GenomeNet

Database: RefSeq
Entry: NC_014424
LinkDB: NC_014424
Original site: NC_014424 
LOCUS       NC_014424             234890 bp    DNA     linear   CON 10-OCT-2017
DEFINITION  Encephalitozoon intestinalis ATCC 50506 chromosome X, complete
            sequence.
ACCESSION   NC_014424
VERSION     NC_014424.1
DBLINK      BioProject: PRJNA51607
            BioSample: SAMN03081424
            Assembly: GCF_000146465.1
KEYWORDS    RefSeq.
SOURCE      Encephalitozoon intestinalis ATCC 50506
  ORGANISM  Encephalitozoon intestinalis ATCC 50506
            Eukaryota; Fungi; Microsporidia; Unikaryonidae; Encephalitozoon.
REFERENCE   1  (bases 1 to 234890)
  AUTHORS   Pombert,J.F., Selman,M., Burki,F., Bardell,F.T., Farinelli,L.,
            Solter,L.F., Whitman,D.W., Weiss,L.M., Corradi,N. and Keeling,P.J.
  TITLE     Gain and loss of multiple functionally related, horizontally
            transferred genes in the reduced genomes of two microsporidian
            parasites
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 109 (31), 12638-12643 (2012)
   PUBMED   22802648
REFERENCE   2  (bases 1 to 234890)
  AUTHORS   Corradi,N., Pombert,J.F., Farinelli,L., Didier,E.S. and
            Keeling,P.J.
  TITLE     The complete sequence of the smallest known nuclear genome from the
            microsporidian Encephalitozoon intestinalis
  JOURNAL   Nat Commun 1, 77 (2010)
   PUBMED   20865802
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 234890)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 234890)
  AUTHORS   Corradi,N., Pombert,J.-F. and Keeling,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAR-2014) Botany, University of British Columbia,
            3529-6270 University Boulevard, Vancouver, British Columbia V6T
            1Z4, Canada
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 234890)
  AUTHORS   Corradi,N., Pombert,J.-F., Farinelli,L., Didier,E. and Keeling,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2010) Botany, University of British Columbia,
            3529-6270 University Boulevard, Vancouver, British Columbia V6T
            1Z4, Canada
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001951.
            Linear chromosome is missing portions of the telomeric regions.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..234890
                     /organism="Encephalitozoon intestinalis ATCC 50506"
                     /mol_type="genomic DNA"
                     /strain="ATCC 50506"
                     /db_xref="taxon:876142"
                     /chromosome="X"
     gene            complement(36..2475)
                     /locus_tag="Eint_100010"
                     /db_xref="GeneID:9699569"
     rRNA            complement(36..2475)
                     /locus_tag="Eint_100010"
                     /product="5.8S-23S ribosomal RNA"
                     /transcript_id="XR_002670149.1"
                     /db_xref="GeneID:9699569"
     gene            complement(2516..3808)
                     /locus_tag="Eint_100020"
                     /db_xref="GeneID:9699393"
     rRNA            complement(2516..3808)
                     /locus_tag="Eint_100020"
                     /product="16S ribosomal RNA"
                     /transcript_id="XR_002670150.1"
                     /db_xref="GeneID:9699393"
     gene            <4118..>4354
                     /locus_tag="Eint_100030"
                     /db_xref="GeneID:9699394"
     mRNA            <4118..>4354
                     /locus_tag="Eint_100030"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073647.1"
                     /db_xref="GeneID:9699394"
     CDS             4118..4354
                     /locus_tag="Eint_100030"
                     /note="similar to ECU10_0110"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073693.1"
                     /db_xref="GeneID:9699394"
                     /translation="MSEQREEKPLYMLKSTGPGRKKRRRGDPFIDCYLKGDPSTRCTS
                     DSSEGRPDIGDAVIYRSDLDSGDEIIYLSELLQG"
     gene            complement(<4393..>5448)
                     /locus_tag="Eint_100040"
                     /db_xref="GeneID:9699395"
     mRNA            complement(<4393..>5448)
                     /locus_tag="Eint_100040"
                     /product="Cdc7-like cell cycle protein kinase"
                     /transcript_id="XM_003073648.1"
                     /db_xref="GeneID:9699395"
     CDS             complement(4393..5448)
                     /locus_tag="Eint_100040"
                     /note="similar to ECU10_0120"
                     /codon_start=1
                     /product="Cdc7-like cell cycle protein kinase"
                     /protein_id="XP_003073694.1"
                     /db_xref="GeneID:9699395"
                     /translation="MEEEKIPESDLKHLSFIIPKYTPIEKIGEGSFSVVYKALDAEAG
                     RHVALKVITRTSSPARVLEELTFLKALEGKRNCMGLLGVFRNEDQVIAVFPYFKPIDF
                     REFISNAGLNDIKQYLYNLLEAIDHVHGNGIIHRDLKPGNFLYNKETGRGMLIDFGLA
                     QYEDRREEHLPKDSSKPQTPLLFFNSIVSKTKPPGYYERDSRPQMKAPRAGTRGFRAP
                     EVLFRYPHQTRAIDMWSVGVIFLTILTAQYPFFYSSEDIDAIVEIATIFGHAEMRKAA
                     KFYGRLWRSNIDTIPEERIPFETIIESLNPWAEVGSEGYDLLYRMLDLCSSTRITAPD
                     ALNHPFFDGLKTHRDPA"
     gene            <5557..>6720
                     /locus_tag="Eint_100050"
                     /db_xref="GeneID:9699396"
     mRNA            <5557..>6720
                     /locus_tag="Eint_100050"
                     /product="26S proteasome regulatory subunit 6"
                     /transcript_id="XM_003073649.1"
                     /db_xref="GeneID:9699396"
     CDS             5557..6720
                     /locus_tag="Eint_100050"
                     /note="similar to ECU10_0130"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit 6"
                     /protein_id="XP_003073695.1"
                     /db_xref="GeneID:9699396"
                     /translation="MCGGLKADLFVRYKQMERKLKLLEIREAYVRKEVETLRREERHS
                     KEELDRVKSVPLIMGQFLEPIDNSTAIVGSTAGSNFVVRILSTVDRELLKPNTTVALH
                     RHSSAIVDVLPPEVDSTIPVMGESERPEVTYADVGGLDVQKQEIRETVELPLLQSELY
                     RQIGIDPPQGVLLYGPPGTGKTMLVKAVANHTKATFIKVNGSEFVQKYLGEGPRMVRD
                     VFRLAREKAPSIVFIDEVDSIATKRFDASTSADREVQRVLIELLNQMDGFDQTANVKV
                     IMATNRADTIDPALLRPGRLDRKIEFPLPDRRQKRLVFNAITSKMSLKDEVDIESLVC
                     RPERISCADINSICQEAGMLAVRASRYMVTQKDFEEAYSKVVERSDTRPAFYN"
     gene            complement(<6788..>7423)
                     /locus_tag="Eint_100060"
                     /db_xref="GeneID:9699397"
     mRNA            complement(<6788..>7423)
                     /locus_tag="Eint_100060"
                     /product="vacuolar ATP synthase subunit D"
                     /transcript_id="XM_003073650.1"
                     /db_xref="GeneID:9699397"
     CDS             complement(6788..7423)
                     /locus_tag="Eint_100060"
                     /note="similar to ECU10_0140"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit D"
                     /protein_id="XP_003073696.1"
                     /db_xref="GeneID:9699397"
                     /translation="MTGQKIPVFPTRMNLKTMETKQKSAEKGYSLLKRKSDALKVKYR
                     VIEEEYKRKELGINQKIKDAFFKLTEAEFLGANLKMFLYECQKQNVYVKPRIEQVSGV
                     SLPFFTLQKENTQPILFLDRSGQSLNECREKFLEVLEMLVDLCALKNSFRVLNSILMS
                     TNRRVNALEFNIIPKLENTISYISSELDEQDRGDFFRLKKIQNLKTKDKSN"
     gene            complement(<7512..>8678)
                     /locus_tag="Eint_100070"
                     /db_xref="GeneID:9699407"
     mRNA            complement(<7512..>8678)
                     /locus_tag="Eint_100070"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073651.1"
                     /db_xref="GeneID:9699407"
     CDS             complement(7512..8678)
                     /locus_tag="Eint_100070"
                     /note="similar to ECU10_0150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073697.1"
                     /db_xref="GeneID:9699407"
                     /translation="MDTKRTLVDKIDIFFLLKQQRLVTKRELEMVLPIQSYEDYSTNY
                     YRRRVPEVFDKSLGKEWFIYRYLDNSFFEQRRKTICNVHSFKIEGPCIIARNIPDSMP
                     GSVIYSIFSKCVNLERFWIQQQTSQNGFSRLCYIILQKEANTQDSIKFMKSILDKGLG
                     VQLEEFDISGVSEPEISFEDDDYQMSASIFTSLSRMFDVNEEEVLEKYASTLEDSSTE
                     RNTAKFICGALKSIFLYCYTCAHQYDDPLEMMMGCRNHKATDTATRRREFLANYRGFG
                     YLHPKTKEEELNNMTTIVNENHYKCGFCGKSFESEKFIFNHFNNKHEDEIKRIEKSIE
                     DFKKFLQRIDCFMLGVIEGTDDDRIPRFILPNIKDDRIVYDMGCVFSGEIVINK"
     gene            complement(8731..8803)
                     /locus_tag="Eint_100080"
                     /db_xref="GeneID:9699408"
     tRNA            complement(8731..8803)
                     /locus_tag="Eint_100080"
                     /product="tRNA-Asn"
                     /note="tRNA Type: Asn, Anti Codon: GTT, Cove Score: 75.19;
                     similar to ECU10_0155"
                     /db_xref="GeneID:9699408"
     gene            <8884..>9201
                     /locus_tag="Eint_100090"
                     /db_xref="GeneID:9699409"
     mRNA            <8884..>9201
                     /locus_tag="Eint_100090"
                     /product="60S ribosomal protein L23A"
                     /transcript_id="XM_003073652.1"
                     /db_xref="GeneID:9699409"
     CDS             8884..9201
                     /locus_tag="Eint_100090"
                     /note="similar to ECU10_0160"
                     /codon_start=1
                     /product="60S ribosomal protein L23A"
                     /protein_id="XP_003073698.1"
                     /db_xref="GeneID:9699409"
                     /translation="MDTPKRNFKHPRNLVSKMPRNTPHDIILYALTTEKAARCMEQFN
                     TLVFYVEKTSTKPEIRDAVTQLYGCKVKKVNTLINKHGKKAYVRFDKEGDAIQIASKI
                     GAI"
     gene            complement(<9277..>10554)
                     /locus_tag="Eint_100100"
                     /db_xref="GeneID:9699410"
     mRNA            complement(<9277..>10554)
                     /locus_tag="Eint_100100"
                     /product="signal recognition particle GTPase"
                     /transcript_id="XM_003073653.1"
                     /db_xref="GeneID:9699410"
     CDS             complement(9277..10554)
                     /locus_tag="Eint_100100"
                     /note="similar to ECU10_0170"
                     /codon_start=1
                     /product="signal recognition particle GTPase"
                     /protein_id="XP_003073699.1"
                     /db_xref="GeneID:9699410"
                     /translation="MGYFCVFNKRGLVIHEEGRMPEHFNQIVVSLDVSRPGGERKIRD
                     EVMEYEIRGAIVYLSLSRTPNLKIAIDNYLNKSKEKAGSENKKRAWKKNKERKWEDIG
                     NEEELNYSSPSSGVSNFVKVIKKATIQKAFGLFKDQIQVKELKDKMTTHLINKNVSYQ
                     ITRTLVENVMEELSGEGLDVVSEKKFKEKMSNVLGKLIPSVDHEKMLDGIRKHKGVFS
                     ICFVGVNGVGKSTSLAKICYWLLKNKLKVYIAACDTFRAGAIEQLKTHVERFQLGGYS
                     VGFYQKGYGKDDASVARCAIQEAQHEGYDVILIDTAGRMHNKKNLMMSLTKLMKINKP
                     DHIIYVGEALVGSDSLEHIKEFNRAIKDADQLRNIDSILLTKVDTVDNKIGQILNMAF
                     SSNAPILFLGVGQTNSDLSNIGSEDIVNSLMSS"
     gene            complement(<10611..>11210)
                     /locus_tag="Eint_100110"
                     /db_xref="GeneID:9699411"
     mRNA            complement(<10611..>11210)
                     /locus_tag="Eint_100110"
                     /product="ribose 5-phosphate isomerase"
                     /transcript_id="XM_003073654.1"
                     /db_xref="GeneID:9699411"
     CDS             complement(10611..11210)
                     /locus_tag="Eint_100110"
                     /note="similar to ECU10_0180"
                     /codon_start=1
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="XP_003073700.1"
                     /db_xref="GeneID:9699411"
                     /translation="MEGYKKNVESRTVIGIGTGTTIERYIGVLDREVVYVPSSIQTAL
                     KLREKGLIVSSPLGHESLDLYIDGADYFDKCGNLIKGGGGALTTEKLLYSMAKDIIII
                     VQRHKYRETFEGCLVPIEISSISLMKFLSILQEYKLKHFLRETTGKAGPLISDLGNCI
                     VDVEYNADFISECKSICGVIEHGLFEANGYTTIIEENLG"
     gene            complement(<11359..>12465)
                     /locus_tag="Eint_100120"
                     /db_xref="GeneID:9699412"
     mRNA            complement(<11359..>12465)
                     /locus_tag="Eint_100120"
                     /product="26S proteasome regulatory complex protein"
                     /transcript_id="XM_003073655.1"
                     /db_xref="GeneID:9699412"
     CDS             complement(11359..12465)
                     /locus_tag="Eint_100120"
                     /note="similar to ECU10_0190"
                     /codon_start=1
                     /product="26S proteasome regulatory complex protein"
                     /protein_id="XP_003073701.1"
                     /db_xref="GeneID:9699412"
                     /translation="MDFDFKEPTLLVHDLIHATKLGKSEAQEELEKLLSDKCMYDLYS
                     FLVEKGILQPNHERIDSLLNCKNQRIQELEELRKKETENETYAEEIERKTAEFYCQVM
                     DTQNGFEWMRKLMRDDMSLSLKMDISLCKIRMGLIVGNKRIVEESINVADDTYERGCD
                     WDRRNRYKVYKGVFKMMERKFKEAGILFSEVLPSFESSEVISYSRAVKYMIFCGLLGF
                     ERNEIETRILKCSDVMGSSEKLGVQLATSLFECNYGSFMEDLYLFCKSLQEDVFVGRF
                     VNLFCREMRLRVYGQVLESYRSMLLENMAETFGVSVEYVEEDLGEFIVEGRLWSKIDR
                     ISGVVEVTSREDQDASSIIGYGCDVVRRIKKCVK"
     gene            complement(12531..12603)
                     /locus_tag="Eint_100130"
                     /db_xref="GeneID:9699413"
     tRNA            complement(12531..12603)
                     /locus_tag="Eint_100130"
                     /product="tRNA-Val"
                     /note="tRNA Type: Val, Anti Codon: CAC, Cove Score: 62.15;
                     similar to ECU10_0195"
                     /db_xref="GeneID:9699413"
     gene            <12677..>13456
                     /locus_tag="Eint_100140"
                     /db_xref="GeneID:9699414"
     mRNA            <12677..>13456
                     /locus_tag="Eint_100140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073656.1"
                     /db_xref="GeneID:9699414"
     CDS             12677..13456
                     /locus_tag="Eint_100140"
                     /note="similar to ECU10_0200"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073702.1"
                     /db_xref="GeneID:9699414"
                     /translation="MDDTIQRYKEKLNELEKIGSEIKDMLSLDYDLDCLSHSPSVCYI
                     ATSLEEGKAEELEENKYSIEVQMIITIGKSLDSTLKKDLISKIEKIKAINIGIEEYRD
                     AIASRFKYLHNLLGNDLLFKLTIEVKSLLPLARAIPSEIMKYGIETYGFPLLSQHQLI
                     MKASPQNQEKLLRKLCCKVTMAAKLDFCESSFEIDFYSQMEKIFNSLESKEKEEKSIL
                     KVPLARKETRRGGINARRKRQGSSPHKRRRLLKLEPDEADG"
     gene            <13483..>14190
                     /locus_tag="Eint_100150"
                     /db_xref="GeneID:9699398"
     mRNA            <13483..>14190
                     /locus_tag="Eint_100150"
                     /product="DNA-directed RNA polymerase III subunit C34"
                     /transcript_id="XM_003073657.1"
                     /db_xref="GeneID:9699398"
     CDS             13483..14190
                     /locus_tag="Eint_100150"
                     /note="similar to ECU10_0210"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase III subunit C34"
                     /protein_id="XP_003073703.1"
                     /db_xref="GeneID:9699398"
                     /translation="MKSLLDFIKSRPEGVVEEELSLEFPDMSKADIAKELNNYLKCQE
                     ISLFRDKGVLYYKPSPVNVDDYELMIYNLVNQSGSEGVWLKVIKDKTNMPHNLVGKVL
                     RNMETKRIIKSVKCLKNNRKVYVLYDQVPSEEITGGMWFQDNDVDVECVTKILEIILL
                     FLEKRLGDRLELPEYEENPKLEEIMNYVKDLGILSVPLRLEDLETLVDILVFDGRVEK
                     LHSGPIVRYRALRPYGK"
     gene            <14268..>15254
                     /locus_tag="Eint_100160"
                     /db_xref="GeneID:9699399"
     mRNA            <14268..>15254
                     /locus_tag="Eint_100160"
                     /product="translation initiation factor IF3 subunit 2"
                     /transcript_id="XM_003073658.1"
                     /db_xref="GeneID:9699399"
     CDS             14268..15254
                     /locus_tag="Eint_100160"
                     /note="similar to ECU10_0220"
                     /codon_start=1
                     /product="translation initiation factor IF3 subunit 2"
                     /protein_id="XP_003073704.1"
                     /db_xref="GeneID:9699399"
                     /translation="MDDGLSIGSEGYFLNIKCHERPITDVKFNYDGDLIFTSGKDSIA
                     TLLRSDGSVVGEYKGHRGSIFSIAVDNKSTSLVTGSADQSIILWDVSTGKMKAQTDVG
                     VVVKGLDFYKDGTLCLGCSDDSMGKTPSIGILDTRNKSFEKIFVPTSSPIKILMDISE
                     NFLVYCDSRGGVSSVDLRNSQVIKSAKIHTSKINNIRPSRCRTFFITGSMDSQAKIID
                     FLDLSVQKTFVCEEPVNCAAIFNTNDKVICVGGINARDVTTTKGKSSFDANFFDVVTC
                     EKIGSYSTHFGTINSVDVHPSGKLYCSGGEEGTITILAFGQDFFQANFTNFN"
     gene            complement(<15270..>15677)
                     /locus_tag="Eint_100170"
                     /db_xref="GeneID:9699400"
     mRNA            complement(<15270..>15677)
                     /locus_tag="Eint_100170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073659.1"
                     /db_xref="GeneID:9699400"
     CDS             complement(15270..15677)
                     /locus_tag="Eint_100170"
                     /note="similar to ECU10_0230"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073705.1"
                     /db_xref="GeneID:9699400"
                     /translation="MTFMQENIKEKIETISTLMKRLEENKNISVVDVLKEEILKLKKL
                     NEEYKKSLEAKRVMHKDQLQNKTRYYLKDGSTYVVKSNQYRYLYDAKTKVITYEFSNG
                     QIEKTFPSGLKEVRYPDGSIAIKNGPKDHEYIK"
     gene            complement(<15797..>17356)
                     /locus_tag="Eint_100180"
                     /db_xref="GeneID:9699401"
     mRNA            complement(<15797..>17356)
                     /locus_tag="Eint_100180"
                     /product="T complex protein 1 subunit gamma"
                     /transcript_id="XM_003073660.1"
                     /db_xref="GeneID:9699401"
     CDS             complement(15797..17356)
                     /locus_tag="Eint_100180"
                     /note="similar to ECU10_0240"
                     /codon_start=1
                     /product="T complex protein 1 subunit gamma"
                     /protein_id="XP_003073706.1"
                     /db_xref="GeneID:9699401"
                     /translation="MQKPIPRKMYILVPDKPAQIQNESAIAAKTISSVIRTCLGPRAM
                     QKMVLTKINSIELTNDGNAILRELDVAHPSARSLIELAKTQDDEVGDGTTSVVLLAAE
                     ILNEMTYILDKDVHPIKICNSLSKALEVCIKAIDGTAMSLDSSEETRIKIINGSVASK
                     VCSILKVPIGKLALEAVKKIYIKEENRCDLKSNMKVEKILGGNFVESEVMDGILINKD
                     IIHPQMRRTIENPRIAIVESPLEYKKGESQTSYEFSKENDFTRALEIEEEQVREMCEK
                     IIAAKPDIVVCEKGISDLALSILFENNITGLRRLKKTDVSRLSKACGARPVNRPEDLE
                     ERHIGTSCGLFEYVKYGEEYYCKFSKCVNPKACSVIIRGPTKDILDELERNFMDAVKV
                     AKSIFISPKLCPGGGAVEMAMSHELMQNSGDNEIEAEVFSRVASALTIIPSILLENSG
                     VFNPLEAITLLEKKHQEGSFYGVNGITGEIVDTRDLVLEPYAVKSQCIKSAIEAVSQL
                     LRIDGIIESKR"
     gene            <17545..>20967
                     /locus_tag="Eint_100190"
                     /db_xref="GeneID:9699402"
     mRNA            <17545..>20967
                     /locus_tag="Eint_100190"
                     /product="DNA-directed RNA polymerase subunit beta"
                     /transcript_id="XM_003073661.1"
                     /db_xref="GeneID:9699402"
     CDS             17545..20967
                     /locus_tag="Eint_100190"
                     /note="similar to ECU10_0250"
                     /codon_start=1
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="XP_003073707.1"
                     /db_xref="GeneID:9699402"
                     /translation="MDSMFTKEHSWLIISSFFEQKGLVRQQLDSFDQFVKTKMQEVID
                     ESPAIIVQSAPTAGIETQKRITVRFGQIYVSKPPIYTESDGRTITVFPNEARIRDLTY
                     ASPLFIDVTKETISELGVVDKHKYSRVPFGSLPVMLRSSYCVLYGLSDKDLIDLGECP
                     YDQGGYFIVNGSEKVIVAQERMASNTVYVFKKAQPATYTHYAEIRSVPEKSSRNPSTL
                     SMKLCRSPGVIRVSLPLVKQDIPLFVLYRALGFLSDKEIIDHILYEDDDEMFELLKES
                     IEEGMVVQDQNVALDYIGKRSAPVGTPQEKRIIIAKDLLAKEVLPHIGTQEFCETKKA
                     YFIGYIVQRLLLVALGRKNPDDRDHYGKKRMDLSGPLLASLFRTLFKKLCADTTRHMQ
                     KCIENGREFNIALGLKASIITQGFRYALATGNWGDQAKAMQTRAGVAQVLNRYNFVST
                     LSHLRRVNTPIEKEGKLAAPRQLHNTHWGMVCPAETPEGQACGLVKNLSLMAYISVGS
                     SSGPLVEFLEECGVESLEEISTPQLNAATKIFVNGIWVGIHSDPVYLIKSLKLLRRSL
                     EMDKEVSIVRDIREKEIRIQSDAGRPCRPLLVVKNNELVITPEDIKRLKRGEIKWDNL
                     ISEGFIEFLDVEEEEMSMIAMNTKALEESKKASDVKISYTHCEIHPALILGICASTIP
                     FPDHNQSPRNTYQSAMGKQAMGIYATNFLLRMDTLSNILFYPQKPLVTTKSMEYLRFK
                     ELPSGQNALVAIACYSGYNQEDSIIMNQSAIDRGLFRSFFYRTYTDQESMSRPGVNEE
                     FCKPSRGTVLRMKNLNYNKLDEDGLISPGTRVTGDDVLIGKITPILDPERSTKEAPVY
                     VYKDSSTAMRRTETGIVDTVIVTNKDGYKFSKIKVRSGRIPQMGDKFASRHAQKGTIG
                     ITLRQEDMPFTSDGIVPDIIINPHAIPSRMTIGHLIECLLGKVSAMSGEEGDATPFSD
                     MTVNEISAKLKSYGFQQRGLEVMYNGMTGRKLRAQVFFGPTYYQRLKHMVDDKIHARA
                     RGPLQILTRQPVEGRSRDGGLRFGEMERDCIISHGASAFLKERLMDVSDAYSCFVCNF
                     CGLLAMGGSKVNECKGCNNTTNVSMIEIPYAFKLLVQELMGMNIAPRIRFEE"
     gene            <21117..>21473
                     /locus_tag="Eint_100200"
                     /db_xref="GeneID:9699403"
     mRNA            <21117..>21473
                     /locus_tag="Eint_100200"
                     /product="CCAAT binding transcription factor subunit A"
                     /transcript_id="XM_003073662.1"
                     /db_xref="GeneID:9699403"
     CDS             21117..21473
                     /locus_tag="Eint_100200"
                     /note="similar to ECU10_0260"
                     /codon_start=1
                     /product="CCAAT binding transcription factor subunit A"
                     /protein_id="XP_003073708.1"
                     /db_xref="GeneID:9699403"
                     /translation="MDEFSRGLRPTDRSLPIANISKIMKKPIPKEAKVAKDAKEIMQK
                     SAGEFIAIITCRAKEICESEARKTVTGEDLIRAMDELDMPYYAELARKYYIQYRELAK
                     NERVRKYSRSFDYGKP"
     gene            <21569..>22135
                     /locus_tag="Eint_100210"
                     /db_xref="GeneID:9699404"
     mRNA            <21569..>22135
                     /locus_tag="Eint_100210"
                     /product="exosome RNAse PH-like protein"
                     /transcript_id="XM_003073663.1"
                     /db_xref="GeneID:9699404"
     CDS             21569..22135
                     /locus_tag="Eint_100210"
                     /note="similar to ECU10_0270"
                     /codon_start=1
                     /product="exosome RNAse PH-like protein"
                     /protein_id="XP_003073709.1"
                     /db_xref="GeneID:9699404"
                     /translation="MSGIRSMMSVIPHCTGSSRFTYNNTTVFCIVHGPSDSISRQEDP
                     EMAILDVKWRDIILINGRIYDKYFSREIEKILSKRIILELDPCRSIQISFNVVGEVRN
                     TLFCAVNAALLALSDAGIPLISMFYASSSFTHEEEVIVFDGDENVLASHSFGSISKTG
                     MERAKSFLKYVKEVQTYTLKSKFPFCIS"
     gene            complement(<22253..>24733)
                     /locus_tag="Eint_100220"
                     /db_xref="GeneID:9699405"
     mRNA            complement(<22253..>24733)
                     /locus_tag="Eint_100220"
                     /product="putative P-loop ATPase/acetyltransferase fusion"
                     /transcript_id="XM_003073664.1"
                     /db_xref="GeneID:9699405"
     CDS             complement(22253..24733)
                     /locus_tag="Eint_100220"
                     /note="similar to ECU10_0280"
                     /codon_start=1
                     /product="putative P-loop ATPase/acetyltransferase fusion"
                     /protein_id="XP_003073710.1"
                     /db_xref="GeneID:9699405"
                     /translation="MTLLCDRGIQNFFEENGRRNHRSFVILLGENGKAQIPAIHRILQ
                     GHTNGSVESIVWCHKNEVTRKTGQRVSGKRQKKRIEEEESQDDLALFIRARDIEFIEY
                     RESERILGRTVDMLILQDFEALSPNLIATSMETVRGGGAIVLLLDTAHSIETLISHKT
                     DLHEKIGEFEPRYNKRLFKSLISSNFALFLDDKLNVLDCMNSPKDKNLKVSKDKYEEQ
                     YDPDSEVLKSLGKTRDQIYIIEEIFKALESRAGKTVFSITASRGRGKSAALGISIAKA
                     ISLGLLSVYIASPAIENVKTVFLFLITGLEKLGYKKYIDFKIIYQFRGNKRFMQKIEF
                     TGGRKHIIEYFNPANELKYYPDLLVVDEAAAIPLVYLTKLIFPNFVIMATTVNGYEGT
                     GRAFSVKLSEMLRKSSAESSSFIYKELTMKESIRYGQNDPVENWLYKALLLDASVPKI
                     QGCPRPSECSLFYVNKDVLFSGKPPAEKFLNDVFSLFISSHYKNSPNDLQVLADSPRH
                     EIFALVTPAEDDGKDIPKVICSLQISFEGKCTRTGHLREGNLIPWVISEEHIDASFLN
                     VYGIRIVRIAVHPEYAGMGYGTASLNLLIKHLSSHGEDICSMKVRDGEKDILLQNITD
                     VLIPQVSWIGASFGMAETLCRFWLKNQFVPVGVKQAVTQETGEHSAVFIRSLSHTEED
                     RIYKYNQKFMSRFVGQLSSSFKSLGPSLSLSLLKDPVPEKGRMMYFPYDDISRIRMAS
                     GGKIDLNLVTDIIPDISRMYFHGMFSQDLSVLRKSVLLMVGCQNRSIDEIAELLTLKP
                     FQIVNILTKVLSILLEDLEKNHVMNQER"
     gene            complement(<24817..>25191)
                     /locus_tag="Eint_100230"
                     /db_xref="GeneID:9699406"
     mRNA            complement(<24817..>25191)
                     /locus_tag="Eint_100230"
                     /product="U1 snRNP-specific protein C"
                     /transcript_id="XM_003073665.1"
                     /db_xref="GeneID:9699406"
     CDS             complement(24817..25191)
                     /locus_tag="Eint_100230"
                     /note="similar to ECU10_0290"
                     /codon_start=1
                     /product="U1 snRNP-specific protein C"
                     /protein_id="XP_003073711.1"
                     /db_xref="GeneID:9699406"
                     /translation="MAKYFCEFCNKTLLNDKLKSRRIHFQGAKHRLMRKAYYMEMFEK
                     KEVIAEMASILKDMKTENKKAESENAEKKQNTCFSFPPGDFYLDLVVPEEPLGFKLPL
                     GFDFRDKRNFLGTITEAIRKYK"
     gene            25268..25349
                     /locus_tag="Eint_100240"
                     /db_xref="GeneID:9699415"
     tRNA            25268..25349
                     /locus_tag="Eint_100240"
                     /product="tRNA-Ser"
                     /note="tRNA Type: Ser, Anti Codon: GCT, Cove Score: 57.03;
                     similar to ECU10_0295"
                     /db_xref="GeneID:9699415"
     gene            <25406..>26608
                     /locus_tag="Eint_100250"
                     /db_xref="GeneID:9699416"
     mRNA            <25406..>26608
                     /locus_tag="Eint_100250"
                     /product="sterol O-acyltransferase"
                     /transcript_id="XM_003073666.1"
                     /db_xref="GeneID:9699416"
     CDS             25406..26608
                     /locus_tag="Eint_100250"
                     /note="similar to ECU10_0300"
                     /codon_start=1
                     /product="sterol O-acyltransferase"
                     /protein_id="XP_003073712.1"
                     /db_xref="GeneID:9699416"
                     /translation="MRNNYVPQENASSHSLSVHTTKKIEKGKGEMYGLKNLAVIIAFL
                     SVGKFIIDNNREFGFLMSLPLQTLSLLECSCFLLAILMSFVRSLFGFYIEARKLGHLY
                     ICLNLGVFEAFIAYLNLNYIRHIYSSGWSMILNVVYTAKLISFHLVVKELRRDRKINI
                     EEELSIRHFLYFLVVPTLCFQLQFPMRSGRNIKGMVLKTIQLLVGFLLFVLVMDQYAI
                     PSIYRIVNFEDLTTVIENIINLSISTIILFLIFFYTVFYCFLETVADITLFYDSCFYQ
                     EWWNASSAREFWALWNRPVYLWFKRHVYAPMVGRGISKERAGVIVFAMSGLIHEYVVS
                     ISIKKFTGWFLITMLLQVPLIHVTESFRRKFPSLGNFFFWGAFCVIGQPSVILLYYRS
                     LYLKECHM"
     gene            <26703..>28061
                     /locus_tag="Eint_100260"
                     /db_xref="GeneID:9699417"
     mRNA            <26703..>28061
                     /locus_tag="Eint_100260"
                     /product="1-acyl-SN-glycerol-3-phosphate acyltransferase"
                     /transcript_id="XM_003073667.1"
                     /db_xref="GeneID:9699417"
     CDS             26703..28061
                     /locus_tag="Eint_100260"
