     /protein_id="XP_003073641.1"
                     /db_xref="GeneID:9698473"
                     /translation="MATTLASGYVTLLKTSIGSGILSFPYLFKTYGILTGIALTMVSG
                     FFSVLGLILYAICSQELGRTATLSRLATESMPYTRIIVDLSVFLKCFGVALSYLIITR
                     QLLPVLIETIFGASILSDPNVSLLAFISCIGPFAYFNRLDKLKYTSLCGVIAIVVVVI
                     ASLYRYEYTPVSATNSIEYFAPLSYAWAGGFGKFVFSFTCHQNIFAIHSEMEDNSFPR
                     MKRLIYMVASSAAIIYISFGILNYLLYGKAVKDNVLENYPNDVLASVVRGLYIVVMGV
                     SYPLQVNPCRSHLINIIAFSQRSEKLLRFAVTTGIIISTCLLAVSGMSLGIIYSVIGA
                     TASTFMCLIFPALFYFNMNITKPKGLIFLSYTAFLFGIFVFSASLFSIILRNI"
     gene            <163613..>164314
                     /locus_tag="Eint_091540"
                     /db_xref="GeneID:9698474"
     mRNA            <163613..>164314
                     /locus_tag="Eint_091540"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073596.1"
                     /db_xref="GeneID:9698474"
     CDS             163613..164314
                     /locus_tag="Eint_091540"
                     /note="similar to ECU09_1180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073642.1"
                     /db_xref="GeneID:9698474"
                     /translation="MNSKEIERYFRKKRQYLSKEEYRTIVEVLRRLENAEKTSNKHLA
                     EEMKNKGNEEYNAGDFQSAIDSYTQAIIYDPTNAVYLSNRAAAYSKLGMVESAIEDCE
                     RGLKIDCKFVKLYIRLGMLHLDRDKEKACQIFKRGLEIDPENKTLKRQLALLQEKTPD
                     QSLKSSKSPSLDDMVKNINMEALKDSKIDFNSFFNNKNIKDVLDTVIKDKSPKDLMEM
                     VKDVIEAMGGQDCKK"
     gene            complement(164352..164491)
                     /locus_tag="Eint_091545"
                     /db_xref="GeneID:20314088"
     ncRNA           complement(164352..164491)
                     /ncRNA_class="other"
                     /locus_tag="Eint_091545"
                     /product="miscellaneous RNA"
                     /note="expressed"
                     /transcript_id="XR_002670148.1"
                     /db_xref="GeneID:20314088"
     gene            <164702..>165526
                     /locus_tag="Eint_091550"
                     /db_xref="GeneID:9698475"
     mRNA            <164702..>165526
                     /locus_tag="Eint_091550"
                     /product="putative membrane protein"
                     /transcript_id="XM_003073597.1"
                     /db_xref="GeneID:9698475"
     CDS             164702..165526
                     /locus_tag="Eint_091550"
                     /note="similar to ECU09_1170"
                     /codon_start=1
                     /product="putative membrane protein"
                     /protein_id="XP_003073643.1"
                     /db_xref="GeneID:9698475"
                     /translation="MKYCFCRCFEESKNLVKIGLVDRIFRRDADEKTKSMCHLLCLKL
                     TNNGNIKRNGRWGFQPVLGMTEFFSALFSFMNLITNIFCFHRMLKKHLRVTRLGKLYY
                     IQYYICNLAFISSTLFHIHETPFTRNCDYFLAFLTILFGFYMALVRVILMASPSMERA
                     IRKPLQLIFTLFYAYHIHRMSNIEFDYVYNKISCTIIIAFTLLSHLITFLKYRRMEHS
                     KNILLFTFFFFLAGAIEIQDVPPYAYLIDSHAIWHLISCISTPFYLLFWSGDVYMH"
     gene            <165712..>167379
                     /locus_tag="Eint_091560"
                     /db_xref="GeneID:9698476"
     mRNA            <165712..>167379
                     /locus_tag="Eint_091560"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073598.1"
                     /db_xref="GeneID:9698476"
     CDS             165712..167379
                     /locus_tag="Eint_091560"
                     /note="similar to ECU09_1550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073644.1"
                     /db_xref="GeneID:9698476"
                     /translation="MDFNQLKRLTEYAKIIEGIGDKEAVKHLESAIESFLKEVESLLD
                     KVTNLGGNLEKAAEGADSEGICQNACQKLTNLSGLLKKAKESCCGKGPHKCTTLFKSI
                     DDVLKEVTEEGLDNTLGGLKDFLGIFKGDETLGEDIREEVKATTTTIEKFLESKFDDK
                     LTEETLSCFKKCFSGTVCEEQCASDFSEGLQGKVDQLKILVDECPKEEVKGQLTELFE
                     QVCALSNNIQEMAAAPENVFKHSCGQLANFSQVSEEFRSELRKVKGTLKDISEKLIDL
                     EKKSEEIRKLTRKGFFERLQDFYQRLKENILSINTGSLYGNLCLAFLGILVIQIIIWS
                     FGREDEETDFQKAWNTTVYFIAVVVSIIYLQWLANKGYKSSSGIGDTLKKEWPTILST
                     IPMMIGILNFGPIKSSIYALTMAATAVVMLYAQNLVRTNNMSKKGMLLVGVGNLIIIL
                     AYFTGPESSFMPTISGPNYRAYTALIIFVILLLIISYLERNLPKEEVLKEGTPGTKGL
                     AYWISYALFALTLITVTWVSYMAGSDYHQLYGSNNSTKPLNDDFFNS"
     gene            <167667..>169040
                     /locus_tag="Eint_091570"
                     /db_xref="GeneID:9698477"
     mRNA            <167667..>169040
                     /locus_tag="Eint_091570"
                     /product="protein disulfide isomerase"
                     /transcript_id="XM_003073599.1"
                     /db_xref="GeneID:9698477"
     CDS             167667..169040
                     /locus_tag="Eint_091570"
                     /note="similar to ECU09_1560"
                     /codon_start=1
                     /product="protein disulfide isomerase"
                     /protein_id="XP_003073645.1"
                     /db_xref="GeneID:9698477"
                     /translation="MFGIMLGTVFFSGYAMAEAVHMQDSTLLDNLKIVPSPSMIGMVR
                     DMKSIVSYVSEDEKFDGEGIKIKHDGRMFVVSKAEDVEGAVNILKKYPAPTEEVIKTI
                     KSSDGKGIEGNFIIYFLDNSGYKEKLVGSREGLNVFVSTDPALASLLDASIPGIYGYN
                     GRDRLSYKFPFSDKNATKIFSLTNLPIFGFTSAESISLYRSLDGTIFYIFFNPSSSLD
                     VLNGYSGVLDDFRYDVRVILIPSVKDGINLEDYGLTEKDLPGCISISEDGGKYILRNV
                     TKESISEFVKDVLGGKAEAFYKSQEEPKDNGSKNVKVVTRNNSKTYLGDVSKDRLVVF
                     GTERCPHCIRIKPTLEKLGEIVKNNADDKVFIGYCDVDMNDMNDVEIRFVPTILLYKA
                     GENKSIQYSGGERNLLNLITFIRESGSLGVDLSKFAGQEDESEKRKFEAGKEATGSWG
                     EDARAEL"
     gene            <169093..>169557
                     /locus_tag="Eint_091580"
                     /db_xref="GeneID:9698478"
     mRNA            <169093..>169557
                     /locus_tag="Eint_091580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073600.1"
                     /db_xref="GeneID:9698478"
     CDS             169093..169557
                     /locus_tag="Eint_091580"
                     /note="similar to ECU09_1570"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073646.1"
                     /db_xref="GeneID:9698478"
                     /translation="MDIPSIILRLLTDGIVDGEYHDSLSSLNELLRPIQYEAVGWPDG
                     SCIVLKDNHSSYPPDSRTKEIEDVFKKVVRGISVSGEVVDMLIRERWMESTSEGYRLS
                     KRSLVQHKDFILGLGEGYTVCDVCGFLRSENEVHKFCKELLESERGFGRKKN"
     gene            <169581..>169973
                     /locus_tag="Eint_091590"
                     /db_xref="GeneID:9698479"
     mRNA            <169581..>169973
                     /locus_tag="Eint_091590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073601.1"
                     /db_xref="GeneID:9698479"
     CDS             169581..169973
                     /locus_tag="Eint_091590"
                     /note="similar to ECU09_1580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073647.1"
                     /db_xref="GeneID:9698479"
                     /translation="MTVLEVEFPFRIGRRHPKLKVDVTMERKEDLVSFDMEYDMDLAI
                     DNAEPKSKERAGGRFIHVYKFVDLDSAMEFMESRKAKALPPKGLLDVERVEKEMDLFM
                     ERYEAGERKVKKKKKTIVVSEDGFMKYA"
     gene            complement(<170022..>170642)
                     /locus_tag="Eint_091600"
                     /db_xref="GeneID:9698480"
     mRNA            complement(<170022..>170642)
                     /locus_tag="Eint_091600"
                     /product="putative membrane protein"
                     /transcript_id="XM_003073602.1"
                     /db_xref="GeneID:9698480"
     CDS             complement(170022..170642)
                     /locus_tag="Eint_091600"
                     /note="similar to ECU09_1590"
                     /codon_start=1
                     /product="putative membrane protein"
                     /protein_id="XP_003073648.1"
                     /db_xref="GeneID:9698480"
                     /translation="MEIEIGKEAIKRSTEYANKGLSGVSLKPFRTYFDIDNTFVLKKL
                     VLILFPFNNKEWASDDEGMARPELYIPVMSFISYVLVRALHLGLEGVFSPEKLGIVFT
                     RLFFLEAMCVLFMRVSGYFVDVTLCTLDVIAYSGYKYVIAVLLRLNKIQYVRVIGGMY
                     LYVSFFVFLSRSLKRRVMDKGAERMRRAYYLFGIVVIQEFIMFLLS"
     gene            complement(<170718..>172193)
                     /locus_tag="Eint_091610"
