GenomeNet

Database: RefSeq
Entry: NC_015663
LinkDB: NC_015663
Original site: NC_015663 
LOCUS       NC_015663            5280350 bp    DNA     circular CON 01-APR-2020
DEFINITION  Klebsiella aerogenes KCTC 2190, complete sequence.
ACCESSION   NC_015663
VERSION     NC_015663.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603581
            Assembly: GCF_000215745.1
KEYWORDS    RefSeq.
SOURCE      Klebsiella aerogenes KCTC 2190
  ORGANISM  Klebsiella aerogenes KCTC 2190
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Klebsiella.
REFERENCE   1  (bases 1 to 5280350)
  AUTHORS   Shin,S.H., Kim,S., Kim,J.Y., Lee,S., Um,Y., Oh,M.K., Kim,Y.R.,
            Lee,J. and Yang,K.S.
  TITLE     Complete genome sequence of Enterobacter aerogenes KCTC 2190
  JOURNAL   J. Bacteriol. 194 (9), 2373-2374 (2012)
   PUBMED   22493190
REFERENCE   2  (bases 1 to 5280350)
  AUTHORS   Shin,S.H., Kim,S., Kim,J.Y., Yang,K.-S. and Seo,J.-S.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAY-2011) Life Science Institute, Macrogen Inc., 10F,
            World Meridian Center, 60-24, Gasan-dong, Kumchun-gu, Seoul
            153-781, Republic of Korea
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002824.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Date                   :: 04/01/2020 11:50:07
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 4.11
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,007
            CDSs (total)                      :: 4,888
            Genes (coding)                    :: 4,795
            CDSs (with protein)               :: 4,795
            Genes (RNA)                       :: 119
            rRNAs                             :: 9, 8, 8 (5S, 16S, 23S)
            complete rRNAs                    :: 9, 8, 8 (5S, 16S, 23S)
            tRNAs                             :: 84
            ncRNAs                            :: 10
            Pseudo Genes (total)              :: 93
            CDSs (without protein)            :: 93
            Pseudo Genes (ambiguous residues) :: 0 of 93
            Pseudo Genes (frameshifted)       :: 49 of 93
            Pseudo Genes (incomplete)         :: 45 of 93
            Pseudo Genes (internal stop)      :: 18 of 93
            Pseudo Genes (multiple problems)  :: 17 of 93
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5280350
                     /organism="Klebsiella aerogenes KCTC 2190"
                     /mol_type="genomic DNA"
                     /strain="KCTC 2190"
                     /type_material="type strain of Klebsiella aerogenes"
                     /db_xref="taxon:1028307"
     gene            join(5279702..5280350,1..728)
                     /locus_tag="EAE_RS00005"
                     /old_locus_tag="EAE_24795"
                     /db_xref="GeneID:45318386"
     CDS             join(5279702..5280350,1..728)
                     /locus_tag="EAE_RS00005"
                     /old_locus_tag="EAE_24795"
                     /inference="COORDINATES: protein motif:HMM:NF017476.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004244861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164926763.1"
                     /db_xref="GeneID:45318386"
                     /translation="MLNKHKLTYILVVYSSLSFASSPYKSDAISMSSNNDKDPVATDY
                     NGKTGVDGAWQGVAVGPTSQAFMGSTTIGDSAKSEGQFGVSLGTKATVTNQAKNSVAL
                     GAHSISNQENQVSIGNDTLKRQLTNLADGKLAEGSSDAVTGNQLHATSKSVAQNAAAI
                     ADTRAAADKGIADNKAAIADTRAAADKGIADNKTAIADTRAAADKGIADNKAAIADTR
                     AAADKGIADNKAAIADTRAAADKGIADNKTAIADTRAAADKGIADNKAAIADNIAHSS
                     NMLKTEEKARRDGDKQTLEQANKHTSERERVINNRTDEEIQNESEARKIGDIQTLQSA
                     NRYTDYKVESQNQESLQQSMNYTDKRFQQSKNYTDNKFKQLTGKINRAEKRLNAGIAG
                     VTAIASIPYLTENNFSYGVGIGNYQNGNALAAGVQYRISQNNNVRLNISWDSSSNSAI
                     GVGFSGGW"
     gene            complement(1231..2034)
                     /gene="citG"
                     /locus_tag="EAE_RS00010"
                     /old_locus_tag="EAE_00010"
                     /db_xref="GeneID:45318387"
     CDS             complement(1231..2034)
                     /gene="citG"
                     /locus_tag="EAE_RS00010"
                     /old_locus_tag="EAE_00010"
                     /EC_number="2.4.2.52"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014885203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triphosphoribosyl-dephospho-CoA synthase CitG"
                     /protein_id="WP_013878099.1"
                     /db_xref="GeneID:45318387"
                     /translation="MAGLHATKPCAIDVPALAEAALWYELELTPKPGLVDKINNGSHR
                     DMDYALFIRSIMAITPWFSRFYELGSSYADTPCDEQLRVLRPMGMACEQAMYAATNGI
                     NTHKGGIFALGLLCFAAGRVKKISSESLCCEVSNICNGLVSRELAARSGMATAGERQF
                     QQYGLTGARGEAESGFATVRNALSQWKGISLHELLLHLMAINQDSNLVSRGGIEGLRY
                     VQDYAQKLLANGWDHEELIRMDNMLVKRNLSPGGSADLLSVGWVLSEIK"
     gene            complement(2012..2465)
                     /locus_tag="EAE_RS00015"
                     /pseudo
                     /db_xref="GeneID:45318388"