                     /note="similar to ECU10_0310"
                     /codon_start=1
                     /product="1-acyl-SN-glycerol-3-phosphate acyltransferase"
                     /protein_id="XP_003073713.1"
                     /db_xref="GeneID:9699417"
                     /translation="MKEMVLKKRTFLHDAIDMVSMGSHTLENDDFTRCFQPAAAIEMD
                     SSGIFYTFSFVIRYFILFPMRIAFLILSMAVFFLMILRAAFTKNNMHLESALIFGAKS
                     LMLAMNAKIKHRGIKKRQAEPHLYVSNHTSFVDFFLLCSHKFPHACVSEMHGGLFGFL
                     FNSILIRNGSIGFKRSEKVDRQLVVEKIKEHVSSGGAPMLIFPEGTCVNNKFSVLFQK
                     GAFELGVTIYPVAIRFRRGLFDPYWNRRNHGFAMHMFYLMTRWRLEAEVTWMKPHNIM
                     KNESPTQFSHRVKAAISKEAGLRNTLWNGFLKSSPAIKDREILRESYLITYGRIVSNS
                     LDKSNAVDVEKNRFYLYDNNIDFSSSRSHSYFESMISYKKFQNEVLKEYLRLKELPQK
                     DLKFLLSNHKSREDSLGDSERKGFCSCGTKKGSKGNNFKKKQSNPLMFCKYESFKSPS
                     LG"
     gene            complement(<28113..>29609)
                     /locus_tag="Eint_100270"
                     /db_xref="GeneID:9699418"
     mRNA            complement(<28113..>29609)
                     /locus_tag="Eint_100270"
                     /product="kinesin A-like protein"
                     /transcript_id="XM_003073668.1"
                     /db_xref="GeneID:9699418"
     CDS             complement(28113..29609)
                     /locus_tag="Eint_100270"
                     /note="similar to ECU10_0320"
                     /codon_start=1
                     /product="kinesin A-like protein"
                     /protein_id="XP_003073714.1"
                     /db_xref="GeneID:9699418"
                     /translation="MVTPGIRHRIDEIKEMFSEIKENINATIPNRVRKDSVLLEICTP
                     GTCGYNGCSKSTRNRESELLERIKELELIIENISKVTDFSTYKEELQAKDIAIAMEEK
                     NHEVKKMKEELSRIVSANECLRKDNLRIQSCLDEYKERASKLEETKKECLAYKEVISK
                     LKSEIMDLKGSVQVICRIRPNTAGRKGSRIEISDGALKISMGGKEHSFSFDKVLGPHT
                     TQECVYGEMEMILRSVLEGYRVCVFTYGQTGSGKTYTMEGNDNNPGLIVRTLKDIYSI
                     IEEMRTDGWVFDITCSYVEIYNEDVVDLFSEDMRKVGIVHRGGDVNMVDCISISVSNA
                     SEAIGLFQSGARRKKIGDTNCNMKSSRSHVIFILKIKMSNKTSKEEKEGVMALIDLAG
                     SERLSVSKAEGARLKETQNINKSLSALGDVFNSILRKDGHIPFRNSKLTHLLQSFLSG
                     NSRAIMLVNISPDAEHFNETVCSLRFADRVSQCKLGSVKRKITNFVSE"
     gene            <29837..>30496
                     /locus_tag="Eint_100280"
                     /db_xref="GeneID:9699419"
     mRNA            <29837..>30496
                     /locus_tag="Eint_100280"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073669.1"
                     /db_xref="GeneID:9699419"
     CDS             29837..30496
                     /locus_tag="Eint_100280"
                     /note="similar to ECU10_0330"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073715.1"
                     /db_xref="GeneID:9699419"
                     /translation="MKCSACQVEIEENIKAHYASEVHKINVKRQIYNAPPITIEEING
                     EQLSDDVSLEINGLETGEKCSSSKKYSRKRNSSKVVGCSPEAVCLFCEFPESNTHYRD
                     HGLSDEEVAYIDNKVCYMCYEAFSERESLRRHISSGNHRNAMTDGVNLILESGKVIQG
                     RGRNRSREEEPRRPESRERNMIVRSQAKEDRRAIIKNKNRLKISLSMNFQPRFKPDWM
                     Q"
     gene            <30593..>31426
                     /locus_tag="Eint_100290"
                     /db_xref="GeneID:9699420"
     mRNA            <30593..>31426
                     /locus_tag="Eint_100290"
                     /product="inorganic pyrophosphatase"
                     /transcript_id="XM_003073670.1"
                     /db_xref="GeneID:9699420"
     CDS             30593..31426
                     /locus_tag="Eint_100290"
                     /note="similar to ECU10_0340"
                     /codon_start=1
                     /product="inorganic pyrophosphatase"
                     /protein_id="XP_003073716.1"
                     /db_xref="GeneID:9699420"
                     /translation="MTSYSTLKIGKKYSPGFKTYVTQNGKIVSPFHDIPLHMTENREV
                     ISVICEIPRFENGKFEINKKERFNPIKQDVKNGKPRFVKNVFPMKGYLWNYGAIPQTW
                     ESPHEIDKHVGAKGDNDPLDVIEIGGRKKKIGEVYQAKVLGSIALVDEDECDWKVIVI
                     DVCDEKANEMNDIEDVQKMCGGLLEQTKFWFENYKVPDGKGKNSFALDGKYMNKEFTL
                     KVIGNAHESWCGMVNSKDSEDICKENSTLMDKIDPPAITGEDLSDSEIPDYVNQFEFI
                     K"
     gene            <31496..>31744
                     /locus_tag="Eint_100295"
                     /db_xref="GeneID:20314092"
     mRNA            <31496..>31744
                     /locus_tag="Eint_100295"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163637.1"
                     /db_xref="GeneID:20314092"
     CDS             31496..31744
                     /locus_tag="Eint_100295"
                     /note="similar to ECU10_0345"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161901.1"
                     /db_xref="GeneID:20314092"
                     /translation="MKNLKLSQSLVNKLISKADVKCTKSAEKLLSKSIVISVAFLSMC
                     IDELSDENCKEEDVLQEVLVALGVPVTHNDVPSLSQKY"
     gene            complement(<31784..>32389)
                     /locus_tag="Eint_100300"
                     /db_xref="GeneID:9699421"
     mRNA            complement(<31784..>32389)
                     /locus_tag="Eint_100300"
                     /product="Rho1-like RAS GTP-binding protein"
                     /transcript_id="XM_003073671.1"
                     /db_xref="GeneID:9699421"
     CDS             complement(31784..32389)
                     /locus_tag="Eint_100300"
                     /note="similar to ECU10_0350"
                     /codon_start=1
                     /product="Rho1-like RAS GTP-binding protein"
                     /protein_id="XP_003073717.1"
                     /db_xref="GeneID:9699421"
                     /translation="MNNKTHKSGKVVVVGDGACGKTCLLEVFRRNQFPETYIPTVVDN
                     FVKEVKISDDKYVSLALWDTAGQEDYDTIRPLSYKETDLVLLCYTIENKKKIPNISRK
                     WLMEIKNYCPSSQFFLIGLKKDIRDLDDPTIDKSSMISESEGRKIADNINATRFFECS
                     SRTRENVNLVFLEAAKHIWDTKQATSDAESCSFLSCMKCCR"
     gene            complement(<32614..>32871)
                     /locus_tag="Eint_100305"
                     /db_xref="GeneID:20314093"
     mRNA            complement(<32614..>32871)
                     /locus_tag="Eint_100305"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163638.1"
                     /db_xref="GeneID:20314093"
     CDS             complement(32614..32871)
                     /locus_tag="Eint_100305"
                     /note="similar to ECU10_0355"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161902.1"
                     /db_xref="GeneID:20314093"
                     /translation="MPRKVQAELQECIKEIEKVIENSKTPKERITLKRKKMERLGGHV
                     KKYTVPLNRIIQRIETKKASAIAERERLEFMGISKKKRKKR"
     gene            <32953..>33420
                     /locus_tag="Eint_100310"
                     /db_xref="GeneID:9699422"
     mRNA            <32953..>33420
                     /locus_tag="Eint_100310"
                     /product="putative ADF actin-binding protein"
                     /transcript_id="XM_003073672.1"
                     /db_xref="GeneID:9699422"
     CDS             32953..33420
                     /locus_tag="Eint_100310"
                     /note="similar to ECU10_0360"
                     /codon_start=1
                     /product="putative ADF actin-binding protein"
                     /protein_id="XP_003073718.1"
                     /db_xref="GeneID:9699422"
                     /translation="MSLTIPGLDLIRNEIEEIKSGNLRYTIANLSIKEPISLSVLRNG
                     GRVKDFDYKRKYTIKELQGIFEEFSESVNEQDPCLVVYDFIHFDDDGIQKNTLCLISY
                     IPEHLVPLKKVAYSTNALNLKELLDISVHISIKKKSDLIFDNIAEKCAASRMK"
     gene            <33499..>33897
                     /locus_tag="Eint_100320"
                     /db_xref="GeneID:9699423"
     mRNA            <33499..>33897
                     /locus_tag="Eint_100320"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073673.1"
                     /db_xref="GeneID:9699423"
     CDS             33499..33897
                     /locus_tag="Eint_100320"
                     /note="similar to ECU10_0370"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073719.1"
                     /db_xref="GeneID:9699423"
                     /translation="MGLGINTKSVRGLRRFTRSKTQVIFFDNSRSPKTSKNTQKHQEC
                     REDQPAENIPQVSNVLKAEERMFPFEKLLETFTNLEKKKIQKTLRPCDGINPMKTLRK
                     DSFAERYFDSPSGTFLGKERHISSSSQERT"
     gene            <33979..>34839
                     /locus_tag="Eint_100330"
                     /db_xref="GeneID:9699424"
     mRNA            <33979..>34839
                     /locus_tag="Eint_100330"
                     /product="mRNA capping enzyme"
                     /transcript_id="XM_003073674.1"
                     /db_xref="GeneID:9699424"
     CDS             33979..34839
                     /locus_tag="Eint_100330"
                     /note="similar to ECU10_0380"
                     /codon_start=1
                     /product="mRNA capping enzyme"
                     /protein_id="XP_003073720.1"
                     /db_xref="GeneID:9699424"
                     /translation="MENKKEEIRRHYNNIREKGKEGRQKSKAINIRNTNNFIKSCLIR
                     LYTKKGDSVLDLGCGKGGDLLKYENANISEYYGIDIAEVSINDARIRAKNMKRRFKAS
                     FKAQDAYGQEIDLGKQFDVVSSQFSFHYAFSSSETLSISVGNVARHLKPGGYFIMTIP
                     SRDVILRRYEQDRMSNEFYKIEIDRKESIPKEDIKEYRFTLVDSVNNCIEYFVDFPTM
                     VSEFKKLGVVLVERKGFIDFLEEESKKNLELFRRMKVKCLEKGELEVVGIYEVIVFQK
                     LSPKEESSVQ"
     gene            complement(<34825..>36369)
                     /locus_tag="Eint_100340"
                     /db_xref="GeneID:9699425"
     mRNA            complement(<34825..>36369)
                     /locus_tag="Eint_100340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073675.1"
                     /db_xref="GeneID:9699425"
     CDS             complement(34825..36369)
                     /locus_tag="Eint_100340"
                     /note="similar to ECU10_0390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073721.1"
                     /db_xref="GeneID:9699425"
                     /translation="MAMDAESQEPGNPGKEFNAVDVINKTYANATEYDLNDALIFLTK
                     VINRTKVRNKQLVKQHFGKFVQCRTVLEEIWVDIKQKGYDKEFTTDLENNIKVVEEKF
                     RKMTSGISDDVEGKIEGGRREYYMKKYSLLFNVKFYLRRNLHNLERFVDIYKGAMEMY
                     LELKNSVYIQKVWNSIHDERCEFLEIIYRNIQRPGCTFHEALYYFDLYFKVCEHKSEH
                     KIMNTLLVNFKENSTKSLELSYLDEEECLKEITRHYLKIMGRVDGKIQILATDHYFEC
                     IEKILYNKELLFIKVWIRKLKENTKVVELSSDAKMVYFSHLKRVKTKVIDDGFRKIPS
                     VTVETFKDAMAHMEDVFNLFIDVVSKEEKRHLKNKVLEYIDKCYESVELKKFSDLESV
                     IKDIYETKHLLGPPDSEDVKDLYKMINKYMEGHATKIIGIVKGMIEQKASDVQILMEI
                     VRIIEEMPMEHLRILRRIKPLVEGHSIVMYYLSNILAFEPPRLSNDLRKKVDEIGDQF
                     GFLLNT"
     gene            <36427..>36849
                     /locus_tag="Eint_100350"
                     /db_xref="GeneID:9699426"
     mRNA            <36427..>36849
                     /locus_tag="Eint_100350"
                     /product="40S ribosomal protein S23"
                     /transcript_id="XM_003073676.1"
                     /db_xref="GeneID:9699426"
     CDS             36427..36849
                     /locus_tag="Eint_100350"
                     /note="similar to ECU10_0400"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="XP_003073722.1"
                     /db_xref="GeneID:9699426"
                     /translation="MPGLFAANNLIKSRKAKRLADTTYRKRALGTKYKHSVLGRAPQA
                     KAIVLEKIGVEAKQPNSAIRKAVRCQLIATGKKITAFVPYDGSVTYIESNDEVTVEGF
                     GKKGRSFGDIPGIRFKVCKVQNVSLHAIFTGKKEKPSR"
     gene            complement(<36892..>37518)
                     /locus_tag="Eint_100360"
                     /db_xref="GeneID:9699427"
     mRNA            complement(<36892..>37518)
                     /locus_tag="Eint_100360"
                     /product="26S proteasome regulatory subunit S5A"
                     /transcript_id="XM_003073677.1"
                     /db_xref="GeneID:9699427"
     CDS             complement(36892..37518)
                     /locus_tag="Eint_100360"
                     /note="similar to ECU10_0410"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit S5A"
                     /protein_id="XP_003073723.1"
                     /db_xref="GeneID:9699427"
                     /translation="MPETIVVLFDNGMASQNQDYLPSRFIVQKETVESLISRKFEDNQ
                     ENTIGIIPLVQVQSNDIITPTKQRSHIKTFLNDIKLNKEGDIMRCLSQSLHIFNQRDS
                     PGCILVVFLASELQESEKDELFARIYQLLTFGIGIKMVFFGEAVEMVEAFKKIDFTNF
                     SCIEVKTNEEFIDRVLPFISGNDLVEEDDPELAEAIRLSLEEQKKQQK"
     gene            complement(<37646..>39256)
                     /locus_tag="Eint_100370"
                     /db_xref="GeneID:9699428"
     mRNA            complement(<37646..>39256)
                     /locus_tag="Eint_100370"
                     /product="ATP/ADP translocase"
                     /transcript_id="XM_003073678.1"
                     /db_xref="GeneID:9699428"
     CDS             complement(37646..39256)
                     /locus_tag="Eint_100370"
                     /note="similar to ECU10_0420"
                     /codon_start=1
                     /product="ATP/ADP translocase"
                     /protein_id="XP_003073724.1"
                     /db_xref="GeneID:9699428"
                     /translation="MLENECTDLAGCEDKILGKERHCASIYSRTLQRINDISNDTKAT
                     LLFSLLYALLSYIDAFLYILGDMVMMNTQIPSSILFIKSVLVLPVTFFFIVIVQKGLK
                     FLSQPRILEVVLIILSVFFLLFGLVIWPCSKKLQPDFFWSRDIFSDGKMKIRHLDFFF
                     PIFLVFNEWASTVLYLVAELWGSLIISFMFFSRAIHQSTEAQLKKFLPVVSLISGMVL
                     LSSGLLTRSLNSYRDTLPYSKKESLFSQVFVVTSILTAVSAITSYFTDKFTPKDDREY
                     GSKKEYKDHKMGFTKSLRIMRKSRFLMAMTESVIATSVCSNIFEATYRGGVVLGAVQA
                     SLSGSSYINKLNAMAQIITSAFLIVMFFRPATHLIERKGWFLVAITAPAIAIITLVLF
                     FPMVFFNNISEDEVITPREGYLGSFVLENYTGMFLNTIIKISKYCFFDVAKEAASIRV
                     PPSHRHSFRGIHDGLGINIGKTIGSVYCTLITVVFDVRDVRNMVSISTVFVGIFCIMW
                     VRSVLYINKKYKESIEKNDFINVELTEC"
     gene            <39416..>39838
                     /locus_tag="Eint_100380"
                     /db_xref="GeneID:9699429"
     mRNA            <39416..>39838
                     /locus_tag="Eint_100380"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073679.1"
                     /db_xref="GeneID:9699429"
     CDS             39416..39838
                     /locus_tag="Eint_100380"
                     /note="similar to ECU10_0430"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073725.1"
                     /db_xref="GeneID:9699429"
                     /translation="MDDNWKAFNLKIEHGLGHKRTLEWERIVKHRIRQNSLNLASENE
                     IERYSDKYFKSLLSEDMIKEIVSVELMPPEISRTFGEKKEKNMEDIEGIESSASEEYD
                     GSDETENSNDVENDYEENFYENEEDDELTEEKDEEGFF"
     gene            <39924..>41126
                     /locus_tag="Eint_100390"
                     /db_xref="GeneID:9699430"
     mRNA            <39924..>41126
                     /locus_tag="Eint_100390"
                     /product="ATP-dependent RNA helicase"
                     /transcript_id="XM_003073680.1"
                     /db_xref="GeneID:9699430"
     CDS             39924..41126
                     /locus_tag="Eint_100390"
                     /note="similar to ECU10_0440"
                     /codon_start=1
                     /product="ATP-dependent RNA helicase"
                     /protein_id="XP_003073726.1"
                     /db_xref="GeneID:9699430"
                     /translation="MEFDELNIDDSLVQACQRNGITRPTEIQKQVIPMVLGGNDIIAV
                     SQTGSGKTLAFVLPIVSRLLLKNRSFFCLVVAPTRELSSQIAECFNMFGSTGLRVCLL
                     VGGTNFNLQANQLSKHPHIVVGTPGRIAEHILKTKSFKAERIRKLVLDEADRFFEQDF
                     VEDLETIIRSLREKRQTLLFTATMSNEISKLSSSILIKPKTIRVVEGYETVSALKEYY
                     FFTAMKWKSSALVEFLEMNPGASTIVFVSMCITARVMSLALSKLGFHSEALYGELSQE
                     KREETMRMFKENKFSVLVCTDVGSRGLDISHVDLVINFDVPKSGKDYVHRVGRTARAG
                     RAGTAITLVTQYDVEQLQRVEFVLKKSLEEFKPVKKNFESIREKVEETIQEAQEILKG
                     ERKRNRRH"
     gene            <41348..>43225
                     /locus_tag="Eint_100400"
                     /db_xref="GeneID:9699431"
     mRNA            <41348..>43225
                     /locus_tag="Eint_100400"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073681.2"
                     /db_xref="GeneID:9699431"
     CDS             41348..43225
                     /locus_tag="Eint_100400"
                     /note="similar to ECU10_0470"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073727.2"
                     /db_xref="GeneID:9699431"
                     /translation="MPPEGTDPEREVPEEKIKEEENKEGPGKEEEGEKKKEEKKDDGV
                     IDDIIANNAVDAPPVEPENEIIFTKAKVFEEEELSFWNIDSYLHSKFSYIPEVIRRLI
                     EITIVVFLFMVFPLVLSFLEDGKEVLYLPKQVFQNTGQGPTYLFFRINLFISMCYVIY
                     VVVSLFASNILYIMVGVLNFFNYDLDEYTIEIIQVINSTSWCWKQSLIAALIFLAASI
                     TSQPYDFGKNDGSYKYKVVTMILMYSVFIFVVFLEKFFMCFMISEIRRKEYRNRIWDI
                     NYKTFVFKKLAAISEVSSSERKELAETIQPDFDPGFYLKYNDLKLNSVEAAEMVAESI
                     FGFLEVQTIIYEDLEKFFPDNHKEVYTYLADNSEVKDKDNPPITFEDLKAKAIALYKE
                     RTDISRTLQSRDIIINKLDIILVGIAMYFGVILVMILLGINYEGMLAAIVPSIVTFSW
                     IFSDTVKEIYNCFIFLLVNHPYDCGDRVVIDGEELYVSSVDLLSSTFTGVNGRQVLIP
                     TSTLFRAKIHNIRRSGKQFSEVSILVSRKTSFDAALRLKDGIAKTFSESTKSFSGEIY
                     IRDFRTEGENVKIIFAIQHQSNFQDVKKKYSRRAEIVNILEKEMRSQGIEYLNSYRFS
                     D"
     gene            43311..43381
                     /locus_tag="Eint_100410"
                     /db_xref="GeneID:9699432"
     tRNA            43311..43381
                     /locus_tag="Eint_100410"
                     /product="tRNA-Pro"
                     /note="tRNA Type: Pro, Anti Codon: CGG, Cove Score: 51.90;
                     similar to ECU10_1475"
                     /db_xref="GeneID:9699432"
     gene            <43471..>43938
                     /locus_tag="Eint_100420"
                     /db_xref="GeneID:9699433"
     mRNA            <43471..>43938
                     /locus_tag="Eint_100420"
                     /product="HIT bis 5'-adenosyl triphosphatase"
                     /transcript_id="XM_003073682.1"
                     /db_xref="GeneID:9699433"
     CDS             43471..43938
                     /locus_tag="Eint_100420"
                     /note="similar to ECU10_0480"
                     /codon_start=1
                     /product="HIT bis 5'-adenosyl triphosphatase"
                     /protein_id="XP_003073728.1"
                     /db_xref="GeneID:9699433"
                     /translation="MEFGDKVIPYDHVIIKTMHSFIFTNLRPFLPLHILVSPISKKQR
                     IYELTNEETSDLFNTVRVAMLGLKDLCDGFTLGVQDGSCAGQTVFHVHVHIVPRVVKD
                     LERNDDIYEKGALDSADRPAREYDEMKKEAAKLRKIIGRAFDSEGLYYQNSFE"
     gene            <43988..>44767
                     /locus_tag="Eint_100430"
                     /db_xref="GeneID:9699434"
     mRNA            <43988..>44767
                     /locus_tag="Eint_100430"
                     /product="putative metal-binding protein"
                     /transcript_id="XM_003073683.1"
                     /db_xref="GeneID:9699434"
     CDS             43988..44767
                     /locus_tag="Eint_100430"
                     /note="similar to ECU10_0490"
                     /codon_start=1
                     /product="putative metal-binding protein"
                     /protein_id="XP_003073729.1"
                     /db_xref="GeneID:9699434"
                     /translation="MLELPPDTRKGFLYLVDREVFSKFKGYVDLDFLYEEDHGEVKVA
                     SVSVLEDSFMWSEGNEEKSALPSEFRCSHGNEITHKSLNLLPQEGWEELIDCWSCHNC
                     EFRTMLDLKLRPREGGLLLSDFFFLVNDRDLPECCRKNDSSVRKLFYNEIEQEEFTHR
                     ALIYSYMNLHFRNKNVLLLEVNEKKYEIRYFYKTMLVSANGKSLEKKEAMKVGIKETD
                     KLLEENKNINNFYSKLIWDAVTLGAVGITALGYGISFVTEK"
     gene            complement(<44836..>48015)
                     /locus_tag="Eint_100440"
                     /db_xref="GeneID:9699435"
     mRNA            complement(<44836..>48015)
                     /locus_tag="Eint_100440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073684.1"
                     /db_xref="GeneID:9699435"
     CDS             complement(44836..48015)
                     /locus_tag="Eint_100440"
                     /note="similar to ECU10_0500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073730.1"
                     /db_xref="GeneID:9699435"
                     /translation="MSLKDQLLRLKKCRRAAHSEMKGRVRFGDTEDMDEETILELIPI
                     QTPYTKTKSLFFDRQRQTEEEERKFNRGFSEFLKELVRYGNVKDIEYLFEYLVRRYMC
                     DTFNPKEMIFFLLPFKKYYGQVLCISQRSDFNYFSIQPTYSYQFIGNLCLREKHFFDF
                     FVGYFEHFKYIQDFCLDVTGYIVSGIKNTDKDFSMQFYEMISHLTKSGESDAAVKIFF
                     EIRDHVEGVLDEFVELLEPYFAKEYLMSRKLEEVSHKEDIPHEESALFRKIYDSGNDR
                     QILRDSSRYKDYVMWLHREELSLKSINEIEIGALKTLCGIEEKNLDGEIFDYINLFRE
                     LEDKKGLVKLLSQRFPKNVSTLIPHMGDADKAYLSEQSPWLWESLITEGNYSIVVMNM
                     PRKMVENDLMKIMKTCLKYVKYDGNVFVDYLDEKVLFSLMDECQENVFVKNIIDTAKL
                     MNIDLATIIIQKEFYTNPAYLNYLSEKARGFEVEMSRRLLKKAMEFSSKAHMDALCGY
                     LQQVKDEELINDVFGWLIDKMWFYPAFYSGLRIHLEVVSKENCEKILSTKGFSKDNYD
                     VVDRLYRYKEEVIDECLVERHHDALLSLCRKYGFCKILGNRRNEHVVDFIETTSKQNL
                     LPKDEEDFIRYSSSLVEFGGERIVKALFQSKYIPHLIKCTTIREWNVIKVIVSELVLQ
                     YDKYRQFCFDYFLGNFSDFKGDLDLFETIVEDEASIDYQKLMDVAKNSDYSFRSSLFD
                     ILLRKLPFDSLQFVPMIAPCMIEHKKESVRILFEKHKNIMGPYVKDILQKFPELQDCM
                     LEIDSRYLLTGAIKAYVDAPDEHHLDFMHKVLDTSGLSVSPSVLIKVVKFLGSNVSKL
                     KGKLLTKFFEVYLKVNPEADEEIQSLLRIIYERNRCVFFQVSQASFSLCFKIFKPYAD
                     VMVKLVEEKDKDAISFITDYLYWDSEYGLPHRKMFEILFLFYCDDPDVLYARCIGSIL
                     RHNPKEIEDANDLILNSMKGDKTVIILKLLQVLYQKVYHFKKCLVKSSPYFALVVDST
                     RKEISSAARKLLSIIERKHNKSGYQLLQL"
     gene            complement(<48071..>49216)
                     /locus_tag="Eint_100450"
                     /db_xref="GeneID:9699436"
     mRNA            complement(<48071..>49216)
                     /locus_tag="Eint_100450"
                     /product="3-hydroxy-3-methylglutaryl-CoA synthase 2"
                     /transcript_id="XM_003073685.1"
                     /db_xref="GeneID:9699436"
     CDS             complement(48071..49216)
                     /locus_tag="Eint_100450"
                     /note="similar to ECU10_0510"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl-CoA synthase 2"
                     /protein_id="XP_003073731.1"
                     /db_xref="GeneID:9699436"
                     /translation="MPAKNMFGIVGLEYQLPSLYIDQEEVANNIDFEVDKIKIGLGLE
                     QMGVPSRREDSISLALNAVSKLMKKYKLSPQSVGRLEVGTESNPDGSKSIKSYLTDLF
                     PGNTSICGCDSVHACYSATNALLNAVSWMESSLWDGRLAIVVATDVAMYKDKRCQPTG
                     GAGAVAILVGPNSIYRIVPSSIIHYFTNQFDFMKPRKTHPFPVVKGKESIENYRTAFE
                     VCYGKFREKMGDETFDYIVLHSPYTRLPEKMCVANHIDRKKFLKSLEASRKNGNAYSA
                     SLYLSLISLLDGHDGKIGEKILMFSYGSGTCSSMFCLERISQGCIVTGFEKRLLERRK
                     ILYPEFVKLVEEPVPQDNYEPREGVSLPGYYLKRISSFERHYECLME"
     gene            complement(<49434..>51065)
                     /locus_tag="Eint_100460"
                     /db_xref="GeneID:9699437"
     mRNA            complement(<49434..>51065)
                     /locus_tag="Eint_100460"
                     /product="ATP/ADP translocase"
                     /transcript_id="XM_003073686.1"
                     /db_xref="GeneID:9699437"
     CDS             complement(49434..51065)
                     /locus_tag="Eint_100460"
                     /note="similar to ECU10_0520"
                     /codon_start=1
                     /product="ATP/ADP translocase"
                     /protein_id="XP_003073732.1"
                     /db_xref="GeneID:9699437"
                     /translation="MSYIQPSTSPKNSCLFRTEEELEEEVYKKTGFFKHIRIARNEWP
                     RVLYLSLLFGVITMVHTIMGNLREMVLMGRQDPMSMFFIKSIFLPPCSLIFVWAIHFG
                     LNFFNPSKMFDITLILFSGCYFFFGLVMWPFKAYIQKDFYWSRDIFGDGKMESLRIHF
                     LYPVFLVFNEWTSSFLFLCSEMWGALVVSYFFNVFTNEISTRRQSQRYITVYNISNAI
                     SIFLSAVFTLIFNRWRDSVVFETKELGFEILILLLAFGVIGVLVLKKYIEKKILPVPV
                     FLIKEIKETPVKQKELKLKEAGKSLSKSKLLVAISLNVLLYGVSSTLIEATFKSGLAA
                     GAKYTNNSKETFSNFYNGSEQIIIAMTLLIVINTPYSALIKMGYWKYVASIPIAVVVF
                     SFFSVFLIAFYNVGVYSGKSGLFKSFFKGKQPVFFLENTLGLITNASLKIGKYLGADV
                     SKEAISMQIDPLYRAKYKAIYDGLCGKLGKSLGSVMCTVMTGIWDITDIRIVSGVLGL
                     LVGIIIVIWCFIVKYLNGKFQTSVEKNTYIELDEF"
     gene            <51385..>52296
                     /locus_tag="Eint_100470"
                     /db_xref="GeneID:9699438"
     mRNA            <51385..>52296
                     /locus_tag="Eint_100470"
                     /product="uracyl-DNA glycosylase"
                     /transcript_id="XM_003073687.2"
                     /db_xref="GeneID:9699438"
     CDS             51385..52296
                     /locus_tag="Eint_100470"
                     /note="similar to ECU10_0530"
                     /codon_start=1
                     /product="uracyl-DNA glycosylase"
                     /protein_id="XP_003073733.2"
                     /db_xref="GeneID:9699438"
                     /translation="MKTEQEKEEGHVCFSRDLGKVDVRNEKVFEGSSPLSSGKGSLGK
                     RQLSLDDMFSKRKTTASEISSGRKVDWVCEGCINPCEYCKLEEKIDPKWRVYLKSEFG
                     KDYFRGIKRFLHKNKNHLPPIDKIFTFSKFFPLENTKVVIMGQDPYHNDQQAMGLSFS
                     VPLGVSIPPSLRNIYLEASTDIEGFEIPSHGDLTKWAENGVLLLNDVLTVTKNQANSH
                     AGIGWREFTSRILQIINEKCTNVVFMLWGRHAQAKGKFINKNKHLVLCCGHPSPLSSN
                     HFFGCKHFSKANKYLREHGKSPIKWQI"
     gene            complement(<52400..>54058)
                     /locus_tag="Eint_100480"
                     /db_xref="GeneID:9699439"
     mRNA            complement(<52400..>54058)
                     /locus_tag="Eint_100480"
                     /product="ATP/ADP translocase"
                     /transcript_id="XM_003073688.1"
                     /db_xref="GeneID:9699439"
     CDS             complement(52400..54058)
                     /locus_tag="Eint_100480"
                     /note="similar to ECU10_0540"
                     /codon_start=1
                     /product="ATP/ADP translocase"
                     /protein_id="XP_003073734.1"
                     /db_xref="GeneID:9699439"
                     /translation="MSEIGFSAPVDEHRPLLTEDEVEAQALSSTTWPLSRIRIARCEW
                     KLWSTLAFIFGSAAYIYSFSRVMKDSFVLSRQLPVAISFLKTCFVLPMSVIATGVVQK
                     LLVTRTISKVFDYTLIAFAFLYTLIGTVLLPFASKIQPGFYLSRDIFADDKMLYKGFE
                     FLFAIFLIFNEWTTSFVYVCAELFGSLIVQFMFLSFANEALTIRQSTRMMPLFYVVSN
                     ILLLLSSESTALYSRRVKMWDYKTTCLVTNSFFVIFGVLIAITYLMKKYAENRILKKQ
                     LFIRTEGIKKKGRKPTTSFSESIKLMAQSKFLVAMVLNALFYYAGTNLIESSWKNGIS
                     VAADAKNMEKRAYSASIVSGEQRVVGALVAIILLTPISTLVQTHGWITMAIVPPLVTL
                     VSSMVIFGSAYFNYPNYPSGREGVILSSLVKGYQPNFFLECNMGIYCVSGMKIAKYAF
                     YDISKEAISLQIDPIYRPKLKAVYDGLCGKLGKSIGSLYAMFWSLMGYNDVRAAAPIT
                     LGIWLIISPVWVYSVLYLNRKYNQSIQTSSPIDLDLFSGKKDLE"
     gene            complement(<54327..>55031)
                     /locus_tag="Eint_100490"
                     /db_xref="GeneID:9699440"
     mRNA            complement(<54327..>55031)
                     /locus_tag="Eint_100490"
                     /product="proteasome alpha subunit C6"
                     /transcript_id="XM_003073689.1"
                     /db_xref="GeneID:9699440"
     CDS             complement(54327..55031)
                     /locus_tag="Eint_100490"
                     /note="similar to ECU10_0550"
                     /codon_start=1
                     /product="proteasome alpha subunit C6"
                     /protein_id="XP_003073735.1"
                     /db_xref="GeneID:9699440"
                     /translation="MTTQEEISNIFNSDGKLLQIEYGLEAVNNSLPIVTAKSKSMIVC
                     ASKKIPRDKLEESESSSFFRVSGKCYVGITGLSGDVDYVIKRIKMVANQKTFSFGMEV
                     TPDILCRCFADKIQQLIQSSEERSPAFNASIFGFDGKKPMIYQTDMSGISYPCYATAA