                     /db_xref="GeneID:9698481"
     mRNA            complement(<170718..>172193)
                     /locus_tag="Eint_091610"
                     /product="Nop56p-like nucleolar protein"
                     /transcript_id="XM_003073603.1"
                     /db_xref="GeneID:9698481"
     CDS             complement(170718..172193)
                     /locus_tag="Eint_091610"
                     /note="similar to ECU09_1600"
                     /codon_start=1
                     /product="Nop56p-like nucleolar protein"
                     /protein_id="XP_003073649.1"
                     /db_xref="GeneID:9698481"
                     /translation="MEHLLFEYAGGYGLFELKEYEDMSKSTYEDYTKLTQVLNLRSGM
                     RFASLNEASDHLKCLSQGEIHEDLKKFLELNNVKVLHCDSTLRKGLDVLGIKQKESEN
                     IMRGVRKDYRKLMRLDEYDSKQMVLGLAYEYSREKVEYNVKREDFIVIHTVMLLEQVG
                     KDINSYSMRIREIYGWVFPELSVALKDNHEYIKAVKHFVDEETEGNKGEWKDIEVDVE
                     KLEKIKELKRNSMGMKLSPVDMINLKKLIEIVNNKIEIRKGLSKYLKDKMESIAPNLA
                     AILGDVLAARLISQGGGLLNLAKAPASTFQLLGAEKSLFKSLKTKTKTPKYGLIYTTS
                     YLSRVRDKDKGRICRYIATKCSIAAKIDYFGKDRTPDYGLELKSLIDKKIQSLRTNEE
                     VERTSTVIQRVFDRINGISKDKKTKDDLQPEDSKKNSKLKKQKKKSERQEHKEEVFRF
                     GERRKGGDEGSKRNDKRVSFDLTRNDIKETEKMPKKFKRKI"
     gene            complement(<172267..>173265)
                     /locus_tag="Eint_091620"
                     /db_xref="GeneID:9698482"
     mRNA            complement(<172267..>173265)
                     /locus_tag="Eint_091620"
                     /product="translation factor"
                     /transcript_id="XM_003073604.1"
                     /db_xref="GeneID:9698482"
     CDS             complement(172267..173265)
                     /locus_tag="Eint_091620"
                     /note="similar to ECU09_1610"
                     /codon_start=1
                     /product="translation factor"
                     /protein_id="XP_003073650.1"
                     /db_xref="GeneID:9698482"
                     /translation="MRVVSAEGLDVESVLDFFEDVVVVPTETVYGLAANIWNLRAVER
                     IFALKGRPANNPLIAGISSVQMLEEIVEGPIPLQYKKLIENFWPGPLTLLFKSKDNVS
                     PIVRGGLNTIAVRMPGSKLLLKIIERLGAPLVIPSANISGRPSPTTIEHVIEDFGDEV
                     KLMIDGGPSSIGVESTIVQYVDGRLQVLRPGGITVERIKDVVDCEVIVKKNEWGGKEK
                     RHKHYSPKSPLVLFKGRQEDIKDGILKYISESSNIARVGVALHSGMDLKIFSDVKVDI
                     FDMGDDKKNICKNFFRGIRKLDKVNDIILVAGMDCDEQGHAIMDRLEKAADRVIEL"
     gene            <173326..>173523
                     /locus_tag="Eint_091625"
                     /db_xref="GeneID:20314089"
     mRNA            <173326..>173523
                     /locus_tag="Eint_091625"
                     /product="subunit Tfb5 of transcription factor TFIIH
                     complex"
                     /transcript_id="XM_009163634.1"
                     /db_xref="GeneID:20314089"
     CDS             173326..173523
                     /locus_tag="Eint_091625"
                     /note="similar to ECU09_1615"
                     /codon_start=1
                     /product="subunit Tfb5 of transcription factor TFIIH
                     complex"
                     /protein_id="XP_009161898.1"
                     /db_xref="GeneID:20314089"
                     /translation="MVKATKGYFLRTEPSVKEVILKLGETENFIIEDINDTCIFITPE
                     AASDIKERVELIMNNAKNPGK"
     gene            <173574..>175250
                     /locus_tag="Eint_091630"
                     /db_xref="GeneID:9698483"
     mRNA            <173574..>175250
                     /locus_tag="Eint_091630"
                     /product="Rad2"
                     /transcript_id="XM_003073605.1"
                     /db_xref="GeneID:9698483"
     CDS             173574..175250
                     /locus_tag="Eint_091630"
                     /note="similar to ECU09_1620"
                     /codon_start=1
                     /product="Rad2"
                     /protein_id="XP_003073651.1"
                     /db_xref="GeneID:9698483"
                     /translation="MGVRSLWKILKPSMEKTTPSGIKLAVDTSIWICQYGHLGSDDII
                     YFFSKRIIKLLYHGIQPVFVFDGKPPEIKKHAILERRKRSNRSGIETVDKMLKWDENL
                     DLPSSKAKAVEFGKDRYNWGDIFDSELDSHLLEYSTSSDEEVSSNEREENSLELDISF
                     DFVESKDLSRTQKLRRLVDLRGRRKEIRTRCNFDDPDTFSMLQIKNLKIRNLISHNIK
                     ALEKKGYRRVHGDCKAIYKLTKKPDYVRNEGETTNELKKPTKRVLPATGPDLENDISE
                     LVDETCVKNNLSVQDLASYPVLKSLVDKYKDSDRSLKKDTECIQGVENYKEEKVALVS
                     GAKERMMGGFFGLDGSLDSWDTVQEEYGSFYKGREIPDETNQGIRDICRVMRLIKDIL
                     EVFNISYVEAPSEADAQCGFMCRNNTVDGVITEDNDVLLYGGTVYRNFFRRDRGIEKY
                     SLERIKKELNLDRKNLIELSYLLGSDYTLGVKGIGPVKALEAVRKGSVREEDIGMLVG
                     LYLNPVAIDMKDILIPVVDKDKIRMFYEKKGLSKERIDGVMFFLERIKFG"
     gene            <175324..>176286
                     /locus_tag="Eint_091640"
                     /db_xref="GeneID:9698484"
     mRNA            <175324..>176286
                     /locus_tag="Eint_091640"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073606.1"
                     /db_xref="GeneID:9698484"
     CDS             175324..176286
                     /locus_tag="Eint_091640"
                     /note="similar to ECU09_1630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073652.1"
                     /db_xref="GeneID:9698484"
                     /translation="MKLRPRRIKKRCLVLLIILFNLLLVLLVKHKNKMNIGNKVDLGR
                     LKWFGTGTIVVSAMEMFQDVGFSDAISKSELISTDVQGQGDVVDSILSRVNVEVREIL
                     LIDTRRLRGMNRTVFPRFEKERANYSLGIDYIEELAKEFIRRIDNGRVKYPFGSNTAR
                     EYVMRIKSFTKRHTKGEDDSEIIKLVNKVFPTIEISFYTYIMMVLLNIREMIVEDFDS
                     IKEILKTRKIYSISNDKINQLGGMIMRARAFNDGIPEWNLCNACDQVFFEEDRADLQK
                     LTCDDVICRRCLKQSFLYSDDEFCIKCGTEYDILPGNRFKDLLD"
     gene            <176368..>177819
                     /locus_tag="Eint_091650"
                     /db_xref="GeneID:9698485"
     mRNA            <176368..>177819
                     /locus_tag="Eint_091650"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_003073607.1"
                     /db_xref="GeneID:9698485"
     CDS             176368..177819
                     /locus_tag="Eint_091650"
                     /note="similar to ECU09_1640"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_003073653.1"
                     /db_xref="GeneID:9698485"
                     /translation="MEMPMKSMTEDIKKEGKKGGRNREKESWKKGEFLGKKYVERSSA
                     GLSNIRRSEEEFQGNGKDEERNNLEGKTNRKETRDTKTNSLELSLLNRTAESDGGVFL
                     SKDVRETENVKWEIFGLKPKLLKRIQDIGYNFPSPVQVASIPHALKGRDMLVRSKNGT
                     GKTASYTIPILNAINPEELNIQGIILVPIRELALQISRNVKRLSEGMGVISAPIVGGT
                     NMQDDIIRVSNGVHVMVGTPGRIVDLIEKKIGVLSKKIILVFDEADKLLDVTFGETVT
                     RLLDILPRERHILLYSATFPYFVTGFIKRYMRDPLCLNLMKELVPVGVKQFYTIVKPS
                     EKLLCLRSLLLKLKINQCVIFCNNIKTVELLAMKVTEIGIPSYFIHSKMTQEDRNIVF
                     HNFLKGKCKILVATDLITRGVDVPNTNYVINFDIPKSPESYLHRIGRAGRFGTPGVAI
                     SLVTTEEKEMLADIEVKLGKEVSPLSDGGLDRL"
     gene            complement(<177927..>179168)
                     /locus_tag="Eint_091660"
                     /db_xref="GeneID:9698486"
     mRNA            complement(<177927..>179168)
                     /locus_tag="Eint_091660"
                     /product="GTP-binding protein"
                     /transcript_id="XM_003073608.1"
                     /db_xref="GeneID:9698486"
     CDS             complement(177927..179168)
                     /locus_tag="Eint_091660"
                     /note="similar to ECU09_1650"
                     /codon_start=1
                     /product="GTP-binding protein"
                     /protein_id="XP_003073654.1"
                     /db_xref="GeneID:9698486"
                     /translation="MRENYYNKKKLKYLEMLRSGKAKKNSRGDIIKDAPFQNSKADVG
                     RIEPSRKWFTGSKTISSTELDAFRLETKIESPYNVLLSTGKVPYSLLEDGTKKKKRGD
                     FEEVFGKRSVRKKPNLQYSSLEELSQKAKEAKEEKKEVKKDHVKGQSHRIWLELYKVL
                     DSSDVIVHVLDARDPLGTMCDKIASYIKEEAPHKHLMYVLNKVDLVPTGVTAKWLKRL
                     SKSHPTIAYHSNSVTNNYGKASLINLLKQLSKLYKKRHLSVGFVGYPNTGKSSIINTL
                     RNKEVCKVAPIPGETKVWQYIALTRGIYLIDCPGIVPIPDYDQAVLRGAVRIENIEDP
                     EDYIDMIVEKARDSISKTYRIQFLDSTDLLERLAIKFGKLQKGGEPNTNTVSKMILHD
                     WVRGKIPYFVPPKEEDGDEEK"
     gene            complement(<179266..>180225)