     CDS             complement(2012..2465)
                     /locus_tag="EAE_RS00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010435501.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase holo-[acyl-carrier protein]
                     synthase"
                     /db_xref="GeneID:45318388"
     gene            complement(2549..4066)
                     /gene="citF"
                     /locus_tag="EAE_RS00020"
                     /old_locus_tag="EAE_00020"
                     /db_xref="GeneID:45318389"
     CDS             complement(2549..4066)
                     /gene="citF"
                     /locus_tag="EAE_RS00020"
                     /old_locus_tag="EAE_00020"
                     /EC_number="2.8.3.10"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006178465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase subunit alpha"
                     /protein_id="WP_013878101.1"
                     /db_xref="GeneID:45318389"
                     /translation="MNQIKLLHVDFPHLRDLKPFDTANSATPWLADRDAKLNRKLCAS
                     IEEAVVRSGLQDGMTISFHHAFREGDRVINTVVALLARMGFKDLTLASSSLMTCNDAL
                     IEHIENGVITRIYTSGMRGKLAEAISHGLMDEPVQIHSHGGRVKLLQDGELNIDVAFL
                     GVPCCDEFGNANGTEGKSCCGSLGYAMVDAHFARNVVLLTEELVPFPNMPASLAQDQV
                     DYIVQVESVGDPAKISVGAARVTSNPRELLIARYAADVIEHSGYFKPGFSMQTGSGAA
                     ATACTRFMEEKMERSGVKARFALGGITGSLVDLHEKGLIEKLLDTQCFDGQAAASLAR
                     NSNHVEISTNVYANPGSKAASCDQLDVVILSALEIDIDFNVNVITGSDGVMRGASGGH
                     CDVATAANLTIVVAPLLRSRIPTVVKCVTTRLTPGESIDVLVTDHGIAVNPSRPEIHE
                     RLKEAGLKIVDINALYERAISLTGMPTPIEFTDKIVGVIRYRDGSVIDTVRQVKE"
     gene            complement(4071..4952)
                     /gene="citE"
                     /locus_tag="EAE_RS00025"
                     /old_locus_tag="EAE_00025"
                     /db_xref="GeneID:45318390"
     CDS             complement(4071..4952)
                     /gene="citE"
                     /locus_tag="EAE_RS00025"
                     /old_locus_tag="EAE_00025"
                     /EC_number="4.1.3.34"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006818318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate (pro-3S)-lyase subunit beta"
                     /protein_id="WP_013878102.1"
                     /db_xref="GeneID:45318390"
                     /translation="MSKLRRSMLFLPGANAAMLSTAFIYRPDSIMFDLEDAVALREKD
                     TARMLVFHALQHPMNQDIETVVRINPLSTPFGLLDLEAAVRAGVNVIRLPKTDAPEDI
                     DELERHLVRIERECGREVGSTRVMAAIESAVGVINAVAIARSSPRLVGIALAAFDYVM
                     DMQTERGDGTELFYARCAVLHAARAAGIDAFDVVWSDVNDEAGFLREVELIRKMGFNG
                     KSLINPRQIDLLHNAFAPTQEEVDHAKLVIEAAEEGERNGLGVVSLNGKMVDAPIINH
                     AQVVLERATASGVRRKG"
     gene            complement(4949..5242)
                     /gene="citD"
                     /locus_tag="EAE_RS00030"
                     /old_locus_tag="EAE_00030"
                     /db_xref="GeneID:45318391"
     CDS             complement(4949..5242)
                     /gene="citD"
                     /locus_tag="EAE_RS00030"
                     /old_locus_tag="EAE_00030"
                     /EC_number="4.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020883681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase acyl carrier protein"
                     /protein_id="WP_013878103.1"
                     /db_xref="GeneID:45318391"
                     /translation="MKIVREALAGTQESSDLMVKIVPAHGELEIVIHSEVIKQFGEQI
                     HQVVNDTLRAMNVDQGLIIIEDKGALDCVIRARLQSALMRAADDQPINWEALK"
     gene            complement(5259..6281)
                     /gene="citC"
                     /locus_tag="EAE_RS00035"
                     /old_locus_tag="EAE_00035"
                     /db_xref="GeneID:45318392"
     CDS             complement(5259..6281)
                     /gene="citC"
                     /locus_tag="EAE_RS00035"
                     /old_locus_tag="EAE_00035"
                     /EC_number="6.2.1.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020455184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="[citrate (pro-3S)-lyase] ligase"
                     /protein_id="WP_013878104.1"
                     /db_xref="GeneID:45318392"
                     /translation="MQSQPIYFRHTLVAKHPERLSQIRYLLADSGLGLDNDITLFVEA
                     WSGSQLVGCAGLAANVIKCVAINEQLRGQNLSARLLGEVENAALERDYFHLFLCTRPC
                     NRERFARCGFWPIAQSGNNAVLMENTPKGIERYCRSLVAKRQCGEKIGAVVMNANPFT
                     LGHYHLVEQAAMQCDALHLFVVHEDVSFFPFSSRLEMVRAGVSHLSNVTVHEGSQYII
                     SRATFPAYFLKETDQVQQAWSEIDVLIFRNYIAPALNITHRFIGSEPFCDITRQYNKT
                     LHDLLTSHIEVVEIPRIKFTGIAISASEVRRLLKTQQFSRIREIVPESTFSHLETNYR
                     DSAEVA"
     STS             5995..6290
                     /standard_name="ha2836"
                     /db_xref="UniSTS:515599"
     gene            complement(6295..7158)
                     /locus_tag="EAE_RS00040"
                     /old_locus_tag="EAE_00040"
                     /db_xref="GeneID:45318393"
     CDS             complement(6295..7158)