                     GEKHGKMTKFIEKNHHGDMEDKELFELAIGALLESIGTDSGYSEIEVAYLRAGQDLCH
                     LSGKDIDKILQDIAEK"
     gene            <55075..>55785
                     /locus_tag="Eint_100500"
                     /db_xref="GeneID:9699441"
     mRNA            <55075..>55785
                     /locus_tag="Eint_100500"
                     /product="putative short chain oxidoreductase"
                     /transcript_id="XM_003073690.1"
                     /db_xref="GeneID:9699441"
     CDS             55075..55785
                     /locus_tag="Eint_100500"
                     /note="similar to ECU10_0560"
                     /codon_start=1
                     /product="putative short chain oxidoreductase"
                     /protein_id="XP_003073736.1"
                     /db_xref="GeneID:9699441"
                     /translation="MGKINLEGKTVCVTGGSRGLGLEITKELAKKGCYVHVFGRSPQP
                     FSHKNVKYYQMDLLKERPAIAIPFDIVISNLGTSVGNKGFDEMEYKEVTDMLKLNVEL
                     HLWLLKNISYKKFVFVNSILSQQGLPGYSMYCASKSFIHTLNQSLRREGKDTIIIYPY
                     KINTSLFSEIKDIWTLDANYVAQRLLRDIENGTREDFILWIFKPITLLSKMIPMFLQD
                     ILSRFLERVFYITKRKSE"
     gene            complement(<55840..>56850)
                     /locus_tag="Eint_100510"
                     /db_xref="GeneID:9699442"
     mRNA            complement(<55840..>56850)
                     /locus_tag="Eint_100510"
                     /product="cAMP-dependent protein kinase"
                     /transcript_id="XM_003073691.1"
                     /db_xref="GeneID:9699442"
     CDS             complement(55840..56850)
                     /locus_tag="Eint_100510"
                     /note="similar to ECU10_0570"
                     /codon_start=1
                     /product="cAMP-dependent protein kinase"
                     /protein_id="XP_003073737.1"
                     /db_xref="GeneID:9699442"
                     /translation="MIGKKDIMCIEKTGLGPFWEEFLVFIDVGEVVGGLYGLRVMKKK
                     KIIGYGEQEMVQDEYYVRSRIRHPFLINTICGFQDYEHLFLLSEQSQNYLVNLISSEE
                     RLSPKVSRFYMAEILLAVQYLHSKGLSYGFLSPRSMMIGDDGHVKLKYDFLNRIDCGI
                     GDLEQNVEYASLDYVESGEIGPVSDYWSMGMVLYHMLSGTTPFAAPDMASTVERIRKN
                     RIKFPEFFDKNARDLVSKLLVVSPKDRLGYRERDCMAIRKHPFFEGIEWQEVFQKKSK
                     PPFLFNIARKECFSRPANLRILYTTDYLPDQKNGYGQTFRGYGTIYSSEVYRKIWRYG
                     YI"
     gene            complement(<56943..>57872)
                     /locus_tag="Eint_100520"
                     /db_xref="GeneID:9699443"
     mRNA            complement(<56943..>57872)
                     /locus_tag="Eint_100520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073692.1"
                     /db_xref="GeneID:9699443"
     CDS             complement(56943..57872)
                     /locus_tag="Eint_100520"
                     /note="similar to ECU10_0580"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073738.1"
                     /db_xref="GeneID:9699443"
                     /translation="MDLEKLLGAFRSRMEEKRFPFITSSMLSLGVGIAILGRPNGAKD
                     KSIMGYIKRAKEKACRFLQDPEPKTPVLPPQERPKPTVIFDCKDFLIKKRFSFFNLDF
                     LVTKRAFTDLFLFHSAHIYELVHVSESSVGFSRFLLNRIDPYGCISYKVYCKDKKMFG
                     SEHLNRPLEKVVVISTKENEYHKDFDENLLRLEKWRGGPEYGLLDLLNFLHNLHFTGI
                     SDFRGTLKSYLGKNFYSAFERVQKGIFVQRNLFSWDVEKRYRSRIKEINEKRMKDFEK
                     AKKTMDADLQKRGVEEQSSVLGNLFDLVIKLLI"
     gene            complement(<57901..>59232)
                     /locus_tag="Eint_100530"
                     /db_xref="GeneID:9699444"
     mRNA            complement(<57901..>59232)
                     /locus_tag="Eint_100530"
                     /product="phosphatidyl inositol-3-kinase"
                     /note="C-terminal region"
                     /transcript_id="XM_003073693.1"
                     /db_xref="GeneID:9699444"
     CDS             complement(57901..59232)
                     /locus_tag="Eint_100530"
                     /note="C-terminal region;
                     similar to ECU10_0590"
                     /codon_start=1
                     /product="phosphatidyl inositol-3-kinase"
                     /protein_id="XP_003073739.1"
                     /db_xref="GeneID:9699444"
                     /translation="MDQLSGSAFECKIEKEDISELARSVSRLLSRSEDAEKMIAEYLC
                     VQKVGSLYIYFPSLGGKDPGDNLSAEHQINRFWKIRFELHEECNESKYRDAVNSFLAL
                     DSKYGILEKLEGQMALINEVRGIYSITCQGSPRKTKIREYKLHGALCLHPRMGSIRHC
                     TSLFNPDTVVKEMILREIKIFPSSTFPILVPLNTDKGISRIIYKKGDDLTKDLFVLET
                     IRYISELVEMDLVAYKVIPLSREEGIVEVVDGVDFTQIKGREDLERYIEGENDPRWMQ
                     NAQKKRTFVDTLCGYSVACYMMGVGDRNPGNMMVSRDGRFFHVDFSYVFGNDPKLISP
                     RITIARPICDYLVNDELIYQDFIIKSGEVFLQIRRSCQKIFVLWCVLLQNKIFRFDLE
                     EIITFARGRLKMEVTEQRALELFEREVKDAVGSFKTSIMHLVNRVGMFLRR"
     gene            <59330..>61048
                     /locus_tag="Eint_100540"
                     /db_xref="GeneID:9699445"
     mRNA            <59330..>61048
                     /locus_tag="Eint_100540"
                     /product="DNA replication factor A protein 1"
                     /transcript_id="XM_003073694.1"
                     /db_xref="GeneID:9699445"
     CDS             59330..61048
                     /locus_tag="Eint_100540"
                     /note="similar to ECU10_0600"
                     /codon_start=1
                     /product="DNA replication factor A protein 1"
                     /protein_id="XP_003073740.1"
                     /db_xref="GeneID:9699445"
                     /translation="MKLEPGTVEALYNSQTTNPLYKNPILQITSLGKLSVAIGDKQRY
                     RVNLSDGVHYMKGIFSSELTAHFEKGLVSRYSLIRPGRFSVRSKDGSVYIYIQEIQEY
                     EDCNVEIGKPVNISTGNASFNDNQLSPGIQKRVDGGNQHGKALDEEDKKRVKKDIKDE
                     GEFTAINMLNPFHNKWMIKGRVVLKGDIRRFSNQKGEGKVFNFEISDGTAQVKIICFS
                     DCVDIFFPIVEVGKVYSVSKGTVKMANKQYSTNPFDYEIILDKNSEVRCTVDDGSPRY
                     FFNFIKLSDLSLGNAYCDVIGVVREVYAPSTVMVRSTQNELLKRDIILVDESGSVRLT
                     LWGPKAELDIEGGVVLGLKSVKVSEFNGISISTTGGSQVVINPDIPEAHELAGWYQST
                     GKDMQVALPRKEEKRRLIQEVKENELAYSTIQGTVMFLKEDALWYTSCKGEGCNKKVV
                     MEDSGNYRCERCNMTYEDCNYRYMVTMHLGDFTGQVWLSLFDEAAASFFGIPAQEMKR
                     MSEESPAELQALIKGMYFKEYLFRIKSKQDSYNDEIRMRYSGLSSSPLDIRKESKRLL
                     DAIEKA"
     gene            <61099..>61593
                     /locus_tag="Eint_100550"
                     /db_xref="GeneID:9699446"
     mRNA            <61099..>61593
                     /locus_tag="Eint_100550"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073695.1"
                     /db_xref="GeneID:9699446"
     CDS             61099..61593
                     /locus_tag="Eint_100550"
                     /note="similar to ECU10_0610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073741.1"
                     /db_xref="GeneID:9699446"
                     /translation="MQYKGINRMTREKILASEEFKKMRSLTQSDVIRSIQSLDSIGGL
                     VRDTPHRFLCLVQKMGAISLDEDVIAANLGDFRPEEPLLSNSSMEMFRGNVCFIAASL
                     LYLRLSKRFHKYESLVRSFLMDFRKVPMVDGENNKTFIYLDVLADDLLNRTRVFNVHL
                     KKTF"
     gene            complement(<61653..>64472)
                     /locus_tag="Eint_100560"
                     /db_xref="GeneID:9699447"
     mRNA            complement(<61653..>64472)
                     /locus_tag="Eint_100560"
                     /product="nonsense-mediated mRNA decay protein 5"
                     /transcript_id="XM_003073696.1"
                     /db_xref="GeneID:9699447"
     CDS             complement(61653..64472)
                     /locus_tag="Eint_100560"
                     /note="similar to ECU10_0620"
                     /codon_start=1
                     /product="nonsense-mediated mRNA decay protein 5"
                     /protein_id="XP_003073742.1"
                     /db_xref="GeneID:9699447"
                     /translation="MREETRQIFLQTIDPDSGKRSAAESMLMNLEKQPSFVMSLPDTC
                     MKDSDATIKRVATIYFKNAIIKQWGSDEYSEVRKYLVENVLDLFLYGDEITRMAYDAI
                     LVNIFNNEKLNDLNGLFQKASSFMKSSDTNHMFTALNMYEKIFDAEKIKYNLEQVLGL
                     LFDTAGKDVLEKVYGFLESGNYSMVKTGMIVLTKSYGYYSIPDFLSAISTFSYVFNLS
                     LRILNLRGTDENLLESKKWAAYFMYKACSKGVKKFYKNNELSEYVTDVNRFQMVYGTF
                     LKIIQERSEHTVDIELYAIDFFVLLTSDSEFFRYMEPNLSYFISGYILPLYSLSDSEE
                     DDFENDPDKYLREKYNFFGNDLRNSLNTLFCEIVAKIKQKQEAFQGIVNYLVSILGAY
                     KESPSRENIRMAYGSFFLLANIKSTLMKKARSALEYIIANHVIPALQGSSLVLKSQAC
                     YFLSTIEEDLPMGDLVFEAMTNVHKLMKSNHKVLEVEGTLAMSFFLFNETASEKFKEL
                     IPETVESILNLSNTYDLEPLTILLDSIIEYYPEEISKYAPELVGSISRITLSHLMNEN
                     DSGDNKLMVVSGFLRSMENLILSLNQRSPALRHSYINSYDVISFILKEEKADFYQEAL
                     DILNGYVFMIKEIEGSMWGLFQMILNLPIDEITVYSSEIADLIDNFITYGKATIMDAN
                     ILGSIYSVVSKLCLCNEENFFDDDFIGGCRIIESIILNIGNEVLCKDPSRLPFFISVA
                     VSGEKMIDENGPAMVYVLELIMNCFILRPRETIQILREQKYLQEFFEKLFSQKSKFKR
                     VHDKKICILFIGTICRLQSGDLPELDVRNLGKALVATVTSLPAAIRLRNQMKDDEDAV
                     ASSVDSEDEEDLDASDISGMDILEEDIYFETALDHFEPFGYISSILSSPVVGSYAEKV
                     IAEMTSHQKESISAVLNGERVVQKI"
     gene            complement(<64565..>66100)
                     /locus_tag="Eint_100570"
                     /db_xref="GeneID:9699448"
     mRNA            complement(<64565..>66100)
                     /locus_tag="Eint_100570"
                     /product="T complex protein 1 subunit eta"
                     /transcript_id="XM_003073697.1"
                     /db_xref="GeneID:9699448"
     CDS             complement(64565..66100)
                     /locus_tag="Eint_100570"
                     /note="similar to ECU10_0630"
                     /codon_start=1
                     /product="T complex protein 1 subunit eta"
                     /protein_id="XP_003073743.1"
                     /db_xref="GeneID:9699448"
                     /translation="MNQLFVQTEKIADPREGKLQVISNIDVCMKMAEFLESTLGPYGM
                     DKLFAGKEIVVTNDGATILKHMKVNHPVGKLLVALSESQDNEVGDGTTSVIILTTEIL
                     SCLKPLIKDNFDLESIRECLSELRMVCIEHLEKMSMDLNDEMLYKLAETCVTSKNIRH
                     EKKHFSQMVVDAIRQASIDDVDSIGVKKVQGGSIGDSTVVNGVAFEKCFTYAGYEQQP
                     KKILNPKILCLNVELEWKSERDNAEIRVGGVEEYQKVVDAEWEIIRRKLDEIIDSGAK
                     VVLSSLSIGDYATQYFAKHGIFCAGRVSKEDLNRVIGSCGGRILGSTDYLEESLGSCG
                     LFEERQLGKFRYNYFEGGGMNACTMILRGPGQEVLEEIGRAVHDAMCVVRSALKTGKV
                     VTGGGSMEMELSKVIREKSMEYGNKKVFVAKAIGQAFEKIPLLLARNFGFDTISTIQD
                     LRKRHASGSLYEGVSIKGVQDMKALGIYEALEVKKNMIKASFNGVASIIMIDSTIMAE
                     KSQ"
     gene            <66120..>66326
                     /locus_tag="Eint_100575"
                     /db_xref="GeneID:20314094"
     mRNA            <66120..>66326
                     /locus_tag="Eint_100575"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163639.1"
                     /db_xref="GeneID:20314094"
     CDS             66120..66326
                     /locus_tag="Eint_100575"
                     /note="similar to ECU10_0635"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161903.1"
                     /db_xref="GeneID:20314094"
                     /translation="MLDKGSKEKLLTSYEPRTYLRRPRKKEDEQMSQTPLRRHGSLFR
                     VDLSRVIKEKEHFVFSRFLNRFIR"
     gene            complement(<66349..>74292)
                     /locus_tag="Eint_100580"
                     /db_xref="GeneID:9699449"
     mRNA            complement(<66349..>74292)
                     /locus_tag="Eint_100580"
                     /product="dynein heavy chain"
                     /transcript_id="XM_003073698.1"
                     /db_xref="GeneID:9699449"
     CDS             complement(66349..74292)
                     /locus_tag="Eint_100580"
                     /note="similar to ECU10_0640"
                     /codon_start=1
                     /product="dynein heavy chain"
                     /protein_id="XP_003073744.1"
                     /db_xref="GeneID:9699449"
                     /translation="MKMFSIFNLFEIFARKTVNNRMMIVRYLDSIVKSCPPSLDDNFC
                     NKLSRLFMFHDMFGEVWKILDLFFGQDYDGIVQLWEIRRMKKSIERQVSDTIYEWENS
                     VLSDGFSWGRIVSISREADGNRKFKVSPEPTILKRLDEYMTIVSLEGVRSRISQPIHE
                     TMALALEARSIYTRIDDGCRRINRILEDVREDLDLFHKEIDLVFGSMEKILMLRWKDA
                     KDFQDIEEIDDRVRELENRVYTYRFLLKKIAKEEMKAIFSKQIQKQMLFSLDSETYLE
                     FFKFYEKSIVVRGINRSMSRVFLQYLESVLEALEAGDSSLFSSKHRLKKEIVKIEGCG
                     NGVEHCFEPPLSEYFKILEKIFPSEGEGYFFEKVLQRLRPGQEIRSKVEKIIGMVVAN
                     YETCTRILELIPTWDLPLGLYERFLRVRDSQRSVEMFVKNTIPFFTFEHTMDASEQAR
                     LFETVCDEVCRFVSAENSRVYDMLAARKDMVGGMGDSGSQESSMERRDLLEGISNSIL
                     VDEYLRSEEFRILEELNGAVIEYGLERPSVAIETVRSERDSALEANREALNLFLNDIP
                     FGIIKSRREALVSEIRDFGEKIDNAAKERDGLMFWPMFKSLKTRYEELEEKIKRFNKI
                     LGIVDYPLICSSLQERIGGLDAEWATFSRFETILKKYESQKVCDVDVEQLSSFLKSID
                     VSLFHAEYYKEFQSKIKYYISGLDCLQHTKSPYVKKKYFDTEMETKEFFLLQDKDEVE
                     KRLADSRMEYEVERYIERARAEIFLVSLKVRHLRKEEVVIPDLSQVEERVNKLLVEHD
                     SISRFNEKNFFIEELNGIKERMDDCLSFLACLEEVQRGIREFANVFSTDGLDFEAKKY
                     SMIKKRFLDVLNRFSTPSSSSGWEVKLGALLPHKDEFLGMKKDFDDISKGLKVFLRRC
                     RERTPRLYLVSDIDLIRGLNSRSYYVEMLGMMFNIDGVIVENGSILGFEGNGETVMLR
                     QKVQIDQDIGGFMDTFEEEVKRTLKSWFHDGLESLKEGCPSIISDLISEFKYFNKRDF
                     EMTPKLRVLEREIEKHPNGVIRLYPKPVLKSGELFMDSTEEIEYGFEYYPPVDIVFTP
                     LVCRVLSSIAISLKSLCGVILYGRSGTGKTESVKYYCRLIGKPVFVFCCNEGCELETL
                     RNVISGAVLTGSYLCFDEFNRLSEEIMSGATELILLNKNKTKFFLTMNIGYKGRYRMP
                     RSLRAILGETRIDAPDIKDIIDYYCKESSEKIYRLMREVESKASKQDHYDFGLRAVRT
                     ITKGREEAEIMRSAIYFYMACLGREDKAIFVKEFEKIFERKVEQNLAHKDMLLYGLEN
                     RRGALVIGGNGAGKSTLIKLARESRGAMCFYYNPRNIGKIFGFQDKVTGEWKDSKFVR
                     DLRRNMDSSKECWFVFDGIAESFWIEDFNSILDENKLLCLSSGERIRIPDHYRFVFES
                     TSMENITPATLTRVFLVHMEEDDLYQIGNLQNTVGTGMDIRYDGRKVPVFPFRGLVVT
                     EEQSFYARAMEALVKDGSKVFFMRGEVGVGKRSLVEEVFKEKVVVIEGNGFETSMIAQ
                     SLGEDKIKRVGEEKIYDLRSVVYIEGFDCRNVSLVEAVREYNECGRIGEIEVKNMVLI
                     CGINEKKGNDAIRNTAAERLRRKIKSIFVEEPRDTELLFESEIRKRFEATKHFQDYKR
                     VLQVVEFIYKNFKVNLKEITSFIRTLGDLCMEEGDLVDLMYFEAKIYFGESKDLEEEM
                     QRAFGRRPEEIEFNLETRRFRRAKRCSDISYVGSIFHRGYNLVIEGGRMSGKHWVVRE
                     CMRQMKENVRIVSNEDEKKIDGQTAFLVEDVSSLRKDISNQCMIFKLKRTAYYSLDLL
                     KIYNMVRSKDISDLDMVKECFTTNVGINIDLENEGIPSETSSLAMGVEEDGHPWECQH
                     PNVVTTGFLCKAIGFGMSFARIAREFKEKESRRRKFLIGGLQKIEDFGKEALALGLES
                     SRKKKDLEKLTDRLDGQLEKIINTQKQLEREKGAIGNRKREIEGALMMNQKKQEVIDK
                     RLRVAKTLLSESRRSIEELPKSSLSEIRVMINPPEIVRNTVEAVYWIVEGETKGGSIE
                     WKQLIQFMKREDFVSKVLNCRSTKVPDVLENMISNPLFSYEKAQKASSACGPLFMWVM
                     ARYKYAKTMEEISPLDQEIAVLGKEVEKSRKEIEEEEKKLLQIEKKIEAMKDEYNASV
                     LKLESIKKEIKSADERALLMDKIVRELSDEVEKWRRMKYLCPIKYILSSTDWVLHCKR
                     NGFVHSSGISALTRARRFISTSLEDKNYKQVLSNCSYYGNDVIVYGCDRFDKDVYRAL
                     KRQMDNPQYSIILVSSTKTNPYKEYTYNCSFVERFETEESGNLERLEERLLELIVEHA
                     PLNEVYEHKKKLEKERSISKQHSKKREVYEILNLVFGRKSKIFFEAYGVHLSFRIYRE
                     YVENVIYPILESRLCRDNFENMWAGMVDADMNLVRDVISRSVDSFYSSTFPDTKDEYE
                     GLIHEMSRHPFDYTLIIACDIATHIIEEKMAITAVISAGPKENNEKIYRMLEEESQED
                     RTYLIKNIHFLGSCKKSGNSRLILTIEEGKKHSLMEDTKVVYCKGYGTQEGTAIASFS
                     GGDEDLVKFHVEMSNRNSQFGLKDLMLCAENMGHCDREYLKTIVYGSRLDV"
     gene            complement(<74315..>75781)
                     /locus_tag="Eint_100590"
                     /db_xref="GeneID:9699450"
     mRNA            complement(<74315..>75781)
                     /locus_tag="Eint_100590"
                     /product="dynein heavy chain"
                     /transcript_id="XM_003073699.1"
                     /db_xref="GeneID:9699450"
     CDS             complement(74315..75781)
                     /locus_tag="Eint_100590"
                     /note="similar to ECU10_0640"
                     /codon_start=1
                     /product="dynein heavy chain"
                     /protein_id="XP_003073745.1"
                     /db_xref="GeneID:9699450"
                     /translation="MDTNNTLCDEIDRIVDKLKSTTDFHKCISDSNGHSYECKEKSQV
                     GADCIVNHRKDGLLILKGSCEFMVDAMSNFVIPATMSRIKKKGVSVAVEKALRLLEHH
                     ALHLSKAVSEEDKKEKIYLSMETQEMDRLYRKHGEELQNGLDPERFLSSGELELIHRN
                     VEQWTSCIRGLHESVGFKRSGFHEEKTFWSKFYMEMCYIREFGKSEVFGFVHDVLKRS
                     KRFVSAATLESLMLSNKYFELGRGLHGFYEGMDFKGVYFPRSLDEFKDSTVSAIKEIG
                     RRIGRQSKMARKLILSQMDRLVWLIIDKVHENLSIGWLKCCEELLLCSIESMCSLTVS
                     REGEESEAMSLESSLFYEFRGGEELAKFHSEFKDIKKILLFSWSFKGLGAVVPKLLKS
                     SPEKAAHEIRYRSLLQEMISEIGDPDLRPVVGWMKKDLFNIKARLEVVFDQQEGFVSD
                     VFNEAFERICDIDSDILEEGEKERNRSSGGIIATGGWR"
     gene            <75841..>76725
                     /locus_tag="Eint_100600"
                     /db_xref="GeneID:9699451"
     mRNA            <75841..>76725
                     /locus_tag="Eint_100600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073700.2"
                     /db_xref="GeneID:9699451"
     CDS             75841..76725
                     /locus_tag="Eint_100600"
                     /note="similar to ECU10_0650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073746.2"
                     /db_xref="GeneID:9699451"
                     /translation="MDIHMLRKERENCINERDRLISEMDSFIVGSMGEIREALTIPET
                     TVWEISQEDLLLFVSWRISKLISLTRDKKIEILSKLVWEKVNYKDLENILVAEYCYKK
                     VLANDFSESSAWDTDVYIDIGNGDVDIKSDSVERITTGSDGVFYRSLNGLFSKRFHVR
                     VSKELMRSYALNIKVEMGLEIFKSLYEKDEEDLKRLSSYKHYKEKGLPTLVMSGEMTS
                     NLMEDIRARVSQEVTGIIAAEMPDRKKALLITYLLVMFGGIGSDLDLSYFNGKKELYM
                     LEWTKSKENIFIKIQLES"
     gene            complement(<76730..>77863)
                     /locus_tag="Eint_100610"
                     /db_xref="GeneID:9699452"
     mRNA            complement(<76730..>77863)
                     /locus_tag="Eint_100610"
                     /product="histone acetyltransferase"
                     /note="MYST family"
                     /transcript_id="XM_003073701.1"
                     /db_xref="GeneID:9699452"
     CDS             complement(76730..77863)
                     /locus_tag="Eint_100610"
                     /note="MYST family;
                     similar to ECU10_0660"
                     /codon_start=1
                     /product="histone acetyltransferase"
                     /protein_id="XP_003073747.1"
                     /db_xref="GeneID:9699452"
                     /translation="MKLEDVCIGFKVPVKKIVDGAEEVFKAEVLGTRTTNSRLEFYVH
                     YVELNRRLDEWIDSSMVDLSDPSQVEIPKKKKSEKTKTEKSRRDSEKEDGGGDEEPKL
                     EKPPQDEEFKMKNVKKIMLRNYLVDAWYFSPYPKAIAENDVVYICEFCLYYFGTMDSL
                     TQHARQCKLRHPPGREIYRDGDLSFFECDGHIQKNYCRNLSLLSKLFLDHKSLYYDID
                     VFMFYVLCRLEDNGYQIVGYFSKEKVSEQGYNLACILTLPFEQRKGYGRVLIDFSYLL
                     SKRENVISGPEKPLSDLGLLSYRAYWMEVVVEYLSRHDKASINEISKETHISEDDIVG
                     TLSAYKMLRISGNEFIFTYSEKQLQKAQRSRDRCVKGSLLKLY"
     gene            <77914..>78444
                     /locus_tag="Eint_100620"
                     /db_xref="GeneID:9699453"
     mRNA            <77914..>78444
                     /locus_tag="Eint_100620"
                     /product="ribosome biogenesis protein NIP7"
                     /transcript_id="XM_003073702.1"
                     /db_xref="GeneID:9699453"
     CDS             77914..78444
                     /locus_tag="Eint_100620"
                     /note="similar to ECU10_0670"
                     /codon_start=1
                     /product="ribosome biogenesis protein NIP7"
                     /protein_id="XP_003073748.1"
                     /db_xref="GeneID:9699453"
                     /translation="MRDLKQEEEEKVLKKLKFFIGDNVNRILSGEEKLFLHNQRVMLL
                     SEKMKAATSMISRKNLIMAGTVIGKFTKNGNFRLGISSLNLLSKWAIHKVWIKSSAEM
                     NYVYGNNSLKSHIFRSSEGIPINAGVFVFNQHDVPLGFGITSLTPQAYSAAKGHALVL
                     LRQSDTGEYVRNEEKI"
     gene            <78539..>80923
                     /locus_tag="Eint_100630"
                     /db_xref="GeneID:9699454"
     mRNA            <78539..>80923
                     /locus_tag="Eint_100630"
                     /product="HrpA-like helicase"
                     /transcript_id="XM_003073703.1"
                     /db_xref="GeneID:9699454"
     CDS             78539..80923
                     /locus_tag="Eint_100630"
                     /note="similar to ECU10_0680"
                     /codon_start=1
                     /product="HrpA-like helicase"
                     /protein_id="XP_003073749.1"
                     /db_xref="GeneID:9699454"
                     /translation="MSGKKERLLKKYLEKKKRQRNRDELYAQIAALCRPEEDRKEQEK
                     SEKRKLEEVRSDSEDISLSVSEDSPSSSENEVGHSLQTKAMDVGCETMKDSNEEEAMD
                     MYLWDTHARNIQEEAKNAMVFSEDKESSECEDGTGDSVSEDRNTYISEETGKDVSKEY
                     ETKTLENRREDIEEYRKTLPIYYEKAEIIFTVRNSSIVFITGATGCGKTTQIPQFLYE
                     GGLGTYGMIGVTQPRRISAVSISGRINEEANEDICGYKIRYESSVTSETKIKVMTDGV
                     LLREIQEDFLLSKYSVIIIDEVHERSTNIDLLVSMIPRIMKIRKERGNELKLVLMSAT
                     GDVDEFKAFLGDITVFRCPEKGFQVNTFYEERTEMDYLNAAYERIRKIILSGSDSGKR
                     RKMNGERSDVIGSAVSNDKSASILVFLSSKQEIYQLKSRLEGSGMDLTALPLHSSLSR
                     AEQELVFKKTPNRKVILATNVAETSITIPDIVFVVDSGKVKNRMVDSEGITRYSVDFI
                     TKSSATQRMGRAGRTGPGICYRLYSGKAYEKFFECMEPQILREPLDGVVLGLLSLGIG
                     NVYGFPFLSRPEKKSIASATMRLQALGAIDGNLRLTELGKKMSMYPVEPRLARLLCAQ
                     GFEDIFTEILVLVSLISLGIEVRRNHSNGKYFEGSKSDLLVLLGIYNDFLKSRNRKSF
                     CTEMGLGYTTAVEAMKMITHLAKITGGTVDKVGSLNLTPDTCSRIRNIIYRGFADHLA
                     MPLSGTHFFQKEEVSPSRDSVSVESGDFVVFGSLVSSKGKLYMKNITIVEESWF"
     gene            complement(<80958..>82331)
                     /locus_tag="Eint_100640"
                     /db_xref="GeneID:9699455"
     mRNA            complement(<80958..>82331)
                     /locus_tag="Eint_100640"
                     /product="DEAD box ATP-dependent RNA helicase"
                     /transcript_id="XM_003073704.1"
                     /db_xref="GeneID:9699455"
     CDS             complement(80958..82331)
                     /locus_tag="Eint_100640"
                     /note="similar to ECU10_0690"
                     /codon_start=1
                     /product="DEAD box ATP-dependent RNA helicase"
                     /protein_id="XP_003073750.1"
                     /db_xref="GeneID:9699455"
                     /translation="MRPRGIEDIPINSILKKEIEANGFGKMTDVQQMCVPEMLKGKDV
                     VVQSPTGTGKTMAFLAPILSAIYDRREEKGIVAMIITPTRELALQIKDVADLFGVGCE
                     CFIGGMNIEDDYERMKKEFPIVVGTPGRLLEIVGRDTKKFSRVRHAILDEADKLLGFG
                     FEEKLLQLLAKLPKNRVTGLFSATINDSVSKLSMSSLRNPVSINVGNNAMPVALEYIV
                     LSPMDKLFALVDIVPGRRCIVFFATCNEVDFFSSLLSRAGLQNICKIHGKIPQDERNR
                     VYREFFKGNSLLFCTDVAARGIDFQDVDLVVHFDIPKEYSSIVHRSGRTARNGCKGES
                     ILFVMPNEKAYTEFLKLKGIPVAESSYKIKPSTSYSDIKSKIDSDLLNLSVKAFVSYI
                     RSYKEHFVSYILDYKGLDFNSLAELFFLEKIPGMAELKNVKFEKFVKPEKTERKGTKP
                     KKRIRKK"
     gene            complement(<82409..>84076)
                     /locus_tag="Eint_100650"
                     /db_xref="GeneID:9699456"
     mRNA            complement(<82409..>84076)
                     /locus_tag="Eint_100650"
                     /product="translation initiation factor eIF-2B subunit
                     epsilon"
                     /transcript_id="XM_003073705.1"
                     /db_xref="GeneID:9699456"
     CDS             complement(82409..84076)
                     /locus_tag="Eint_100650"
                     /note="similar to ECU10_0700"
                     /codon_start=1
                     /product="translation initiation factor eIF-2B subunit
                     epsilon"
                     /protein_id="XP_003073751.1"
                     /db_xref="GeneID:9699456"
                     /translation="MEIRDIKNFIRENREIILLICDFYETKQIPAEMTSLRKNLSLFP
                     VANIPMIEYILSSLCDQKFFNVVLAGSDCEEVIKHVKKTELGGRMNIISLGCDGKSLG
                     DLMRHIDDNGLEFDDLLVIYANHYTNYPLRSIINRHREDKSFVMTLFLHPNESNSRVS
                     HLYGFRDNEVIFYNKCINEKCNSEKVREAVESDGTIEFTANLSSPTIAVVSSAIFPLF
                     TENFDFKTLGDLVGGILGFNAYNFKIMCCRQGDMMDVNGNIEQLSIERRNRFYSREIV
                     TLYDYFKFNEDVREGKAVDLLRFKCHNSGDFRSFVQVESNFFFDIPDVEFHEPISNTV
                     IGCDLKFKMNHFIKNSVVGHGCFIGGNIDRCIIWDDISVKEDFMDHIVFSEGRVIHYN
                     YLEDEAEEAVFEEKEPRRGTSFFDDVVLYLLSVVEREDLDRVDMDDVVKQITLLRIVR
                     NASSLDLIEAFSMFLVEMIDFNDIDGSTIKASMFFSILDGHMREIEKQEMLMDLIIQG
                     LGECPPDIKMNVVFKYGYLLVEDGIISRSVFKRYNSILKTWVLPSGS"
     gene            complement(<84262..>87039)
                     /locus_tag="Eint_100660"
                     /db_xref="GeneID:9699457"
     mRNA            complement(<84262..>87039)
                     /locus_tag="Eint_100660"
                     /product="MutS-like DNA mismatch repair protein"
                     /transcript_id="XM_003073706.1"
                     /db_xref="GeneID:9699457"
     CDS             complement(84262..87039)
                     /locus_tag="Eint_100660"
                     /note="similar to ECU10_0710"
                     /codon_start=1
                     /product="MutS-like DNA mismatch repair protein"
                     /protein_id="XP_003073752.1"
                     /db_xref="GeneID:9699457"
                     /translation="MKERKTLFDYFKAPKKKEDSGETLDRMVDLENSRNSTGILDLKE
                     HKRICKAPSPEEREEAADGSKPIVPSDVEPSYRSNKGLGKEEKEEKKTEERYKFLEDI
                     RDRNGRRVGEEGYDPSTLLIPKSEYNRFTPFEKQFWDIKKDHFDTIVFFKKGKFYELY
                     ENDALIGAKLFDLRITDRVNMKMSGFPESSLDYWTRKFLENGYKIARVDQSENMIGKQ
                     IRERDELSKGVEGRMAKDKIIRRELKEIITQGTIYNIDYMKSSIPMYLMSVATDEICY
                     AEKCNGEIHTSVLLYDASIGEVYFSSFCDDRARHGIKTILSQHDVREMIADFTIPGIP
                     RVVPDKTGYVSSKKYEFSNSREYVCFQYLAKYMEKLRRSDALKNVKISKLQDEARTMV
                     VDDATLRNMEIFKNNYNGTGEKTLFKAIDFSSTPFGQRLLRRWIAAPLVRREDIAKRQ
                     ETARMFKEVEVSNLKNALARIGDGERLLTRLFNGNPGTKDLNKFIRCLDACREAGDVL
                     VQTLKGQKSDSAESMVAKAEEFSREISKVLEWHRKIYDVSETEISPGEEDGDELCQLM
                     KERREIEEGLNEYLREQKARLKCQSIKFKDVGKDIFQMEVAKETKVPSDYFIMSSTKG
                     TNRYYTRDLKNLVERYVECEEKIFQSKGSLLRRAIDVLLPHVVFFRQMFWELANVDCY
                     LSFTTFSQRNRATTPTFSEGLRICGMSNPIYPTFVANDYNAQKRILVLTGANMGGKST
                     LLRTLCFNVILSQAGMDVCCEKMETPLFDRIFTRIGARDDLVKGESTFMVELGETASI
                     LKHSTRNSLVMMDELGRGTSTRDGECIARAVLDYLKERGCHVLFSTHYHRIIREVEGV
                     SNGYMNSTVKGKDIVFLYKLMDGTSWDSHGLYVARMAGVPEEIVERAERIKETLQRSA
                     GRGEASNIYEN"
     gene            complement(<87065..>88165)
                     /locus_tag="Eint_100670"
                     /db_xref="GeneID:9699458"
     mRNA            complement(<87065..>88165)
                     /locus_tag="Eint_100670"
                     /product="ankyrin repeat-containing protein"
                     /transcript_id="XM_003073707.1"
                     /db_xref="GeneID:9699458"
     CDS             complement(87065..88165)
                     /locus_tag="Eint_100670"
                     /note="similar to ECU10_0720"
                     /codon_start=1
                     /product="ankyrin repeat-containing protein"
                     /protein_id="XP_003073753.1"
                     /db_xref="GeneID:9699458"
                     /translation="MDDEEIKAALMANSSVFLDSVPNSYSFSDGTGLIHWASMYNNLD
                     VCHRLVKDPGIVNSVGGALDSSPLYYALYNSNYKVMKLLIENGADITYVNKSGMGLLH
                     TCARFDDVLGMVLLLSYGADAGVEDFKGRTLRVYARGKRARNVERFLEANRVTDRYKI
                     WMIEGISIGMHWGSFFLGKAWQVGVVAVFLIFWGRVARTRLPVYLNLFYSFYISYKVL
                     GEDFEHTTHTLEYFFNLVCLFLTRPRFGPVGTYQEARELVSTMIEQDEYTMEHFCYTC
                     LVRKAGGTKHCSICERCVLGFDHHCPCINKCVSKDSMKLFQRHLLSTLTVTMGVLLSG