                     /locus_tag="Eint_091670"
                     /db_xref="GeneID:9698487"
     mRNA            complement(<179266..>180225)
                     /locus_tag="Eint_091670"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073609.1"
                     /db_xref="GeneID:9698487"
     CDS             complement(179266..180225)
                     /locus_tag="Eint_091670"
                     /note="similar to ECU09_1660"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073655.1"
                     /db_xref="GeneID:9698487"
                     /translation="MSQEAREVSNLVNDMHKICDFGVTSQHWQLKDMLKIKGESLVFP
                     KACNVMSFDPYKNATKMVYEGTDFFPTSICLKDDILAVGGSRGHLKVKNLSTNEVLSQ
                     VVSSSINNNICINNNRIFICNNDRTLKVFTMDLQSSGCINHIAQVNSCGISPDNKFLV
                     IVGDSNDVFLYSIDNDNYKLVKKLKSTEDGGFSVSWNSVSSSFAVGTQDGYVCIWDIR
                     SDRMLHKFESKQKDSHKGAVRNVKFSLKNSLDLLFFTEHFSFLTICDMRDFRRCQRLK
                     IFPDKQITGAVFSEMNDKIFSSSEDQIFEININSKARRMFGGI"
     gene            complement(<180357..>180506)
                     /locus_tag="Eint_091675"
                     /db_xref="GeneID:20314090"
     mRNA            complement(<180357..>180506)
                     /locus_tag="Eint_091675"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163635.1"
                     /db_xref="GeneID:20314090"
     CDS             complement(180357..180506)
                     /locus_tag="Eint_091675"
                     /note="similar to ECU09_1665"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161899.1"
                     /db_xref="GeneID:20314090"
                     /translation="MDYNSKLEIAREVSMNPEDAKEIIREFMMSNDSLEGIQILQLEE
                     FLNHV"
     gene            <180555..>183155
                     /locus_tag="Eint_091680"
                     /db_xref="GeneID:9698488"
     mRNA            <180555..>183155
                     /locus_tag="Eint_091680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073610.1"
                     /db_xref="GeneID:9698488"
     CDS             180555..183155
                     /locus_tag="Eint_091680"
                     /note="similar to ECU09_1670"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073656.1"
                     /db_xref="GeneID:9698488"
                     /translation="MDSNWNTKDLYLLALEVSHLHKIGYGEIMSMRLRNGIQISCTLD
                     NGEEIGFGHLWRYEGEEAETRFKLCLVETQLKNSTEGAVDHLLMILPNTSKANQLTIF
                     MIFYKLTTKYKVYDKRILRECKAHLHAIHLRYPILKTLVAYTLFKEDLVSEEFTDEEI
                     IEMNLVDPRNLNPENPDAVRLVKRLFSTITKTSFRYSRRIFKHMDEKFFFHFPLELNG
                     VGYSHLRELIGELSPRKALSIGEIICSRSAVRLFFPLKIDDVERFFIHKDVEVRIESV
                     RHIDTVGLMKRFLEVNQFIYNRNMVKLLSRYFRIWLGKRVNEEHEFKVMYTEIVSPML
                     RSRNTYRRLLGVHLMDSLIDIGVVEPSGHSWLLFDPDYEIRSIVCKYSGWIPLNIEEA
                     RIRIESYQSYDVNGCVEYIKSCRPEWLISDLKDILDTYAKDFMSGKKGIEEVPIYGFL
                     RLFSEVKSYNIKIYVDRVYEYCFGKLSNVIHEQDDDGLVVYWKNMKECCNYYCSLALE
                     GDKSSAAKLVRTLLYINHLGVVLQVSQYLNKVLRSVVFPQDELLEIVDLSFKRIQNCK
                     IFFRKSGGIPLLLVQILRNYPSIINYVLERLLEMIDKDENNIKVHCLNILSRIIGDGS
                     LSPKIPLQTIELFKISFRCSRSSLWAVRNIGIEIFSHLVRKVFERGPEFIVSIAHKEF
                     RNLLYEELSSCSHNKDDILVFLILHLYGRVKKLDEREMELVRRFSSRSDLIGLESKSI
                     CEGKECRRPQYRETRIKFDDKMNEGEILLRLLILLDSEQPEERRMAESYMKDVYKLSL
                     YSEEYFRHYIAKRICRIGYKDVAVKKLQEYGLGVEKSQSCFFKDSPSNERFDLEYNIS
                     LIEKYKSQKW"
     gene            complement(<183211..>184554)
                     /locus_tag="Eint_091690"
                     /db_xref="GeneID:9698489"
     mRNA            complement(<183211..>184554)
                     /locus_tag="Eint_091690"
                     /product="asparagine-tRNA ligase"
                     /transcript_id="XM_003073611.1"
                     /db_xref="GeneID:9698489"
     CDS             complement(183211..184554)
                     /locus_tag="Eint_091690"
                     /note="similar to ECU09_1680"
                     /codon_start=1
                     /product="asparagine-tRNA ligase"
                     /protein_id="XP_003073657.1"
                     /db_xref="GeneID:9698489"
                     /translation="MSGKIEEEISKLDFSEYKRIELSKLTKENIGQKIRTFGWVTNVR
                     SQSSITFIDLYAHYKTVKCVYPKKMHLTMCTSMTIYGTVAENFGKKDAYEFEIQVEKV
                     EIYNDAIAPSFPLNEESSVNAILTNAHLALRTKKRQLFLKARGYLLKIIRDFYFAKEY
                     TEITPPTMVQTQVEGGSTLFKLDYYGEDAYLTQSSQLYLETVVPVSHRAYCIMPSYRA
                     EKSRTRRHLSEYTHVEAELADIDFSELMSSIESLISYSMEKFYEGMKDDILSLYPKFE
                     FHKIPKTPFKKIKYSEAIDFLNSKGYKKEDGTDFEIGDDIPDAAERYIVEAIGDGCPV
                     FLTNFLVEQKPFYMRKDKGNKDWTESVDLLFPGIGEILGGSMRQDIYEDLIEGFKRED
                     INIDPYYWYLDMARFGPCKHGGYGLGFERFLMGLMRYENVDEATLYPRKVSRCQP"
     gene            <184698..>186008
                     /locus_tag="Eint_091700"
                     /db_xref="GeneID:9698490"
     mRNA            <184698..>186008
                     /locus_tag="Eint_091700"
                     /product="kinetochore Nuf2-like protein"
                     /transcript_id="XM_003073612.2"
                     /db_xref="GeneID:9698490"
     CDS             184698..186008
                     /locus_tag="Eint_091700"
                     /note="similar to ECU09_1690"
                     /codon_start=1
                     /product="kinetochore Nuf2-like protein"
                     /protein_id="XP_003073658.2"
                     /db_xref="GeneID:9698490"
                     /translation="MQKRNVYAVPDLPVKEIMQYFNEMEINIKASDILKPTPQSTQRI
                     YEILLEVYCGIKTSDLVSRTESTEGFEESLSYLLLQKRMEGFLRKIGMDNFGLRDLSP
                     DSKRLIGILSVIVNFSMFRDNKRHVYERVCQANDEKLLLKNEIDERVYNARKELEKCE
                     KDAKKSVEDAKEVEKEISLLESELKDFYKHQRALVQETERIKAERNEYSDKLSSLRLM
                     LLNFSQEITCLKTQVVSDPTKLMELLEEMRSLISKENEIIRGLETKRIGLKEKTEFME
                     LMKEDTMKAITLAISNREAGKTVDRINREISELEVQIKNLDSGINALKIRLNHVNRQI
                     SHIESKIFNLQDNDKRCSEEISAKLEKLKNNYGVVSGERNTIRKKIEENVRQTKNIEY
                     ELVKKRNEHINDITAIQSALCRLKDDIFNYFAEAKGVIDKTMSS"
     gene            <186052..>186306
                     /locus_tag="Eint_091710"
                     /db_xref="GeneID:9698491"
     mRNA            <186052..>186306
                     /locus_tag="Eint_091710"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073613.1"
                     /db_xref="GeneID:9698491"
     CDS             186052..186306
                     /locus_tag="Eint_091710"
                     /note="similar to TP01_0402"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073659.1"
                     /db_xref="GeneID:9698491"
                     /translation="MVPESVNNLYKDLESVILQFKSPAFGNYFLKKAKEEFDNISIQT
                     SKQKDEGAIERYLKDQGELLDVLRRQTTIYNMFYDESSGI"
     gene            <186513..>188240
                     /locus_tag="Eint_091720"
                     /db_xref="GeneID:9698492"
     mRNA            <186513..>188240
                     /locus_tag="Eint_091720"
                     /product="vacuolar import and degradation protein"
                     /transcript_id="XM_003073614.1"
                     /db_xref="GeneID:9698492"
     CDS             186513..188240
                     /locus_tag="Eint_091720"
                     /note="similar to ECU09_1700"
                     /codon_start=1
                     /product="vacuolar import and degradation protein"
                     /protein_id="XP_003073660.1"
                     /db_xref="GeneID:9698492"
                     /translation="MVLGRIKKMFSNTKKNLFGDLHCGRTILMNGCEALASQEDLLFS
                     SKKSKMSFKLCEIVSIEHDNKTLSFIHNQKKYLFTSGESLDLFCKAIVPFIKKTKILY
                     KKSAVYSRYNTTTGRFEEASGNVDVFIVEDGMFLIRIETRDDIIHFEEIRTETQYYMD
                     QKNITFVWSVMEGGVFHTFSLKFLDNLDFLEFLGKYIGCLYKNVNHENKEDKEAEQYF
                     EKMEMENYHPDESSESEEEEEYESCDDDELENHFGEADEKNKHLVVGDEMAFITRGKS
                     IGVFENTDDGLEFRANIKNVLNEDVKKIITHDNCASLIYLDKSERDKLHKLDVERGEV
                     IETWDVQRDVNDYFDAQKLIDTGSLVGLSDYSVFRIDPRTKNKVVESKDYKTRNNFNC
                     GMATSLGHVVAAGKGGDLRLYDKIDKRAKSLLPGFGDEIKYIDVTSNGKHIICTCKNY
                     LMLTTVPGDYKQPIGKDKPVPKRLQLKPEHLAYINEEIDFTPAKFSTDTSESSIITST
                     GSYVVKWNLDDVLNGKLYSYQLAKCNDLVVADNFEFGENNSVIVTMPDDIRKVNVRNL
                     KRPGRKIWG"
     gene            <188316..>189479