                     /locus_tag="EAE_RS00040"
                     /old_locus_tag="EAE_00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015963045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase family protein"
                     /protein_id="WP_013878105.1"
                     /db_xref="GeneID:45318393"
                     /translation="MKLASFLHQGIRSYGIVQAEGMIDLRRRLGDRYSDLKALLQGDG
                     LAQAACYQNDAVDMPMSAITFLPVIEQPEKILCVGMNYLDKRKEFDQHNPAPTLFVRF
                     PDSQTGHNEPVLKPRYSSEFDYEGELAVIIGKAGENISRDDALSHVAGYSCYMDGSAR
                     DWQHTWFTAGKNWRQTGAFGPWMATSDEIPDPHQLTIRTWLNGRMVQEDNTSSMIHKV
                     AELIEYISTFTRLSPGDVIITGSPGGVGKKRNPPLFMKEGDRIEVEIERIGHLSNVIV
                     EAPAIGLAAAH"
     gene            complement(7176..8537)
                     /locus_tag="EAE_RS00045"
                     /old_locus_tag="EAE_00045"
                     /db_xref="GeneID:45318394"
     CDS             complement(7176..8537)
                     /locus_tag="EAE_RS00045"
                     /old_locus_tag="EAE_00045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013574927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxycarboxylate transporter family protein"
                     /protein_id="WP_013878106.1"
                     /db_xref="GeneID:45318394"
                     /translation="MSTNDDSFSVTNHPTEIQRPSLQVRWWNIMDTWKVGIIPLPLFV
                     LAGVLIAIDCLGGNLPSDIVVMVATLAFFGFACGEFGKRLPIVGKLGAAAICATFIPS
                     ALVYYGLLPDAVVESTTKFYKFTNILYLYICCIIVGSIMSMNRTVLIQGFLRIFFPML
                     CGEIVGMLVGMGVGLALGLEPFQIFFFIILPIMAGGVGEGAIPLSIGYAALLHMDQGV
                     ALGRVLPMVMLGGLTAIIISGCLNQLGKRYPHLTGEGQLMPNCANADATVSQPAFSGK
                     ADVTTIASGALLAVLLYMLGMLGHKLIGLPAPVGMLFMAVLVKLCNGASPRLLEGSQV
                     VYKFFQTSVTYPILFAVGVAITPWHELVAAFTVSNLLVIVSTVSALVATGFFVGKKIG
                     MHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSISLLILGN
                     FLI"
     gene            8882..10507
                     /locus_tag="EAE_RS00050"
                     /old_locus_tag="EAE_00050"
                     /db_xref="GeneID:45318395"
     CDS             8882..10507
                     /locus_tag="EAE_RS00050"
                     /old_locus_tag="EAE_00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014885211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_045362996.1"
                     /db_xref="GeneID:45318395"
                     /translation="MKVSFQIKLFISLIVFFLVLFVLLGGYYYVDASKQLYQEMSVRA
                     KIQAEGIALIPTLRNEVEQKNINAIRDFMQKISIPSDASFIVIGDNKGHHLFHSVFSD
                     KVGTTLVGGDNEAILQGKSTTTIRKGGLGISLRSKAPIFNDAGKVVGIVSVGYLTSYL
                     DTITVSKVVNIFIAVVLLLIALFIFSWFFTRSIKKQIFSLEPREIGLLVRQQKAIMES
                     IYEGIIAIDAERRIEVINQAARQLLGLNLTAKELRGQLISEVIDLIPFFDTQIMLEKD
                     THDEICRFNELKVIANRVHIMLEGSLQGWVITFRDRNEIDSLSAQLSQVKRYVDNLRI
                     MRHEQLNRMTTLSGMLHLGRYEEAIGYIQEQSEHAQELLDFISSRFSSPTLCGLLLGK
                     TARAREKGVELNFDPACQLDRAFLPLGEQDLISIIGNLLDNAIEATQRSPQPSAPVEV
                     LIKLSDQELIIEVADQGVGIKPEVRDRIFERGITTKTRGDHGIGLYLIESYVTQAGGA
                     IEVADNTPRGTIFSLFIPTTGTDRQLEDTNYAA"
     gene            10497..11189
                     /locus_tag="EAE_RS00055"
                     /old_locus_tag="EAE_00055"
                     /db_xref="GeneID:45318396"
     CDS             10497..11189
                     /locus_tag="EAE_RS00055"
                     /old_locus_tag="EAE_00055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015585738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_013878108.1"
                     /db_xref="GeneID:45318396"
                     /translation="MRHEFIDVLIVEDESELAQLHTELISKHPRLRPVGIASTLASAL
                     AELESKKPQLMLLDIYLPDGKGIALINNPMLARANCSVIFITAASDMDTCSQAIRNGA
                     FDYILKPVSWKRLSQSLERFVQFFEQQRVWKIVDQQNVDSLYQLQAKNYRLHNSSKGI
                     EENTLARVQTLFSDNATHCFTVDEVVNETGLSKTTTRRYLEHCVETDFLSVEKQYGKI
                     GHPRRMYKRAKG"
     gene            11634..>12404
                     /locus_tag="EAE_RS00060"
                     /pseudo
                     /db_xref="GeneID:45318397"
     CDS             11634..>12404
                     /locus_tag="EAE_RS00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012543393.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing C-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /db_xref="GeneID:45318397"
     gene            complement(12727..13419)
                     /locus_tag="EAE_RS00065"
                     /db_xref="GeneID:45318398"
     CDS             complement(12727..13419)
                     /locus_tag="EAE_RS00065"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_164926737.1"
                     /db_xref="GeneID:45318398"
                     /translation="MRIKTFNLMRLIFISFLMFLFSLHSAYALYLDSRVFTLESEKSF
                     YSRQFVNNTKNTNLYTINAWRIDRPGKNEIRKELQEGELMYTPLRKIMQSDGREFFKL
                     FYSGPKDDQERYYRIVIHEIPVAFHSSGGVNKTPLVSPIVALETIMVVRPRELHFDYQ