                     RTPDVSLELMSVAAFVVLVLVASASVKSPRPV"
     gene            <88269..>89069
                     /locus_tag="Eint_100680"
                     /db_xref="GeneID:9699459"
     mRNA            <88269..>89069
                     /locus_tag="Eint_100680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073708.1"
                     /db_xref="GeneID:9699459"
     CDS             88269..89069
                     /locus_tag="Eint_100680"
                     /note="similar to ECU10_0730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073754.1"
                     /db_xref="GeneID:9699459"
                     /translation="MIHDEKMLLKSLEHKNIEEKEIFPSICSVLGLQYFSEENGALAH
                     TLASPSFIIDISGLSAKLTFVDESFSRYFKYVEFYLCQHLEKRNMRDFYFYLRMFVRM
                     ETGNEGLEEKDSGDICQCVFNGGYCINPSFRDVAKSSTDGIYDIYRHRFEYHMYTKRF
                     IFPIPVNDPVEDEDSGFLVAEGVNGKQMNAKVSLNLSRYFGPKAFDREVLRILPHIGF
                     YWKGMVDHEEVVVRKDLGVYVNGELRRDAAFLMKLGKNLHLSLNFLRD"
     gene            <89142..>89645
                     /locus_tag="Eint_100690"
                     /db_xref="GeneID:9699460"
     mRNA            <89142..>89645
                     /locus_tag="Eint_100690"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073709.1"
                     /db_xref="GeneID:9699460"
     CDS             89142..89645
                     /locus_tag="Eint_100690"
                     /note="similar to ECU10_0740"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073755.1"
                     /db_xref="GeneID:9699460"
                     /translation="MLVVNGTGLRRNSIIELCVFPDMNVHRMMVELSKQTDNPVFFDT
                     VGNLRVVADASFILSYRKLVKALLSLKSRRGFVLFIDSISFLADKSVANLQRFYNILW
                     MLIYENDATIVVSNHYRIVRNRGALDFALELGQRWKMMVSYRIMYKYVGDKVVAKIYS
                     DELFEKV"
     gene            complement(<89890..>90966)
                     /locus_tag="Eint_100700"
                     /db_xref="GeneID:9699461"
     mRNA            complement(<89890..>90966)
                     /locus_tag="Eint_100700"
                     /product="methionine aminopeptidase 2"
                     /transcript_id="XM_003073710.1"
                     /db_xref="GeneID:9699461"
     CDS             complement(89890..90966)
                     /locus_tag="Eint_100700"
                     /note="similar to ECU10_0750"
                     /codon_start=1
                     /product="methionine aminopeptidase 2"
                     /protein_id="XP_003073756.1"
                     /db_xref="GeneID:9699461"
                     /translation="MKFILIDQAPELPIEFLPKGDCYRKGRLFGPKGEEIENTTDCDL
                     LQDARRAAEAHRRARYKVQSIIRPGITLLEIVRSIEDSTRTLLEGERNNGIGFPAGMS
                     MNSCAAHYTVNPGEEDIVLKEDDVLKVDFGTHSNGRIMDSAFTVAFQENLQPLLMAAR
                     EGTETGIRSLGIDARVCDIGRDINEVITSYEVEIEGKTWPIRPVSDLHGHSISQFKIH
                     GGISIPAVNNRDTTRIKGDTFYAVETFATTGKGFINDRSPCSHFMLNVHKSRKLFNKD
                     LIKVYEFVKSSFGTLPFSPRHLDHYNLVEGGSLKSVNLLTMMGLFTPYPPLNDIDGSK
                     VAQFEHTVYLSENGKEILTRGDDY"
     gene            complement(<91111..>93759)
                     /locus_tag="Eint_100710"
                     /db_xref="GeneID:9699462"
     mRNA            complement(<91111..>93759)
                     /locus_tag="Eint_100710"
                     /product="transcription initiation factor TFIID subunit
                     TAF1"
                     /transcript_id="XM_003073711.1"
                     /db_xref="GeneID:9699462"
     CDS             complement(91111..93759)
                     /locus_tag="Eint_100710"
                     /note="similar to ECU10_0760"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     TAF1"
                     /protein_id="XP_003073757.1"
                     /db_xref="GeneID:9699462"
                     /translation="MQTEFDNCSRKVAQGGERRTTEDGDETLETRPANVGFLDLLVIE
                     KSYEYKLRKYKGRKVPNESMSYEVDDQGKFRNSMTYARDSNTTLQALSGSTRSTGLKQ
                     YLKRKQLEKEILKRKVSKDVLERVEEIKYPFDLVEWENDVVYDTDKIGSLGTSDTVTM
                     ELVDSILEEDWEKYVVVDENDMKNYKSFLTLYLEDPNLIFEKVDEKKQGKPKKKQKEV
                     FSVDKPLKGKYNISLDKYYGQESRTKNSLGTFGVQHSLPALRLDPMFYKNNHTREELR
                     NFHRPRFMVNGSGIRFKAVEGNRGKGQSIIKKAGELTIKDGGPFSLFEYSEEEPFFLV
                     NPGMVSLLNIYYRKSNVRDEYAPDQSQYTILDPEDPSPFSGFGDVMPGTSIQAITNNL
                     FIAPVFKHSSRDYLCIVESSADGEFLTYRNIDNLYCVGQQFPLEEVYAPHSRKLNIFC
                     KNRLKVAAFRLFNSKVGGSKELRISQLDEMFPYFSEGSKRKWLKEYADCVKKGRDNVW
                     VLRPSSALLGEEDLRKLVTPENICQYESMLAGERKLQDSGYKMVVESDDEENEEEMVP
                     PPWCLSRNFVNACNGRGLLELSGPGDPTGIGEGFSFRKIRLKRGNEVENRKIINEHQL
                     RYKEEIDRIWNKQLASLSSVEEIPFNDSFLARRHKEGRRNTDVASETTVLSEETFLTI
                     RRTYGEGESSYVETERISDPRVIKAYLKARKKKISEERKGVLTCGSCGQVGHMKTNKA
                     CPKFASAAKMTKKKIEAEKRKARVYLQEIMLDLLAQFFQIPYSIAFHRPVSIKKFPDY
                     PLIVDNPIDLTTIKTKARHNKYRKFNEFLDDLELMRSNCRKYNGEDHSLTRIADSIVE
                     AGRRRYNEKMEEILETERVLNGFFDE"
     gene            <93837..>94382
                     /locus_tag="Eint_100720"
                     /db_xref="GeneID:9699463"
     mRNA            <93837..>94382
                     /locus_tag="Eint_100720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073712.1"
                     /db_xref="GeneID:9699463"
     CDS             93837..94382
                     /locus_tag="Eint_100720"
                     /note="similar to ECU10_0770"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073758.1"
                     /db_xref="GeneID:9699463"
                     /translation="MSISGPQDIPQEYINNENPFAYMKEYFENPFLDPEIKLRLNALQ
                     QMQPRFVPLGINGSVLKAEQAAKTKAIVESQIERLLQEGMSLINSTDPEREAVLKSNA
                     NDPRILDILISIGRLKLLSNQEKLREKVYCALKSTIPSDVVESVDYSSPLKEDYLLGA
                     MEYGELEEKSNKTEPLPSPNY"
     gene            complement(<94387..>95451)
                     /locus_tag="Eint_100730"
                     /db_xref="GeneID:9699464"
     mRNA            complement(<94387..>95451)
                     /locus_tag="Eint_100730"
                     /product="DNA replication factor C small subunit"
                     /transcript_id="XM_003073713.1"
                     /db_xref="GeneID:9699464"
     CDS             complement(94387..95451)
                     /locus_tag="Eint_100730"
                     /note="similar to ECU10_0780i"
                     /codon_start=1
                     /product="DNA replication factor C small subunit"
                     /protein_id="XP_003073759.1"
                     /db_xref="GeneID:9699464"
                     /translation="MIWIEKYRPTSFDKVVGRDKISSLLKSYTLETIPHMILHGKSGH
                     GKKTTLLCLINHLYGGNSEPKIRTVEVLSGTKKIEVSYMESDEYVEISPSQYGHHDKA
                     VIQNIIKEMGQTKPILSMLSRAKRTPIKLIVITSAEELSLEAQAALRRTIEMYSNVLR
                     VVLMCNELSRLIEPIRSRCFFLRIPGFSDEDIMSNMRRILEKENYTVPEETLEEICRE
                     SEGNMRRALCILELFCFNMNEKEAKRPKNNCKAMKLDWEIEVGSMAGVIKRNPTSEGL
                     VEIRKSLYALLNTCISPRTILIGLLRNLVLGEDFKTFLLLSRHALKYEERIRLGMKSI
                     YHLEGFVAASMCVLNEKRYI"
     gene            <95588..>96358
                     /locus_tag="Eint_100740"
                     /db_xref="GeneID:9699465"
     mRNA            <95588..>96358
                     /locus_tag="Eint_100740"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073714.1"
                     /db_xref="GeneID:9699465"
     CDS             95588..96358
                     /locus_tag="Eint_100740"
                     /note="similar to ECU10_0790"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073760.1"
                     /db_xref="GeneID:9699465"
                     /translation="MDFESKDRRYGDLPGRQTKIFMKNEISDGDSAAIENTSRQIPHS
                     EFEAFLKDYFAEADEKKFNQTVLRTPLDEEWLEEIVGKETECAREAMIKGLMGCLIDE
                     GDILNGFSEVLEEEGSAEMEVEDCIEVEKTLRSFSLENIRDLVRLYKEQVSINNKRKD
                     LLRKKLKERLAYYGYWMVLRAIDSEIEDLVSREKGRKKGIEEERAREVLEKRSEFMEL
                     FKDFSVLEEDYRNYEDLFDPKENVDASRHGVFPYDYFS"
     gene            <96409..>97041
                     /locus_tag="Eint_100750"
                     /db_xref="GeneID:9699466"
     mRNA            <96409..>97041
                     /locus_tag="Eint_100750"
                     /product="putative methyltransferase"
                     /transcript_id="XM_003073715.1"
                     /db_xref="GeneID:9699466"
     CDS             96409..97041
                     /locus_tag="Eint_100750"
                     /note="similar to ECU10_0800"
                     /codon_start=1
                     /product="putative methyltransferase"
                     /protein_id="XP_003073761.1"
                     /db_xref="GeneID:9699466"
                     /translation="MSLEEKLMKRLEGGMFRILNDKMYHGKGLKKRDLKLYHELYDQQ
                     VKRWPVNPLDVIIEKIKKKGNGMAIADIGCGDARISREFENVMSLDLNPSRKDIIRCD
                     MRQRIPLDDKSVDIAVCCLSMMAENISVPMKEVNRILRESGYWYIAEVKSRIPNIKHL
                     EKKFESFGFEVEHTDMSNAQFILFVLKKNLDKNPKKLPPVRLIPWVYKKR"
     gene            complement(<97079..>97519)
                     /locus_tag="Eint_100755"
                     /db_xref="GeneID:20314095"
     mRNA            complement(join(<97079..97284,97308..97464,97493..>97519))
                     /locus_tag="Eint_100755"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163640.1"
                     /db_xref="GeneID:20314095"
     CDS             complement(join(97079..97284,97308..97464,97493..97519))
                     /locus_tag="Eint_100755"
                     /note="similar to ECU10_0805"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161904.1"
                     /db_xref="GeneID:20314095"
                     /translation="MMFKDKMEMISSLLGLILTASLAPRYFYGSQVLIVIITYSTALS
                     LVKPMAKKGKLYFRIINALHVIAKIMNLLAFFIIMNNVFVMRMGYKNCRECFTMTTPD
                     IVVSILFFIYYSVYSTAFVFFFGVSAK"
     gene            <97669..>99303
                     /locus_tag="Eint_100760"
                     /db_xref="GeneID:9699467"
     mRNA            <97669..>99303
                     /locus_tag="Eint_100760"
                     /product="chromosome segregation protein"
                     /transcript_id="XM_003073716.1"
                     /db_xref="GeneID:9699467"
     CDS             97669..99303
                     /locus_tag="Eint_100760"
                     /note="similar to ECU10_0810"
                     /codon_start=1
                     /product="chromosome segregation protein"
                     /protein_id="XP_003073762.1"
                     /db_xref="GeneID:9699467"
                     /translation="MTRRFTMTPNSRNSIKTPISGAKVALFPRHSVAAEEIKRRDMRL
                     VREKGYKQQCVDTILGFLMENGYDGQISQKIMHNPSSKDFQSIFKFLYGFVDDFVFSS
                     RFEDEVVNVMKNLRYPYCGEITKSQLSAITPHTWPVILSMCSWLVELIRHGATLLEQE
                     EEKSVESCFFEYVCDGYMRFMEGDEDDAALEEEFERKVTEIYTGIFKEIDRKKEELSR
                     IEEMIGKSRRMSESLGELERKKRELTDDLNMLIASEKQLEGKKKKYLGAIERLCEDIA
                     RVEEEIESQRVQEEGLRVQITKQKINPEDVREMNTEKMELFKELERMKPEKEGLMREV
                     GEQEREAQEKVEEVEKLFFDLKGLRDEISLRIVKDTKGGVQVVNEVSNEVFDNGIASV
                     IVRLEEELNGRSDVLVAGEMNKGMLEEARAEKEGMSSELSNRLKYCSDKLLMAGKLYL
                     EKKEISENEQRKSKTEMELLENELLKLNLESNTSLLMSEQKLQKAKILLDRTLNTINY
                     EREEISKMVFNFYNTVVDVHTLIQSQVGDLRTLLNR"
     gene            <99397..>100251
                     /locus_tag="Eint_100770"
                     /db_xref="GeneID:9699468"
     mRNA            <99397..>100251
                     /locus_tag="Eint_100770"
                     /product="rRNA methyltransferase NOP1"
                     /transcript_id="XM_003073717.1"
                     /db_xref="GeneID:9699468"
     CDS             99397..100251
                     /locus_tag="Eint_100770"
                     /note="similar to ECU10_0820"
                     /codon_start=1
                     /product="rRNA methyltransferase NOP1"
                     /protein_id="XP_003073763.1"
                     /db_xref="GeneID:9699468"
                     /translation="MKKTNKKPNGGKFRKESRMARPDKRGGRERMNNKKKGSVRAGLD
                     KKVLVEPHRRFPGVYVSRGKEDLLLTKSLAPGISVYGERRITVDVEQERIEYRVWNVY
                     RSKLAAGIVCGVENIHMGPGSKVLYLGASSGTTVSHVSDIVGKDGVVYAVEFSERSGR
                     DLINMSMKRPNIVPIIEDARHPSRYRMLVPMVDCIFSDVSQPDQTRIVALNAQYFLKE
                     GGGVDVSIKANCVNSSVPAETVFAEEVNILRKHNIKPKEQVTLEPFEKDHAMIVGKFR
                     LSKSGEKK"
     gene            complement(<100346..>101053)
                     /locus_tag="Eint_100780"
                     /db_xref="GeneID:9699469"
     mRNA            complement(<100346..>101053)
                     /locus_tag="Eint_100780"
                     /product="glutathione-S-transferase-like protein"
                     /transcript_id="XM_003073718.1"
                     /db_xref="GeneID:9699469"
     CDS             complement(100346..101053)
                     /locus_tag="Eint_100780"
                     /note="similar to ECU10_0830"
                     /codon_start=1
                     /product="glutathione-S-transferase-like protein"
                     /protein_id="XP_003073764.1"
                     /db_xref="GeneID:9699469"
                     /translation="MSDESIWRNIGGEGYCSFKMKTEENALCRNKNNVTGLCDRFSCP
                     LANSKYATVREMGEELFLFIKEPERVHVPRDVYEEIKLSSNYEEALRQIEENLEFWDE
                     KIIHKCKQKLSKLTQYLRRLERFKEHGKTKYMVRRKKMNRREKLRALKTLNKINFEKN
                     IGDELMLRLESGIYGTELKDRFHLANKAAVEREKKQNRKKRYVAELEESDGILEEESC
                     GVEKKADKKTKKTAMKW"
     gene            complement(<101115..>101849)
                     /locus_tag="Eint_100790"
                     /db_xref="GeneID:9699470"
     mRNA            complement(<101115..>101849)
                     /locus_tag="Eint_100790"
                     /product="U1 snRNP protein"
                     /transcript_id="XM_003073719.1"
                     /db_xref="GeneID:9699470"
     CDS             complement(101115..101849)
                     /locus_tag="Eint_100790"
                     /note="similar to ECU10_0840"
                     /codon_start=1
                     /product="U1 snRNP protein"
                     /protein_id="XP_003073765.1"
                     /db_xref="GeneID:9699470"
                     /translation="MTDRAREVLDMLLGRERDIYNPDKLSSERRDTCIYMLASFCPFE
                     LFRNTRRSIGKCRYGNHEEYYRAEYNKNGRKRAEEYEWELLRLLVEIVLDVRNVAKKC
                     TASDTSDLPLLERIKEKEELFKKLYESIEQLGMEGKVEEACHAFDECEKVKWELERIK
                     EAYYAKNNGEGMGRCTVCGAGIVLSDTKVKIDRHIKGRLHKGHLLVRSKLADLLEKFG
                     ITSVAEIFPDGFLFKHLRSHPFSSSL"
     gene            complement(<101995..>103089)
                     /locus_tag="Eint_100800"
                     /db_xref="GeneID:9699471"
     mRNA            complement(<101995..>103089)
                     /locus_tag="Eint_100800"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073720.1"
                     /db_xref="GeneID:9699471"
     CDS             complement(101995..103089)
                     /locus_tag="Eint_100800"
                     /note="similar to ECU10_0850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073766.1"
                     /db_xref="GeneID:9699471"
                     /translation="MRRIADLKIGNKKRLIPRETCKPEFQIPRDLVYLIGKYDRRLKA
                     LCKSVPPREVPILSPWRKPYERKVYYEARPAFDVDLHPFINLRVLRVCDSCSFDLASI
                     NNTCIRKLSILKVANVKMRSNIDTVLQEIVMRDTTVAYEDLMNILGVGSLVSVSLVNV
                     DVLGCHEWREGLMKKLQEMPKLKKIELVNMGIDFQSFVDLCISRELVWFKIIDEGVCL
                     DVRLCSFVNAVRCMGFLKCLTNLGLEMAEIMYVGGRDLKCMRESLPNLRLLHVTEAEI
                     DSRMFKTVYLRYPNLVGLGFVGCTFDGASFYEVIMHFKGSLRYLDLTSSRLPHDYVSF
                     LKKTLSFCSIKLKSGEFIMIGGRSSVSLPG"
     gene            <103149..>103499
                     /locus_tag="Eint_100810"
                     /db_xref="GeneID:9699472"
     mRNA            <103149..>103499
                     /locus_tag="Eint_100810"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073721.1"
                     /db_xref="GeneID:9699472"
     CDS             103149..103499
                     /locus_tag="Eint_100810"
                     /note="similar to ECU10_0860"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073767.1"
                     /db_xref="GeneID:9699472"
                     /translation="MSLKESGVMVMTIGVTVFLAGAILLMDRALMISGNLLIIIGIAL
                     LARSRMFSFLRPEKMQAMVIFGMGILFQVYKLLVFGFFLEVLGLFLLLKDSIPTFRTV
                     LTTLLFGKLQKLIK"
     gene            complement(<103579..>105366)
                     /locus_tag="Eint_100820"
                     /db_xref="GeneID:9699473"
     mRNA            complement(<103579..>105366)
                     /locus_tag="Eint_100820"
                     /product="glycerol-3-phosphate dehydrogenase"
                     /transcript_id="XM_003073722.2"
                     /db_xref="GeneID:9699473"
     CDS             complement(103579..105366)
                     /locus_tag="Eint_100820"
                     /note="similar to ECU10_0870"
                     /codon_start=1
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="XP_003073768.2"
                     /db_xref="GeneID:9699473"
                     /translation="MLAALVVLFLSVLMAFRYLYKKIFVMGRLKCIRKPCKNWEVPTR
                     EAMMERLRSEVFDLIIVGAGSSGAGCALDGATRGLKVALVDAGDFGSGTSSKSTKLVH
                     GGVRYLASAVSNLDWSQYKLVWQALEERSTMFRISPYLTNSIKIMVPVYSRILIPYYY
                     IGLKLYDWISGLKSLGGSYFIGRKEAIDVFPHVNKKNLCGAMVYFDGQQDDVRNNVML
                     VMTAVYHGAVATNYLSVKSLISSGGKITGVRCKDGITGSEMEIKGLGVINSTGSFADD
                     LRKKSDSSTGEIISQSSGTHIVIPKEYAPKEMGFLDPLTGDNRIAFFMPWMGKTLVGA
                     TDIKAKNELSPSPTKEDLKFLMHEVRAYTSQGLKLVKDEVSAIWTGIRPLVKDDEVSE
                     TSSIVRKHFVKIEKNGLLTVTGGKWTIYRKIAEDAIDLAIREFSLKPKGPCVTKYVQI
                     LGSDGYSEDTYVSIQRKLGVGKDTAERLTRFYGTMALKLAKYRRRGKKKDHLSEKYTY
                     LVEEVEYCIDNEMAVRICDVLCNRLMIGLIDVKEAYRCLGKVLEIFKRKHRWDADRCN
                     REEVDAIRMLNTYGLKILRGELQSSSSLE"
     gene            <105541..>106464
                     /locus_tag="Eint_100830"
                     /db_xref="GeneID:9699474"
     mRNA            <105541..>106464
                     /locus_tag="Eint_100830"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073723.1"
                     /db_xref="GeneID:9699474"
     CDS             105541..106464
                     /locus_tag="Eint_100830"
                     /note="similar to ECU10_0880"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073769.1"
                     /db_xref="GeneID:9699474"
                     /translation="MEGIRFADVLQSFEKKTEDGEYVSVERDYNERKVIENDVKRTEL
                     LGVDKRNQEAIKILKRLLFVELDKIPVKYTQGMSEVASVFVLYYFQEIVEEEVAKGMF
                     IAEREEKPEGEASTAEGFSEHFIELPEEETTELKKFLSRHKDIIAKLGVVLTNVFKRK
                     LEPLVANDFKLYKENMKIFVEMMKKRGVKIPELESYKFMGSILTFFLRNLTKMEDVHK
                     VFEIILSCPNTCPFLLLVLFYGQISSGKAIESINNKLFPKVVKLEEEFIETRKRIESK
                     EVCPSKRKIMLIGGVISIITAVVVYKITRKE"
     gene            complement(<106561..>108651)
                     /locus_tag="Eint_100840"
                     /db_xref="GeneID:9699475"
     mRNA            complement(<106561..>108651)
                     /locus_tag="Eint_100840"
                     /product="putative beta-lactamase fold-containing
                     exonuclease"
                     /transcript_id="XM_003073724.1"
                     /db_xref="GeneID:9699475"
     CDS             complement(106561..108651)
                     /locus_tag="Eint_100840"
                     /note="similar to ECU10_0900"
                     /codon_start=1
                     /product="putative beta-lactamase fold-containing
                     exonuclease"
                     /protein_id="XP_003073770.1"
                     /db_xref="GeneID:9699475"
                     /translation="MFSSEKIKVMPLGAGNEVGRSCVIVECGGRTIMLDCGVHPAYTG
                     VASLPFLDLVDLSKIDAIFVTHFHLDHAAALPFLTEKTSFKGKVYMTHPTKAILKWLL
                     NDYIRLINAASDADFYTETDLVKCYDRIIPIDYHQEVNVKGIKVKALNAGHVLGAAMF
                     LVEIEKSKILYTGDFSREEDRHLKAAESPGCKIDALITESTYGVQCHLPRSEREGRFT
                     SIVQNVVQRGGRCLLPVFALGRAQELLLILEEHWSSNASLQKIPIYYASALAKRCMGV
                     YQTYIGMMNERIQKLSLVRNPFAFKYVKNLKGIDSFDDEGPCVIMASPGMLQSGLSRD
                     LFERWCSDSKNAVIIPGYCVDGTLAKEILSEPKEIEALNGKRLRLNMSVEYISFSAHV
                     DFTQNSQFIEECQPRHLFFVHGEMNEMQRLRNVIQQRNEKKGIEMELYTLRNGEEAGF
                     DLVKDNEAKIFTNAEGEFEGIIVGTENDIRIYKRDDLMESKYKEMSIYERQRIPYNST
                     GVLLKQVLMDGFEELVEVESGLMIGNIHVKLSGQEVILEWKSSYADDILAISISKVIS
                     GIGHLKDGFKTAQGEYIDPEKLETLYIDGDIIQDVFIPRRSESERIIAIVVCPDEKRS
                     EKEIMEHLREVGEKLVKQRRITRLEIPSKVVVLRRGFESFEGADLLTPTAKKKRALVE
                     KYFAEEIDKTLGIK"
     gene            <108799..>110868
                     /locus_tag="Eint_100850"
                     /db_xref="GeneID:9699476"
     mRNA            <108799..>110868
                     /locus_tag="Eint_100850"
                     /product="long chain fatty acid CoA ligase"
                     /transcript_id="XM_003073725.1"
                     /db_xref="GeneID:9699476"
     CDS             108799..110868
                     /locus_tag="Eint_100850"
                     /note="similar to ECU10_0910"
                     /codon_start=1
                     /product="long chain fatty acid CoA ligase"
                     /protein_id="XP_003073771.1"
                     /db_xref="GeneID:9699476"
                     /translation="MGTIRFISIISFLSDMMIWCIDGPGKEAKDNLKAPLLTSDNKPN
                     DFKASPIPCSESTVRMSRFKDMMNRIRIMEDGSVQHVNFQRDVVCTPDGSKTILELLL
                     SRCATMGNEPFLGTIVGNKVKYKTANDIRREAEGLASFLAQTTSPGDMVGIYSVNRYE
                     WIVAEMATYMCGCTNVPLYSMFSPENVQMILKETGMKVCVASREKAEQLVETVLEGRE
                     TMLEHIVLMDKAPELVARLENAGLRGHYLKEVISHRGGITKERYSKGEDLATICYTSG
                     TSGCPKGVMLTHRNFISGVSGIFRGSRKEEMVSLDKEDVYLSYLPLAHVMERICVNIS
                     MAYGCKIVFYRGNMKEIKEDYLVAKPTFIISVPRVLNLFKDKIEEKVRQKNFVLRWIF
                     RGALRYKMWRVGRGELKSKFADWLVFNRIAKEFGGRISRILCGSAPLRKEVLVYMQAV
                     LSCRIIQGYGQTENVGSGIVQPLDTNLYDNVGIPFPSNEVKLGEIPAELGSEYGRRYP
                     GRKFGEILLRGDNVTQGYFKRPEETAELFTKDGWLRTGDIGMFDVSTGMFSVIGRLKD
                     GFKTAQGEYIDPEKLETLYIDGDIIQDVFIPRRSESERIIAIVVCPDEKKSEKEIMEH
                     LREVGEKLVKQRRITRLEIPSKVIVLRRGFESFEGADLLTPTAKKKRALVEKYFAEEI
                     DKTLGIK"
     gene            <110942..>113248
                     /locus_tag="Eint_100860"
                     /db_xref="GeneID:9699477"
     mRNA            <110942..>113248
                     /locus_tag="Eint_100860"
                     /product="ribonucleoside diphosphate reductase"
                     /transcript_id="XM_003073726.1"
                     /db_xref="GeneID:9699477"
     CDS             110942..113248
                     /locus_tag="Eint_100860"
                     /note="similar to ECU10_0920"
                     /codon_start=1
                     /product="ribonucleoside diphosphate reductase"
                     /protein_id="XP_003073772.1"
                     /db_xref="GeneID:9699477"
                     /translation="MENSLNSKRVKSEKLKIDMVRGQIEEYTNLLKLQHVNVDELMEK
                     IASGWCEDMTRKEIVDYCSETAASMITKHPEYGWISSRIIVSYIHDITMDSFVEKIKY
                     IQKYQGTISEEMYKIIVENAEIIDSIIDYEKDFLFNYFGILTLMKSYLIKVGEEIVER
                     PQDVFMRTALQVHKSDFGKVKETYEMLSRHYFTHATPTLYNSCLKEAQLASCFLITPR
                     EDSIEGVYHMINQTAIITKYSGGIGLNLHGIRSKGSPLKRTGGKSNGIIPLIQVLNAT
                     KRYINQGAERRPGSIAIYLEPWHMEIFDFLDLRKNTGPEEFRARDIFIALWINDLFME
                     RVKNNEEWSLFCPSQAVGLNETWGEEFNALYCKYEKTISRTVVPAQKLWKAIIEAQIE
                     TGTPYMCYKDACNRLSNQQHLGTIKSSNLCAEIVEYSSGEETSVCNLGSISLPMFVKN
                     KKFDFESLKDVVRILTINLNKVIDFNYYPVEESKRSNMKHRPIGIGVQGLADLFAILR
                     LPFDSDEARNLNKDIFETMYYSALETSCKLAEKEGPFESYEGSPISKGIFHFELAGKK
                     ASNNWDWEGLRERIKKYGTRNSLLIALMPTAGTSQIFGNNETFEPFISNIYTRRTHAG
                     EFQIVNKHLINDLSELGLWSYEMKNLIIENEGSIQNITTIPKKIRDIYKTAWEIKMKA
                     VIDLAADRQVFVDQSQSLNVFVAKPTYSQLTSMHFYGYHCGLKTGMYYLRTRPITSAI
                     KFTVDKKLAEKTLSSMNDTDEPCSMCSS"
     gene            <113338..>114921
                     /locus_tag="Eint_100870"
                     /db_xref="GeneID:9699478"
     mRNA            <113338..>114921
                     /locus_tag="Eint_100870"
                     /product="transcription initiation factor TFIID subunit
                     TAF12"
                     /transcript_id="XM_003073727.1"
                     /db_xref="GeneID:9699478"
     CDS             113338..114921
                     /locus_tag="Eint_100870"
                     /note="similar to ECU10_0930"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     TAF12"
                     /protein_id="XP_003073773.1"
                     /db_xref="GeneID:9699478"
                     /translation="MNFFKEGERLKAIFDDLVKQHKKSKRKVVDNKNVSKEMLQTYEE
                     NRMKLMHFFEMHSRFIRPRKNSIGIFSVDDFVKVKTSESMMFPKKEDFRREGRPGMPF
                     SVGRPMQWGGMNGREPFYIQDRIPTQGWKGCGRDGKPMWMGFGGYPGAPGQESILRGW
                     GPMNFLHQNSRGFFGAGSYEMEGGSFEGEHGSYGYGIRMAPGPGVRRRFDIGGGGPSD
                     GYGMFPKRRPPDMDSKTAEVSKMGFPHEREEIGRNGVPPSMSWTGSRRPYIPTERREE
                     MIRPPFYYPILGGYGYPVHGNGTFPGVPVEETFATACSIYPETSRKEQHFVKYPQSFP
                     GSDVIDWMPEKKSSKTKTPKETKVPTSPKENESSISGKEDPWRLDITTDLEKRKLCDE
                     DQGRDENKEKASFADFPDGKNNSHGELSTNHGKDLNIMTIEDLIGDKTIDKDAKEFIY
                     ELCDGFVDHIIHMSCALAYHRKKNTVEVCDVKLALKTEVGIELPSDGDSEEESSLSPG
                     REVKVVRNEEKQPRMAKKD"
     gene            <114994..>115470
                     /locus_tag="Eint_100880"
                     /db_xref="GeneID:9699479"
     mRNA            <114994..>115470
                     /locus_tag="Eint_100880"
                     /product="ubiquitin-conjugating enzyme E2"
                     /transcript_id="XM_003073728.1"
                     /db_xref="GeneID:9699479"
     CDS             114994..115470
                     /locus_tag="Eint_100880"
                     /note="similar to ECU10_0940"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2"
                     /protein_id="XP_003073774.1"
                     /db_xref="GeneID:9699479"
                     /translation="MATTKGKNSRLAIEMESMSRDPPPGCSASPISPNELDKWIAVIT
                     GPPGSVYEDGIFELLIVFPPFYPFSPPKVTFKTRIFHCNIFEKNICLDILKDQWSPAL
                     TIDKILLSIVSLLQDPNPDDPLNKEAADLYRNNRMEYNRKAKEWVRLHASKHKSEE"
     gene            <115587..>116135
                     /locus_tag="Eint_100890"
                     /db_xref="GeneID:9699480"
     mRNA            <115587..>116135
                     /locus_tag="Eint_100890"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073729.1"
                     /db_xref="GeneID:9699480"
     CDS             115587..116135
                     /locus_tag="Eint_100890"
                     /note="similar to ECU10_0950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073775.1"
                     /db_xref="GeneID:9699480"
                     /translation="MIFGEAGTWLLEDLKSSVLKPYRHAEIKAIQGENGDLDKKMEEI
                     RRAAGSGISEELSVNYVMMKHFKERNERIVRSYKFHRILGLFDCFFGRKETSGILSPE
                     EEECAEEYYATLKEYLEPFADMDFTTETPPTQFFVQVITLEDCGVVMDEGDLIELKKD
                     RIYFIKKSSIAHLISDGLVRII"
     gene            complement(<116145..>116657)
                     /locus_tag="Eint_100900"
                     /db_xref="GeneID:9699481"
     mRNA            complement(<116145..>116657)
                     /locus_tag="Eint_100900"
                     /product="putative nucleotide kinase"
                     /transcript_id="XM_003073730.1"
                     /db_xref="GeneID:9699481"
     CDS             complement(116145..116657)
                     /locus_tag="Eint_100900"
                     /note="similar to ECU10_0960"
                     /codon_start=1
                     /product="putative nucleotide kinase"
                     /protein_id="XP_003073776.1"
                     /db_xref="GeneID:9699481"
                     /translation="MKILVTGTPGVGKTTFSLDISKRFGIPHVEMSRYIEENNLYEEY
                     SETYKSLLFDDEVVRKSLEGYLLGKESYIIDTHSCGMAANIAFDLVFLMKAPVEVLYK