                     /locus_tag="Eint_091730"
                     /db_xref="GeneID:9698493"
     mRNA            <188316..>189479
                     /locus_tag="Eint_091730"
                     /product="sulfite reductase subunit alpha"
                     /transcript_id="XM_003073615.1"
                     /db_xref="GeneID:9698493"
     CDS             188316..189479
                     /locus_tag="Eint_091730"
                     /note="similar to ECU09_1710"
                     /codon_start=1
                     /product="sulfite reductase subunit alpha"
                     /protein_id="XP_003073661.1"
                     /db_xref="GeneID:9698493"
                     /translation="MDFNPVRFEYNKNYTKSIASIFSRVEIISTDTDSSSRKFVFPSI
                     GSIKYCKARIVETERLETSWREVYRIKFDKKFDFKPGDSIGILCPNNDALVDEIMKIL
                     CLKDFSCQMSRTGKNSFNYTGRIRDFFKYYFDFGGLPRKSLLINLARSCTEENQKYIE
                     YLCSREGIADYLGIGKRWNNILDIIRTFKCKPTLEEIIGECEIVKPRYFSLINEIGKE
                     SEILIGITNKIFNEFVRYGHVSDFIIQSEAEEIEACLRTNLLFRMDYNRRRILAICTG
                     TGIAPFLSFVANLQSHQSIWIIYGFRNDEDDISKLMKSGEKIKISRVKSSDGHYVTDY
                     LVEKIDEIKEYIDEECAVYACGKMEMQRKVFEIFKNEHPEIVESKRLIFDQWG"
     gene            complement(<189525..>190541)
                     /locus_tag="Eint_091740"
                     /db_xref="GeneID:9698494"
     mRNA            complement(<189525..>190541)
                     /locus_tag="Eint_091740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073616.1"
                     /db_xref="GeneID:9698494"
     CDS             complement(189525..190541)
                     /locus_tag="Eint_091740"
                     /note="similar to ECU09_1720"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073662.1"
                     /db_xref="GeneID:9698494"
                     /translation="MSWDEYDEASLSSSARSSEDIEGASNKDSSEDNSGCKDLVPDNK
                     DTKNKTEDDCSKLYITALGEEFFYLLIFDGSNLTLIKRVKKKISSQVFAKDLYIISDK
                     KLYGFHDVVSSPDSLDEVLKPERKRKKVNGSLLNDESHEEYTYRPFRKDRRIIFKREE
                     GKSDIANNWEGFFITRGLVHKIVYEDGGYTFVYNSKKYSYEKEIGRIAHNNEMLVYYL
                     KGKDSKLYFQEVHEKIYSIPKITTMSCEGQWTVVGTADGYIYLFNKCVLSGRKKVYNV
                     PITGVGFMNESVYFSSFDGFVGVHRMSGRYNILHMTLPIAIFIFAILIGLILKPVEFP
                     FTSK"
     gene            complement(<190818..>191633)
                     /locus_tag="Eint_091750"
                     /db_xref="GeneID:9698495"
     mRNA            complement(<190818..>191633)
                     /locus_tag="Eint_091750"
                     /product="RNA polymerase II accessory factor"
                     /transcript_id="XM_003073617.2"
                     /db_xref="GeneID:9698495"
     CDS             complement(190818..191633)
                     /locus_tag="Eint_091750"
                     /note="similar to ECU09_1730"
                     /codon_start=1
                     /product="RNA polymerase II accessory factor"
                     /protein_id="XP_003073663.2"
                     /db_xref="GeneID:9698495"
                     /translation="MDLLKRALRDPSICQMNPEEITIGGRKISPKQTIKFKGTETKEY
                     TFEQVLFYLLNKDKKYTAYMTLCKESGIGKIYYTDQKIIVEEIENFKEASIEAKIDGP
                     DFRYIGFRDYSYLNNICKKEEEGRPVTYYAIVPQSVSSPVNLSNVKEFFEKGICSDEI
                     SISEAEKVELKIEGFGVVAVDDVGRFTSEDWKKVVCIFLDGTKWQVSRWNIKDVGEIF
                     NSIPTFCFVKRGMTSSIYMRNWNAIEIPIQNGKVDGPILSSIKERIRSCILGI"
     gene            complement(<191755..>193410)
                     /locus_tag="Eint_091760"
                     /db_xref="GeneID:9698496"
     mRNA            complement(<191755..>193410)
                     /locus_tag="Eint_091760"
                     /product="putative phospholipase activating protein"
                     /transcript_id="XM_003073618.1"
                     /db_xref="GeneID:9698496"
     CDS             complement(191755..193410)
                     /locus_tag="Eint_091760"
                     /note="similar to ECU09_1740"
                     /codon_start=1
                     /product="putative phospholipase activating protein"
                     /protein_id="XP_003073664.1"
                     /db_xref="GeneID:9698496"
                     /translation="MIGIEKIEKISNSDVKALFVNDEMIITGGREGVIRIYGYELGCW
                     AEIKPGQGYINCITTGNGFLFVGCQNGCIVMYSMDELGAQKEEQKVEPMRLIKEHSSN
                     VCCLDTVGDLVVSSSWDCSAIIWTTKHILNGNVTIVQKIPHPAVVWSAKFVNENTVVT
                     GCSDKLVRVFKNGTLACTFNYNLSYVRGVALLHKSIISVDNEGMILKISLDGRILKHY
                     SAKDFMYTISSCTNGDSDLIICAGENGKVVILNEDLKLVQEILVPTTSCWAVLGWKGR
                     VYVGGSDGRLYVYSSDISDEASRILEEIRNSKEAPLKDGEFISDGQKFRVTDGSVYQE
                     INGEWVFLGKGEGIKPHDNTFQVELENKYYTLSFNNDENVYEVAEKFLSKNKLRDEFR
                     DDIVDFIKKNFTSAREFKTYSRINVEGIKNMLNRVKDDHGYLYPYILDNLERPKIADN
                     GKVEEEIEKLIENGLMFMALDLIRYFMVHKYSFDLSFLPTFTPQDKKEAITFVRLLSN
                     LFIDPPFNLEMFHSRVLELKDRGVVDGEVLDDYFVNRSLRNRA"
     gene            complement(<193483..>194874)
                     /locus_tag="Eint_091770"
                     /db_xref="GeneID:9698497"
     mRNA            complement(<193483..>194874)
                     /locus_tag="Eint_091770"
                     /product="SET domain-containing protein"
                     /transcript_id="XM_003073619.1"
                     /db_xref="GeneID:9698497"
     CDS             complement(193483..194874)
                     /locus_tag="Eint_091770"
                     /note="similar to ECU09_1750"
                     /codon_start=1
                     /product="SET domain-containing protein"
                     /protein_id="XP_003073665.1"
                     /db_xref="GeneID:9698497"
                     /translation="MISNNTNPTTENHLRPNGFHPSVKKIVIPRIEPKTRSTFFTFTN
                     TSIKTEDDPILRFIPYIPGASGFINLTEFKNTGFIEKCYSYDKEVVKGTLPKKLDVWD
                     RSSFREECVKDDGLRIMRRIFCNVCFIFGCRWHSKTEGICIKPVGFEKNPTNAFVEAR
                     DICGDICKKMKITCKESTKEELDFNAYNALYEACMESQGYECIASLLFYFRYKKYIPC
                     TKIKDSCAIPPGRHKYLIESKSKNNVDFNVFFTPCDHSGNCTKENGCVCISNKTNCEM
                     SCLCAGCKNFFIGCRCSSACDNKCRCRQAMRECIQTCSCNQCGNRDIQLGKKSPIYVS
                     SSKIEGYGLFAKEKISKGKFIIEYVGEIISNEEAERRGTFYDLKGCSYLFDLYSREGV
                     PLYVIDSRFIGNESRFINHSKKNSNLNALVLLVNGIRRIGFYASRDIDKNEELFFDYK
                     YSEKHKKKHGIKD"
     gene            <194983..>195114
                     /locus_tag="Eint_091775"
                     /db_xref="GeneID:20314091"
     mRNA            <194983..>195114
                     /locus_tag="Eint_091775"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163636.1"
                     /db_xref="GeneID:20314091"
     CDS             194983..195114
                     /locus_tag="Eint_091775"
                     /note="similar to ECU09_1755"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161900.1"
                     /db_xref="GeneID:20314091"
                     /translation="MGNKRRPSFEQEFIDSFVSDEVINWKFDPILLDGELKARLSQE"
     gene            <195143..>195538
                     /locus_tag="Eint_091780"
                     /db_xref="GeneID:9698498"
     mRNA            <195143..>195538
                     /locus_tag="Eint_091780"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073620.1"
                     /db_xref="GeneID:9698498"
     CDS             195143..195538
                     /locus_tag="Eint_091780"
                     /note="similar to ECU09_1760"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073666.1"
                     /db_xref="GeneID:9698498"
                     /translation="MQVSTWPLPPRFKKKEPPKIPSSYTIFGVGYKVENGEPTSTSFS
                     SVEFDKSRLKDLLNLSFSTFVELLTFPLDHQELIETIGSIHLEINQILNGAKKMEAVS
                     EIRRIKNDHTRNKNRIAEEVRRGISDFKI"
     gene            complement(<195565..>196500)
                     /locus_tag="Eint_091790"
                     /db_xref="GeneID:9698499"
     mRNA            complement(<195565..>196500)
                     /locus_tag="Eint_091790"
                     /product="WD40 domain-binding protein"
                     /transcript_id="XM_003073621.1"
                     /db_xref="GeneID:9698499"
     CDS             complement(195565..196500)
                     /locus_tag="Eint_091790"
                     /note="similar to ECU09_1770"
                     /codon_start=1
                     /product="WD40 domain-binding protein"
                     /protein_id="XP_003073667.1"