                     YNSQARILKNTGNTYFQVMIHRSCEARDDTAKVFYLLPGESYHGSDLDGEHRKFIVGF
                     NRYQQFGKQCLN"
     gene            complement(13416..15008)
                     /locus_tag="EAE_RS00070"
                     /db_xref="GeneID:45318399"
     CDS             complement(13416..15008)
                     /locus_tag="EAE_RS00070"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_072051209.1"
                     /db_xref="GeneID:45318399"
                     /translation="MKTTTVTTMILGGFFSFSNVFAATVKNDYVFVENTIDGEYFITP
                     AKTDPRFSGANVFTKYASENQDSLGYMGSSGALGLNQFADIWLENSPIDKPFIGQRCK
                     RNASGCPSNGYLAGDYISHNGAYHIKVNTHAGGAGIARGIFSDSAYQYFKNVAVGSTE
                     SYQYNYCSTKTDYDPASGQTCVSMGGKQGSHTFLITKVGHLKLESTNALQEIFIDSSG
                     SPSIGLGSQFCKVGYIGSINGAICKLVSYTLNGETLTPMRVNMKVDAGLVGFTPSGKD
                     IQISSDGASGWEYYDDKVKSSEYFKPGHGGVYVFLSQTFLKQLINNSQDLTNSQKFFT
                     FQFTSTVAPQSGFYEFSPSNSIILHTRDYGISIISKDLDPNPHREGKVGPGESALVFD
                     YTVTTSGPRQANSIIAQVSGPMDKLNGQPYCIFSSDDGKTTVPFSAYLSWTKNDGQTQ
                     KVRSSCDNLPVSLDNAQWLETAWPLPYQNDGSFYRTDLKLTFPMDESTSLSSLDGRDW
                     MGIVSAAGEIKVTAVWSGADIQ"
     gene            complement(15020..17533)
                     /locus_tag="EAE_RS00075"
                     /old_locus_tag="EAE_00085"
                     /db_xref="GeneID:45318400"
     CDS             complement(15020..17533)
                     /locus_tag="EAE_RS00075"
                     /old_locus_tag="EAE_00085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006659750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane usher protein"
                     /protein_id="WP_013878114.1"
                     /db_xref="GeneID:45318400"
                     /translation="MSQCIALKLTAAAVFVAYTLGIAHAETSSLQDVRLGKYIIPGVF
                     GQALQQGMTIPIFLRFKGAKEGQNQKIAEGTVVLDGNNLIIKEITILEQLDGAKLSVQ
                     TQMLLKSLKNRRFTDGTSISISHDAELNLNIRSFFLTLDVNQKSLATSIIPRSSLLGE
                     SSVQQGTSVLNYDLGVYRSQIKNGDNTSNSYLNIDDTLSIAEHHFNINGSFYGIGDSQ
                     RDSQLYRAMYEHDFHGRRFAAGLLDTWNLQSLGSMSALNSSKVYGATYGTKSLTQVVN
                     NQYSLTPITVFLPAAGEVHIYRQGRLLNIQNFPMGSFEVDTSGLPYGIYNVQVDVVID
                     GKVISHMTQTINKSFSSRTQNMQHWDWQIYAGTVDYQDRKYTAESEETNHSPDSYQTW
                     LAGFSTSVSYPVLSGLTLQTSTYSFDSNYINESSLNLTILKYGSIGWQGLISQGGVHR
                     NIINATMQLPEGFGSVWVNREKSHINDKLPIYETNNYSFGGTLNFNQIIDHAGQVTVS
                     HTVDKRVRSNSNNFEYTTSLFSGRWGNVNLRAGIQRYQYDYQSNSSNQRYISLDFSLP
                     LATWLSTGMSSNNGNIKANLTATKNFEDSAFSSAGLNLSKLLKDKKNGESDYSISGYT
                     AFDTKYSSGTLSLSRPDSERLNGNVTARGSVAYSSRNIAASGIQEKSGVIINTEVSDD
                     AVLAAQVNGRHYRLSGSNNFIPLPPYSDYKVELMNDKNSQDSFDIVTERIKNFTLYPG
                     NVALYTPQIKQMITVFGRMTTQDGKPIPNASVRNHIGHTYTDGDGKFSMDVDKRFPVV
                     SLAMHDNAICESELDLRKARGVKWVGNVICEKQTTLAQR"
     gene            complement(17557..18240)
                     /locus_tag="EAE_RS00080"
                     /old_locus_tag="EAE_00090"
                     /db_xref="GeneID:45318401"
     CDS             complement(17557..18240)
                     /locus_tag="EAE_RS00080"
                     /old_locus_tag="EAE_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008913156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_045363081.1"
                     /db_xref="GeneID:45318401"
                     /translation="MKLMNHWLLMLTLLVFGSRALAINVGAITESMPSDTNMIAKEVS
                     NTVDVARLVSLSVERISSPLEQGKVIPMEAQNEIMVTPANLILPGKAKEIFRIFYGGQ
                     KDDKERYYRLIWQDNPVVEEGNSKSTKTAMATTSATISTLMVVNPRKENFNYRYENGV
                     ISNIGNSSFRVVASGPCFPNKSEGENKMCRERYYVMPGLAVHLKFVDYQLNKSSIGIW
                     HNKNYITVK"
     gene            complement(18294..18893)
                     /locus_tag="EAE_RS00085"
                     /old_locus_tag="EAE_00095"
                     /db_xref="GeneID:45318402"
     CDS             complement(18294..18893)
                     /locus_tag="EAE_RS00085"
                     /old_locus_tag="EAE_00095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005225668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_013878116.1"
                     /db_xref="GeneID:45318402"
                     /translation="MKKLAMALIAASALGTVHVATADTRTANATASWDAKAIKDTNSM
                     LVVTPLKSLTFNYAQGLERFNTQDGAFDITIAGQSGASDFKLTSKIISNTLTRLSDDS
                     ALTVGVKWNGTELSEGVDTVMVDTSKGISAGLSPLAVNSAYAGSGRTSTQGVFAFNVS
                     KATVAGKDTLFKDLTDGYWDGNVNVEFTATWDGTFTPAK"
     gene            complement(20036..20614)
                     /locus_tag="EAE_RS00090"
                     /old_locus_tag="EAE_00100"
                     /db_xref="GeneID:45318403"
     CDS             complement(20036..20614)
                     /locus_tag="EAE_RS00090"
                     /old_locus_tag="EAE_00100"
                     /inference="COORDINATES: protein motif:HMM:NF012422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878117.1"
                     /db_xref="GeneID:45318403"