                     RLKERGYDEDKIKENIECEIFGVVEEEVEGLFGDNYHTIGEEEGGLTSEEAMCIISKK
                     IGPESSVDIP"
     gene            complement(<116688..>117935)
                     /locus_tag="Eint_100910"
                     /db_xref="GeneID:9699482"
     mRNA            complement(<116688..>117935)
                     /locus_tag="Eint_100910"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073731.1"
                     /db_xref="GeneID:9699482"
     CDS             complement(116688..117935)
                     /locus_tag="Eint_100910"
                     /note="similar to ECU10_0970"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073777.1"
                     /db_xref="GeneID:9699482"
                     /translation="MSRFFESIDEEREESSRVKIKEKTYEASEKQGKKEKRLHDLQCR
                     VMELEEEENQKIFDKQLKKILVDIRKMEGYLSRGLPPFLKKFLESPRVYTKTHKKTID
                     ELLAHHEPKEDENGQQEDRRDEERLSRDLSKILVIKDTEERRKELEEFKDSAKDKEMK
                     AKALRTLLSIHMKSKDGVEIMKTINELLDCFGDREKNTLLENIDFYLETLYEILDSPK
                     ISTYNGLLKRLLEIDPKLVERRVLQFEFFKLGRPAKTEDRLFRLLYIDRTQGYGESRK
                     YYESIKDTIGEGKIEQEVLGEFGLSSFRSGDFETSFEVLSKCSEVQPPNHGLVMKLLC
                     VILNDRIRGSPVHKKFLEDFKSFGKNRFCLPSGDSAFEVYRSFYLLNMLDKKGAGEIV
                     KRFCEGFEESIWFKDFVESRIKG"
     gene            complement(<118002..>118877)
                     /locus_tag="Eint_100920"
                     /db_xref="GeneID:9699483"
     mRNA            complement(<118002..>118877)
                     /locus_tag="Eint_100920"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073732.1"
                     /db_xref="GeneID:9699483"
     CDS             complement(118002..118877)
                     /locus_tag="Eint_100920"
                     /note="similar to ECU10_0980"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073778.1"
                     /db_xref="GeneID:9699483"
                     /translation="MEEIERDREIVRRMKKFDRESMEDACNESLKSKRISYIPNLVAM
                     NSTEATKKSARPGMLSLKIRNMSTRNILFAVSESFRNINKKIIKKLERIKEELTKRDD
                     LFECILDQVESMEVIEDELFSWYPGLKTSDVLSFFLELMPDLLERYKEYFVRSLVLQQ
                     APKKKILKALRDRLHKNLQCFDIIEKDLELFEEFSGCIPEGGRIITSSYWCEDEEKCE
                     DAMEFFPQLKDKMRLSSEVCAELFHPLSHADVQINGRDLVVSFTQLNDLLTKNSRSLE
                     FWMKEGIVDSDWRYL"
     gene            complement(<119009..>119480)
                     /locus_tag="Eint_100930"
                     /db_xref="GeneID:9699484"
     mRNA            complement(join(<119009..119449,119478..>119480))
                     /locus_tag="Eint_100930"
                     /product="60S ribosomal protein L27A"
                     /transcript_id="XM_003073733.1"
                     /db_xref="GeneID:9699484"
     CDS             complement(join(119009..119449,119478..119480))
                     /locus_tag="Eint_100930"
                     /note="similar to ECU10_0990"
                     /codon_start=1
                     /product="60S ribosomal protein L27A"
                     /protein_id="XP_003073779.1"
                     /db_xref="GeneID:9699484"
                     /translation="MAEKVKKTRKMRGHVSHGHGRVGKHRKHSGGRGLAGGFSHMKTL
                     FTRFHPDYHGKRGMRVYHRKENSNYARPISSARLWGMIPKEQRYEFLDNVEKVPVIDV
                     REFGYHIVIGGKLPLERPIVVKARYFTPSAKEEITRVGGKWIITY"
     exon            complement(<119009..119449)
                     /locus_tag="Eint_100930"
                     /number=2
     exon            complement(119478..>119480)
                     /locus_tag="Eint_100930"
                     /number=1
     gene            <119636..>121009
                     /locus_tag="Eint_100940"
                     /db_xref="GeneID:9699485"
     mRNA            <119636..>121009
                     /locus_tag="Eint_100940"
                     /product="kinesin-like protein"
                     /transcript_id="XM_003073734.1"
                     /db_xref="GeneID:9699485"
     CDS             119636..121009
                     /locus_tag="Eint_100940"
                     /note="similar to ECU10_1000"
                     /codon_start=1
                     /product="kinesin-like protein"
                     /protein_id="XP_003073780.1"
                     /db_xref="GeneID:9699485"
                     /translation="MHSTHKKIKVSIRLRPSTGNREIWKTSEDGLWHIRGERRVKYSG
                     FQSILSNMTNEEVYKLCVQEEVWKFLNEENCTVFAYGQTGSGKTYTMLGGDEEGIIKL
                     AIRDVLKKRSVGISYLEIYNEKLFDLSNNNEVQMFSVGNKNVISNLWVEHVDKWEDVV
                     PFIEKCEKNRRFGTTEFNTKSSRSHTVVQVTYSSNNRVRTLNMIDLAGSERASRSNDR
                     RKEGSFINRSLLALCTVVNNIGNGKYLGFRNSKLTRVLQPSLDGLTNLIAICTLSPYE
                     DCVEESVSTLKFAARLCNLELKTEEMQISSDGDGRCGGDGLEGSSRCEVKHRCCRKFH
                     PEVSKETSDVLEKTESMTFEKYFEGYGFSEAPGLEEHREHDKVCSEKDSVAGILRTFG
                     RVIMENLEWKVKLMEELNIINNDRIHLLERMVGELLGKNPSRRMNEIFILEKYRFNLR
                     RKMVGRK"
     gene            <121041..>121466
                     /locus_tag="Eint_100950"
                     /db_xref="GeneID:9699486"
     mRNA            <121041..>121466
                     /locus_tag="Eint_100950"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073735.1"
                     /db_xref="GeneID:9699486"
     CDS             121041..121466
                     /locus_tag="Eint_100950"
                     /note="similar to ECU10_1010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073781.1"
                     /db_xref="GeneID:9699486"
                     /translation="MGPKIKTLVFLKVMVLVILLHFLPVVLKEIGLKKRVEMMKRDFN
                     RRLLEGSESLERLRMLKTLINNARYCKDGDIPLDGSMAETKRAYEGLRVWSDPVFLRL
                     SNIYNISIFFPVFAPVVIQSIKILRYRDSWGSRGEKVEP"
     gene            <121552..>122205
                     /locus_tag="Eint_100960"
                     /db_xref="GeneID:9699487"
     mRNA            <121552..>122205
                     /locus_tag="Eint_100960"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073736.1"
                     /db_xref="GeneID:9699487"
     CDS             121552..122205
                     /locus_tag="Eint_100960"
                     /note="similar to ECU10_1020"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073782.1"
                     /db_xref="GeneID:9699487"
                     /translation="MNEESGKECSKQQKRLAEALRRRDGLKEEMEKVRQDLQKLEIHR
                     RVLLDMVRIGNGGMEIDVNRYRPIYKAEVEGAKGLIHVPGERYHLAIYNLGRIPMASM
                     KPFYNQKNIYPIDYMCKRAYYKSRGSPGGDGYALYTCTIRNVCSKPLFEISERDLCIR
                     GKAGEVFNAFKSLFSWEIEFGSITEFFGLNNLYVRRLISEQEGFRGLGIGDRWERKA"
     gene            <122280..>124085
                     /locus_tag="Eint_100970"
                     /db_xref="GeneID:9699488"
     mRNA            <122280..>124085
                     /locus_tag="Eint_100970"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073737.1"
                     /db_xref="GeneID:9699488"
     CDS             122280..124085
                     /locus_tag="Eint_100970"
                     /note="similar to ECU10_1030"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073783.1"
                     /db_xref="GeneID:9699488"
                     /translation="MILDEIVKEAAALQLRKEDENTWSRVNDVLMRLSGAVVGPEDVR
                     RVLESVSDLIVRSMQSDRSRLAGTALGFLKNCICILGNEFGMAGQYLVPLAKVCGKSS
                     KVFYSRGEEVLVELCKRVNIKGHARFFSEYCGSANKNVRLAIFRGIEAWGSESGKIEG
                     LENLVIKGREDAFSEVREVCKRMMEKFSIGERKEGCFRRQRLEESLESGVKKGPVRMA
                     RMPVRGGYGGMEGIGAREMEKKELAPKFSPARKQTKTGDKDYDKIRELSRQVKDIAED
                     IRPNVGAEKSSSGRIRTKIKEMFSRGSDKAGTVYPESKVEIPKEVMNHEDLTPVRLDK
                     YLSRYREEYGRLIPKNITGVSNGFEVEDTELGEEFLEAKEVSDEDKARIGETKEEDKL
                     NGSCEEKKERIVVGNESFDEEMGHDLEGGDEVCAELEIGELSKSLANISINEGDVEDK
                     PHSDGDGMLSEASGNPYENLVEGQEMESSLKEYTIMDSGKLEEHKENNRDESRLCRGS
                     GASIGESTISIDSEVENQRKERKKGCRNALEMMKGNRFAGFLELSESSEEETVFSRRQ
                     GERKEGVEKQDADNTGDFTAMDSLVEVRRGVFRKK"
     gene            124177..124413
                     /locus_tag="Eint_100975"
                     /db_xref="GeneID:20314096"
     ncRNA           124177..124413
                     /ncRNA_class="other"
                     /locus_tag="Eint_100975"
                     /product="miscellaneous RNA"
                     /note="expressed"
                     /transcript_id="XR_002670151.1"
                     /db_xref="GeneID:20314096"
     gene            <124461..>125894
                     /locus_tag="Eint_100980"
                     /db_xref="GeneID:9699489"
     mRNA            <124461..>125894
                     /locus_tag="Eint_100980"
                     /product="vacuolar ATP synthase subunit B"
                     /transcript_id="XM_003073738.1"
                     /db_xref="GeneID:9699489"
     CDS             124461..125894
                     /locus_tag="Eint_100980"
                     /note="similar to ECU10_1040"
                     /codon_start=1
                     /product="vacuolar ATP synthase subunit B"
                     /protein_id="XP_003073784.1"
                     /db_xref="GeneID:9699489"
                     /translation="MLENIRIEPKMSYRKIVGVNGPLVIMDNIGFLKYAEIVSLTLPD
                     GSVRQGQVLEVCGKKAVVQVFEGTSGIDIKETQVTFTGETLKMGISEDVLGRIFNGSG
                     KVIDGGPNIIAEDYFDIQGQPLNPYSRIYPEEMIQTGISSIDVMNSIARGQKIPIFSA
                     SGLPHNEIAAQICRQAGLVKRKDSIDSSDDNFAIVFAAMGVNVETANFFRNSFEASGS
                     IGRTALFLNLANDPTIERIITPRLALTAAEYLAYEKEKHVLVIMTDMSSYADALREVS
                     AAREEVPGRRGYPGYMYTDLSTIYERAGRLEGRNGSITQIPILTMPNDDITHPIPDLT
                     GYITEGQIYVDRQMHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYAKYA
                     IGKDAQAMKAVVGEDSLSLEDKISIEFLERFEKEFISQRHNELRTVNQSLDIAWDLLR
                     TFPREMLNRIPSDILDEFHSVAPSRSE"
     gene            <125964..>126128
                     /locus_tag="Eint_100985"
                     /db_xref="GeneID:20314097"
     mRNA            <125964..>126128
                     /locus_tag="Eint_100985"
                     /product="DNA directed RNA polymerase"
                     /transcript_id="XM_009163641.1"
                     /db_xref="GeneID:20314097"
     CDS             125964..126128
                     /locus_tag="Eint_100985"
                     /note="similar to ECU10_1045"
                     /codon_start=1
                     /product="DNA directed RNA polymerase"
                     /protein_id="XP_009161905.1"
                     /db_xref="GeneID:20314097"
                     /translation="MNGMGTDQKVFTYVCIQCPSLRELKLKDPIRCTECGNRVLRKKR
                     TDNVVQLDAV"
     gene            <126205..>126564
                     /locus_tag="Eint_100990"
                     /db_xref="GeneID:9699490"
     mRNA            <126205..>126564
                     /locus_tag="Eint_100990"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073739.1"
                     /db_xref="GeneID:9699490"
     CDS             126205..126564
                     /locus_tag="Eint_100990"
                     /note="similar to ECU10_1050"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073785.1"
                     /db_xref="GeneID:9699490"
                     /translation="MEEGRKRKAKDQLSPYSNPVEESDQHSGVVEPLPLIHKKRAKAR
                     VGDSSMIANSESLKGVLSSVNILKPRGGGNDRISGLNRCFVNAVQKVVEKESNKSLLY
                     LFRQYEKYYRELTESND"
     gene            <126623..>128134
                     /locus_tag="Eint_101000"
                     /db_xref="GeneID:9699491"
     mRNA            <126623..>128134
                     /locus_tag="Eint_101000"
                     /product="phosphoglyceromutase"
                     /transcript_id="XM_003073740.1"
                     /db_xref="GeneID:9699491"
     CDS             126623..128134
                     /locus_tag="Eint_101000"
                     /note="similar to ECU10_1060"
                     /codon_start=1
                     /product="phosphoglyceromutase"
                     /protein_id="XP_003073786.1"
                     /db_xref="GeneID:9699491"
                     /translation="MRNVCLVVIDGWGHLESRTQGNAVSESECRWMRALSWGRCSLLL
                     HAHGRYVGLPDGLMGNSEVGHLTIGSGRIIEQDILRIDRAIEEGRLKKIVDEVLQGGR
                     GRIHVVGMVSDGGVHSHIRHLKGILESLKGRNEEVFIHCISDGRDTEPQVFLKYLEEI
                     KNFCRDIGTGKIASVAGRFYSMDRANNEERTELSFKTMTSGKEIGEDAEDYVLGMYKE
                     GLGDETLRPFLVDKAGRISREDTIIFFNFRADRMRQIASRFAKNGNNIVTMTEYKKNL
                     KSKVLFGKVCAKNTLAEVLSDRGIRHTHIAEKEKEAHVTYFFNGGREQPFLWQKTIIL
                     PSPDVESFDTVPSMASKEVTEYVIAEIRDGVPMVIANLAPPDMVGHTGNLEATKMAVE
                     AVDGCIGTIYRACIENKYTLIVTADHGNAERMTDGRGNCCKTHTTSKVPLIVCGEEVG
                     EFSSSWGYTDTDYSLRDIAPTVLEIMGIPKPDEMTGRSVLGAFGHTLPARDNQ"
     gene            complement(<128166..>128471)
                     /locus_tag="Eint_101010"
                     /db_xref="GeneID:9699492"
     mRNA            complement(<128166..>128471)
                     /locus_tag="Eint_101010"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073741.1"
                     /db_xref="GeneID:9699492"
     CDS             complement(128166..128471)
                     /locus_tag="Eint_101010"
                     /note="similar to ECU10_1070"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073787.1"
                     /db_xref="GeneID:9699492"
                     /translation="MTQENMINDMYPLAALLIYATNQQVTKEKIDSVFKFFGLESHPK
                     ISEFFEMDALEIKTLLMSSTQEAAAPVEAKASADVPGDAGKKEEPEEEEVEIDFGMF"
     gene            <128616..>129875
                     /locus_tag="Eint_101020"
                     /db_xref="GeneID:9699493"
     mRNA            <128616..>129875
                     /locus_tag="Eint_101020"
                     /product="DNA polymerase alpha-primase complex subunit B"
                     /transcript_id="XM_003073742.1"
                     /db_xref="GeneID:9699493"
     CDS             128616..129875
                     /locus_tag="Eint_101020"
                     /note="similar to ECU10_1080"
                     /codon_start=1
                     /product="DNA polymerase alpha-primase complex subunit B"
                     /protein_id="XP_003073788.1"
                     /db_xref="GeneID:9699493"
                     /translation="MDFDSQIFRKLSRRYSTKSDIRMVRRPRISNFYLKKGDKYEYVA
                     YRLTSMKPYFLELLGIEDFSPVNSISSTSFYTYGIIMNPFGHKLDSQNTFIASNIDGS
                     NDVVVKLNLSHLRRYSVFPGQIVAVKGKNITGGEITVETLHCIPVVDINEEKDGKEEK
                     HNQPSIVAFSGPYGFASEFDVLDRILMEEADVLILVGPFISSAHGSEDHSPASMMEKE
                     FVPRIRRWLNERPGSKVVLVPSVNDITCLGVFPQGPIDIDEERIVCTSNPCEFFLNEF
                     LVCVSSLDTPLEISSEECFHDSGLESEDDACGNLLFGGDRLKRIAYHLIFQRTFLPVF
                     PSRNVVSYSVPENMSMDTAPDIYIVVSRLKHFSRDVGPSVVVNLGLQTGKTEKVACHI
                     RLPEAEEPKKFSVEFVDLEISMPRENK"
     gene            <129895..>130446
                     /locus_tag="Eint_101030"
                     /db_xref="GeneID:9699494"
     mRNA            <129895..>130446
                     /locus_tag="Eint_101030"
                     /product="chromatin remodeling protein"
                     /transcript_id="XM_003073743.1"
                     /db_xref="GeneID:9699494"
     CDS             129895..130446
                     /locus_tag="Eint_101030"
                     /note="similar to ECU10_1090"
                     /codon_start=1
                     /product="chromatin remodeling protein"
                     /protein_id="XP_003073789.1"
                     /db_xref="GeneID:9699494"
                     /translation="MQTHFEVFDKMLEEIQQLRLDAIYFTKSTSRTEGKIEKLRGKCK
                     RYKEKFVRKPSERYFKKIEKFYRAIKKHLVNNRRCEDAFQEVIHELKKKCEDLCSRSG
                     VSFDLECPEIPDVNCVVNLGEMGSNEQLYCKCKRPAFKNMIACDSLDCKGRWFHFECV
                     GISTVPKTLWICPECRKAGTLTR"
     gene            complement(<130499..>131131)
                     /locus_tag="Eint_101040"
                     /db_xref="GeneID:9699495"
     mRNA            complement(<130499..>131131)
                     /locus_tag="Eint_101040"
                     /product="DnaJ-like protein"
                     /transcript_id="XM_003073744.1"
                     /db_xref="GeneID:9699495"
     CDS             complement(130499..131131)
                     /locus_tag="Eint_101040"
                     /note="similar to ECU10_1100"
                     /codon_start=1
                     /product="DnaJ-like protein"
                     /protein_id="XP_003073790.1"
                     /db_xref="GeneID:9699495"
                     /translation="MDYSEAARSCLSRKDYSGYLENAKKQYELTGSPEDKREMEKATR
                     TLSLHKDIEAFLKKKSEDYYDILGVPKNATQAEIKRAFNTLIMKFHPDKTGMDESSAV
                     SGIIQNAYSTLGNPEKRRKYDMAREAPTFRASPRFSTPEDVMPNVFFNAFHSQGYQES
                     FVYSNDFYEYLYSQMYRRFDHRRRPPTANDPDTQKILTFLVIIMLVLMAM"
     gene            <131310..>132797
                     /locus_tag="Eint_101050"
                     /db_xref="GeneID:9699496"
     mRNA            <131310..>132797
                     /locus_tag="Eint_101050"
                     /product="polyadenylate-binding protein 2"
                     /transcript_id="XM_003073745.2"
                     /db_xref="GeneID:9699496"
     CDS             131310..132797
                     /locus_tag="Eint_101050"
                     /note="similar to ECU10_1110"
                     /codon_start=1
                     /product="polyadenylate-binding protein 2"
                     /protein_id="XP_003073791.2"
                     /db_xref="GeneID:9699496"
                     /translation="MEIDESKRASSDSLTIYVGDLSPKTLDSDLFRIFSNVGKVLNVK
                     LIKRGEPVSSFAFVTFENEEEAERAIREYKHYELHNRQIRVMRKDERPPETGNIFVKN
                     LPENFTSKDLDDAFSMFGEITSCKVATTSHGKSKGYGFVQFKEKKAAKKVIKNFNNLN
                     GLMLGENKIVVELYNPEMKKGENKKTPTMFTNCFIKNFPVDVEEENLRELLEKYGKVT
                     SLFFPTKEDGKPKGFAFANFESHECALNAIKNLHETFPFGDGESGEPFYIQKGQRKEE
                     RAEELRKTFEQLSMQGQSYKKNLYITNIPEGFGAEELNNIFREFGNITSMSVGTDGAN
                     SQKQYAYVCYSTPEEASIAVERGNEIYLDGNRLQVAYFKNKLERMKEKEFGSIGYKPN
                     IPYMYNQGVNFVPNGFKRERNRGGSAKGYSSELEKLHGLVLAEAPSFKSQWKSFGVNN
                     EAEFTSKVTRAFRNKSEEEIKDMIDLDFVLAKSIAAVIENDNSSD"
     gene            132884..132954
                     /locus_tag="Eint_101060"
                     /db_xref="GeneID:9699497"
     tRNA            132884..132954
                     /locus_tag="Eint_101060"
                     /product="tRNA-Ala"
                     /note="tRNA Type: Ala, Anti Codon: CGC, Cove Score: 54.74;
                     similar to ECU10_1115"
                     /db_xref="GeneID:9699497"
     gene            <133005..>134075
                     /locus_tag="Eint_101070"
                     /db_xref="GeneID:9699498"
     mRNA            <133005..>134075
                     /locus_tag="Eint_101070"
                     /product="transcription initiation factor TFIID subunit
                     TAF6"
                     /transcript_id="XM_003073746.1"
                     /db_xref="GeneID:9699498"
     CDS             133005..134075
                     /locus_tag="Eint_101070"
                     /note="similar to ECU10_1120"
                     /codon_start=1
                     /product="transcription initiation factor TFIID subunit
                     TAF6"
                     /protein_id="XP_003073792.1"
                     /db_xref="GeneID:9699498"
                     /translation="MLFSKETLKSFAQSKGISNIDDDALRVLSQDLEYRIKEVCQEGS
                     KFMVGSKRTKLSIDDINYALISRNVDPLFGYDPQESLVFRGLPSNVYYVPDEEIDLEE
                     YLDRPLPKIPLRPSIQSHWLAIEGVQPQIPYNPILLEKPVAKKDTLGTYQEEAELKSQ
                     NRHMLTKELSMYFDKVIQAMETDEEIAMECLHNESGIQQLVPYFIHHFNEQIVKNIKN
                     KEKLMTVMMVYNSLLRNKYIFIDPYLHQILPSLITCVIGKSVDDEVRRVAADVVKYVF
                     SNFSSSYKTLAPRIINTLSKAWLDKEKTESTQYGALLCLSLLSKHVVETVVKPKADYY
                     VKEINNPRVTELLDDILKKNDI"
     gene            complement(<134100..>134867)
                     /locus_tag="Eint_101080"
                     /db_xref="GeneID:9699499"
     mRNA            complement(<134100..>134867)
                     /locus_tag="Eint_101080"
                     /product="origin recognition complex subunit 2"
                     /transcript_id="XM_003073747.1"
                     /db_xref="GeneID:9699499"
     CDS             complement(134100..134867)
                     /locus_tag="Eint_101080"
                     /note="similar to ECU10_1130"
                     /codon_start=1
                     /product="origin recognition complex subunit 2"
                     /protein_id="XP_003073793.1"
                     /db_xref="GeneID:9699499"
                     /translation="MSSDLSDFHFNCKKELNALAKSFNILFYGYGSKMPLLRKMFPSA
                     IHLNCRAMSRHEILLEIMDAVRRRSRSAAQSISKVSTIKDIDEAIGFRKEKYKIVMAN
                     FDFSMTDFSGLRNFAILGTIEEINIKFSFEDAEKFNFIFRDLTTFEPYEEEIAGIHFR
                     ETRAEASSKVVRNVPRNSRLVLKEILLYNSDVVGLGELFERIKRKLFLTSKTSVLSMI
                     SEFIDHGLLKVRNGSEITVCMSSAEKKEVAKELGSLD"
     gene            <134962..>138138
                     /locus_tag="Eint_101090"
                     /db_xref="GeneID:9699500"
     mRNA            <134962..>138138
                     /locus_tag="Eint_101090"
                     /product="ARF guanine nucleotide exchange factor"
                     /transcript_id="XM_003073748.1"
                     /db_xref="GeneID:9699500"
     CDS             134962..138138
                     /locus_tag="Eint_101090"
                     /note="similar to ECU10_1140"
                     /codon_start=1
                     /product="ARF guanine nucleotide exchange factor"
                     /protein_id="XP_003073794.1"
                     /db_xref="GeneID:9699500"
                     /translation="MDESKQKLEEVQILLNRLAASSNKEIRRILDGLPSCPTSKSILD
                     TFCLLFSLGRYSNKELLCFLDAFQRFIPICRADLSEVGDKIVELKFTPSEKDTDLVIL
                     KYFEITNTIAESIQSESSRSVFSRYMFVLSNSVVSRGAQVEVLGRFREFLKKKKGLLK
                     LFAARRMYRNIGCTEDLIINFSELLSDEEMVEVALECTTLRGFIIAKTRSRYLFQMYH
                     NELPWWYVMGMHESLIPYLYYTFDGVGLYKNVSKEVYGRLDEQDIIRAMDEDMKSKIS
                     PDECDVLGNVSEHKNMADDEGMVGVKRDIRRFNETGCLKEMLEKYGEQMSFEFLRYFE
                     ETDLRRLGEFLCKLKNEPLLRMFAETFDFLDMDILDGLRIFLLSFHLSPEGQVIHRVV
                     EAYADKYYLDNAGICTFMDMAKDKKTKEFVFNLSFSFLVLNTKFHNPNIKVKPTFKDY
                     MKDFTPEEIPPSFGEEYLESMYQSIKKKPLEFPAKNQPGKEHYKVFKKVCKNLQEMES
                     RESKLRIRLLEPELPEGLRICTACRMEAHRKLFSTDFKRFLFLDPKVFYQICSRLRMT
                     HIFEEYLNAHKEDTQKFIESFVYYLGMEGKASLYATLLDVLARTDKQRSSGMLSDLGI
                     SFLKSSPGKDRVQQQYRDAYKELLNSEIPNVGLLCEGLCLFLSRDVSGGVSGEEEMAS
                     QKRRQRSIGFVKGVVVDILKRNISKVEDLSMLDDENIGVLLRECVETGNRKKFCHISK
                     FVSEERLLFYFRQVLEESPGFLDDEILEVFKRISIYNENGFHCILLLQSNGVDMFDFV
                     VTVKYESIVCRAINAHEGEDGDQSEQSRLEFSGKDTLNCYTVEEKYGESLSVPSNLFH
                     FYVSSNSVLNQSKARSIHKSGCPLKEKLFNREEMDKRLIYMIKKADSMNSKDITNYAL
                     WIVNLLSSSLPLLSKFFVRNFGLLLTLKDQTMTNNFIKIFYSRICKVINGSELCCRCG
                     YSYLDDVEKLIEMLLKYDLASEKDFEFYFKGKSEMIKSGRVKVGERGVQLVNSKEKND
                     GSENNSGEPGEVAVVGEPNIKTNPDFNL"
     gene            <138262..>140904
                     /locus_tag="Eint_101100"
                     /db_xref="GeneID:9699501"
     mRNA            <138262..>140904
                     /locus_tag="Eint_101100"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073749.1"
                     /db_xref="GeneID:9699501"
     CDS             138262..140904
                     /locus_tag="Eint_101100"
                     /note="similar to ECU10_1150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073795.1"
                     /db_xref="GeneID:9699501"
                     /translation="MEIFANDPFLEEGMCNAPIGTFDKHYRLSRNFIADLVHLGPILV
                     SVAVEKDFSRALVRSVLGFKEYRFYSKHIEECPYFFTVRNSLSRYFVDTIDNWRHVEI
                     APEQRESSLMGILGSIFSFGAWPLRDESGGGRKKMYDAISSGMMGCPERYSAKEIMNK
                     MAEVRVEYARGVDNEFYTKPIYVDLVCESSKRIPREMLGKRFIDPEDTLSVSSDDLED
                     IKSPTHSGEKRLRQALLGFLFNEVEYFCQVNGFYLDIVSKARKSEINFEDVFKGFYKV
                     HSFEAGFIESMRDIVEEAGFKMDRILSDPQYFADTMRDNGVGEIKMDDEEILEKVLDS
                     FERHLNGFRCYEDMMLFHEEYIETLEKVRSYDWAPDYRVVNDCFCNCLQRIVRYPILI
                     DDILQNLTFSLHEKRVKKIYAKMTKLINIIDKKKERHDNIRCEQLIREKVEEIPGEVA
                     ERKANFLFQLNCEDSNGDPIALFLFREMVIIADREGPSLPIQDPRCGRYFFRHSLRLE
                     DIEIVSFGTTGIKIIGKGSLKGNEMYEMKEVYSDVSIGVMYFSKGSPHSVKWFIEEYH
                     KAGTDSGNGLYASGNVFFRVLKDSEEGGQERKRDLIIYVGDVGLDISSDSNSAHLDLE
                     NGAFTTKGQSIQHSINYGKDEIKQKFGEIVGNGVRARKAWMASKDTPGKCPELFAMYR
                     IKLREIVEECGDSSVVEFNGRFSKCNSSTITRKIRVAEGIIRYLSRSLPYVGCRSSGG
                     KYLFSSAGLDRSRLKEEEMVNFLEKALSTEELEDYAFSEYNAEDILYLLMYFIRTSMY
                     TFFRIEDIETLHRTLFVDKIHFLGAVVPKMSNPSFVSSLFETIVTARDKLCIVPTLDM
                     FLVMFSPFQVSEQEMAEIVTKICW"
     gene            <140987..>141250
                     /locus_tag="Eint_101105"
                     /db_xref="GeneID:20314098"
     mRNA            <140987..>141250
                     /locus_tag="Eint_101105"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163642.1"
                     /db_xref="GeneID:20314098"
     CDS             140987..141250
                     /locus_tag="Eint_101105"
                     /note="similar to ECU10_1155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161906.1"
                     /db_xref="GeneID:20314098"
                     /translation="MDTEEEKALRESSRNMKTTVQIIQEKMDQQALIYESIEAETERN
                     GKILFLNIRRFEEAIRRMNSDPRNKIIFMLFLVIVGCSGYLFF"
     gene            complement(<141270..>144392)
                     /locus_tag="Eint_101110"
                     /db_xref="GeneID:9699502"
     mRNA            complement(<141270..>144392)
                     /locus_tag="Eint_101110"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073750.1"
                     /db_xref="GeneID:9699502"
     CDS             complement(141270..144392)
                     /locus_tag="Eint_101110"
                     /note="similar to ECU10_1160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073796.1"
                     /db_xref="GeneID:9699502"
                     /translation="MVVKWRSTELVFKGKKLRFREEIISVGNFKKWVVVCTQSRIHFF
                     GDEDMTLSRPIKAAIVKEEGVYYHHKENNHVMFISHPFEPEEFVFFHHGFVLREVISG
                     EMILEGRGRYLLRNTGRKEIGLEDPIESSCSGMGDDNFDETNRTRMLIAYKIEEGIRC
                     LVEDYEEDTKNEGGIKMRITEYENFMVGIYGNTALFVRVGGSKGRVKRSKLLSETNVR
                     FEKEAKHLIKYRMRLTRDKYLEFLRINDVLFMGNEIMCSRIRKDLWPKSRIPKKWMQN
                     YYKPFWSGINEVEKNILSCYPRAMQRVFMGAFLQSKEKRFDLLEITEDVMAGIDRVLD
                     EWLARCKSVWEFLGMEIAPIKGLETMSRCKELINYTCPSLSVGQDVMNIKFRRIMRCN
                     LDAITGLKYSDVKNLGYRVIYMEMKKSRILGSTKPTRSINKLCRIAKKHFGDSRIEEV
                     ISLFDEKPIIFEIDEYDLENKKEKGYVLRKISNIGGAYLFYGLGVAKEEQSPGQLRFP
                     IYKNGELGEIEIKDPEWMNWPMFNYSVSRSCGLSSFDEISHDFIESRILEFTSTGEGN
                     EFEVAGRIFAFGLQGRLEGVHPQKVGEFITAKYPVVSMALLAGMGMSHLGKRDDLLGK
                     MYLHCLKSPQPLYIHAGCIVGLGMLYAGSGNVFIRNVLSSEANKKGVFGDEQYNKGNK
                     IWYDYTYRVLSSISLSMVYMKTSLDMFKFIELEDSLCELLTNGIVLFGSKQTRFRSKF
                     KRSDTSTPEEVFYSELFLLGLEMNEQLDSIIEEVAKKSRAASFYELYRGSGRLLYVSL
                     YLLYKGIKVDLEGSLFKSILEVCLFAERAMRENDEFKILFDASLVSLSLISNSSCNLD
                     TIRILRRQIKATETGKSLGEQTDLFFTSSRCKQEAQLSMRYGDIERYKMCLGIVTCGM
                     GTLKIASTFHLVLDVISTFFICFPISPVDQEYFNMTRYFLLLSMKENPEGFKSTVKYL
                     KETNKRSRRKLRRDMSRINKIFLKEYSEASDADKKFIIDILTDFYEKYAESDNLLDVE
                     MLKNIACKTP"
     gene            complement(<144441..>145013)
                     /locus_tag="Eint_101120"
                     /db_xref="GeneID:9699503"
     mRNA            complement(<144441..>145013)
                     /locus_tag="Eint_101120"
                     /product="DNA excision repair protein"
                     /transcript_id="XM_003073751.1"
                     /db_xref="GeneID:9699503"
     CDS             complement(144441..145013)
                     /locus_tag="Eint_101120"
                     /note="similar to ECU10_1170"
                     /codon_start=1
                     /product="DNA excision repair protein"