                     /db_xref="GeneID:9698499"
                     /translation="MALSIEIPNAYLEFMSICDEYEIVSLVGKRTSVIISYADDLRMV
                     QRVLDEHPDENFQCSEFLIRQNDVLLALGGSLGIIKVLNLSKGTFVGYIQAHGGIIFS
                     IKRYKDEYLLSCSEDTTIKMWDVSELKCVCVFGGYTGHRDHVLSIDVSDDLRYLASGG
                     TDCSIRVWRIPSSLNKFQCVAPIYLSPRIHKFPIQCVRFYREFLVFYSGESRIDIISP
                     RYGEVEPTSRTEFVGGVKFEGQLLRGFEIDDGMLVAVTESQDIILFKMNDIGFTSQST
                     ILRSTKKGKIRDFRVIRNRMFILFEDSFFRVLSLA"
     gene            complement(<196525..>197355)
                     /locus_tag="Eint_091800"
                     /db_xref="GeneID:9698500"
     mRNA            complement(<196525..>197355)
                     /locus_tag="Eint_091800"
                     /product="mevalonate kinase"
                     /transcript_id="XM_003073622.1"
                     /db_xref="GeneID:9698500"
     CDS             complement(196525..197355)
                     /locus_tag="Eint_091800"
                     /note="similar to ECU09_1780"
                     /codon_start=1
                     /product="mevalonate kinase"
                     /protein_id="XP_003073668.1"
                     /db_xref="GeneID:9698500"
                     /translation="MAYLARSPLKVILFGEHGVLSGARCLAISIKIYGYLAMKPSPRD
                     KAVVIDGEGNYIDLIEKYKCSIPGSDAILFLEASLGCGLGTSAAVSLLLSYGRVQDSK
                     MTREALAIENMFHGKASGVDVLACYTGGLISFKQGNVQKLSTRHLSRFKILIFNSRIP
                     KNTQSAIQVGELKKELYDEIGKISEEAYWLLQREFTLEELYKLIRKSQDLLDELGVCP
                     REMREVVRRMRDIGVEVKITGAGCGGHLVTVVNKDLEIPGWTPVSIDLQGFYIFDTEC
                     "
     gene            197421..197492
                     /locus_tag="Eint_091810"
                     /db_xref="GeneID:9698501"
     tRNA            197421..197492
                     /locus_tag="Eint_091810"
                     /product="tRNA-Glu"
                     /note="tRNA Type: Glu, Anti Codon: TTC, Cove Score: 54.23"
                     /db_xref="GeneID:9698501"
     gene            complement(<197613..>199715)
                     /locus_tag="Eint_091820"
                     /db_xref="GeneID:9698502"
     mRNA            complement(<197613..>199715)
                     /locus_tag="Eint_091820"
                     /product="V-type ATP synthase"
                     /transcript_id="XM_003073623.1"
                     /db_xref="GeneID:9698502"
     CDS             complement(197613..199715)
                     /locus_tag="Eint_091820"
                     /note="similar to ECU09_1790"
                     /codon_start=1
                     /product="V-type ATP synthase"
                     /protein_id="XP_003073669.1"
                     /db_xref="GeneID:9698502"
                     /translation="MLRSEKMCLVSMYFSKDTAKQTITEIGKNGLLHFKDLNKSIKAE
                     NLLYTREIAHMEKLISRLQYLTGDVGEIDEGIKHSDIDQVEEQVNKFFSRLTQLKSIK
                     KETNANQGRLKEDLYMQEETENFLGTVAEEVHLVQFDFMTGIVERGKKLLIRKVLHQA
                     LRRNLVIRTRDVEEGTKTVFIVLAHGCEALEKVRDIFSSLGGRMLDHKKFRECKRGLL
                     ELSATISQMQQIEDHNDEAIEKEQDKIRHFANTWKYYLNKETKIYQTLNKLSFDFDRD
                     CLVGEAWILGEEIGKLKRINEIKGDGTSLFAFEITESEEMPPTYFRTNEFTESFQILT
                     NTYAIPSYGEINPAVFSLFTFPMLFGCMFGDVFHGLLLLCLSVYMIKNSKKFKNCSET
                     LRMIVNGKYIIFVFSLAAMFFGFLYSDFGSLTIPLFSSSKDTGRPYPFGVDHMWHHSK
                     NEMIFLNSMKMKMSIIIGFFHMSLGIVISFLNAMYFNEPVEIYGVLIPQTIVFCSFVG
                     YMVFLIIYKWLVTSNYPSIIGVLVNMFTNPFVVAEEIYPYQHRVQLCLLFLMLLCIPW
                     MLLGKPVYMIAKNKVKKEEISSLWINQFIHVVEFGLGLISNTSSYLRLWAVSLAHAQL
                     TRVLHEFTIGKEGFIAPIALSGVYILGTIVLLIGMEGLGSCLHALRLNWVEFHSKFFR
                     GKGYLFEPLGFNISLDDE"
     gene            <199942..>202722
                     /locus_tag="Eint_091830"
                     /db_xref="GeneID:9698503"
     mRNA            <199942..>202722
                     /locus_tag="Eint_091830"
                     /product="DNA helicase"
                     /transcript_id="XM_003073624.1"
                     /db_xref="GeneID:9698503"
     CDS             199942..202722
                     /locus_tag="Eint_091830"
                     /note="similar to ECU09_1800"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="XP_003073670.1"
                     /db_xref="GeneID:9698503"
                     /translation="MDRKPSVKWEEPESDRKTVPKKIERPSVSTLDFWNRELENPLDS
                     DKDQDESTDMDAFFTSTGCLENEKEREFLVYSKFTVREIKRSTDSVVLVGDKVECHLS
                     GEWCETEYRVNDRITVLHCICCNEQDETSDIDYLDEIFESECGDHSMIEEKENSGQSI
                     LRNRIFVTNTENYLLIEDDPISITTLCESLSCKNKRYINTKIASIRFSYTDLRVLIGV
                     VVHSVMEKALVERNFSFDFLTRQTKAKISKNVALMHRCGIDERTALNESLKLIKNIYL
                     FRDHRFEVVETEKKLMSLLFNIKGNADAIGEDSVLEIKSTKSQRAEHRAQVILYALML
                     REKTGRDFSPCLYYIPTREMVEVKLKHQEIRSLLNLRNKIAVTSEPCECTCDDFSCNA
                     LLKIKSLDETHFLRSQLDAIDSEEGRTAESFIPVILRYQNNTLVRLDIQGVFSPNNIY
                     LSLFSSDFVRISKGIVEEINGNRLLVRLNEEILFKDREKLYVSFGVSDIFFRFMRFSL
                     VHIAYPRYCTPEVIGGFTLPMEKMGLGLENGFDEPNSGDGDSLLTEELEECLKSDKEV
                     LENDKEKIKADGNGGDKTSSNISEIHTSYELDDHKITIPEVYREEFLKLNDDQRSALF
                     LSLNCKNYRIIHGMPGTGKSTLICLLIKILVYLKKKVLLICYTNLALANITKKLSGIR
                     VYTAGKEGFFFKTTEEAKLFFDNIELVVGTCFSFSDPIYLNRRFDFCVVDEGSQMHLL
                     LTLIPISISSKFVIVGDHLQLKPLSRCSKDLSISLFEYLLGKDYSKLRTQYRMGNEIM
                     RLSNTLFYSNQLLGEKRPSKVEFIDTDIIDFMALVPSFEKCTILCYFNAQVDTIREMT
                     RCIVETVDRFQGSESDKVVVVFDPISKCEVMESSERLNVALTRAKKHLVLAGSRTKMM
                     EIDILKRLISIL"
     gene            <202792..>203076
                     /locus_tag="Eint_091840"
                     /db_xref="GeneID:9698504"
     mRNA            <202792..>203076
                     /locus_tag="Eint_091840"
                     /product="U6 snRNA-associated ribonucleoprotein"
                     /transcript_id="XM_003073625.1"
                     /db_xref="GeneID:9698504"
     CDS             202792..203076
                     /locus_tag="Eint_091840"
                     /note="similar to ECU09_1805"
                     /codon_start=1
                     /product="U6 snRNA-associated ribonucleoprotein"
                     /protein_id="XP_003073671.1"
                     /db_xref="GeneID:9698504"
                     /translation="MLFYEFFKSNIGKRIFVMLKAGVYVSGVLNSIDPYLNLNLEEVE
                     ILSDHPGLSGTSLCSIRGSSIKYILADRDAGLLQGVNAGSRLRMILDKCY"
     gene            <203170..>205314
                     /locus_tag="Eint_091850"
                     /db_xref="GeneID:9698505"
     mRNA            <203170..>205314
                     /locus_tag="Eint_091850"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073626.1"
                     /db_xref="GeneID:9698505"
     CDS             203170..205314
                     /locus_tag="Eint_091850"
                     /note="similar to ECU09_1810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073672.1"
                     /db_xref="GeneID:9698505"
                     /translation="MKGYKRQSRESTIVKKFLKEHLNEGTTKSTCEKIYQLSQRVAKA
                     RMSKRLLSEIIKVSKVFVDDYAEKTRGMSSKDTGRCLYSFDCLWSRSMNLFGKVFCPI
                     IRTRRKFIDRLSSKLFMQFVKNIEDKIVKFIIDNIREEIQKVETNRRTSKPESSSLES
                     SSNKKQKLSQDEPGKLGELKERDFGVFESLSRKEKISTLIGILQGRGCFDLFLERVVG
                     SLTSVLDEKIDREGLGILAIKRLIDEQRKAGYMKDYFYAVESNLMRKIVIKYTNEEIF
                     KMLDKEDEMRLCMGFFCASNEEKRLMEALDVYFRKIMGNPSIDDFIGKYYWIYLKFRE
                     LENSKDGGYERIIEGIRNCKKDILKLDAECVVECVCRWTDSFLRGKIIIQENTIEGME
                     SPIFIPGSERKEVINVERVLKKIGIDSLLEGNGWREYLVLNIFDMIGEMFRFCDYKEM
                     FETTLQGRLGSRLVSGSSISMDWEIRLIDKIDSGRSTIDKMRCMIKDFMETEQFMGHD
                     ILLLRGCKWPRYEETILRIPDVEEVKKRYNHVVKNKRKIIRWNDLLSSCEIEFLGRMV
                     RVTLPQYLMMKLLVEKDRTAEDLKICKSWDKNLEVLVKKGLVKVEGKRHFLNMDYWKG
                     DFPMDSMIPDMFPLLGPQKIIKMFDESESYKDLLDCKIIKEMKANKTLSKSGLKELLN
                     KTYPQEILDERIDSLANREFLSVEGENIKYVP"
     gene            <205453..>206151
                     /locus_tag="Eint_091860"
                     /db_xref="GeneID:9698506"
     mRNA            <205453..>206151
                     /locus_tag="Eint_091860"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073627.2"
                     /db_xref="GeneID:9698506"
     CDS             205453..206151
                     /locus_tag="Eint_091860"