                     /translation="MRHIQFYIMSDNSFFIIGVSRSVDGLAERQPFMVNNINMSMYCS
                     GQAFALYNDYFSIPRDQDCLKVIIADKDYLSVVALAISSDKVRDTLFIPSNQCTEECL
                     KNIIEVKSNRYRYNCMLPKFTLLGSITSREKRVCYYLYHGFSMKLIGIIMGIHPKTVS
                     GYRTRIMRKIGCKSKGDFNQTLIKYFRLCLDK"
     gene            21046..21852
                     /locus_tag="EAE_RS00095"
                     /old_locus_tag="EAE_00105"
                     /db_xref="GeneID:45318404"
     CDS             21046..21852
                     /locus_tag="EAE_RS00095"
                     /old_locus_tag="EAE_00105"
                     /inference="COORDINATES: protein motif:HMM:NF012698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_013878118.1"
                     /db_xref="GeneID:45318404"
                     /translation="MENIADQTYIVENVVEFSPQEHTLYSKVNGNKVTLLASASECFL
                     CLLENHGELVTKKELIHIGWEQYNLHVSDSTFNQNIFTLRKAFKDCGLNHEIIRTIPR
                     KGLMVSKTININLLIIKNELVDYMPVCKDSKEVDHTSPTKSQKYSKFIYRITAKLQLN
                     IFIIILIITCASGIVNGIYFTLPTSYLSNYRTILEGDNCHVKIDILRSALIDYKKFIS
                     SYNLHCKNSEYIYFSTYQYVPRISVFRCNHEFREHHRNDCVSWYFLDKKI"
     gene            21849..22331
                     /locus_tag="EAE_RS00100"
                     /db_xref="GeneID:45318405"
     CDS             21849..22331
                     /locus_tag="EAE_RS00100"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_047045797.1"
                     /db_xref="GeneID:45318405"
                     /translation="MIRNISLSLFLMALLFLLAVIAGRLLMIGVVAHRDAYFSCDAKV
                     VVVNGVSNLSLATSYFFEGDKGLVVFKGRMQQGEKIYNVSRKVLFNINSLQNISTLTS
                     TQVDTSPADNTPEELLQLMLPAFFYHPKNNMEYTIYHQGWNGYIFSTGYVPLFYCRRS
                     "
     gene            22775..23886
                     /locus_tag="EAE_RS00105"
                     /pseudo
                     /db_xref="GeneID:45318406"
     CDS             22775..23886
                     /locus_tag="EAE_RS00105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012543393.1"
                     /note="programmed frameshift; internal stop; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /db_xref="GeneID:45318406"
     gene            complement(23866..24126)
                     /locus_tag="EAE_RS00110"
                     /db_xref="GeneID:45318407"
     CDS             complement(23866..24126)
                     /locus_tag="EAE_RS00110"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_131629757.1"
                     /db_xref="GeneID:45318407"
                     /translation="MKSAKLGSTPGINHIELADSQEPVYSEYGEIRVRIISNSLNYHD
                     LNVASGVLPSSPGRLLMSDGAGVVEEVGEGVVNRPVLAPCIF"
     gene            24200..24601
                     /locus_tag="EAE_RS00115"
                     /old_locus_tag="EAE_00125"
                     /pseudo
                     /db_xref="GeneID:45318408"
     CDS             24200..24601
                     /locus_tag="EAE_RS00115"
                     /old_locus_tag="EAE_00125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013202605.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /db_xref="GeneID:45318408"
     gene            complement(24812..25384)
                     /locus_tag="EAE_RS00120"
                     /old_locus_tag="EAE_00130"
                     /db_xref="GeneID:45318409"
     CDS             complement(24812..25384)
                     /locus_tag="EAE_RS00120"
                     /old_locus_tag="EAE_00130"
                     /inference="COORDINATES: protein motif:HMM:NF023154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inovirus-type Gp2 protein"
                     /protein_id="WP_013878123.1"
                     /db_xref="GeneID:45318409"
                     /translation="MNNCAENEALKTNSDVNNVTLIRRVLQQATDHYPRLIALGFTLH
                     YGNCHSCDNVQQGNAQLLRFHAEAYCRIGDYSKIRIEAGKPSQPTLLRWLWEAESTLS
                     CRMMMLFNFDVCSLPRYDSSASYGIQEVMSLLVAAWREVELDGELTEIKVHRVERTKP
                     ADFDKRYAELRDTAMQMASPVAFAKSFPTT"
     gene            complement(25481..25702)
                     /locus_tag="EAE_RS00125"
                     /old_locus_tag="EAE_00135"
                     /db_xref="GeneID:45318410"
     CDS             complement(25481..25702)
                     /locus_tag="EAE_RS00125"
                     /old_locus_tag="EAE_00135"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_063410966.1"
                     /db_xref="GeneID:45318410"
                     /translation="MKQQPTKCAVDEWGNLVNAEDFRYPSFWKLYCFYCKSPVVLVLA
                     PNGQVSHFLHDETFMVSADFMACPNVECS"
     gene            complement(25736..26020)
                     /locus_tag="EAE_RS00130"
                     /old_locus_tag="EAE_00140"
                     /db_xref="GeneID:45318411"
     CDS             complement(25736..26020)
                     /locus_tag="EAE_RS00130"
                     /old_locus_tag="EAE_00140"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878125.1"
                     /db_xref="GeneID:45318411"
                     /translation="MKQPENMIAVKVAEYRLHIIRLRVCQDSLAGCCSDAERRGWRLR