                     /protein_id="XP_003073797.1"
                     /db_xref="GeneID:9699503"
                     /translation="MENTSRDGGFFPEKEDKKKELKEDESILLPVLPGKRCKYCLQIP
                     LDDEIEKTFGIPVCRSCRYSSLKFVTKTSCLSDYLLVDDELKELRFLERPNPRKGTWS
                     RMHLYLKEEVEEFAVWKWGSLEKIEEIKEKRKKRTKDRKQRKLKKNIKDLRRKTRMEV
                     GDTKKHEHVFEDDGEVCRCRCGMSVEEEEL"
     gene            <145122..>145805
                     /locus_tag="Eint_101130"
                     /db_xref="GeneID:9699504"
     mRNA            <145122..>145805
                     /locus_tag="Eint_101130"
                     /product="ubiquitin fusion degradation protein 1"
                     /transcript_id="XM_003073752.1"
                     /db_xref="GeneID:9699504"
     CDS             145122..145805
                     /locus_tag="Eint_101130"
                     /note="similar to ECU10_1180"
                     /codon_start=1
                     /product="ubiquitin fusion degradation protein 1"
                     /protein_id="XP_003073798.1"
                     /db_xref="GeneID:9699504"
                     /translation="MLLDLFGLFGGKPSWSLSPKKFEGCNQNNFGGKVIVPQSVLVDL
                     VSFQIQPPFTFEISHSDGVFKTHCGVLEFTGEEGQVVVPSWMYQQLSMGDVDKVELKY
                     MTFPLGRFVKLIPHSVDFLEVENPKQELELCLRNYQVLSEGDEILFQFDEVGSMRFTV
                     AHIEPSSSAVYIVDTDLAVDFLEPIGFKDKVERERTVTKYIEVVNSNYDIKPIRMKKL
                     GLYMYKSAD"
     gene            complement(<145847..>147397)
                     /locus_tag="Eint_101140"
                     /db_xref="GeneID:9699505"
     mRNA            complement(<145847..>147397)
                     /locus_tag="Eint_101140"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073753.1"
                     /db_xref="GeneID:9699505"
     CDS             complement(145847..147397)
                     /locus_tag="Eint_101140"
                     /note="similar to ECU10_1190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073799.1"
                     /db_xref="GeneID:9699505"
                     /translation="MHASELRTLHSSKNYEEIYNIIREEMEKLSLRDKLCTNDLEGLQ
                     SSIEEEIRRCVHEQKGIPKPLVNITLLQGESFEARMKSLAISYLGSLCSVSYQEFLNC
                     NFQRLSSLKSCLGWIEESISRVSLKYSHVPDDWSLPREILLKYYVMTKQRVCDYFFYN
                     EVDEEDFIEAFDATIRCEKRLGKLFEKQGCSACVQSTSLEDGACKSKGLSQKETFCPH
                     KTMLSSLFVPNIEIYLERSFKELMESDLNQENVKLCIISGFLDFFRGVEKILKRVEYL
                     NDKSAHRHLVHYFDEYLSLLIKRTRLPGCLNESIIVLNTMLYIRETALDFLDQIIEKS
                     EVEEDIPKIHMQMRKAERLQNTFIDDFLSSYFLGLDFSAPEGLSRKVIQILDKDIMNE
                     EIEGIYEDIRITLVESVVSHVFSGIYSIKVTPRISEALLLETAEIKRYLRTKVSVLPL
                     IDVVEKYLKIFLCPPDNERCFVENFILMSEGIFSFDQIVNNIGSSHGEDRLYLAYKSV
                     VDSFNGVS"
     gene            <147571..>148188
                     /locus_tag="Eint_101150"
                     /db_xref="GeneID:9699506"
     mRNA            <147571..>148188
                     /locus_tag="Eint_101150"
                     /product="casein kinase II subunit beta"
                     /transcript_id="XM_003073754.1"
                     /db_xref="GeneID:9699506"
     CDS             147571..148188
                     /locus_tag="Eint_101150"
                     /note="similar to ECU10_1200i"
                     /codon_start=1
                     /product="casein kinase II subunit beta"
                     /protein_id="XP_003073800.1"
                     /db_xref="GeneID:9699506"
                     /translation="MENLLEDDSENLLRMSPDEYWVGDFMHRRENRSIVRVPDEFLED
                     RFNIIGLDRYIKDLEKVYSSILDKGPRSSFQEESSLYYLIHQKYIFTKPGLETVLDRV
                     MSKEYGACPRIGCKSVGMIPIGLSDRPGVSSTKVYCHCCVSVYEARGILRLVDGCAWG
                     KSFPHFLILTHSYHFPSGKCEEYVPRIYGFRICAHDDNDSLSEDN"
     gene            <148254..>153584
                     /locus_tag="Eint_101160"
                     /db_xref="GeneID:9699507"
     mRNA            <148254..>153584
                     /locus_tag="Eint_101160"
                     /product="DNA polymerase type-B epsilon"
                     /transcript_id="XM_003073755.1"
                     /db_xref="GeneID:9699507"
     CDS             148254..153584
                     /locus_tag="Eint_101160"
                     /note="similar to ECU10_1210"
                     /codon_start=1
                     /product="DNA polymerase type-B epsilon"
                     /protein_id="XP_003073801.1"
                     /db_xref="GeneID:9699507"
                     /translation="MRDELLEEQYGFISHHESRRREGWVLNYITTVFKDGRMEAKLYL
                     IDDKRAEFLVKIPYFPSLLLKASDYDSVEEYLRRKYAAEIYSMERVHRIDFNEYNHLN
                     KDPGVFLEVRFRTESGFSTAVKDFKKIVARNKVQKNNEYDCFGKDRTLCAEELMEGIF
                     EYDIPVEVCTANNLKIRCGKWYTFYYTGETYVIEKSERVVFPDLRILAFDIETFKKPL
                     KFPNPDYDEVMMISVKTECRGELIVNRRLVSKDIRKFEYNPREDMECVFDVSNEGDEE
                     GVLIRFVELIQKHKPHLITTFNGALFDFPFLEKRMKNYGISLRETTGFTLKDEYYISP
                     FIVHLDCYKWVKRDSYLPAGSQGLKEVTKVKLGYFPDEIDPEDMVRLAMSDPDKMASY
                     SVSDSVATYFLYTKYVQPHVFSLCSLVPLSPTSALCQGSGTLCEALLVSEAIEYGVLI
                     PERRRESKTREHNGHIAESITYVGGYVECLRSGIFRSDLEHEFNISKEFIGEVVSSLD
                     EILYEYKEEGGFEEMKAQILANLQENKGRLRKEGLIYHLDVGAMYPNIILTNKLQPVS
                     IVNEEICIRCDFSDESNNCKKRMEWSLKVEYIPAGKRETEMIRRQVEKEKNFEGNEEE
                     EVKKRVRRYSKSMYGKKREKKICTRSSTVCQREIPFYVETVRKFRDQRYVYKRLQAQA
                     QKAAEEATTDEERKYAMKSVVVYSSLQVAHKCVLNSFYGYVMRKSSRWYSMEMAAIVC
                     NVGGNIIKKAREIVEKIGISLELDTDGIWCIVPSSLVSSYVLPSGKKFSLLSGLLNHF
                     VCKKFTNNQYQEKIDGEYATRSENSIFFEIDGPYRAMLLPTSTEESKLLKKRYAIIDD
                     NNKIAELKGFEMKRRGELQITKKFQEELFLHFLDGSNLNECYESLAEVCRYWLDILKS
                     KGEYLDDDTILELLSESRSMSKGFGEYRGRKSNLTVTAVRMSEVLGEGILEEKLKCEY
                     IVAAYPENKSVAERAIPVVVFRSEQKEEFLRKWLERDYSGDIRAVIDWEYYRVRLECV
                     IQRMVILPALSQGIKNPLSEVGIPEWAKAKTQLRGFDLRNVDDIEDAFCKARLSKDTE
                     AGREKCKEDFEEDKENCKDDEKKMRDLMETDVREYILKNRIAWIERIKRIIDVGDIIK
                     MVCSNDGYMDVYRMGRSDSVERIPLERRIYMQVNDWRYFDKSGDIERVAVYFPENSET
                     TEVGTISIKEHEFVKDYSLYRKFLSHFSIRRVFEDKIPILYSNLKECEGHDVEFVTVG
                     SFIFLGKPVYTVGEEEFLVFSGKEGLYDLGRYLLRNFGKWRIGVIGSSDPCKTELRKI
                     LCKYHILEIQVRRNLSLKEYSVMCNEQKEFHKQMAREVELVCKLSKYSRIPIFNVNEN
                     VMDVLFYRELKKNRVVCGRQECEMSYSPRLRAESFRPGLYKKYVVEIECIGTLVLSII
                     EYEAFLGKDTLFKGVERKDFHILRSLLKRIVLDSIKGEDGAKLLLRNIGRWIRSDSAI
                     ICSELRSICCMLQKRYMMHLAKKLRDEKYDVICVAGDVVLIDTGKTSEESALDFFQYI
                     CKKGLELCGYEMMKMKAIRIFQSLAFVDPSTYFFLDRGEYFCFSESKVPTAFLQAYFN
                     EEKVDSEFVYSLVTKIPLESSKMVLKLLSFRQDSQALLSNCYKLLHLSEFAEKERKEI
                     YLDIVCPSCGMESALRARCIKCYNAYPKSAVLEVCMAYAKHLLWLELSRDLSCTICGK
                     SNEARLSSFCKCGGAFQKTSYGNELESLREIAGSPIFDGFYRRISKHFLK"
     gene            <153632..>154054
                     /locus_tag="Eint_101170"
                     /db_xref="GeneID:9699508"
     mRNA            <153632..>154054
                     /locus_tag="Eint_101170"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073756.1"
                     /db_xref="GeneID:9699508"
     CDS             153632..154054
                     /locus_tag="Eint_101170"
                     /note="similar to ECU10_1220"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073802.1"
                     /db_xref="GeneID:9699508"
                     /translation="MCSEIKVLERNNETQIDTLLYDHTLVHITFNTKEHPLSPRDLSI
                     NHLGRSSSGSVKVFVNSKKVDFSYELVFGYALSCIGIEEYDCKVYLFDDTDDLCVLKN
                     LMFAIDEKFKAGLRVFSDHSKTTVSLGGKIIYETTIVL"
     gene            complement(<154104..>155819)
                     /locus_tag="Eint_101180"
                     /db_xref="GeneID:9699509"
     mRNA            complement(<154104..>155819)
                     /locus_tag="Eint_101180"
                     /product="MdlB-type mitochondrial ABC transporter"
                     /transcript_id="XM_003073757.1"
                     /db_xref="GeneID:9699509"
     CDS             complement(154104..155819)
                     /locus_tag="Eint_101180"
                     /note="similar to ECU10_1230"
                     /codon_start=1
                     /product="MdlB-type mitochondrial ABC transporter"
                     /protein_id="XP_003073803.1"
                     /db_xref="GeneID:9699509"
                     /translation="MKKKVSGRYSYMISLIIHFLVKDKAVLLGILTTVFFIMLSSKFH
                     FEFQKSLTKIEQYIARKTIDETDSSRLLITFMLLPISHYMSSLLYKLVSAYVIQLLIG
                     KSFHHCLREYLLTNYHRFHHLGSGQIHSLVERRSNGMVSFLRILFADIFFNASYVLWG
                     FLYFSRCSTGVVILTVIQILVYVVVSWYGTILRNHFRRKYNGAYNFASNRLYGILQNY
                     DIIKSYNKEENELQKYIDTFRDVGRHSRRYDQINGFVEFFQKSLLFVPNAFMVLMIIG
                     GYMFKSMRIGNRYIEYSKFFSELRSGIMKLKESTFVMNENLTDIFDSKIEDALEEEDL
                     GLAIERFGDTIRFNGMSVHIGNRLILEGFSGEIKKGEKIGIIGKNGCGKSSLVNVLLR
                     FLDYSGEVYIDGIELRRIRKSSVRGLISFVPQNHHLFNGTILENIGYSYNSIEYDHVM
                     KKCVHFNVHEIFSKLPRGYQTLVGENGKFLSGGQKQRVSFMRAMVKDSDIVVLDEPTS
                     NLDADSEKELVETILKKMEDKTVFLVVHDHDLLRGFDKILGLHDNKVKIYNSFDDFII
                     DKSKY"
     gene            <155981..>158467
                     /locus_tag="Eint_101190"
                     /db_xref="GeneID:9699510"
     mRNA            <155981..>158467
                     /locus_tag="Eint_101190"
                     /product="karyopherin beta"
                     /transcript_id="XM_003073758.1"
                     /db_xref="GeneID:9699510"
     CDS             155981..158467
                     /locus_tag="Eint_101190"
                     /note="similar to ECU10_1240"
                     /codon_start=1
                     /product="karyopherin beta"
                     /protein_id="XP_003073804.1"
                     /db_xref="GeneID:9699510"
                     /translation="MDRRGLESCLYEVLKSDSTSGKRAEAKILELQSSDFERFISILV
                     EVFCDLKSNDQLRMVSGIILKNSLHANDPDLQKGCLSRWLGMRPESREYIKNTIKRAL
                     RGPTPRFCTMAGAALGQISRMEIPNSLYQGFFEEMKRMVCDEETACGVCEAVGTCCSY
                     LTKEAPDILRMHNATVFEICIHPLKRGTTRESKLSGLKCLMNCMEVEGIFCYEENVNI
                     FLNSTIEIWNGDDEELIHKLMICFNRLVMLNYKFIRKSILENILGQYLGRFFKSKHDE
                     IKIQAIEYWCIFAEKRDEEMANKYMSVVLPEILSLLKKGPDYYEEIWSPHKAASSCLE
                     IYTELKGDKMMRNGMIWGFIETSLKSESKADVDIGAVALGSVMHEKCEDCLVKIVPDL
                     VAGIGFEESKDSCLWALSRTAECNFYALVDHLPIILSRCGSVVLESSKSSIGAAWAMD
                     CIFRSVADSKRKEGFASHIPSSTKKRADDFVESFLVKQYLDILNVLVKGTELANLNDS
                     SLRVALFSALDELILICPQTVLDILIGFYDYTSKKIDECISVLGYATQDQLLVVEDVL
                     SNYIGLIEAIATARKREDVEDLLELFIRILESTPTIAFGEVYTSISNLSTKFAPHTSR
                     ILPYMTRDMRCTDRFVLNSVINLVGRLANTMGTDFNILATVLTSSLVQCLSSEATHRD
                     LKPIILSVFGDIALALERNFESYLDMVVMLFQQISELNRHGDEEYVDDLRKNAVQLVN
                     CSLVAIGDSSKVRNLLPRIISIAHKMGIEDGSGKTHEDILGLIDDLVGMYGKNFGLDE
                     PWIKEFLYGMMKSSNDRNRKKASHVLEVLR"
     gene            complement(<158506..>161151)
                     /locus_tag="Eint_101200"
                     /db_xref="GeneID:9699511"
     mRNA            complement(<158506..>161151)
                     /locus_tag="Eint_101200"
                     /product="formin-like protein"
                     /transcript_id="XM_003073759.2"
                     /db_xref="GeneID:9699511"
     CDS             complement(158506..161151)
                     /locus_tag="Eint_101200"
                     /note="similar to ECU10_1250"
                     /codon_start=1
                     /product="formin-like protein"
                     /protein_id="XP_003073805.2"
                     /db_xref="GeneID:9699511"
                     /translation="MEGETLMNGARINSRILEKIQALVKNSEGGDFRCVGSTSLSNGS
                     KEVYIKKERGDRRQGANLNVWRISHRVLVFGQCWDNSTESITRRNNTGELIEFLNTNY
                     KDRFMVWSLGESLKKYPNVQKIPSLDFDLGLAYRISCAVRCWLEFNPNNIAAFETQNG
                     DEDKLRFLVGCVLRYCELADRTELIWEKCLEGAFASSLSNINTVKRYIKYFDSASTLK
                     GELAHTVILRQLIVTTIPSASTKSFLIGMKIMKKGEELCAIKEGDDDRVYRDKDYAVF
                     SGVDCDISEDIQVFLYYYLEEEEKRMVLLRINTLFYRQGLYRFALDDVECFLPENRFD
                     KEFTIDLVMIESGKAVQKPQCIHKVDLIQGLRLLNEGFWGEPDREIYERLVSEGQNEI
                     VAKFCAFMRYFSEKTSELVRTLEAKGFRASILEAKTLKHADIVFENKEKCWGKHRDAE
                     VEEISGEGVCGGVGIDRKALYTMENGNPKPLELIGSFSRVENRYKVKPKKIVVKKRQA
                     EKCDAQPNVVIKKPFHWIPLSRAEETIFSETSGISTDIDYEKFEEIFCEPFSEQKKTS
                     KETKRSIIEESRLFLASLSLKHLELRNITPENVYSILKTPDNPLGLQDLLNIEKMYPG
                     QEEVMDLISTPPESLGKVEKAMLEFSKLLDVRKLVEILIFERRFFDEIFLIEKTLLGL
                     LEVCNRILDSQSLRIVLRTILEIGNTMNFRYSISRKKANGFKLSSLYVFSNYRGKNNT
                     SLFPFLFHVLEANGVRVEHLLEELSPLHDLKNEELPKIREKINHFIEIYTEKLGLLNL
                     LEEDAKKEYAKFFRFAYSKLEEMSCSFKKFHLHSSMVKRKFGEEETKSLREILTTLSD
                     FLNSTKQELGRYRKTQNRSFCPKAT"
     gene            complement(<161270..>162331)
                     /locus_tag="Eint_101210"
                     /db_xref="GeneID:9699512"
     mRNA            complement(<161270..>162331)
                     /locus_tag="Eint_101210"
                     /product="putative 1-acyl-SN-glycerol-3-phosphate"
                     /transcript_id="XM_003073760.1"
                     /db_xref="GeneID:9699512"
     CDS             complement(161270..162331)
                     /locus_tag="Eint_101210"
                     /note="similar to ECU10_1260"
                     /codon_start=1
                     /product="putative 1-acyl-SN-glycerol-3-phosphate"
                     /protein_id="XP_003073806.1"
                     /db_xref="GeneID:9699512"
                     /translation="MKRAWNAIFFLVAMIVYFSYIIVGLAFVSVVWLVCYGKVAKRAL
                     RRSAKITWLHLTRAVFSGYFPKKVFIRYNPAILKRSRNVIISNHLTEYDWLFVCCVLH
                     CFGRFKDICIVLKMSLKDIPLLGRGMKFFQFIFLNRKISKDKELIISGTSRLRSEGKY
                     DLLIFPEGTYIDKLSHPKSHKWSSEADVEIDGRSFDPEEVLIPRTTGFKILRENIRDD
                     MEGIIDITMMGNPYVKYPNDTFSYWDVIVNKSQKVNFMFFLDYIPNNNSMDEDSFLLK
                     QFEKKEKMISRFKEKNGEKCVTRIEEFSMIANLLSDPNEEYRDMEIELSSPWGPFFHI
                     MFTLNLGLLIGWIVRLFSK"
     gene            complement(<162415..>163062)
                     /locus_tag="Eint_101220"
                     /db_xref="GeneID:9699513"
     mRNA            complement(<162415..>163062)
                     /locus_tag="Eint_101220"
                     /product="Dullard-like phosphatase domain-containing
                     protein"
                     /transcript_id="XM_003073761.2"
                     /db_xref="GeneID:9699513"
     CDS             complement(162415..163062)
                     /locus_tag="Eint_101220"
                     /note="similar to ECU10_1270"
                     /codon_start=1
                     /product="Dullard-like phosphatase domain-containing
                     protein"
                     /protein_id="XP_003073807.2"
                     /db_xref="GeneID:9699513"
                     /translation="MSWLLRTLRNFCRCNRKEMSMVGSEKARRESKEKKFMQLVSPQK
                     NDLGRTVVLDLDNTLVYSTFKKPRLYDFCLEVPGKKNLQIYVKVRPHAVEFISIVGAI
                     YEVIIFTAAKKEYAEKVIGIIDANKRIAYSLYRDSCTLVNGKYVKDLCKLGKPLNEVI
                     LVDDSPHSYEFQPHNGIHIPPYTGEKDDDSLLKIMKFLREIHEDGMFGSIHQTPF"
     gene            <163105..>164013
                     /locus_tag="Eint_101230"
                     /db_xref="GeneID:9699514"
     mRNA            <163105..>164013
                     /locus_tag="Eint_101230"
                     /product="Ser/Thr protein phosphatase PP4"
                     /transcript_id="XM_003073762.1"
                     /db_xref="GeneID:9699514"
     CDS             163105..164013
                     /locus_tag="Eint_101230"
                     /note="similar to ECU10_1280"
                     /codon_start=1
                     /product="Ser/Thr protein phosphatase PP4"
                     /protein_id="XP_003073808.1"
                     /db_xref="GeneID:9699514"
                     /translation="MTENPLDVKYQSMLENIRDSLLPSREDVLVLVEEVRKILESEPN
                     VLYIDTPVNVVGDVHGQFYDVLNMMSLMEDPSEKPYLFLGDYVDRGYNSVDLILLLFV
                     YKRLYRNTLHLLRGNHETRMLSSVYGFKEECVRRYDLVVYWRICEAFQYLPIAAVVLG
                     KYFCVHGGLVPGMSLDFLMKHDRIGEITEINDILWSDPDETLGFRKSQRGAGYLFGED
                     VLRNFLDEHGLFHFVRSHQLVNDGYKVYFDGKLYTVWGAPNYCYSSGNIACVMAIDEN
                     GHDFRLFDRCEEQFKEIPVRCDFFGS"
     gene            complement(<164021..>164524)
                     /locus_tag="Eint_101240"
                     /db_xref="GeneID:9699515"
     mRNA            complement(<164021..>164524)
                     /locus_tag="Eint_101240"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073763.1"
                     /db_xref="GeneID:9699515"
     CDS             complement(164021..164524)
                     /locus_tag="Eint_101240"
                     /note="similar to ECU10_1290"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073809.1"
                     /db_xref="GeneID:9699515"
                     /translation="MNKSPFVSSSLERRYPIDISDGILQEITQYSVFELIRDIRDPEH
                     SYTLEQLGVVSREGITIGLIDSDGIAPSAGLPIKYIKVMFKPTIPHCSMAAIIGLCIK
                     AQINQYIENHFIQVHIVNDGHINFKALNKQLDDKDRVLAAMENETLLDLMKECLPRHG
                     ELLDMPK"
     gene            complement(<164579..>164893)
                     /locus_tag="Eint_101250"
                     /db_xref="GeneID:9699516"
     mRNA            complement(<164579..>164893)
                     /locus_tag="Eint_101250"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_003073764.1"
                     /db_xref="GeneID:9699516"
     CDS             complement(164579..164893)
                     /locus_tag="Eint_101250"
                     /note="similar to ECU10_1300"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_003073810.1"
                     /db_xref="GeneID:9699516"
                     /translation="MVNIPKTRNTFCKKCSGYSPHKVSQAKKSKDNPRAQGNRRYARK
                     QRGYGGQTKPILRRKAKVTKKLVLKLECTKCKFSHQKPLKRAKHVIFGGEKKTKGEAL
                     VY"
     gene            <165043..>165534
                     /locus_tag="Eint_101260"
                     /db_xref="GeneID:9699517"
     mRNA            <165043..>165534
                     /locus_tag="Eint_101260"
                     /product="ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_003073765.1"
                     /db_xref="GeneID:9699517"
     CDS             165043..165534
                     /locus_tag="Eint_101260"
                     /note="similar to ECU10_1310i"
                     /codon_start=1
                     /product="ubiquitin conjugating enzyme E2"
                     /protein_id="XP_003073811.1"
                     /db_xref="GeneID:9699517"
                     /translation="MSTPAKRRLMKDLKRVKKNSCKTIFAEPLEDDLMTWAAVIFGPE
                     STPFEGGTFSLVLAFPETYPQDPPNVRFVSDMFHPNIYPNGELCLDILSNRWSPSYDV
                     MGILISIQSLLNDPNTASPANTEAANLFSIDPHLYAEKVRNSVIKSWMDVENLRDKYG
                     SPQ"
     gene            complement(<165601..>168072)
                     /locus_tag="Eint_101270"
                     /db_xref="GeneID:9699518"
     mRNA            complement(<165601..>168072)
                     /locus_tag="Eint_101270"
                     /product="SNF2 DNA/RNA helicase"
                     /transcript_id="XM_003073766.1"
                     /db_xref="GeneID:9699518"
     CDS             complement(165601..168072)
                     /locus_tag="Eint_101270"
                     /note="similar to ECU10_1320"
                     /codon_start=1
                     /product="SNF2 DNA/RNA helicase"
                     /protein_id="XP_003073812.1"
                     /db_xref="GeneID:9699518"
                     /translation="MNVKLLRKYKSFIGDNEFFRAFIPNYEDVMKGDDEPIEPYTFIS
                     SPKFIIHELKDYQIEGLNWLINMHENSINCILADEMGLGKTLQTIAFLGYIRYVKKER
                     KRHLIVLPKSTLANWKREFRKFMPNYKARIFYSSRKEMKREAEEIMSSKWDACLTTYE
                     MCINAKNILSKVNWSYIIIDEAHRIKNEHSLLSKIVRIFSCDHRLLITGTPLQNNVHE
                     LWALLNFIVPEIFNDAEKFENYVMSIEEEDGEAIKRIRNVLQLFFLRREKIDVEKGLI
                     PKKIINLYSKLSPMQREWYKMLLKRDLSPLGSTRDPKGMLMNVVMQLRKCCNHPYLFP
                     DAEPEPYTNDKHIIENSGKMIVLDKLLESLRARGSRVLIFSQMSMMLDILEDYAMFKE
                     YEYCRIDGSTSYKDRTEAIDAFNAEGSEKFIFLLTTRAGGLGINLSTADTVILFDSDW
                     NPQMDLQAQDRAHRIGQKKQVVVFRLISENTVEERIVYRSLQKLKLDDILLQGRCYKS
                     SGVSQSELIDILANGMEITEDEEKDENIEDLIRRGEEKTREMNMKLCDFKISDTLNTN
                     IDCYTWEGEDYNIKKIENFIESNQDAYGRSSRTSVLFRTRPRIIEYPEYQFYPRELME
                     IQEKEIKLYEEGKSLSPDEVARKKELQSQGFDWTKKDFQSYVKAMEKVGKDDVSKIAM
                     LMKHKNDVEAYHKVFWERVNELRDAEKIISSIEKSQKKMERRSKIREMIEGDFDSISA
                     KLGKTRSRLGDYNPLLIDLYRKYIDHPNWVECIRKDILKLPEYKFDYYLLSRTNSDIQ
                     KHINHLISALAKYCKETKDTDPIKA"
     gene            complement(<168131..>168694)
                     /locus_tag="Eint_101280"
                     /db_xref="GeneID:9699519"
     mRNA            complement(<168131..>168694)
                     /locus_tag="Eint_101280"
                     /product="Ercc1-like DNA excision repair protein"
                     /transcript_id="XM_003073767.1"
                     /db_xref="GeneID:9699519"
     CDS             complement(168131..168694)
                     /locus_tag="Eint_101280"
                     /note="similar to ECU10_1330"
                     /codon_start=1
                     /product="Ercc1-like DNA excision repair protein"
                     /protein_id="XP_003073813.1"
                     /db_xref="GeneID:9699519"
                     /translation="MIKVSPLQKGNNVLNYLSNASWHYDNSITPDYEINRSTALLFLS
                     LRFHSCKPEYIHKRINKLKPYKVKVLLVHVDIPNYSKTIQELFDTTSLTMVLGFSIDE
                     CSRYIRGFDEAGKRSIEAIRRGSHDEEGFLTAFPKVNKSNAQQILKYNGTLLRFFGKS
                     SEEMEKIPGLGKTKSEDIIKYLNMQFE"
     gene            complement(<168756..>169427)
                     /locus_tag="Eint_101290"
                     /db_xref="GeneID:9699520"
     mRNA            complement(<168756..>169427)
                     /locus_tag="Eint_101290"
                     /product="Rrp4-like RNA-binding protein"
                     /transcript_id="XM_003073768.2"
                     /db_xref="GeneID:9699520"
     CDS             complement(168756..169427)
                     /locus_tag="Eint_101290"
                     /note="similar to ECU10_1340"
                     /codon_start=1
                     /product="Rrp4-like RNA-binding protein"
                     /protein_id="XP_003073814.1"
                     /db_xref="GeneID:9699520"
                     /translation="MKTLFLPGEDVLESDGYIRGHGTQLRGSNIASTYFGRVKITNKL
                     VSIDPISSMKYNPEVGNVVVGRVIGIHNKKWKVELSSRGDAYLGLSAINLPGTVQRRK
                     QESDEMSMRDFFDINDLVVSEVQKVNRNGTIALHTRNDMYGKLGQGLLVFAPHFLLEP
                     LRTRFLLHGNIKVIVGCNGYIWVGKTREDPMAFIEIASLVSKIKTMVSQNRYINMEEL
                     LEKNS"
     gene            <169497..>170987
                     /locus_tag="Eint_101300"
                     /db_xref="GeneID:9699521"
     mRNA            <169497..>170987
                     /locus_tag="Eint_101300"
                     /product="putative beta-lactamase fold-containing
                     exonuclease"
                     /transcript_id="XM_003073769.1"
                     /db_xref="GeneID:9699521"
     CDS             169497..170987
                     /locus_tag="Eint_101300"
                     /note="similar to ECU10_1350"
                     /codon_start=1
                     /product="putative beta-lactamase fold-containing
                     exonuclease"
                     /protein_id="XP_003073815.1"
                     /db_xref="GeneID:9699521"
                     /translation="MNVVPLGAGQDVGRSCILVTINGRTVMFDCGMHMGFNDERRFPD
                     FSYISKTKNFDKVIDCIIISHFHLDHCGALPYFTEVCGYSGPIYMTLPTKEVCPVLLD
                     DFRKIVGGKGDSIFSYQDISNCMKKVVTISMNETYKHDENFYITPYYAGHVLGAAMFH
                     VSVGDQSVVYTGDYSTTPDKHLGPASIKCIRPDLLITESTYGSITRDCRRVKEREFLK
                     AVSDCIARGGRVLIPIFALGRAQELCLLLDGYWERTGLEIPVYFSSGLTEKANEIYKK
                     FIGYTNETVKRKIFERNVFEYKHIKPFQRYYMDNKGPMVLFASPGMLHSGMSLRIFKE
                     WCEDEKNLVIIPGYCVRGTIGEKILNGAKRLEILGEEKDIKLEIKNLGFSAHADAQGI
                     LSVIEQCAPRNVMLVHGERSRMKQLKKSVEERFGIPTFLPPNGTLINIPSKNIVNLKI
                     RKGHLSSHFKPNLSKGKISLRMSLSSKKEENHIDVVDCEDYIEDDG"
     gene            <171112..>172761
                     /locus_tag="Eint_101310"
                     /db_xref="GeneID:9699522"
     mRNA            <171112..>172761
                     /locus_tag="Eint_101310"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073770.1"
                     /db_xref="GeneID:9699522"
     CDS             171112..172761
                     /locus_tag="Eint_101310"
                     /note="similar to ECU10_1360"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073816.1"
                     /db_xref="GeneID:9699522"
                     /translation="MEKEDFRWFEGDGETEAEEFVPAPNRVSSVSYVIDAIGGIFYSI
                     FVLSLVARVTTYVFGLKLLVFSVDLNVVFLSITVVSLLFIVLAIARETMTFMALTLGM
                     VENSDACAKLQRLVMVSVWFGLSAYWIKYVGTAYGHNFYIIKKVFMSGMITSAAYSIV
                     TIAMAYFESFFLKKTLKRKLDDVQKTERIVYAMKNYRYDISESGGGPTPECTCRDLFC
                     FRTAATVGSRETGRNGGEEGFHMFTGGLLINAPEIRGIMDAKTLARDVFFKASGGKDV
                     LSYEDFSAIFPGAQDAQNAFSFFDSNHSKVISKKEFHDTTIYFYMERVNLEKAIMRAE
                     DFIGIILGTLNVITGVVLCFVYLMIFGVPLQELFALILSGSLAFSFIASGIATDMYHN
                     FMMLASHPFDIGDDVIIDGADYRIYEFGLTSTSLIGENGGKVKLLNSDLRKKNLVNMT
                     RAPEKIIVFNFDLNPDIRPEEFKRFKSIIHEFIKQKPFDYDNEFSLQASTENFVSIDV
                     LSCTMILKCKSYKNKSKKFLLRVEMTSFLRSLIAEMGIGVK"
     gene            <172826..>173791
                     /locus_tag="Eint_101320"
                     /db_xref="GeneID:9699523"
     mRNA            <172826..>173791
                     /locus_tag="Eint_101320"
                     /product="inositol polyphosphate-5-phosphatase"
                     /transcript_id="XM_003073771.1"
                     /db_xref="GeneID:9699523"
     CDS             172826..173791
                     /locus_tag="Eint_101320"
                     /note="similar to ECU10_1370"
                     /codon_start=1
                     /product="inositol polyphosphate-5-phosphatase"
                     /protein_id="XP_003073817.1"
                     /db_xref="GeneID:9699523"
                     /translation="MLVTVFSWNVNNREGVADAIPEILGDQKSDMILISLQEHFDSQS
                     TVAKSIQKMYPSYRMISVDRMFGLLSIVLSKERHTVERIKMGFGILGFINKGVCVTKI
                     SNGIMFISCHLSAHQENNKKRLKEIRRIFECVCDSESVRNVKTVILAGDMNFRIAGGS
                     RSLDYLKSGKDDQCNEFKRAYPMFLEGMIDFKPTYKYIAGTDELCKKRHPSWCDRVFV
                     SSSYVKFNTYDSAYEVKISDHKPILCALEVSDKKTSRAAIPMIGYSGHHVIRGLTRFY
                     CIVHEYRNAVSALLLIIMLYLMLSRFKTISRLRNPFRVFYPEADC"
     gene            <173832..>181073
                     /locus_tag="Eint_101330"
                     /db_xref="GeneID:9699524"
     mRNA            <173832..>181073
                     /locus_tag="Eint_101330"
                     /product="ubiquitin-protein ligase"
                     /transcript_id="XM_003073772.1"
                     /db_xref="GeneID:9699524"
     CDS             173832..181073
                     /locus_tag="Eint_101330"
                     /note="similar to ECU10_1380"
                     /codon_start=1
                     /product="ubiquitin-protein ligase"
                     /protein_id="XP_003073818.1"
                     /db_xref="GeneID:9699524"
                     /translation="MEERFEWRWMGSPLEEKLHEYIRSMVEEEDLDCLAKKITAYFDI
                     WPFKEFSLRCWRILSDKLIDIISSLEKKYFSEGIQMFKMSEEDKSLLIGIFKLFQRIF
                     GYSRQRHPLDVSTQVMKFIYAMDLDVVIEAHKMLVFCLNYSIGLDEFSDDHDILFKCL
                     GINSELNGEKILSLSEKAFVSIPKDLEGEDVFWTLKKNVDEYGRGNLVFELRQRINNE
                     NRDGLNVLKVLGTCIFLILAKGEGAFDEIVEKIDFGEIWRFAGEELSENMEFAIMNLL
                     DILIYDEFDFGRISRILELSNTKGFFYKRFVNGFDEWTFERHMVFLIYNTLVGSQKTK
                     YLKMNVLMEVLPKFHECSPDVRYHFLRTVRMHCKETNSRGTAEFISRNGVGILTEYLR