                     /note="similar to ECU09_1820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073673.2"
                     /db_xref="GeneID:9698506"
                     /translation="MNSEARIKKIMEETGCSLEVAKKAEQESQGNLNAAIEMAKKKGN
                     VLYSGGNSGLYVEENPSRKSITQYKNGILVEDKFYDFSVDNNIRLKDMLEKGTFDASL
                     LVLEGDTAEVIYSERLDEEYKEKKPQEPSKVTASFVGEGRQIGNSSRDIPCNNIEDTL
                     EIVHDGDTVFKVMIGSKRVTVKMHKFQTVGDFFDYMERYYDFGLVLSTNGKEIPPSHS
                     VEEISNKLVLLSRR"
     gene            complement(<206247..>206912)
                     /locus_tag="Eint_091870"
                     /db_xref="GeneID:9698507"
     mRNA            complement(<206247..>206912)
                     /locus_tag="Eint_091870"
                     /product="nucleotide excision repair factor TFIIH/TFIIK
                     subunit cyclin H-like protein"
                     /transcript_id="XM_003073628.2"
                     /db_xref="GeneID:9698507"
     CDS             complement(206247..206912)
                     /locus_tag="Eint_091870"
                     /note="similar to ECU09_1830"
                     /codon_start=1
                     /product="nucleotide excision repair factor TFIIH/TFIIK
                     subunit cyclin H-like protein"
                     /protein_id="XP_003073674.2"
                     /db_xref="GeneID:9698507"
                     /translation="MENSVERIIGYRWEIIEACIKLDLPVTVRSTSIQIFDRAIGKML
                     RGKKEMRDVIYAIVIVASKCEDLHGNIDTLIKRLPGSNKKNIFNYESELFEVLDYNFH
                     FPSLYLRMYGVLALLQEKGLIKVARDTPEATEGDKGEEIFVYSGEDCIVPCINKLWKL
                     SVERMDKILILGREPYKEIELVYASLYFPCEMFGFLSFSFSKDNVIRLRNACESFRPP
                     ETK"
     gene            complement(<207102..>208280)
                     /locus_tag="Eint_091880"
                     /db_xref="GeneID:9698508"
     mRNA            complement(<207102..>208280)
                     /locus_tag="Eint_091880"
                     /product="26S proteasome regulatory subunit 8"
                     /transcript_id="XM_003073629.1"
                     /db_xref="GeneID:9698508"
     CDS             complement(207102..208280)
                     /locus_tag="Eint_091880"
                     /note="similar to ECU09_1840"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit 8"
                     /protein_id="XP_003073675.1"
                     /db_xref="GeneID:9698508"
                     /translation="MVEGFCKNFYSNKLDHLEVLIAKKSKVLRVLEQKRAELNRRVRF
                     LREEISIVQEPSSNVGVIVEKMGKMQVLVKTNPDGKYLAKVEPGVNYDDLKPGVRVAL
                     RSDSYDVHRILPTKVDPLVSLMMVEKVPDSTYQMIGGLDEQIKEIREVIELPIKHPEL
                     FENLGIAQPKGVLLYGPPGTGKTLLARAVAHHTQCKFIRVSGSELVQKYIGEGSRLVR
                     ELFVMAREHAPSIIFMDEIDSIGSTRGDSNKGSDSEVQRTMLELLNQLDGFESHNNIK
                     VIMATNRIDILDPALLRTGRIDRKIEFPQPKESARLEILKIHSRKMNLTKGIDLETIA
                     SKMVGCSGAEVKAVCTEAGMYALRERRVHVTQEDFEMAVHKVLKKAGDLNSDLRKLLK
                     "
     gene            208464..208534
                     /locus_tag="Eint_091890"
                     /db_xref="GeneID:9698509"
     tRNA            208464..208534
                     /locus_tag="Eint_091890"
                     /product="tRNA-His"
                     /note="tRNA Type: His, Anti Codon: GTG, Cove Score: 64.28"
                     /db_xref="GeneID:9698509"
     gene            complement(<208560..>209690)
                     /locus_tag="Eint_091900"
                     /db_xref="GeneID:9698510"
     mRNA            complement(<208560..>209690)
                     /locus_tag="Eint_091900"
                     /product="PHD zinc finger-containing putative
                     transcriptional regulator"
                     /transcript_id="XM_003073630.2"
                     /db_xref="GeneID:9698510"
     CDS             complement(208560..209690)
                     /locus_tag="Eint_091900"
                     /note="similar to ECU09_1850"
                     /codon_start=1
                     /product="PHD zinc finger-containing putative
                     transcriptional regulator"
                     /protein_id="XP_003073676.2"
                     /db_xref="GeneID:9698510"
                     /translation="MSTSKCLGGVPREERDYRSIYHNLEIEKMHQIISKSTYASESES
                     DSKKTTRRNQKGNFFESIVYKLDSYDQLYLERSGIDISKDVFELVIDRLEKEWFLFVQ
                     DLVSRHVKPIEPTSFCDICTRHASERTGTLFVCQGCGICVHENCYGIQDLSDFWLCKG
                     CIYGKDLKECSFCPSSDGIFKQTSDNRWGHVLCAMFNRSLSFGHPLSKDPIDVSSYTK
                     ESGCSFCEKTVGTVICCSYFMCSRKYHVSCALDKCYFDLENRISYCIDHSPLKRSPYE
                     LGYRKVTKIRYFGYEKLRNPPIIRKKAPMACPQVTLFRKLCNLQPVATPSILSKIKAY
                     TQKEGNFPDLLKVLEYWELKRRGVGGPLLVLPEIKIGRKEEN"
     gene            <209719..>213024
                     /locus_tag="Eint_091910"
                     /db_xref="GeneID:9698511"
     mRNA            <209719..>213024
                     /locus_tag="Eint_091910"
                     /product="IkappaB kinase complex protein"
                     /transcript_id="XM_003073631.1"
                     /db_xref="GeneID:9698511"
     CDS             209719..213024
                     /locus_tag="Eint_091910"
                     /note="similar to ECU09_1860"
                     /codon_start=1
                     /product="IkappaB kinase complex protein"
                     /protein_id="XP_003073677.1"
                     /db_xref="GeneID:9698511"
                     /translation="MENFFSRHITIAETGGDTWIYSKGYTARKNIIYNESGESIYEIP
                     FVPKHFHVLAFEYFLVDELNAIYLVNKNTLEILEIGRVKDEVVALSVSRDEKWCVIAS
                     TTEILLFDSYIDFKKSIKFEFNEVIQIEWTDYEVFGVLTSNMIFFYDIELNLVGKSKE
                     REYSSISWRSKYNVFGCSTGKEICFVEPNGLEHGDPLEVRCNKLTFLENEDLLATIEN
                     NDEGSLLKVFYTKNFHWYLKLLKQVPGGFLCSEKNAVLFKDKERIAKVFLFEEKTHSG
                     PEYYVIDGNCILYTDFSKKIVPPPFFSVKIEFDSNVIDIFPSAKKGAVLLRDKVIIFK
                     WNGDNFISEEAFFLGREFDSVVQFKSFLLLKSKDEFLIKKMNGGEEIRINRSVRIQEA
                     TRRNIMNEENINVVTSQLCEILNSSVDVVRCYNFEEKLYLLLEDGSVIHNGRIVHSGI
                     DLEKRFEIVIGEDIFVHNGTKLFKNGNVTENITSFLIGEHGIITVSEGTGRFFLGLKE
                     STCQVDHRLELLCALDFRVVGLTRHGTLETYTPKIYTLTFIRKLLLDGKYKDAIEGCQ
                     RYIIPFGVFLDYNIELCKFIEACKDTHLISFFNEALQTFGDFDFILESEKVKRFRRVF
                     NFPMVLEPGKGKEYFEVLIANDESISDGSLEHLMEYRNGKSQEDSKLGNSRYSRDLPR
                     DGKKLCGRNTKDFFNELFQSLDLERNFKFAIFALVKVKRMDLALQVAKHDMKGGIGYM
                     LSITNMSNIINSALETCEEDLVHEVMKICQKDSSDFLFLIRNCEKDLRGFKINDFLKN
                     RIDALYHISRTGMVDLEREYIQKHDLVEEALMYEACGLSIRKEGYYFNLCAELLPPEK
                     ALILFKRAQNIEKALETAIENLYWREALGMCVKERQEELGKSLASRLIDSGKNYEAGQ
                     LFEEFLGDTEKAFIEYVKAKSMGNALRLCSDGELLMKEAREILKEKLLVLDDIKKSFI
                     KYRDRLKTLEEREDDCMSETSFSYTENRRGSKSTKVKNRPGGGYEKEFVLGKIRDIGL
                     NLMRWRDETEDLLKVFEKFEMKECIDAHNTSFSAVGEVLKMEIDNVFGTEKRHLYESN
                     RPIVEKPDLSKWL"
     gene            complement(<213061..>213879)
                     /locus_tag="Eint_091920"
                     /db_xref="GeneID:9698512"
     mRNA            complement(<213061..>213879)
                     /locus_tag="Eint_091920"
                     /product="undecaprenyl pyrophosphatase synthetase"
                     /transcript_id="XM_003073632.2"
                     /db_xref="GeneID:9698512"
     CDS             complement(213061..213879)
                     /locus_tag="Eint_091920"
                     /note="similar to ECU09_1870"
                     /codon_start=1
                     /product="undecaprenyl pyrophosphatase synthetase"
                     /protein_id="XP_003073678.2"
                     /db_xref="GeneID:9698512"
                     /translation="MLENLARKVLVCVVEAVENGVNNKYIMELILFIVGIFRKASSLT
                     SMGLDVWNGIPYSNHSDGAFRRSRIKIFQGMRVAFICDGNRRYMKKIGQKDKFTRDPG
                     LQKIYEFINFGYFYGLKEVSFFCFALSNLRRTPEEVNGIMNIIRKKIKNPKKTSIKPK
                     FLVYGRLDLLDSDVRNKLIEVEKETENNTDIVVNIFFAYSSEDEINRGIKFDSKVDIL
                     IRTGDAKRLSNFMVRQVATGTSVFFAKVLWPELTIVHLFLILLKHQLENKYLLN"
     gene            complement(<213985..>215223)
                     /locus_tag="Eint_091930"
                     /db_xref="GeneID:9698513"
     mRNA            complement(<213985..>215223)
                     /locus_tag="Eint_091930"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073633.1"
                     /db_xref="GeneID:9698513"
     CDS             complement(213985..215223)