                     ALEQLSKASSLYCQRASSADTCKFQQACEGLQQHINKVLPEGQWCSDLAA"
     gene            complement(26225..26803)
                     /locus_tag="EAE_RS00135"
                     /old_locus_tag="EAE_00145"
                     /db_xref="GeneID:45318412"
     CDS             complement(26225..26803)
                     /locus_tag="EAE_RS00135"
                     /old_locus_tag="EAE_00145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004129361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inovirus-type Gp2 protein"
                     /protein_id="WP_045362661.1"
                     /db_xref="GeneID:45318412"
                     /translation="MLKNSDRNFNEDWFLASVLNAHIDEMINRYSCLLALRMDFFYQK
                     ESARYSHLNHQTLEHDLRVLMEKMTKEKGVVGYFWVVEWTERHRYHAHVVFWLDRQKT
                     QHSYPFALTTNTFWEEITHWDGVSHRCEYRPQYSRNINIPVRYNDPESINNIRHVLSY
                     LAKEEQKEGLCAYGCNDVPPRSAAGRPRKPGP"
     gene            complement(27081..27320)
                     /locus_tag="EAE_RS00140"
                     /old_locus_tag="EAE_00150"
                     /db_xref="GeneID:45318413"
     CDS             complement(27081..27320)
                     /locus_tag="EAE_RS00140"
                     /old_locus_tag="EAE_00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013878127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family phage regulatory protein"
                     /protein_id="WP_013878127.1"
                     /db_xref="GeneID:45318413"
                     /translation="MTNKTHPISSSTQTTTSLLNDQLVDMTFITGYTNMTDKWFYRLI
                     SENAFPAPIKLGRSSRWLKSEVEKWMLERIQASRG"
     gene            27776..28873
                     /locus_tag="EAE_RS00145"
                     /old_locus_tag="EAE_00155"
                     /db_xref="GeneID:45318414"
     CDS             27776..28873
                     /locus_tag="EAE_RS00145"
                     /old_locus_tag="EAE_00155"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878128.1"
                     /db_xref="GeneID:45318414"
                     /translation="MSDSDNENYYLKRIGKLGAEELARPEESPYEGGNRFTSPESKFS
                     VDSLAEDESAQAAEDCDIEDRTGETASGNPISESSKNATGADEAIKRLMQNIQAGEKR
                     NVKSKSLHGGDSSCLQDVDLKWLKGAVNSRAIFWFWAYIRKASARELCLPENTAGLIP
                     EWDRKEENLYSFFRLPGNPTSSAERSRVIITFMNELSCSLSPEQSKKTFDYIRGIWLV
                     FNSQVQSPKWLKKNDNEAIEWAWSYLSRKKDIKRNILSWFKPADLNERYIGLMGAIDC
                     WAIPNKLDVGNYRKFLDDKDALVKNMRDSFKQRKRRSGKNDLTISAKASRELSELAVA
                     LDKKEIKVIEKLIHDEYLRYKSKLFDYKNPS"
     gene            28972..29865
                     /locus_tag="EAE_RS00150"
                     /old_locus_tag="EAE_00160"
                     /db_xref="GeneID:45318415"
     CDS             28972..29865
                     /locus_tag="EAE_RS00150"
                     /old_locus_tag="EAE_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013878129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_013878129.1"
                     /db_xref="GeneID:45318415"
                     /translation="MPQIHDPQDTSDAVRTCLNLLPRQATERILFRLKETINYEPVIG
                     IMGKSGAGKSSLCNALFQQPVCLTSDLLGCTREPQRLLLTIGERSMTLVDLPGVGETP
                     EYDEEYLALYKALLVELDLIIWVLRADDRARATDITAYRALMEAGADPSRFLFVLTQA
                     DRIPPLRDGEPWQASPSSEQCLSLAAVSAQVAGQLPSSFPVMAVSAHTGYNLPALVEL
                     IVHALPVQASSAVYCQLKPEHQTPDTVAAVRQQFGEAAGKAFDSVINPDHLPSVWTAL
                     LRSIRQKLVQLATALWDRIFG"
     gene            30151..30828
                     /locus_tag="EAE_RS00155"
                     /old_locus_tag="EAE_00165"
                     /db_xref="GeneID:45318416"
     CDS             30151..30828
                     /locus_tag="EAE_RS00155"
                     /old_locus_tag="EAE_00165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013878130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878130.1"
                     /db_xref="GeneID:45318416"
                     /translation="MKIQTVIALVLSAVSVSAQAGNWAVKNGWCQTLTDNGQALVMLK
                     NNTIGIFGQLQGCPNGPQELMGSRINVNGNLVPTSQMCNQQTGFKAVEVEGGQAPAAA
                     RKAIASIAGQETSTLQVFGAQLTFTRGDMMTVCPKYVSGLAASAGSRAPEINKGSVMK
                     AAKESYTKEYDRDTAEAADFGSYKVEGNTVVYEVYNAGYRTYDKVTVTVGADGKATGA
                     RVEYMGQ"
     gene            30924..31751
                     /locus_tag="EAE_RS00160"
                     /old_locus_tag="EAE_00170"
                     /db_xref="GeneID:45318417"
     CDS             30924..31751
                     /locus_tag="EAE_RS00160"
                     /old_locus_tag="EAE_00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000197395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF945 domain-containing protein"
                     /protein_id="WP_047057968.1"
                     /db_xref="GeneID:45318417"
                     /translation="MMRLASRFGAVNLVRRDRPLTRDELAHYVPSVFSEEKHESRSER
                     YTCIPTITLLDNLQREGFQPFFACQTRVRNPDKREHTKHMLRLRREGQITGKQVPEII
                     LLNSHDGSSSYQMLPGLFRSVCQNGLICGESFGEVRVPHKGNVVEKVIEGAYEVLGVF
                     DRVEEKRDAMQSLMLPPPAQQALAKAALTYRFGEEYQPLTESQLLAPRRWQDESGDLW