                     HAEKYDVNENVNLKYSLKILSEIYMDERNRGVVGNFEDSPFLDVIVATIQKLCLFDSR
                     IVSVCIGILSSFMFEEPLNLPIFMERGVNVVLKTQLSVEHTLEYVSAFVSYIDAFSLN
                     LSFQKEISHGEYLFKLLVLCREEEFLGSMSNTNKMVSLLNVLIMHHPIFKEDILKFYR
                     FEIGYLKNLFSEESSSLLVEKEYCIEIFNNFFSLVEKMEVYPEEKDADGFFNNVFDLV
                     TNPAYSCNMQNFFKGSFGEVYRTIYRESRTSLDKPFEQLISDTMKIIELSRMSEEQDT
                     RDWKKAMKMEQWCGAEADELIFSYESQISLACILCEDFMELIDNGVKTRLFKAMADLY
                     LMLIRFSGAFISISNFEEHRFLSTYRSIRLKLEESTTKESIRLHLLQSVYLCNLFLLQ
                     RMYLLEIKDSFDKTLELVERLVEVMALEGDDSITLGLRAIERLSKNFGKEHYEAISRE
                     WFIKSLLKPHSRSDRLIAVINFLSSQLSSKINSDPKLRSMLLEYLEEIDISVSSDLRK
                     VELSNMVIEAIGRIFGDGGSLSDDEMEMIFRIYERFYISPLCSRLMIKRMIRLPRFTM
                     RLVRIKAFPTFQYFLMKDEKVYEHACFIVNRFFEYSDEFIEMASNVLLFGTVGRCPHR
                     IDIKEIGKKISGLVMSEVSSPKVLFFLIMYFRLLHRLGMPRHCGFDLGKLISRVKTCD
                     EMTLMRILISYIITPDIDSILERSGIPSRRIRSKDREFLKSHDFLIYRDYDLFVEKCL
                     KKSGLGPIDGICFKHGCNRTFSLKGEEISVSDKEIDCSKTFIRKLVLLLDTQEYFGMV
                     IQLLCEMMFNHPSLLHDICRYQVLDIVYERCIRKMDVSSKHKVTGELHWGIMLFVIGL
                     YSEVLLSKSSTGSEKKSETEQENTRKSLPSVSDFLLEKIKDGSNEDFLNVSFILVRSL
                     TPLFILRHEDEEDTTMERFREISIFMGSVGIFEKIIKRIIAVDESDPKYITCIQCSLD
                     YLGRVFRHCYGDILQDLDDYGDDESREIEYYSLVSEDHGFEESIFDSDESYFFDDPPF
                     HEIEEERAMESDEAESSSQSENTVFIKSIENDHEMPTEMYLISSEYYNISAESRTEIE
                     ALMCRKLYVDLIDSSTSCYTWMVNNFQKSIVCELREPSVHCKEPERSLNEDDKDEGYV
                     TDGEEKMIWNFEPTNDEDNLEDTNEALDTSNPPDREEIEEENEDVGSSESDVGSQNGE
                     IPTLDPDNLNRMEEDELNEVLKAYFDERRSLSLTYIPLHTGFYERLSSRVRPMFEEME
                     RVYRESFFYDIRTESTKESDEEIMETKENLLEMDLSTFEEFIKKSIVEKDFPFAKSWK
                     LVDALSKDTKMKSVVFKVSNSMISSISSSQEGDLNNYDAVKFRRTLCFLLSIVKSSIR
                     YYGYFRENPEIVRKVFILLGKVKLTNDLLRLVTDFSVIFRKDKDFVFGQDIDLENILG
                     CFGRMVDSECFNLLEEFMENTADHFGPRFLDIILVEIKQQFSILSKDIGKEFPSDAFL
                     ESQKIFLRLWKMMTKVIGRSNLCSEERDIALLSLMLNPLWNVFFENQKNKESIEDLIN
                     VSDIYEAFFVVGKVFENRFGETENTGCAEMCNKFQTFYKKIIELRAKQINLLADERPE
                     KLFRNFNSLISHSILTFSNKKKYLSRMLSVEGVDKSSSFYRVYVDRNDVLRSSYFQVM
                     AKSPEEFRTRRLEIKLTGEEGLDYGGLTREWLVLLSKDFLDPNFALFEFSTEDKTVAV
                     PCKNSYVNPEHLSYFKFVGRIMAKVIMDGNFINLYLPKFIYKHILGKSCDLQDLESAD
                     PEFHKSLVWIRDNSVGKSLGLTFSFDDVSFGVHRTVELVKGGANIFVDDSNKEEYIKL
                     ATQYRLFDGVELQLSALKSGLFEILGNRALEMFDENELELLICGIPDIDIDDWKSNTL
                     YYGYTESSKTVIWFWKAVKSFDSVNRARLLQFVTGTSTLPFEGFSHLQGNNEIQKFSI
                     HKISDRTDSLPTAHTCFNQLVLPEYSSYESLLKYLMLAINECSTGFGFI"
     gene            complement(<181095..>182582)
                     /locus_tag="Eint_101340"
                     /db_xref="GeneID:9699525"
     mRNA            complement(<181095..>182582)
                     /locus_tag="Eint_101340"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073773.1"
                     /db_xref="GeneID:9699525"
     CDS             complement(181095..182582)
                     /locus_tag="Eint_101340"
                     /note="similar to ECU10_1390"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073819.1"
                     /db_xref="GeneID:9699525"
                     /translation="MMPEIPSILPKLKKCAELSREIESQANTLSSLMERLQLSAVDGF
                     RPYINPKKNISRLLTFLDSFMSTKEIIEEEKSKLGEVFGESEKRFLPRDLKLLQEKKA
                     IESTRRLIDMGEVLKEYKGVKIVDTEIDILDDFVKRAIDGIEESFFVSLKRVPEYKPE
                     FRVFATFLLSNGNERRFISKYTDTVYSTLGFDDIGMNTELLIERTSHLDKFLLDVIEM
                     NDNVLGKENSKITNIGLLKMFVIGLKRAIADNLLKMEKEEDIANIGLLIILDSQLKYS
                     GDKRIRVVEELFVFKDSIHKIMCNSILKYFEDLDMIMEPNKYCNTEELCMKMEKALEA
                     FYDNKDVSKVFASEYGKDFELETVQDIFEKFSTKTMEKILFLAETLRGIPKSVYVVNN
                     IYIFRNYLKSLEGIPIEKMIEINVEDILNVWKKEISKRTEEDITFFLDKNIENQSRYR
                     LPTELGEKLAADIQNLVNDALKDKKYTGNTEKLKESISKLYQDSK"
     gene            <182703..>184388
                     /locus_tag="Eint_101350"
                     /db_xref="GeneID:9699526"
     mRNA            <182703..>184388
                     /locus_tag="Eint_101350"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073774.1"
                     /db_xref="GeneID:9699526"
     CDS             182703..184388
                     /locus_tag="Eint_101350"
                     /note="similar to ECU10_1400"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073820.1"
                     /db_xref="GeneID:9699526"
                     /translation="MVDFGASKKTLLTGFILMAYSDILNNRTYDLVGVDQGYTTFKGY
                     HYNAEKDMYDEVFSHKHKEKIHLVIPADFTGTGNVSYILVSKKGPEKFNIYIYFRDYD
                     ESRYLGESITVPLLYACPDDLRPQLLVQYSDGLKKIRIDESGNMIKEPADEYGKLHKE
                     HTSAFVEVDGSMKACLCLVLDDGHGGRLLRILSNRNGEFINYFEMKLPDEIGPIVFGD
                     FNGNGMNDMAFVQKNGEKYLLKIYFNTTSRVGDGDKRLLGGFLPHQIDSTIFSEGNMK
                     VIDLSEEFPNCTPVIRSEDHFEGLPYGIFNADLRAKGRQDFFIIMKDIDSSIRIGVLE
                     NNSNPDDIRLGKAEYNEDIFGLKNIISISCCDYNNKGREAVFLNRVVDNNAVVEAYKN
                     DLSKENLKLSLSTIHPGLQKYGSVVPGVSYLVSYGDGERIIISNQTPYSTFVHLKHQV
                     AYIGLGTMNLIVDSLMIGTPGKNGSPYAGPYVIDSIAIPNTDLVVYLEENEKYTVEAH
                     FIVGDHFKTIIGTLLIVAGVNLAFILLLQYRDRRRIIKAKNMDKLHPLFSTLQ"
     gene            complement(<184459..>186012)
                     /locus_tag="Eint_101360"
                     /db_xref="GeneID:9699527"
     mRNA            complement(<184459..>186012)
                     /locus_tag="Eint_101360"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073775.1"
                     /db_xref="GeneID:9699527"
     CDS             complement(184459..186012)
                     /locus_tag="Eint_101360"
                     /note="similar to ECU10_1410"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073821.1"
                     /db_xref="GeneID:9699527"
                     /translation="MKERHRILLLSGLILFSFYFVYDIPSALSHHMDFGSESGIEYKI
                     TLLYSVYSLPNIIVPVFFGWITHVRKSTMAKLLCAFVFLGHLIFTIGVWNHSFKIMLI
                     GRFFFGIGGESFAVIQNKLISYEFKGKELGFAMGIFSCIARMGTVANFLVTPFLADYI
                     GKMFPCVVGIFLTLLGLWVCLRINNSERSHKVLKQKLIELQKNGFGDEVQEEKMYPGE
                     GFLEESDSGFLLKASDPTPRDASNSLSIPENPFFYDYKESKPKELLQTDPILFENPFS
                     PWKADGKETTSIKSRLEKGKPKVLFEESGILFYEPRLEGKNTHHSAFYVLVGMSFLFA
                     LVWAPFYTIAPMLFQKRYGLSPVSSGNVLAIIEGISLVLVTFTSAITDAYGLKLWLIG
                     AGCILFLLGHLGIFFNFLSPYASATFLGFSGPLIACYWPCIPSLVSEESLGTGFATIY
                     CILNLAFTFSPIAVAFLASGDYSYDNVEIYILSVGMLAFSLVGLLFYLNKKQSLGLNR
                     KTLTEMETE"
     gene            complement(<186137..>187342)
                     /locus_tag="Eint_101370"
                     /db_xref="GeneID:9699528"
     mRNA            complement(<186137..>187342)
                     /locus_tag="Eint_101370"
                     /product="26S proteasome regulatory subunit 6A"
                     /transcript_id="XM_003073776.1"
                     /db_xref="GeneID:9699528"
     CDS             complement(186137..187342)
                     /locus_tag="Eint_101370"
                     /note="similar to ECU10_1420"
                     /codon_start=1
                     /product="26S proteasome regulatory subunit 6A"
                     /protein_id="XP_003073822.1"
                     /db_xref="GeneID:9699528"
                     /translation="MSLEELEMMDQSNPEEFLEKVREKIRMLNSETRILQSRVNTIKH
                     DISTKNASIAENMERIRLNKQLPYLVGNVVEVLDNQSAVVNASTRMSSYLPITGLIPN
                     SELRPGDLVALHKDTNIVFEKLPPDYDMKVGGMVLKSDAKPDETYEDIGGLERQIEEL
                     NEAIVLSLTHPERFEKLNIKPPKGVLMYGPPGTGKTLMARACASKTNATFLKLAGPQL
                     VQMYIGDGARLVRDAFALAKEKKPTIIFIDEIDAIGAKRSDSDQTGDREVQRTMLELL
                     NQLDGFSSTEEVKIIAATNRVDILDPALLRSGRLDRKIEFPLPNALGRKRILQIHARN
                     MSVRDDVNFDELARSTEGFNGAQCKAVCVEAGMAALRREKTEISQNDFMDGIQEVLSR
                     KKSKLLYFT"
     gene            complement(<187414..>188622)
                     /locus_tag="Eint_101380"
                     /db_xref="GeneID:9699529"
     mRNA            complement(<187414..>188622)
                     /locus_tag="Eint_101380"
                     /product="bromodomain-containing transcriptional
                     activator"
                     /transcript_id="XM_003073777.1"
                     /db_xref="GeneID:9699529"
     CDS             complement(187414..188622)
                     /locus_tag="Eint_101380"
                     /note="similar to ECU10_1430"
                     /codon_start=1
                     /product="bromodomain-containing transcriptional
                     activator"
                     /protein_id="XP_003073823.1"
                     /db_xref="GeneID:9699529"
                     /translation="MDSVETNLFGLERNQTWRNEKEMLYAKFKNGELKAVVVSSSDPC
                     VDKILLLRTKYLFQNQLSKMPGEYILRQVFDTKHANLVLLNSVGEVVGGICYRPFFER
                     NFVEIVFLAVDYDFQVKGIGGFMMDLFKEVIKEEIRSYFEKPSNGLSGSPKQKNRVIE
                     DLTPLLCRTPESNAPSLYLVTYADNFAIGYFKKQGFTTEIRFGGWIGFIKDYEGGTIV
                     ECCVLWEINYLKKQEIIQDRKRKLFEEMKKVNEYHIIRKIDDYSEIKDVNDIPGVLNA
                     RYSAEETNDQRCQDRFISYLISDLCINAYAWPFLKPVDPKEVPNYYKCISKPMDLSTM
                     SSKLKNNEYKFIEAFVEDVNLMVNNCFTYNGKDTQYYKCAQKLLNHFNRRLEFYKHVV
                     DKLPKKKEIN"
     gene            complement(<188657..>189355)
                     /locus_tag="Eint_101390"
                     /db_xref="GeneID:9699530"
     mRNA            complement(<188657..>189355)
                     /locus_tag="Eint_101390"
                     /product="membrane associated phosphatidic acid
                     phosphatase"
                     /transcript_id="XM_003073778.1"
                     /db_xref="GeneID:9699530"
     CDS             complement(188657..189355)
                     /locus_tag="Eint_101390"
                     /note="similar to ECU10_1440"
                     /codon_start=1
                     /product="membrane associated phosphatidic acid
                     phosphatase"
                     /protein_id="XP_003073824.1"
                     /db_xref="GeneID:9699530"
                     /translation="MTREMLAITIVSIGLLFLSSTVEPYERPFNVNDRSISKSYLYHD
                     TITFVEIAAISILAPLGIMFGTFRINIVKRVDEIYFYMSFLVACLFTSAIVENMKNVV
                     GRLRPDFLDRCIPVGGKCTGDPSIVMEGRKSFPSGHTSIAACGFMFLAFFIYKELSLP
                     ELRAKVNRGIVFMLYSLFLMVPIAVGASRVIDNKHFASDVVGGGIIGALAGIARLKHL
                     ETTIVAERYKRNEG"
     gene            complement(<189430..>190038)
                     /locus_tag="Eint_101400"
                     /db_xref="GeneID:9699531"
     mRNA            complement(<189430..>190038)
                     /locus_tag="Eint_101400"
                     /product="proteasome subunit beta type-6"
                     /transcript_id="XM_003073779.1"
                     /db_xref="GeneID:9699531"
     CDS             complement(189430..190038)
                     /locus_tag="Eint_101400"
                     /note="similar to ECU10_1450"
                     /codon_start=1
                     /product="proteasome subunit beta type-6"
                     /protein_id="XP_003073825.1"
                     /db_xref="GeneID:9699531"
                     /translation="MFNKKEMTGTTIIAIKYDDGVLIGADSRTSMGAYIPSRVTDKLT
                     PITNNIFVCRSGSSADTQMISEYLKMYLTLYSHLESSIPLVQRAATLASKIIYENPSL
                     LAGLIVAGYDDKPRIFNISLGGTLVECDWAIGGSGSAFIYGYCDVNWKNGMSLEEGIG
                     FIKNAVSCAINRDNASGGCIRMSAISRNGVQRYFYPGDKVLQ"
     gene            complement(<190111..>192201)
                     /locus_tag="Eint_101410"
                     /db_xref="GeneID:9699532"
     mRNA            complement(<190111..>192201)
                     /locus_tag="Eint_101410"
                     /product="glutaminyl-tRNA synthetase"
                     /transcript_id="XM_003073780.1"
                     /db_xref="GeneID:9699532"
     CDS             complement(190111..192201)
                     /locus_tag="Eint_101410"
                     /note="similar to ECU10_1460"
                     /codon_start=1
                     /product="glutaminyl-tRNA synthetase"
                     /protein_id="XP_003073826.1"
                     /db_xref="GeneID:9699532"
                     /translation="MLNLEEVFEKLEISSEKRHEVMKKEQVVKNMEKIFSGRSFSNRL
                     LYTLACTASRNANVELLANLIESGTIKNESMLKECLKHMGKKEVSAEEMVSFVKSNEV
                     DEESIKNNIAKMRREGLSKKDMLSKARNTMPCADFRIVMEEINKIPDDVEEHEENLEG
                     GDWLEEGEIRKLPKPGETPQVSEEIRQAHLKRTGGRVVTRFPPEPNGILHIGHAKAIN
                     LSFEYAKKFGGYTYLRYDDTNPKNEEVEYFDSIYEDVRWLGFEPYKVTASSDYFDKMV
                     EFGFQLIKKGKAYVCHLSQEEICERRRQYTSDNMNERSHLSQYRNRSVEENLRIFQEM
                     VDGKWEEGTACLRFKMDTNTKNPLMLDLIGIRILNAVHPMKKVRYTVYPTYEFALCVS
                     DSLEDVTHSFCTREFFTRQESYHWLLDQLEIYKPIQWEFSRLNISNTVLSKRKLVPLK
                     KYGIELDDPRLFTIKGMRRRGFPPEAINEFCKSLGLTFAETIVDVKKLENFVRDNLNR
                     TSRRIMCVRDPLKVTIMNAEPCSVSIPDFPGSEVSRNVPFTPVIYIEKSDFMDKGDGD
                     FLRLTLDQPVGLYMLYPIRVVKVTEDGILAERWDGIPKKFIHWVSSDCVRVEMRMYSP
                     LWTSFSPKDSTYLEEMNKDSLKIVHGLCDKRISEAGVEDRFQFQRIGYFCVDRDTTEE
                     NIVVNLTLPLKNIV"
     gene            complement(<192245..>192409)
                     /locus_tag="Eint_101415"
                     /db_xref="GeneID:20314099"
     mRNA            complement(<192245..>192409)
                     /locus_tag="Eint_101415"
                     /product="hypothetical protein"
                     /transcript_id="XM_009163643.1"
                     /db_xref="GeneID:20314099"
     CDS             complement(192245..192409)
                     /locus_tag="Eint_101415"
                     /note="similar to ECU10_1465"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_009161907.1"
                     /db_xref="GeneID:20314099"
                     /translation="MYDNNKKIKRILEIVNILLRRAEKRRKAIIDEIRAVDEYLKELE
                     QRKKRLTRHD"
     gene            <192807..>193262
                     /locus_tag="Eint_101420"
                     /db_xref="GeneID:9699533"
     mRNA            <192807..>193262
                     /locus_tag="Eint_101420"
                     /product="homeobox domain-containing transcription factor"
                     /transcript_id="XM_003073781.2"
                     /db_xref="GeneID:9699533"
     CDS             192807..193262
                     /locus_tag="Eint_101420"
                     /note="similar to ECU10_1470"
                     /codon_start=1
                     /product="homeobox domain-containing transcription factor"
                     /protein_id="XP_003073827.2"
                     /db_xref="GeneID:9699533"
                     /translation="MSRLPNLASSRMNEIRKVYIEANNRIVEEIDAVTEKFSKEVETI
                     PNISASVRIYLEEKIRSIREFVVDSIGFSIGEFRALYNPDGNESIKTRRFPKFITEAL
                     ERSFEIDQYPSEAEKSRLAKICKLSTKQINNWFTNKRNRSKSHDGGRQY"
     gene            <193799..>194368
                     /locus_tag="Eint_101430"
                     /db_xref="GeneID:9699534"
     mRNA            <193799..>194368
                     /locus_tag="Eint_101430"
                     /product="TALE/PBX transcription factor"
                     /transcript_id="XM_003073782.1"
                     /db_xref="GeneID:9699534"
     CDS             193799..194368
                     /locus_tag="Eint_101430"
                     /note="similar to ECU10_1480"
                     /codon_start=1
                     /product="TALE/PBX transcription factor"
                     /protein_id="XP_003073828.1"
                     /db_xref="GeneID:9699534"
                     /translation="MNMIMDILNQVMYAEECYFSNRVSREKLMEDIRRLRSEYEIGIM
                     RDSGREGIKFKMALLFILRRVRHKIILEDRLMEMIDSEVAFVRGCVSSIISEPFGVKP
                     VETMRPTQQEAETRCAKPRTRANFPMDTSQLLRSWLKENMDNPYPSDAEKAYLCQKTG
                     LGPAQINNWFINARRRILPFMKGKRASFK"
     gene            complement(<194690..>195838)
                     /locus_tag="Eint_101440"
                     /db_xref="GeneID:9699535"
     mRNA            complement(<194690..>195838)
                     /locus_tag="Eint_101440"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073783.1"
                     /db_xref="GeneID:9699535"
     CDS             complement(194690..195838)
                     /locus_tag="Eint_101440"
                     /note="similar to ECU10_1490"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073829.1"
                     /db_xref="GeneID:9699535"
                     /translation="MEREFDFIIYGASGYAARYIIEAFKAENVRLALASRNISKIKDK
                     AFPVYECKIDNIDEIASMTKVLINCVGPYSIHGECIVKSCIRNGTHYMDISGEVYFFE
                     LIINKYHDEAVRKGVYIINCCGFESVPSDIGVMYLRDMFEYYVEIESVLKVSNVVVNL
                     TTWESLLASVANFREMNALREKRYGQGKKRRSLRVVKKNSYQVIFRGIDYSVVRRSQE
                     LMESIGINGAKYSAYLDVGGRIEMIKYRILAWVIWLFSGFSFGRWIITSLAKMFAFRT
                     IKRRPSFEEIRNADFTIEIRARGEKGNEIVGKLLTITGPDPAYIVTSVCLTQTAVTFL
                     RSLNQKERGTGVTLFRGGVITPACVLYNTDIIPRLSSKGIKFELKESS"
     gene            <196062..>197474
                     /locus_tag="Eint_101450"
                     /db_xref="GeneID:9699536"
     mRNA            <196062..>197474
                     /locus_tag="Eint_101450"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073784.2"
                     /db_xref="GeneID:9699536"
     CDS             196062..197474
                     /locus_tag="Eint_101450"
                     /note="similar to ECU10_1500"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073830.2"
                     /db_xref="GeneID:9699536"
                     /translation="MDGLSGKDKDKMSGKKEKEVGTPISAEGSNGEGEESFESDVMKH
                     VIGAACMLSHKSSDEDVTECSEEKISTFDVYIVNEDGKVNGYELKHIGPAGGVECSNS
                     PQSSPSNEMIRSRSFHFDRKNKGLPPQEFYRRKKSSEQLPWKINGNCSNGSKEKCEPI
                     ILEISEISDGYSVDGTDEHQDINASVCSQDTGSSKISLKCENETSNTFVDLNFSNRQE
                     TSEKSDCRGLQSDKGSQDEILLPFPSQDKDYTSSGSASPESRNGPSRNSDLEKIALSI
                     VKITEPGESGKEKEHESDAPKAMGNIIKAIQAQESEDKLVINQKIGLNSPCPINEEKC
                     LGEDAMMTSEDLSRELKTALLAAFIPSMETSEMSETSEKSFVETSITRNIGGKPDSTE
                     EVEKFRTVLNIGDSVPPLLDVKDLAGKKGKDDEMIIFVEAEDIGKKRNVATRNNRVGR
                     LVKFFESLEERNKERDPKEE"
     gene            complement(<197554..>197910)
                     /locus_tag="Eint_101460"
                     /db_xref="GeneID:9699537"
     mRNA            complement(<197554..>197910)
                     /locus_tag="Eint_101460"
                     /product="putative zinc finger domain-containing protein"
                     /transcript_id="XM_003073785.1"
                     /db_xref="GeneID:9699537"
     CDS             complement(197554..197910)
                     /locus_tag="Eint_101460"
                     /note="similar to ECU10_1505"
                     /codon_start=1
                     /product="putative zinc finger domain-containing protein"
                     /protein_id="XP_003073831.1"
                     /db_xref="GeneID:9699537"
                     /translation="MLPKLNVPTRLNKSYLLEYRVHKIVPKTTPKPREVERSASNYRT
                     ILCKFFLMNSCKHGDNCTYSHDTSKFPCKAFHIKGNCTRKDCPFSHEPPTDKEMEEII
                     SEKQEESTSFFKSTLL"
     gene            <197986..>199044
                     /locus_tag="Eint_101470"
                     /db_xref="GeneID:9699538"
     mRNA            <197986..>199044
                     /locus_tag="Eint_101470"
                     /product="mevalonate kinase-like protein"
                     /transcript_id="XM_003073786.1"
                     /db_xref="GeneID:9699538"
     CDS             197986..199044
                     /locus_tag="Eint_101470"
                     /note="similar to ECU10_1510"
                     /codon_start=1
                     /product="mevalonate kinase-like protein"
                     /protein_id="XP_003073832.1"
                     /db_xref="GeneID:9699538"
                     /translation="MDPKIEFRVPGKVIVNGSYIVLEGETCRAIALKEYMISEAIRME
                     SSKQKIVVEVEGQEKITYYHNRSDLPEDKGKSSYYLLKVVDSFFEVTGIIPKNQIQIR
                     MKAGNGFFVNGPTSEKTGIGSSVCILVSIVYALLKFHQEDLNQIISLKGFERWGRSPV
                     FRGNLESHLGHLSLSKEILNHLLSITYQVHQKTNQGGSGSDAMCCLLGSIYSNREACI
                     PIEKVPRYLILGSFGKSTSTREMLKKIDLSDSKWKSLKDMNSRINKERRNPKKLYIEY
                     LNIIRNISTAIVPEKQYEILIKTNEYDIWGCGISGAGGDDCVWVLTDDYKSVYEYWQK
                     AFAFTFITEVSYKGICLL"
     gene            <199196..>201223
                     /locus_tag="Eint_101480"
                     /db_xref="GeneID:9699539"
     mRNA            <199196..>201223
                     /locus_tag="Eint_101480"
                     /product="White ABC transporter"
                     /transcript_id="XM_003073787.1"
                     /db_xref="GeneID:9699539"
     CDS             199196..201223
                     /locus_tag="Eint_101480"
                     /note="similar to ECU10_1520"
                     /codon_start=1
                     /product="White ABC transporter"
                     /protein_id="XP_003073833.1"
                     /db_xref="GeneID:9699539"
                     /translation="MQEKDLGPIVGYNLELKDIFLEAPNKDLSSSTKYVRLINGISTT
                     FESGKLSVIMGPSGSSKTTLINLIVGIIQENSKVSGNVLLRGKSRNPKTWLTQVAYLN
                     QDDCIVPYITIHEYIYFCVSCRTTKKQRGGRSINEIINKVMKKLHIEDLKDVVMTAIS
                     GGERKRVMIAVEFAVSPEVLILDEPTSGLDSHLAFELIQMIKEYAVENNKIVITTVHQ
                     PGPGLFDMFDYLLFLNKGSLVYSGSADQCERFFDSKGIHRVGNLSVSEFLFELFSGQS
                     YISGIEEYREAINKMIESAVQEGDLKIENKTMSQISGSVVKLPFSFSKALKIAKRKWI
                     MEWRSWRMMRNWIFEIVFLFVYVYFLYPMIFSIEFLNFKNLLNLNINERDETESVFRW
                     LIGSLKSMIDESLVGNVDEAIKWEICSFLLITLSLFGSTDILDGLNYVHRETSKATYG
                     ISTLYFSTWIAETPITILKCFVFLGISSSIGIHGGNTFELITYIIVGSLLILAFDIMM
                     RSITSSSAFRKFLSMITFIFLTSLTPEISYTFTKILSVPSAGNLRLLKLLKYPSILLW
                     PQIFFQGFMRLSFFERVMFPKEPNEKFTFIYKAIMGSIVTPRLYDLHLSDEENREKLL
                     NPQTRFLVDQNYSKYILLPLGATSLIIVILLSNYFLVRRFSPRLQLNLSNK"
     gene            <201261..>201593
                     /locus_tag="Eint_101490"
                     /db_xref="GeneID:9699540"
     mRNA            <201261..>201593
                     /locus_tag="Eint_101490"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073788.1"
                     /db_xref="GeneID:9699540"
     CDS             201261..201593
                     /locus_tag="Eint_101490"
                     /note="similar to ECU10_1530"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073834.1"
                     /db_xref="GeneID:9699540"
                     /translation="MESLILWDGRSICGLKKIPKTILIVDEYNTITPEKKSKIKDSVA
                     EMDIDFEEEATRYSLVILCNTVLRFNLKNPLVLAECEIWFTRKTFSSKVFEDALIHYS
                     ECEIRNGV"
     gene            <201601..>202062
                     /locus_tag="Eint_101500"
                     /db_xref="GeneID:9699541"
     mRNA            <201601..>202062
                     /locus_tag="Eint_101500"
                     /product="ubiquitin conjugating enzyme E2"
                     /transcript_id="XM_003073789.1"
                     /db_xref="GeneID:9699541"
     CDS             201601..202062
                     /locus_tag="Eint_101500"
                     /note="similar to ECU10_1540"
                     /codon_start=1
                     /product="ubiquitin conjugating enzyme E2"
                     /protein_id="XP_003073835.1"
                     /db_xref="GeneID:9699541"
                     /translation="MNPREDSSFAAFRLKTEIESIQLLPGSLLNVDRSSEDKYAMEIK
                     YSMMITEGIYKNRLFRFKIKIPHAYPFKPPKLLCLDKVFHPNIDDDGNVCMEILRLGW
                     RPSHGLESILVNLYVIFVEITGEDALNTQAGDLFKLDYERFVRIARGQERI"
     gene            complement(<202078..>202380)
                     /locus_tag="Eint_101510"
                     /db_xref="GeneID:9699542"
     mRNA            complement(<202078..>202380)
                     /locus_tag="Eint_101510"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073790.1"
                     /db_xref="GeneID:9699542"
     CDS             complement(202078..202380)
                     /locus_tag="Eint_101510"
                     /note="similar to ECU10_1550"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073836.1"
                     /db_xref="GeneID:9699542"
                     /translation="MEASINLWKNSSLKGTLNRIFKEEVHGPLRVLISPNNIGVVLLD
                     PKSSYQFVEKTLNKKILKNLDFIVVDGHKASLPFDFVLKEVSEDAKEEYAAIIHKR"
     gene            <202419..>202688
                     /locus_tag="Eint_101520"
                     /db_xref="GeneID:9699543"
     mRNA            <202419..>202688
                     /locus_tag="Eint_101520"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073791.1"
                     /db_xref="GeneID:9699543"
     CDS             202419..202688
                     /locus_tag="Eint_101520"
                     /note="similar to ECU10_1560"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073837.1"
                     /db_xref="GeneID:9699543"
                     /translation="MDLSGMNRLFEVLDKIKNKVEKEERPPNPKEALERELHKLYLCI
                     SLEICKQKLQGSVGKEVLDKVKEIKQYFKHIENIRGKDRNDPVQK"
     gene            complement(<202697..>203122)
                     /locus_tag="Eint_101530"
                     /db_xref="GeneID:9699544"
     mRNA            complement(join(<202697..203089,203120..>203122))
                     /locus_tag="Eint_101530"
                     /product="ribosomal protein S24e domain-containing
                     protein"
                     /transcript_id="XM_003073792.1"
                     /db_xref="GeneID:9699544"
     CDS             complement(join(202697..203089,203120..203122))
                     /locus_tag="Eint_101530"
                     /note="similar to ECU10_1570i"
                     /codon_start=1
                     /product="ribosomal protein S24e domain-containing
                     protein"
                     /protein_id="XP_003073838.1"
                     /db_xref="GeneID:9699544"
                     /translation="MSLELEISGLKENKLLSRKELDVVAYHPGMPIPSREEITDKISE
                     LYQTSKKNIVVGNLKNRYGTHRTTLRAKIYSNAEVLSSVEKKHVVAKITGKELQITPR
                     RVRKDERKKRYKIFGTIKRAMKKAEKKNK"
     exon            complement(<202697..203089)
                     /locus_tag="Eint_101530"
                     /number=2
     exon            complement(203120..>203122)
                     /locus_tag="Eint_101530"
                     /number=1
     gene            <203211..>203426
                     /locus_tag="Eint_101540"
                     /db_xref="GeneID:9699545"
     mRNA            join(<203211..203213,203250..>203426)
                     /locus_tag="Eint_101540"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_003073793.1"
                     /db_xref="GeneID:9699545"
     CDS             join(203211..203213,203250..203426)
                     /locus_tag="Eint_101540"
                     /note="similar to ECU10_1575"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_003073839.1"
                     /db_xref="GeneID:9699545"
                     /translation="MATITINKAGKVRNQTPKDPVVEKERKKCGRCRQRLKFEKRNEM
                     GYFDVMGKMKLNPQS"
     exon            <203211..203213
                     /locus_tag="Eint_101540"
                     /number=1
     exon            203250..>203426
                     /locus_tag="Eint_101540"
                     /number=2
     gene            complement(<203595..>204005)
                     /locus_tag="Eint_101550"
                     /db_xref="GeneID:9699546"
     mRNA            complement(<203595..>204005)
                     /locus_tag="Eint_101550"
                     /product="small nuclear ribonucleoprotein D2"
                     /transcript_id="XM_003073794.1"
                     /db_xref="GeneID:9699546"
     CDS             complement(203595..204005)
                     /locus_tag="Eint_101550"
                     /note="similar to ECU10_1580"
                     /codon_start=1
                     /product="small nuclear ribonucleoprotein D2"
                     /protein_id="XP_003073840.1"
                     /db_xref="GeneID:9699546"
                     /translation="MFLPNNPDNPGEKESMEMKGPLSLVRRAMVKMIPVLISLRNNRK