                     /locus_tag="Eint_091930"
                     /note="similar to ECU09_1880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073679.1"
                     /db_xref="GeneID:9698513"
                     /translation="MIAIIVLIQVCLSKIVVVDDLGVTDRPNKDPDMARKVINALGGT
                     IKNSRDGVLLSNTKGIKRVVGDNENIPSKYDEGNRGEDKLFGKGKDSLSKKDDEENRL
                     QLNSSKPEYMGRSTPSSMDEDTTPELGMSYQESSLLNPLHIRSLFNRGNQQMFNGSGS
                     GTQGYLPKDILSGYRPEQSKYIPLSFRESGDSFMEVPRYTRSPLGDGMGFGMGENTNQ
                     SDELGAKKSFIVLKMAQSKQKENMLQNSIDKLLQDIDQLTEKIQDTQKMKDNMMSRIH
                     TKKNHLRNLQTNIKEVEIQRGRTLALIRLSRNELLKLSKMMDDQRSKLALLEDEEKIF
                     SDRIKKYDEEYDIGNRELQLDETRTQEIKKNIEELERMYNILKIRNNELLNERNKESA
                     LRNRLELETERLDRNTIDFI"
     gene            <215364..>218003
                     /locus_tag="Eint_091940"
                     /db_xref="GeneID:9698514"
     mRNA            <215364..>218003
                     /locus_tag="Eint_091940"
                     /product="putative transcriptional activator"
                     /transcript_id="XM_003073634.1"
                     /db_xref="GeneID:9698514"
     CDS             215364..218003
                     /locus_tag="Eint_091940"
                     /note="similar to ECU09_1890"
                     /codon_start=1
                     /product="putative transcriptional activator"
                     /protein_id="XP_003073680.1"
                     /db_xref="GeneID:9698514"
                     /translation="MRKTDLEDIRRVYEKYGEVLDVDKIKNGAKHIFKYVMDIPGSLL
                     DYPKVRHLRFLAKEKISQIVSEIRSQHNEGDIDSKRTLEWISAIKNIRKVHSAIVGYE
                     SARIAYWRKISVICARELKRGLSKTSRTNPILKSKKIYKELFGHIKKTERSMKDKSKR
                     AEKEEMERKKKEMEEKEELRQKRKFEYLLSQTELFSHFILKKSKCDVSNTEGEGTEEY
                     NSMKGYKAAMLQKEKVKEFEMGKQGKKFKSGEEVGEVASRYVSQPSILKCVLKEYQLK
                     GLNWLVSLYDKGINGILADDMGLGKTVQSISLLAYLYETEEIPGPFLVVTISSTLDNW
                     AQEFSRFLPSFKVCRFSGSPSERKELKKQFKNSDVVITTYQTAVSDEKMLKKIKWQYM
                     ILDEAQAIKSSMSRRWKTLLSFKARNRLLLTGTPIQNSMQELWALLHFIMPTLFDSLS
                     EFSDWFSKEIETSATMKKTVDEKSLQRLHTILKPFMLRRHKSDVIHELGQKTQIDLYC
                     NLSYRQRVLYKEITKSCSSMEMENLLMQLKKVCNHPDLFKKLEPTCGLSLEISDGVGD
                     TISFGRSKLDIKIPSLIAKDALEVFHRREQELIERINALEKIAYGRGFWGWYLENSLD
                     FKYKGRIFRSVKEVGKSILRNFENLDSNKLLESLKRLMNEEMYCLKRYACCISPVVAT
                     VPRLISNEVELPGIYLEDVHIPLNTTIHVPPLNTFISDSGKMIILDELLPRLKAEGHR
                     LLIYFQMTRMIDLIEDYLVKKGYTYLRLDGSLKASARADVIRDWQTNDKFIFLLSTRA
                     GGLGINLTAADTVIFYDSDWNPTADQQAMDRAHRLGQTRDVTVYRLITRGTVEEKVLE
                     SANRKDEIQKMVIHGNIFEGENF"
     gene            <218180..>219385
                     /locus_tag="Eint_091950"
                     /db_xref="GeneID:9698515"
     mRNA            <218180..>219385
                     /locus_tag="Eint_091950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073635.2"
                     /db_xref="GeneID:9698515"
     CDS             218180..219385
                     /locus_tag="Eint_091950"
                     /note="similar to ECU09_1900"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073681.2"
                     /db_xref="GeneID:9698515"
                     /translation="MEFLDRLILGSRTPRYADEALFPSRTYKKPMCNRKHCNTSCTSR
                     VLEEFEFWAYFLSEKEPNRREVRKKIHTMSKDLRFSIWIKCVGSREKFIRMKEIGLSN
                     TKEARDVESKEDGNRKLDDKGLVKFILDMCRDAEGNNQEAIFNILKNLERDFSSISNK
                     KLLALTIMHILELPYASPQTTYRFIHSLMESHNFCSVFSGFNESELDNGMDQDDENSV
                     HSAFWKFIISENALVFDRIIDLLVCYEGANIASVPTFLKKQTGDNDVQKWVEFISVRS
                     NLDKLGSVFDSERLEGPTEVEDREETYFDFLVIQNETIKAQEMMKIETNEKLNSLKEE
                     RDELYAQKVNLMEACSSLESDLKEYQKEYVKKVEEMLHSVEDKCEKYEKENMELKAKV
                     DEKEQVKDL"
     gene            <219454..>222498
                     /locus_tag="Eint_091960"
                     /db_xref="GeneID:9698516"
     mRNA            <219454..>222498
                     /locus_tag="Eint_091960"
                     /product="chromosome segregation protein"
                     /transcript_id="XM_003073636.1"
                     /db_xref="GeneID:9698516"
     CDS             219454..222498
                     /locus_tag="Eint_091960"
                     /note="similar to ECU09_1910"
                     /codon_start=1
                     /product="chromosome segregation protein"
                     /protein_id="XP_003073682.1"
                     /db_xref="GeneID:9698516"
                     /translation="MHIKQIRLKNFKSFKDETLVEFTENVNIIVGRNGSGKSSIVSAI
                     RFVLCGEKYNCESRMELIHEGSRASEEEASVEIVFDSGSPESLGKGFSIKRVVDAKKD
                     EYMLDNKTISRDELGGLLQGHGFATSSPYFIVLQEEISELAVLSDRRRYELIKDVAGV
                     SEYEKDRENSMQTLEETKQSENKIELLLERIEEKLRGFENDKKEAELCLELEKEKRRL
                     EYGYIEREVGEINEEICKIENLGSNNLEESSEENEDYGCEIREVESKLERLGRRRKEL
                     HVDEKYKDKESEIENEIKNIEKKRNDLLGSLEIEKKTLKSLKRNEMETFVRSGYIKYL
                     IVFLETLGNREVSSEEIEISKRALKEKIEKLKDFNNLDHSGKFEEKRNIEELIERRKH
                     LWREERRLKLSEESIGGIVKSQEGRLIAMGNIGLDVYKQIKNEKGVLGYVYDLISIPN
                     ELANAFEAVVGNALFNIVVESEDVASNVLKKMKDLRFRVTFMPLNRIEYKEENEIEDS
                     NVISLTSQLKCNQQYKPLLRYITKNFYLCPDLKQALHLSKKYGINVVTLSGEVVAREG
                     TITGGYERRNMVFQEYKRICKESRKIKGEMIKVQHELGKINKEIEEVKMHKECGSDES
                     RYYESLKSSVLFLQEKIKILEEVVKEKLDGNGINGKLRKLREEEKDLKLKGIWIGGEI
                     KKVGMRIEEAEIGVRNLNEGVGRLREELSKSSMYREAKEIEKEILELKDKKRAVKEMM
                     FNEENMGLFAKPKKINVEVENLVRRKHMLINKRNELCERIGISDFRNLERLFPDKKKE
                     DIMNEIVRINERIRGLSVVNRVAVSQWESYIEQKNSIRKRLEELKDDKRHISEFIAEL
                     DSRKEGAMGKAMSVVEEGFSEFYSRLTEGGKAELYSYESSIGIKVGKDVGTSLLSGGQ
                     KAVVALSLIFSMQRVNPSPLYVFDEIDANLDAQSRQKVSMLIKEMSERNGSQFIITTF
                     RKELLNCGDKYLNVEFREKRSNIKDIDAGVAHKFLDEDLGER"
     gene            <222556..>222861
                     /locus_tag="Eint_091970"
                     /db_xref="GeneID:9698517"
     mRNA            <222556..>222861
                     /locus_tag="Eint_091970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073637.1"
                     /db_xref="GeneID:9698517"
     CDS             222556..222861
                     /locus_tag="Eint_091970"
                     /note="similar to ECU09_1920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073683.1"
                     /db_xref="GeneID:9698517"
                     /translation="MGENKDFISPLDLAKRLRSNVYDPVKTLLSIQCLSRPLSVDRSQ
                     VRAIRRLSKFLFSLSLDKEVLVSLAFNPEAVDTFMDFGKIVMHREYNKIYYCIDIKP"
     gene            <222933..>224252
                     /locus_tag="Eint_091980"
                     /db_xref="GeneID:9698518"
     mRNA            <222933..>224252
                     /locus_tag="Eint_091980"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073638.1"
                     /db_xref="GeneID:9698518"
     CDS             222933..224252
                     /locus_tag="Eint_091980"
                     /note="similar to ECU09_1930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073684.1"
                     /db_xref="GeneID:9698518"
                     /translation="MLKELIDEDDFCRKLRTSKEEDSKTGFYRLFYVLLDDPSLQVLE
                     SLLSNYTLQDVVNGLKHLIKFKFDRLTKEVYANILLVVRMMLDYEENIDTLIINLLRH
                     HLVEEVYSMYKDKPKYFNNHPNCLSFLAFFCAQSSTRRDAFEANLSTRDFLFMTIKEM
                     MSGSHFEDQKKKKIKKESIHGSSEYPIFPFTSYFSSKKLLPALFMPTSLNILSSQLSV
                     DLEMNIMFILEHDQNFDFHLELLFKNHIRNLDDACRVLRFVVNIPYPQNIGRLVNSLL
                     DKYPSSYIAVIYDMLFWNQKERLNGNLVEYLKGNSNKIAEKITSLQEEWKPLKLAMES
                     IKKRQECTVESITKMIHGLNFQKYFGLVKEMEKWGTPIVPKEMYDRIILESSEWDGYA
                     QVYLWKIIGFQKIYLGLDVDTPKRIESLEGIEGFEIIKSLSNIKKRT"
     gene            complement(<224267..>224908)
                     /locus_tag="Eint_091990"
                     /db_xref="GeneID:9698519"
     mRNA            complement(<224267..>224908)
                     /locus_tag="Eint_091990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073639.1"
                     /db_xref="GeneID:9698519"
     CDS             complement(224267..224908)
                     /locus_tag="Eint_091990"
                     /note="similar to ECU09_1940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073685.1"
                     /db_xref="GeneID:9698519"