                     TTYQRIQENLIKGGLVGRAANGKRANTRAVKGIDSDVKLNRALWVMAENMLSLLGQS"
     gene            31775..32005
                     /locus_tag="EAE_RS00165"
                     /db_xref="GeneID:45318418"
     CDS             31775..32005
                     /locus_tag="EAE_RS00165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014837276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF905 domain-containing protein"
                     /protein_id="WP_072051205.1"
                     /db_xref="GeneID:45318418"
                     /translation="MHTEPALSLPDGPFTRHQETSLTELYKNVAIEDDQGTHFRLVVR
                     YNGTMVWRAWNFEPEAGRLLNCYITSYGIRKP"
     gene            32075..32515
                     /locus_tag="EAE_RS00170"
                     /old_locus_tag="EAE_00185"
                     /db_xref="GeneID:45318419"
     CDS             32075..32515
                     /locus_tag="EAE_RS00170"
                     /old_locus_tag="EAE_00185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001750285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="WP_045362630.1"
                     /db_xref="GeneID:45318419"
                     /translation="MNIALPDTSLVPAPITATFIPDEQRLSFWLQHFSTVPQWILLEP
                     RVFSRMDALCADYTGGIWNFFTLSNGGAFIAPDGDETWSLFNVLNGNSAILGNEAAGI
                     AVCLLAWNNHAWHTGSDVMCDHFYRLRDYALQHPECSAILQIID"
     gene            32526..33002
                     /gene="radC"
                     /locus_tag="EAE_RS00175"
                     /old_locus_tag="EAE_00190"
                     /db_xref="GeneID:45318420"
     CDS             32526..33002
                     /gene="radC"
                     /locus_tag="EAE_RS00175"
                     /old_locus_tag="EAE_00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008924959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_013878135.1"
                     /db_xref="GeneID:45318420"
                     /translation="MTGELTASPAVPVTTRRTVQRALSLLEKHLREPGALFTSTAAVR
                     DWLRLKMTGLEREVFIVLYLDNQHRLLECETLFSGTINSTEVHPREVVKSALRHNAAA
                     VLLAHNHPSGEAEPSLADKQITDRLMKALSLVEVRVLDHCIVGGMTVSSFAERGWL"
     gene            33015..33347
                     /locus_tag="EAE_RS00180"
                     /old_locus_tag="EAE_00195"
                     /db_xref="GeneID:45318421"
     CDS             33015..33347
                     /locus_tag="EAE_RS00180"
                     /old_locus_tag="EAE_00195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007665153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV toxin-antitoxin system YeeU family
                     antitoxin"
                     /protein_id="WP_013878136.1"
                     /db_xref="GeneID:45318421"
                     /translation="MSSTDIQQWGLRHNISPCFGARLVLERSRLHFLADRASFNGQFT
                     EEQALRIDRAFPLMMKKLELMLSTGELNPRHPHCVTLQHNGLTCEADTLGSCGYVYLS
                     IYPTRLST"
     gene            33359..33595
                     /locus_tag="EAE_RS00185"
                     /old_locus_tag="EAE_00200"
                     /db_xref="GeneID:45318422"
     CDS             33359..33595
                     /locus_tag="EAE_RS00185"
                     /old_locus_tag="EAE_00200"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878137.1"
                     /db_xref="GeneID:45318422"
                     /translation="MSVPIVRMNSLWWESGNIAVREEEDSLVISEPLSTFPPDHLFLK
                     SGPGLKRVMTVSRLPETLRVNRYMAFNETYLNED"
     gene            complement(33828..34781)
                     /locus_tag="EAE_RS00190"
                     /old_locus_tag="EAE_00205"
                     /db_xref="GeneID:45318423"
     CDS             complement(33828..34781)
                     /locus_tag="EAE_RS00190"
                     /old_locus_tag="EAE_00205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004112486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_052766685.1"
                     /db_xref="GeneID:45318423"
                     /translation="MVMLWMLRLLYYRLSVHYAQYYYRLVSQYQQEWWTEHQLHFTLS
                     DVVLLGPSGSTNTHWWRLLKHEQRPAEVKNEANGKALRVARTLVEPAHEREVQLAKML
                     VLQWKEQRLHAGLPDLRCCYWQGSRRAWQAFCAQMQAAFPTVGLPAEPRLWRGEQSLA
                     EFAAISDTLASNEAILVAGCHSLMASFYSVLPAGESAALWLVGKGGSVCLTRGEVYDV
                     TDKETLSETCSRAERQIGLEEPPDACILFAQPTLSGCGWNITRHRQDAYWGNCGEMEM
                     LIVIALAAISAEYFRRPCSWIARDPQHTLALGIVKPGGEEN"
     gene            complement(35024..37474)
                     /locus_tag="EAE_RS00195"
                     /old_locus_tag="EAE_00210"
                     /db_xref="GeneID:45318424"
     CDS             complement(35024..37474)
                     /locus_tag="EAE_RS00195"
                     /old_locus_tag="EAE_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016536808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2235 domain-containing protein"
                     /protein_id="WP_013878139.1"
                     /db_xref="GeneID:45318424"
                     /translation="MSAIISERAWYPPAFPAQGRLPTQAALVGQNSLRQESLETAYRQ