                     VTGKVVAYDRHYNLLVREAREFGTARGRNKGRKKRQGSEFSRKLGNVFIRGDTVILVA
                     VGAEAEEPEKNSMENDEKKNTDLTQEECQTNSKV"
     gene            complement(<204063..>204899)
                     /locus_tag="Eint_101560"
                     /db_xref="GeneID:9699547"
     mRNA            complement(<204063..>204899)
                     /locus_tag="Eint_101560"
                     /product="choline phosphate cytidylyltransferase"
                     /transcript_id="XM_003073795.1"
                     /db_xref="GeneID:9699547"
     CDS             complement(204063..204899)
                     /locus_tag="Eint_101560"
                     /note="similar to ECU10_1590"
                     /codon_start=1
                     /product="choline phosphate cytidylyltransferase"
                     /protein_id="XP_003073841.1"
                     /db_xref="GeneID:9699547"
                     /translation="MMKRNDTEKYKMMAPTYPDRNTFEYEEMTSEVGMYKVPVNRPVR
                     IYCDGVYDLFHYGHARSLKQAKNLFPNVYLLVGVTDDDITIRLKGNLVMNEKERAEGL
                     IHCRYVDEVITSAPWELTSEFLQKHRIDFVAHDDIPYKGENKDDIYKFVKDMGMFIPI
                     KRTKGISTSGIITDIVRNYDVYVRRNLERGVSAKDLNISFLHMKRIKMSKKMNEMIKN
                     VDIQREIEDIRREIRIAMRYWERVSNEIISGFIENFYHGKTSGRFIDRLVEFVKLKRK
                     NE"
     gene            complement(<205019..>205630)
                     /locus_tag="Eint_101570"
                     /db_xref="GeneID:9699548"
     mRNA            complement(<205019..>205630)
                     /locus_tag="Eint_101570"
                     /product="putative meiotic recombination protein"
                     /transcript_id="XM_003073796.1"
                     /db_xref="GeneID:9699548"
     CDS             complement(205019..205630)
                     /locus_tag="Eint_101570"
                     /note="similar to ECU10_1600"
                     /codon_start=1
                     /product="putative meiotic recombination protein"
                     /protein_id="XP_003073842.1"
                     /db_xref="GeneID:9699548"
                     /translation="MATVKMKADQKKSILLEIIRTSKSFFKLQELETLGSKKGIVVNT
                     IKEILQQLVDEGLVTVEKVGTSNLYWSFASEGVQKKKLKCKELMDECKRMSEDISNKR
                     KHLEDERKSKNYTEERSRLEERLNSLEKMEEEQKKELKKFEETDPIVYDKLIGDRKKV
                     IDEYNKIVDNIFVIQDYICNKFAMEKSEFNSSFGIPQDLDYIQ"
     gene            <205701..>206966
                     /locus_tag="Eint_101580"
                     /db_xref="GeneID:9699549"
     mRNA            <205701..>206966
                     /locus_tag="Eint_101580"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073797.1"
                     /db_xref="GeneID:9699549"
     CDS             205701..206966
                     /locus_tag="Eint_101580"
                     /note="similar to ECU10_1610"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073843.1"
                     /db_xref="GeneID:9699549"
                     /translation="MMSLELTKENINAVSLELVKNKKMFDKNVNYVMGFMLKSFPEKN
                     ELLSRIKVLNIKSRSAKKIDPESDVMEQIAMNVFAIKNLDEGSFTKNMLALFRDPSSF
                     SQAFLTYFYSNLNLSTTKTDEILNGLVELLLSESKLKKSFMNFMNSIELSEDSESISL
                     EEAKSLHKASDDHTFEKIINKESYDESSSTVMSLVSLDDSEEIKRIDTSISLLFEGKR
                     EKMSMLSILVCTRVLNIIRIILENNYPRDVDVIPVLMYIAEIDQTIFKKSMSAIKIIL
                     RKTDYRDKEKLFEMFCALLERNPGIIRMAMLFVDTCGKHFNWPRFLEIIDGNEEIDLD
                     VVDRSYIPNSSFYEFILFAEDPRRYMKTIKSMIRNELDSSLLRDLKEKINGRPDLKDI
                     KPIKDAISSRLKLLSQKKCSKKERKDNSN"
     gene            complement(<207016..>207930)
                     /locus_tag="Eint_101590"
                     /db_xref="GeneID:9699550"
     mRNA            complement(<207016..>207930)
                     /locus_tag="Eint_101590"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073798.1"
                     /db_xref="GeneID:9699550"
     CDS             complement(207016..207930)
                     /locus_tag="Eint_101590"
                     /note="similar to ECU10_1620"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073844.1"
                     /db_xref="GeneID:9699550"
                     /translation="MDEFVSLLKALKKNDKITQNVLLMISESFRYNEEAVSDALIKNH
                     RSLLGKEAVLDFLFLLCSKDTRYLSLFEKYKDEFNRNHKIFKLLSGESQEEKPKRPRI
                     DEESSSSSEDMIKASINERNTLIDEEGETDSKPKEVASKKTSRSVLEEARTKNLWDKK
                     EQESDILNNEYLKTEMDPSILYYPNQCKLCGLRYKDTPEGDEQMGVHIDEHRRKARVL
                     GEKDCISREFFPTLEAWTKNIEKIKLRLEVEKVEKIVHSGGPALCDVCRSRIEVEWDD
                     QEDRWILKDAVSLEKGGRTSFCHRKCVS"
     gene            complement(<207994..>209163)
                     /locus_tag="Eint_101600"
                     /db_xref="GeneID:9699551"
     mRNA            complement(<207994..>209163)
                     /locus_tag="Eint_101600"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073799.1"
                     /db_xref="GeneID:9699551"
     CDS             complement(207994..209163)
                     /locus_tag="Eint_101600"
                     /note="similar to ECU10_1630"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073845.1"
                     /db_xref="GeneID:9699551"
                     /translation="MIIFPEEKPTKYLNDSFALKMLGAPKYNGKFDFSRKELDIPLAF
                     PFRKTAVKSKSPPQVAFMEKIDNDSVIYSSDGHFFNVLGKYKYSFRIEDTCKRLVTGH
                     QKAFILTEKHMYIYEKKKVSMFSISAIDLSTSSFGEVFVLTSKEILLFDEDGIKKVFP
                     YTGRVNFIHFYLFRELIVVGVKQVFHLNLNNLKVSTIYSTPLRIQLTILKDRLYIQEG
                     TSKGFRVTSLNIEDRTAESIFLEDFMKISVGKSMLALYKRGGEFLFCDRFDLINSKTV
                     VYEVENLIGFFFVEEKSYFFFKEKFVMWNKGCVKEIKIGLEKNRNYLVKFPDNLEMLK
                     EVYETRQTPKGVFRPGKVVSTLYEIIKQITEKEDESVKSMPKKKIKYSEKNLGGF"
     gene            <209295..>211634
                     /locus_tag="Eint_101610"
                     /db_xref="GeneID:9699552"
     mRNA            <209295..>211634
                     /locus_tag="Eint_101610"
                     /product="putative DNA helicase"
                     /note="involved in mRNA decay control"
                     /transcript_id="XM_003073800.1"
                     /db_xref="GeneID:9699552"
     CDS             209295..211634
                     /locus_tag="Eint_101610"
                     /note="involved in mRNA decay control;
                     similar to ECU10_1640"
                     /codon_start=1
                     /product="putative DNA helicase"
                     /protein_id="XP_003073846.1"
                     /db_xref="GeneID:9699552"
                     /translation="MKCQYCEVEELLIECVGCGKHFCNSRSASSISHIVFHLVKAKHK
                     SIRIGGDIKCRKCGEDNLFKLLENNGKIFCNGCSSGRMVVEERCLTIIKSPEVQGKRL
                     TKQQMAEMEEKSMASLPYVKSRFEAKEYVEVFSSLIEAECKKEREIKESMRQENVFVR
                     WEKLKYCYFYFQNGDSELKINIGDEIRLTHKSGFVLHGFVSGETFSEELKVEIETPGD
                     YPRSGYTVEYLWRGICYERMEWALRKLYNTYKKETDKIKRNKNKNDERKPCDKGIDVC
                     RDLSVQRPTNRGDIGAMGDEGKMQKGRKSLNEGPSIFEYILKGYKEGIGNSGHIFPVP
                     DLPRLNASQEIAVRAALGRKVTLIQGPPGTGKTLVSSAIVYNLVKHYGGKVLVVAPSN
                     TAVDQLTLKIHKTGLRVLRVMSRRRECGQSDVNFLSLHENLKELQEGRKKKDECYGDH
                     NRYNSIYNDETNESLKKHLLNQAEVITCTCVTSGQKMFNKFRFHYVLIDEAVQSTEPL
                     SLIPLVYGCKKLVLVGDHKQLGPTILCKKVAQAGFKQSLFERLISIGVVPYVLSVQYR
                     MDADLCEWPSEMFYNGELLTGGKNFCRFDLGIPTNFFYVCYGREEVSPSGTSFVNQAE
                     ALHCESIIRHLFKCGVTENQIGVITPYEGQRSYILNRIFGAEPGNLEISNVDGFQGRE
                     KDFIIVSLVRSNLYQGIGFVGDKRRMNVMLTRAKHGLVIIGNPMTLMRHDMWSNLLSF
                     YDRKGLVMEGPLHNLRRVVIKPPKLFDFREISRSLMNQI"
     gene            complement(<211737..>213671)
                     /locus_tag="Eint_101620"
                     /db_xref="GeneID:9699553"
     mRNA            complement(<211737..>213671)
                     /locus_tag="Eint_101620"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073801.1"
                     /db_xref="GeneID:9699553"
     CDS             complement(211737..213671)
                     /locus_tag="Eint_101620"
                     /note="similar to ECU10_1650"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073847.1"
                     /db_xref="GeneID:9699553"
                     /translation="MGDSKIKGAGCTDIQDFSFRIDSLNMNDPENVVWAYRNIQQVYS
                     HSAVDFEKMVKIMMGTKLLDFNTSLIVLEMVGNALQDHFEKQKEDEEISFVASKCGLS
                     ISSGENKVSTGYIDYLYKLILPFARICTKQVVDIVAFLFTRTSRAEFDELFEMFEKKK
                     DFLVELYLLKVRLMRERSLKYKCGRCKDAREMSSLEMEEWIKNMKISSVGELGDDKGV
                     ECEKKTDFYSIDSAGGGRREDGMEGLPEELSFSQDKPFFESTTSPSNNSKDREEAKNK
                     LEGDTLECRPHQRPYEEECHDGVCRCRVEESEDKTCLCASYKPSDESRCLKEAKKYLL
                     DIESVSPRFFLENVALYLSLSFDKELLDLFEKYIGTEYEPVCASHIFKLKAIDSGVLE
                     AMIGRMRNSKREMLKSDNLPVTDTTFGLYIEWCADTFGSISISSVNDYSNISKLYIKF
                     LRSFPHKKMFLILEEICESKIERVSDAVYAHIAEDLEEIVKILLNLFNSTEENNKLSK
                     DEEKMSMLGDEKTFKNAKRLNSPEFCIEQELERIVLEVCKRYRKAFLSQIRVLDHFPD
                     NEFLLKISKTLCTNYENDWRYRRALLHSYREWPKFFGEILNIDSFTKDPVFIVRRTAL
                     DIKEEIDVGSESKIPKKETL"
     gene            <214009..>215175
                     /locus_tag="Eint_101630"
                     /db_xref="GeneID:9699554"
     mRNA            <214009..>215175
                     /locus_tag="Eint_101630"
                     /product="spore wall protein 1"
                     /transcript_id="XM_003073802.1"
                     /db_xref="GeneID:9699554"
     CDS             214009..215175
                     /locus_tag="Eint_101630"
                     /note="similar to ECU10_1660"
                     /codon_start=1
                     /product="spore wall protein 1"
                     /protein_id="XP_003073848.1"
                     /db_xref="GeneID:9699554"
                     /translation="MIKLSLLLSLASFTAVLANQRPRCQRCPVSSSKYFQQNNLLGSR
                     FQNEVQRLCARRVREESSSESSSSSSSEDCSRRRRRPHREWEDSCSSSYSSCSSTDSC
                     SSSAPCPPPVAQRCDIELKTPIILMGERIYEFLKNYEDQYKKAVLLFLTNILSQISGF
                     NPVFPGGDYDALIEQLKTLGVTVPANTAAELAAIDAAESSALTRAIQANAQKVISDLL
                     TRVSAMCYLDIMSLVNSGLLASQVSSVFNNIQPIITIAGNDLFAKQMAVFQKIPGTLP
                     SAAITAITNALQGNRTNFVTFFTTQTSNLQTSVQNSLTTLISELEKLATDTETAFTAF
                     ANAEISALISRIFPTSTTSSGSGDSTGSGSTGDAGDAGDTGEDGGDDEGTEGTG"
     gene            <215371..>216723
                     /locus_tag="Eint_101640"
                     /db_xref="GeneID:9699555"
     mRNA            <215371..>216723
                     /locus_tag="Eint_101640"
                     /product="DEAD box ATP-dependent RNA helicase"
                     /transcript_id="XM_003073803.1"
                     /db_xref="GeneID:9699555"
     CDS             215371..216723
                     /locus_tag="Eint_101640"
                     /note="similar to ECU10_1680"
                     /codon_start=1
                     /product="DEAD box ATP-dependent RNA helicase"
                     /protein_id="XP_003073849.1"
                     /db_xref="GeneID:9699555"
                     /translation="MKFEDLKIDQRIEKGLRESGFVDMKEIQQKVIPMALEGHDIIGS
                     SQTGTGKTLAFLVPILQKLTDLQWSGGDGLGCVIITPTRELALQIFDVLSKVGKYTVL
                     STGLIMGGLETENESLRLSNMNILVCTPGRFLQHLQENPYLNTGGIQILVLDEADKMI
                     EMGFKETLEDILGYIPSKKQTLLFSATPKASTARILRLEDPKIVSMYKEEGFPSQLHQ
                     YFYMMRMEDKVNYLHTFIGSNPGVKGIVFFSTCKEVKFHYLLFEKLKLRNRIFCLSGG
                     MSQKQRIDTFKKFVREKNGILFCTDLGSRGLDFPKVDVVIQYDCPCNIETYVHRVGRT
                     ARNNEGGESYVYLVYGEEKLLGDIQKKGWIKKQETESKDEEDRGSSEEIVEGPNIRIK
                     SIDRMIKGLIKSNKELNEYCRKYLTTYEKFLTFSSKRYSESIIRKISILYEYFGISKD
                     "
     gene            complement(<216778..>218016)
                     /locus_tag="Eint_101650"
                     /db_xref="GeneID:9699556"
     mRNA            complement(<216778..>218016)
                     /locus_tag="Eint_101650"
                     /product="enolase"
                     /transcript_id="XM_003073804.1"
                     /db_xref="GeneID:9699556"
     CDS             complement(216778..218016)
                     /locus_tag="Eint_101650"
                     /note="similar to ECU10_1690"
                     /codon_start=1
                     /product="enolase"
                     /protein_id="XP_003073850.1"
                     /db_xref="GeneID:9699556"
                     /translation="MKVKDALEEIKPRMILTSRGHPTIEVDLITSKGVYRSSCPSGAS
                     RGSKEAVVVSDGGKSYNGRGVKTVINNINEVATKSIFELECPVDDLQGIDDCLLKLDG
                     TKDKSRIGGNGIIALSTAFCKMGAAYSNRRVDEFLSDIGMFKRKIPIPHFNVLNGGIH
                     SGNKMDVQEIMVVYQYDDLEKNIESGCVFYESLKKTISERYGALYTSVGDEGGFAPPI
                     EKLEEGLELVLEASRRCKRTEMKIAIDFAANEFLRDGKYHLDGEVYTTRDLGEKYMRI
                     LREYPQIYSLEDPFSEEDYDGWTWINSEVGNKINIVGDDLTVTNPQLVENAGIRKMCN
                     TLLVKPNQIGTVSETINAIKVARRHGMKIMVSHRSGETEDHFISDLSVGVGAEYIKSG
                     APCRGERVSKYNQLLRLNEY"
     gene            <218084..>218374
                     /locus_tag="Eint_101660"
                     /db_xref="GeneID:9699557"
     mRNA            <218084..>218374
                     /locus_tag="Eint_101660"
                     /product="RNase P subunit Rpr2"
                     /transcript_id="XM_003073805.1"
                     /db_xref="GeneID:9699557"
     CDS             218084..218374
                     /locus_tag="Eint_101660"
                     /note="similar to ECU10_1695"
                     /codon_start=1
                     /product="RNase P subunit Rpr2"
                     /protein_id="XP_003073851.1"
                     /db_xref="GeneID:9699557"
                     /translation="MKKDFSKHLKYLYITALNMIGIPSLHRRKTKKMKMISNKYQVRL
                     SREIKRTLCSTCLSILVPGFNCTSRIVRKENGLCLKTVCGCGSEKIFVAQGR"
     gene            <218463..>220358
                     /locus_tag="Eint_101670"
                     /db_xref="GeneID:9699558"
     mRNA            <218463..>220358
                     /locus_tag="Eint_101670"
                     /product="dynamin-like vacuolar protein sorting protein"
                     /transcript_id="XM_003073806.1"
                     /db_xref="GeneID:9699558"
     CDS             218463..220358
                     /locus_tag="Eint_101670"
                     /note="similar to ECU10_1700i"
                     /codon_start=1
                     /product="dynamin-like vacuolar protein sorting protein"
                     /protein_id="XP_003073852.1"
                     /db_xref="GeneID:9699558"
                     /translation="MAVMDLLIEKINDLQDICTENNISNRIELPQIVVVGSQSSGKSS
                     VLENIVGRDILPRGTGIVTRRPLILQLIYSKTEDYAVFNHLPETKFTNFEEVKKEIIK
                     ETNRILKSKNDVSPLPITLKYYSSKVLTLTLVDLPGLVRVPTNDQPKDICTKITEICR
                     KYVSNRNALILAVSSANTDISNSDALQLAREVDHNYERTIGVLTKVDLMDSGTDVVDI
                     LAGRIICLRLGFVPVVNRSQQDIERNKSIQQALKDEEVFFLSHESYKRNRAYCGTGYL
                     ITKLHNILHEHIKQCLPELQERINSGMIDAQNNLRDLGNICLSPKENVMRIINTVSKR
                     FSDILSGNIESKGNELMGGARLNYAFNHHFSKFINRLGALDNIHDEQIRALLYNSSGS
                     SSVLLFGHVAFEKLARVSVESFKLHSLKLVSIVFSELVRMIKHIVDVSTASRYPVLGE
                     RIIACAIGMFKERCDATHKLVESFVDWNTGYISTRHPDFIRWNEMLSREMEDSVLERK
                     AEKIDFYKGMESKATLDSIPNTLRIRDGLSEQEVIEINMIKSMVESYFEITKKIIVDQ
                     VPKAIMCELVKKAENSLQETLFMEIYNREDLDSIASESEEVKLERSRIESMLKALKQA
                     YDIICSL"
     gene            complement(<220380..>221171)
                     /locus_tag="Eint_101680"
                     /db_xref="GeneID:9699559"
     mRNA            complement(<220380..>221171)
                     /locus_tag="Eint_101680"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073807.1"
                     /db_xref="GeneID:9699559"
     CDS             complement(220380..221171)
                     /locus_tag="Eint_101680"
                     /note="similar to ECU10_1710"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073853.1"
                     /db_xref="GeneID:9699559"
                     /translation="MENVIKKFILEESLTSSEGHLYIGKVEGQKAILIFPNQPVPQDT
                     FSQFLSLPMERIQSNDVYYTYKVLGNMPISFRLIYPATEEHIRKYSSSPIYIRETYEE
                     YLDFLKNYGHISTSWMDNIIDPSKRNVNEEILYEDQEIMIIPDYKWNKQLIDHLHLLV
                     IFKDPALKTIRDINSHNLLIRAQENANTILATKFALDPKHVFMFFHYRPTYLRLHIHI
                     INIKIAHEGTVSSIRAIPLHDVIHNLHMNSNYYKKDMFVLLKEAN"
     gene            <221211..>222398
                     /locus_tag="Eint_101690"
                     /db_xref="GeneID:9699560"
     mRNA            <221211..>222398
                     /locus_tag="Eint_101690"
                     /product="3-hydroxy-3-methylglutaryl CoA reductase"
                     /transcript_id="XM_003073808.2"
                     /db_xref="GeneID:9699560"
     CDS             221211..222398
                     /locus_tag="Eint_101690"
                     /note="similar to ECU10_1720"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl CoA reductase"
                     /protein_id="XP_003073854.2"
                     /db_xref="GeneID:9699560"
                     /translation="MKDSNQKANEKAKELLKKMEECMGIKIEGICSQEDYSDVINRCC
                     ENLIGYKKVPLGVSNRGVLINNRMFFIPIATTEGALVASMCRGIKLINACGGVEGYAE
                     NVGITRGFTMRFESFREAMRFYQWIKMEKSIANLKRIGNEGSRYMRISKIESKHVIGE
                     DVYIKVHGYSGDAMGMNMITKSCVQISNEIVRLFPNSSLVCISSNTCTDKKWSAENYC
                     NGRGRKIFMNLRVDNRNCEEILGVNIDRILDVYHAKVVVGGSLVLGGFNCQAANYVAG
                     IFLALGQDLGQIIESSNCILSMKKLESEVLSVSLFMPSVTVGVVGGGTHLEPSKSFLR
                     QFSNVNDEYIITNKDEDKSVAPGYLGLALGAAVLGGELSLLGSLADNTLMESHLRLNR
                     RQG"
     gene            <222528..>223355
                     /locus_tag="Eint_101700"
                     /db_xref="GeneID:9699561"
     mRNA            <222528..>223355
                     /locus_tag="Eint_101700"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073809.1"
                     /db_xref="GeneID:9699561"
     CDS             222528..223355
                     /locus_tag="Eint_101700"
                     /note="similar to ECU10_1730"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073855.1"
                     /db_xref="GeneID:9699561"
                     /translation="MSIRLTIRYRTDSIEASVMMTDTLESLKLRIQEITGVPVDSQVL
                     LFNDRVLNDNNKELKELGIENDSTLYLKKRSGARKEGKRQDFTASMMKNPLVKNFLKN
                     PDAMKSIVEMFPGLKEEMSNNPELRMMMNSSNLQEELEMFSMNPEYMNTQLKNLDITM
                     SKLENIPGGLNMINSMIKDVQDPLSSALKEGMGRGYRVKEGRKIDKPINEAIPGARKE
                     ESQLVKYRDKLAELKQIGFSNTRKNFTALIACNGDLERSIMYLRELDSKSSPTQRAK"
     gene            complement(<223449..>226514)
                     /locus_tag="Eint_101710"
                     /db_xref="GeneID:9699562"
     mRNA            complement(<223449..>226514)
                     /locus_tag="Eint_101710"
                     /product="putative RasGAP domain-containing protein"
                     /transcript_id="XM_003073810.1"
                     /db_xref="GeneID:9699562"
     CDS             complement(223449..226514)
                     /locus_tag="Eint_101710"
                     /note="similar to ECU10_1740"
                     /codon_start=1
                     /product="putative RasGAP domain-containing protein"
                     /protein_id="XP_003073856.1"
                     /db_xref="GeneID:9699562"
                     /translation="MESKKEELKKNSINVHQRLGTDVHVSSEDMDLERRNTRAYEYLC
                     RLEEAKSWLGDFTSVPESFEEFEEEMRKGVILTDICKVFAPNSVKNVFVDCTLQYRHT
                     DNINYFLSGVSHIGLPEYFHFEVIDLYEKKNFVKVIYCIHALAHLLSSKGISKNIKSA
                     KGKIFSYDDMARADVQVEKMNMPKFDNIEDVLKEKIAMEEAAGNGENKVRKEILDQEN
                     VEEKEGSFLSEDISVCDESFDILKLTLRTFLYKKCFDDIYYRKEVSLFSIRRFAFIFF
                     SNSSEMVKENLIENLHHKISRKFDSIYAKEAQIKDIETRIRLIVQNRMEVGNITIKNP
                     IPEDEDTRDFERVLLFLQNNPKYLSELLRNVNDPDSFIVSIIIPIFSNVSSKKEEYMF
                     INLVLEIFRKELLDNGLDVRKLVPIDMSLGIHSSTFFSLELFREVEFPVHHTLMPGSI
                     SHKLMVNYFRISQGSFVLRDKILQVVKNLENIEVDANPVLIYKMLFNQSTSADKALEN
                     ERVREAVQTRLMVVRGVIASALDLLESSVESIPYILRYFLKLYGPRTFYSEFVMPFIL
                     APDAFIESFEVGKSLRNKCFIISKILEHIADRVMFFEESDNGEEEKDGDGMSKYMSFI
                     SGEKKNFELRFYSPLYPFFRRCHERYQSILSKLTNVSGLDHYFQFESMNELGKLKRAT
                     VHLPSSTANQLITLLLSNTRILGSELCEILETLPLFPDDQNKTLSFTFFGPEWICSQD
                     PEKIALENFVRGLKRKLIYAISVCKGRNLLEMLLKESDEEERSRYLEMKKSAICTKEE
                     DDGLSIASPPKQYETIDQLKESIIDDLNFLEDKKITSRHNLYSELLFMLAQDIVILRF
                     MSEERSKELRINEISYDNLCYKDDYLSGKIELYQNYLNSFAAKLAIKRRSLFGFNGVD
                     DIIRDSKYGTHKYSAEKLMNMGVLVQIYDSPDISEIFFLFLSDTPLLFSVEIYVQNIL
                     VSHPVSFRFDDLLKLRKNGNNICDIAGICSFSVCRFIDLVNSKYIGSEV"
     gene            <226593..>228446
                     /locus_tag="Eint_101720"
                     /db_xref="GeneID:9699563"
     mRNA            <226593..>228446
                     /locus_tag="Eint_101720"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073811.1"
                     /db_xref="GeneID:9699563"
     CDS             226593..228446
                     /locus_tag="Eint_101720"
                     /note="similar to ECU10_1750"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073857.1"
                     /db_xref="GeneID:9699563"
                     /translation="MQELLLNFIHTFFGIHGKSPSPLFLESAMRYLKPSKFEAMEDDE
                     IENAIKIKSYRAYLAYRRMKKNIIAKMLCYVLANVADSEISVMSELDRNVKKGALGIE
                     ISYFSEASLPLLKESVGTHIYGIAFQVYQNACIYRKLRSETSFSSKAHSYFYEIVREE
                     LEKYERSVIEQDEELLSFYVGMYSRYIRIQIIHQLNECFRDNPKKPFEFLKFNFLSNH
                     PFYRQVLESSCLHIDSCLQEFLLTGSFKDDTNEFFICRKVTIDPWEEFTIDFGLVPYF
                     ISNRVVQKILYIGKCSSLIRRYDLERIGSLDTFQASQIESRMEKTTEGVNFRNLVEEE
                     LENIARQINILNPNLEENIDLILHKINKKIRHDFLSCPAICSQIEGIKNTFLFRRCDF
                     IETLFLYLKDSRDLTRKSFSYVLDLAIRNTYGDVDEFTSGLGVYIVDDENKYENFALF
                     CQVSYPASIIITKESVLKLVAIFQFLWKLKRVEHLLLRISKMKMEGKTKIKIASYKTL
                     VYKISYFVFQEVIEKKWNFFSASGEMPLNKLRLGMEKVLDEVINICQIGGKMEALLDS
                     MKDSLIDTGARSSSFSDEEIQRKLSELVKEHGNSFIGTSLYDLHKYSKAIN"
     gene            complement(<228462..>229064)
                     /locus_tag="Eint_101730"
                     /db_xref="GeneID:9699564"
     mRNA            complement(<228462..>229064)
                     /locus_tag="Eint_101730"
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /transcript_id="XM_003073812.1"
                     /db_xref="GeneID:9699564"
     CDS             complement(228462..229064)
                     /locus_tag="Eint_101730"
                     /note="similar to ECU10_1760"
                     /codon_start=1
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="XP_003073858.1"
                     /db_xref="GeneID:9699564"
                     /translation="MKIHGAVLLVLLCMGVNTSPNRGTPYLDVEYVVNGTKKSGRITF
                     ELYWDAAPKTAANFYKLVEGTHIGNEFYKYEGSIFHRIIPEFMMQGGDIVKGNGTGSI
                     SIYDGQPFEDEKFIFGHDGIGKLSMANSGPNSNGSQFFITFSPQPHLDRKHVVFGNVN
                     EDCISLIKDIEKVDIYSTRPIPPVKIVKSGIMEKDRKEYL"
     gene            <229121..>230578
                     /locus_tag="Eint_101740"
                     /db_xref="GeneID:9699565"
     mRNA            <229121..>230578
                     /locus_tag="Eint_101740"
                     /product="leucyl aminopeptidase"
                     /transcript_id="XM_003073813.2"
                     /db_xref="GeneID:9699565"
     CDS             229121..230578
                     /locus_tag="Eint_101740"
                     /note="similar to ECU10_1770i"
                     /codon_start=1
                     /product="leucyl aminopeptidase"
                     /protein_id="XP_003073859.2"
                     /db_xref="GeneID:9699565"
                     /translation="MELLDYGKLKVTGETNQESTKVRIILYSPSKEGVDIKSEKKDSS
                     HQAFLNRMGAKGNSGESYVLPEENGKITVFVGIGKEDENVFLVKNNAKKAGALAYKAV
                     SQFKNLEIFLESEFMGKEVASGVTLASYKYQFLNKEKGEPKKVAINTQFPSVKKAIMI
                     GNAQNFARFLGDTPANLMNPTLFTEYAAKYLHGKKNVTFEVFGKEFMKSKSMNLLLSV
                     SQGSVQEPKLFVAKYRGKGGDGVDIALVGKGVCFDSGGISLKPSARMSLMKGDMLGAA
                     SVLSVFGLAADMEIKINIDLVIPLVENLPSGTATKPGDVYIGMNGKSVEIDNTDAEGR
                     LILADALVYAQEGHPTYIFDVATLTGAMAVALGDAFIGYFTSDDKLSEIIYQSGIDAS
                     DPTWRMPLSQLYLPTMKSDVADLKNTGEGRYGGSASAAIFLNEFVGKEYKWVHFDIAG
                     VMNSNNSKGIYGDGMTGCSVSALIETIEKLSTIVN"
     gene            complement(<230646..>231917)
                     /locus_tag="Eint_101750"
                     /db_xref="GeneID:9699566"
     mRNA            complement(<230646..>231917)
                     /locus_tag="Eint_101750"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073814.1"
                     /db_xref="GeneID:9699566"
     CDS             complement(230646..231917)
                     /locus_tag="Eint_101750"
                     /note="similar to ECU10_1780"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073860.1"
                     /db_xref="GeneID:9699566"
                     /translation="MPDLTSKISRFNSFDLESYLNNTFQRYEGFILENERHNISKIEH
                     EVDTELLKTFLLNSDSLLDILNVYEESYRMVTSMVDLTKELVRYNMDGGVEEEVFVDK
                     DLVRKFRRVLDNFDNEVDVFATEGRYLVHFDILREKSGKECILIMTNDILLIGIVQEG
                     AKKYRLLNAYSYSIIQIQIKDDLLEIKVSPTVYVFEKNKESVEYILRIYQELTYTYKK
                     KTDSTVQKPVIDKELIDYLVFTEQYEYIEADECFHSPKVLFHDKTEMVRYLSVISKGK
                     KGISPYVFSFLEERFKDGLKRINKIQPLKSFIEDIFGYFRVFLEEQTILVKDLEKIES
                     IKRSGMVFLIEEQLVRCIEMLESRVFNKGYDVKYTDSILEAVKENLVFSKYDFSYIMD
                     RFLKKRNNYKKKCLGNAMKDIGRIIEDMISN"
     gene            <231978..>233717
                     /locus_tag="Eint_101760"
                     /db_xref="GeneID:9699567"
     mRNA            <231978..>233717
                     /locus_tag="Eint_101760"
                     /product="glycyl-tRNA synthetase"
                     /transcript_id="XM_003073815.1"
                     /db_xref="GeneID:9699567"
     CDS             231978..233717
                     /locus_tag="Eint_101760"
                     /note="similar to ECU10_1790"
                     /codon_start=1
                     /product="glycyl-tRNA synthetase"
                     /protein_id="XP_003073861.1"
                     /db_xref="GeneID:9699567"
                     /translation="MRKFDQQQIDQVLKKRFFLAQSAHIYGGISGLYDLGPPGLSIKT
                     NILALWRKHFVLEEDMLEIETTTMLPYDVLKASGHVDKFCDILVFDEVTGDCFRADHL
                     VEETLEKMSPTEEVIRDLQRVDCMTCQEIDAVISKYNIKSVLGNKLSKSQQFNLMFGT
                     QIGYKGGQTMFLRPETAQGQFLNFKKLYEYNNEKLPFASASIGKSYRNEISPRSGLIR
                     VREFDQAEIEHFVLPDEKKHPKFSSVKEIKLKFIQEDSSEEISLGEAVERKMVCNETI
                     GYYIGRTALFLIEVGIDKELLRFRQHKKEEMAHYAKDCWDAEIYTSYGWIECVGIADR
                     SCYDLKCHEDGSKVDLRCKRRLTNPKEVEEWILKLDKKEWGARLRDRFSTLIEMINGF
                     SQEYIEKNISALDGNKNYLNVEFDGHGINVECSKEKKKIFVENVIPDVIEPSFGIGRI
                     LYALLEHSFYQREDLRPVLKLKPMIAPIQCAIGYLIYYNEFEEHILKIKRSLAENGLV
                     VHVNERSCSIGRKYSSYDELGVPFFITFDPDFLKDSMVTIRERDTMNQIRVDVEKCPS
                     IILEYIRGESKWN"
     gene            <233777..>234784
                     /locus_tag="Eint_101770"
                     /db_xref="GeneID:9699568"
     mRNA            <233777..>234784
                     /locus_tag="Eint_101770"
                     /product="hypothetical protein"
                     /transcript_id="XM_003073816.1"
                     /db_xref="GeneID:9699568"
     CDS             233777..234784
                     /locus_tag="Eint_101770"
                     /note="similar to ECU10_1800"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_003073862.1"
                     /db_xref="GeneID:9699568"
                     /translation="MRTKRKIVILIVTFVVLLILFTTLIVRRKRSYINSRNASGLVKS
                     NIITNENSGIPSTKDRGLSFGLTSWQLKENGSLKKIDSIFMPILEKAYNLEKKEDPES
                     KNKDETIEDELFRHNQRLISFKIEGKHSIGNYLFGLLRKTIDNICACSPPDGKKHETF
                     GISSEHTALIRHYIKYFKTFVCMPKVIYHGNTEPEDIYKLHFDSINCFIGARLTKYHT
                     ASSFTKGEEKYMTYIEQFIDTEASDIPIEILSEGRERLSVKDHILYTLLHYICLFYSK
                     SQETRDMLYTKMKIEKMGISSINLSKIINDYRYSDIVESIRPIHFVNDSSCIVKPLIV
                     K"
CONTIG      join(CP001951.1:1..234890)
//
DBGET integrated database retrieval system