                     /translation="MIISWTDAFKVLRNIKMEERLFQKKLIFEYLSKQPKSTSCSLCS
                     RRMPIKDIVCRACFCRLHPFPADFKISIAVEYAKIFQIIRAKSLGKSKLLSKNEDECL
                     KLLGISSRCPLQDLIGKILTLEPTGLSHEEILILNSIKLKIRASTVNEWTVVRIKSMM
                     DLIDEQLNAINLRYLICLRHLRIDDALSLKKHIIEIKKHKDDLDTILKRKSIL"
     gene            complement(<225015..>225554)
                     /locus_tag="Eint_092000"
                     /db_xref="GeneID:9698520"
     mRNA            complement(<225015..>225554)
                     /locus_tag="Eint_092000"
                     /product="putative membrane traffic regulatory protein"
                     /transcript_id="XM_003073640.1"
                     /db_xref="GeneID:9698520"
     CDS             complement(225015..225554)
                     /locus_tag="Eint_092000"
                     /note="similar to ECU09_1950"
                     /codon_start=1
                     /product="putative membrane traffic regulatory protein"
                     /protein_id="XP_003073686.1"
                     /db_xref="GeneID:9698520"
                     /translation="MDCLRKQAEKIPILDAFEKRMNIRKEYALLGISFLCLVIIMTTS
                     LGPLVTSTIGIIVPLQETLVILRQVNPKKEEGKHMLVFWMVFGILTSLDAYSTTVISL
                     IPLWYTIKFFFLLWAGPLRFHGGIIIYDNILARIPESWYREECGIENAVRKATDAVKT
                     VAESELSKKDVIESNKKTD"
     gene            <225643..>226092
                     /locus_tag="Eint_092010"
                     /db_xref="GeneID:9699386"
     mRNA            <225643..>226092
                     /locus_tag="Eint_092010"
                     /product="deoxycytidylate deaminase"
                     /transcript_id="XM_003073641.1"
                     /db_xref="GeneID:9699386"
     CDS             225643..226092
                     /locus_tag="Eint_092010"
                     /note="similar to ECU09_1960"
                     /codon_start=1
                     /product="deoxycytidylate deaminase"
                     /protein_id="XP_003073687.1"
                     /db_xref="GeneID:9699386"
                     /translation="MALSSSRHSFFMDMALDQAEKAFDQLEVPVGCVVVRDGIVVSKS
                     HNMTNANKSPLDHAEVISIRSTDCSNSTFYVTCEPCIMCMGILGRLKGVRVYYGCKNE
                     IFGSETICGVGIESTYLPDDRCFKILQKFYSRENAFAPDEKRKLKNR"
     gene            complement(<226117..>229377)
                     /locus_tag="Eint_092020"
                     /db_xref="GeneID:9699387"
     mRNA            complement(<226117..>229377)
                     /locus_tag="Eint_092020"
                     /product="myosin heavy chain"
                     /transcript_id="XM_003073642.2"
                     /db_xref="GeneID:9699387"
     CDS             complement(226117..229377)
                     /locus_tag="Eint_092020"
                     /note="similar to ECU09_1970"
                     /codon_start=1
                     /product="myosin heavy chain"
                     /protein_id="XP_003073688.2"
                     /db_xref="GeneID:9699387"
                     /translation="MENDDLCELGDLDGNVISDILEKRYASGKIYTRSGLVFLALNPY
                     ENLNPSIKEIMQSPADYAYSYPHIYGVAESAYQDLFIHGNQTIVISGESGSGKTENAK
                     LIIKYLIERTASSASIERNIAAANAILEAFGNAQTILNDNSSRFGKRIKVMFNGKITG
                     AKFETYLLEKSRVTHHEIGEKNFHIFYQFCASKGLNLKNDFIDTSSLVGNKEYSMRLS
                     KEYAATRSAMESVGVACINKIEDCLLGILYLGSIQFGGDGILKVVRNECFKEFCKLHD
                     IQEDAFEESLVKFSIQVKGETIEVFNTLKQAVTIRNSMARLLYSNIFNYITSSINNCL
                     SGNGELFISVLDIFGFEIFEKNGLDQLCINWTNEKIQNDFIRKVFRGKQEMYKKEGIE
                     WRDVEFFDNNQCILDFEKPCGLMDLISEESFNAWGNVQNLSMKIKNYLKGNIRTKADD
                     KIVVSHYAGDVEYDLRSFLDKNRERGNLKIFENPLIIHEENKEDLVKYFKDSMNNLLH
                     SINETQTKYIKCIRPNAQKKPKLFDRPLIAKQLAECGVLETIRISKQCFPQEIQKNEF
                     ETRYEVLGSTTFEMVTVKKGKSRYFMSNESLRILEIRRSLFYEECFRNIKNALRSYLN
                     NHNCDKKQRIMFVNEPVVAESSVSIESNSVELMIDKGYNTTDPCNAQEDNRKQRSYKE
                     IIRDLELKIEKYKKFCEAPCRNCKSLELKYRFQSEALKKKNMIELELEKYKAKVEDLE
                     KRLSEKEEDDDSHMSVSFTNAYNVFNCLVQLYLEFVPTFSNEEVPKPEILGLAHSAFY
                     AVNKLGKNIVESTACMMNEINLQLHMFERNIHKVSFILSNLIEYENILRGYGVNNVEE
                     VKSLISILFKHLCELQRSFLLEVLPHAVLEHQQLSKFKCSEGYFKKLFKPPHISKLIH
                     LLEYFYHQMSYYYIPDPYIMESINYLLKTINISVFNEILVKKNFLSFNRGVQINYNIN
                     EIDKFCRSINYLEGMFNLSHTTAIIRLINLVESRATADLILDECSILNCLQINEIVSK
                     LDAEASYFFGNDNRNDKFISDPTVTLPSYTGVSSHAFICPRYLPSESLLSILKSIR"
     gene            complement(<229552..>230145)
                     /locus_tag="Eint_092030"
                     /db_xref="GeneID:9699388"
     mRNA            complement(<229552..>230145)
                     /locus_tag="Eint_092030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073643.1"
                     /db_xref="GeneID:9699388"
     CDS             complement(229552..230145)
                     /locus_tag="Eint_092030"
                     /note="similar to ECU09_1980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073689.1"
                     /db_xref="GeneID:9699388"
                     /translation="MNSENNSSILATIQGRYKFRSKTLDYSTSFYPDRFTILYKDRKV
                     GEVSYENILRVEKNREGLKFGLRNGVWIKIPCASDDKRKIFRIFKAKKLGGIMSQNDI
                     MGLALVEFADLKFLVPLASMCFSDFKKSVIKKIGSHFLPSQSLDFVSLDHYNEFSLFI
                     KDKDSLVIFENDDDLLCSLLYFEKKLDVVVKHVPRTS"
     gene            <230310..>231065
                     /locus_tag="Eint_092040"
                     /db_xref="GeneID:9699389"
     mRNA            <230310..>231065
                     /locus_tag="Eint_092040"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073644.1"
                     /db_xref="GeneID:9699389"
     CDS             230310..231065
                     /locus_tag="Eint_092040"
                     /note="similar to ECU09_1990"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073690.1"
                     /db_xref="GeneID:9699389"
                     /translation="MIDKIRSFLPSPRSLEPLEPLKKRVKRKERPSKCILSRSIYEET
                     DLSRLTPRQRLLHQKYQENKNNVSSFFLLSNNIPIERHIDIKPKKLNEEAPSKSTDKS
                     IELDCEANWKVRDGNSLQEEKNFLILTSDLYNSSYKDIEEEQSSSESNDEVIEAAEIE
                     SPFRSRIPENASDKDHHICKDCFKDAVEIYYILERISDVHKCRLKNFILLHKYKIRQN
                     FKKKLCFSTIRREETAFIKTLEKVECCMEKPRF"
     gene            complement(<231104..>232129)
                     /locus_tag="Eint_092050"
                     /db_xref="GeneID:9699390"
     mRNA            complement(<231104..>232129)
                     /locus_tag="Eint_092050"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073645.2"
                     /db_xref="GeneID:9699390"
     CDS             complement(231104..232129)
                     /locus_tag="Eint_092050"
                     /note="similar to ECU09_2000"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073691.2"
                     /db_xref="GeneID:9699390"
                     /translation="MEDDGFLDNTKILSYTNEAVFSLLLLVFAVWRSTRSTMPSYNIF
                     RGKLRSLGSIFALSSIFLSGIYICIVTYLSTKLEIDKANIELVGWLDANYPVRYKDFK
                     ADLVYLLNISLIGSRILRMSSVFLLIGLWGPCAYSVFNGGDRPFDIFKSSSTGTRTFV
                     AKSMFNTSVVTFSKIYAILRAPALLYYYYSRSRLMGEKTAVFIESFLLGNEVYLSVAL
                     LLILRTKHSFLSEYKSLDSTNLLSFCLMFHGFLTYTINTVAIPFEMTDLHHQIQQSLS
                     LGARLILDMLLISMFCPIRDQLFDNSSDRYEKNFEITRITRLEDEGPIVQEIESVIEF
                     EEKEIGK"
     gene            complement(<232627..>233388)
                     /locus_tag="Eint_092060"
                     /db_xref="GeneID:9699391"
     mRNA            complement(<232627..>233388)
                     /locus_tag="Eint_092060"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073646.1"
                     /db_xref="GeneID:9699391"
     CDS             complement(232627..233388)
                     /locus_tag="Eint_092060"
                     /note="similar to ECU11_0090"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073692.1"
                     /db_xref="GeneID:9699391"
                     /translation="MSSIFITELASTPMYTYHENSKRESYWSPDLYSHLGTSISILIP
                     LLMFLIFGENTLKDNSFIRFLFFAIPLLQLTFLNFCLFSTINNSNTMSIFHSILHSVL
                     KFLLILFSILPFLLIFMFPLLKPENIKVLSSSSLFLLSITYFFFTSLSPIPSTIQFSG
                     SAIDALAGFSLLLIFFLKRNHLLLFHLFLFLFTLFKFLRFKYSPPKNIETTPWRQILF
                     VLIFTVLTVVYLFISLLFFLFITKNLFSLAVKKIL"
CONTIG      join(CP001950.1:1..233397)
//
DBGET integrated database retrieval system