                     QLSLAVGRRVDPPCCKTLHISLFFDGTGNNLNHDLFVANPKHPTNIARLFRATIGQGY
                     AGGLADKGPELLDASNSGGNKYYKYYIPGVGTPFPEVMDLDFSTMGLAAATHGEDRIN
                     WGLLRLVDALKRTMDKDALSDGDSWKAVKKMATSMVSFGLTGGANRYETIHNLLNAMS
                     ADLHKALLPATPGKQKLLGIKLYVYGFSRGAAAARTFVNWLSELLPKPGEGETKPEQC
                     LAVGELKIPLSVEFLGLLDTVASVGVAHIAPVAEGHMGWADGSQELPDEEFYGGFIKR
                     CVHLVSAHEQRLCFPLDSIRRPDGKYPANSVEVIYPGVHSDIGGGYPPGDQGKANAVN
                     DGYLLSQIALHEMFASAFEYGAPLKLPMEILPQDLARDAWRTMSFDLGREFYLSRILI
                     NRFNAWRELTLGLPTPQDPGSAELAAKYDPQRAPLCLERALEEQIAWITAWRINRYAG
                     GSYKTQRFYIDSAANGLDKDSDPQVRKKSEVEREEAQQAVEKARRKRIVEQDQESAFL
                     MLPQGPKDFDAALGQTQLRQAADEFREDYHRLSRTDNGNWLFKAVDAMSNAIFLLNGD
                     DEYGEWLKIKTTGAEREKILFPPQGESSNAHLPAGLVRALFDEQIHDSRAWFMHSALG
                     AREPWGSYFLQRMIYFGSRSSKPLTPLMIAGAVVGAATVAGGVAVIIKQKRVMGELIG
                     VIGAAGAIYLETQAIDLLSGKPLSMLENAAQLQLPTMEPGVVVAGQTQMISEQRQALK
                     KSQIEKRWTESIASTLLV"
     gene            complement(37462..37971)
                     /locus_tag="EAE_RS00200"
                     /old_locus_tag="EAE_00215"
                     /db_xref="GeneID:45318425"
     CDS             complement(37462..37971)
                     /locus_tag="EAE_RS00200"
                     /old_locus_tag="EAE_00215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011147446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3304 domain-containing protein"
                     /protein_id="WP_013878140.1"
                     /db_xref="GeneID:45318425"
                     /translation="MNLTFPRVIQVALLLTVTSQGTLAGTIKAINHTRWAINAFSVDG
                     QSGIDIIGPYQGGGGGCCYQVPAKWRPGMTVKVNWETGVGDMNGFPGFGDDAKYLAWE
                     KKMIKLNKRHSKVVSVPDYTGQETCGITVHFLPCDRAKVTTSCANYGSPGYPIKEPIK
                     MMEPKLCPR"
     gene            complement(38020..38799)
                     /locus_tag="EAE_RS00205"
                     /old_locus_tag="EAE_00220"
                     /db_xref="GeneID:45318426"
     CDS             complement(38020..38799)
                     /locus_tag="EAE_RS00205"
                     /old_locus_tag="EAE_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012006216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4123 domain-containing protein"
                     /protein_id="WP_013878141.1"
                     /db_xref="GeneID:45318426"
                     /translation="MQCISYWVSKLEPLCAEIETEYLDFIIDQSGLDYSIIPALEEFS
                     PPLQWQSLYLGLPEESLPKIAPLLIRIVLNAPLQRQWFIELAYKTQTRTPLLAIGSQW
                     TFSTLAEWLTDCVDATHEGRSGLFRYFDARLFPWLFSDILQPEQQVQLRRPALFWSWL
                     DLDARPALLIGHGAPLGRGEKCQKIAFSDEQFEVMMCLCDVRLFLRHRSLPNSWFNSQ
                     EERFSACFRAMLDATKNGILLDNDREEWVMNTLVERHSPAE"
     gene            39112..39603
                     /locus_tag="EAE_RS00210"
                     /old_locus_tag="EAE_00225"
                     /db_xref="GeneID:45318427"
     CDS             39112..39603
                     /locus_tag="EAE_RS00210"
                     /old_locus_tag="EAE_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WbuC family cupin fold metalloprotein"
                     /protein_id="WP_013878142.1"
                     /db_xref="GeneID:45318427"
                     /translation="MKQITISDMQQQSAAAAAAPRLRAHRNFHPELSDPVQRLAIAME
                     PGTYIRPHRHPHTFELLLPLSGRFVVLNFDEQGTVTQRVVLGEECTALEMSAGTRHAV
                     LSLDRGGIIFEVKHGGYQPVAEQDSAPWAPAEGAPGTEELMAWYATAQVGDGGFTLQD
                     NAH"
     gene            39982..40815
                     /locus_tag="EAE_RS00215"
                     /old_locus_tag="EAE_00230"
                     /db_xref="GeneID:45318428"
     CDS             39982..40815
                     /locus_tag="EAE_RS00215"
                     /old_locus_tag="EAE_00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878143.1"
                     /db_xref="GeneID:45318428"
                     /translation="MNNLPPLEYCSIARAQKLLQCELEDLLHWHDIGAISLCLKLKKN
                     RGTLNSALTRNQGVGDSSYGYGGFDDITKANKPWSQHSKINNIITLNENVSVIDADHD
                     SAIAKIKLNVSVSGLWHTHSRNLMDVLENPDNIQQEDTLSIISPAKNVIYCNFIPDND
                     DKPTIELSKLYITSKEIEKIYEHTISSRPLEYSEAAMNSYNEKTINEPSTPPQNKLLL
                     EFINYIIQSNPAFNRDLLNATESSKQLAFKSIMEKLKKEGIVTNENHSMASLSELILN
                     S"
     gene            41170..41847
                     /locus_tag="EAE_RS00220"
                     /old_locus_tag="EAE_00235"
                     /db_xref="GeneID:45318429"
     CDS             41170..41847
                     /locus_tag="EAE_RS00220"
                     /old_locus_tag="EAE_00235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MipA/OmpV family protein"
                     /protein_id="WP_013878144.1"
                     /db_xref="GeneID:45318429"
                     /translation="MPKGWVLGGAAISGTARYQKQDNETHFIPGGLYFGDQLMYLGDR
                     ARYYFHLDDNIALYGYGRWRFGNLDPDDDTAFRGMNERKGELEGGIGATWITPYALIS
                     ARISSDISGRSNGQELLLWADFPIIKDNLLVMPGMGLMVRSHNMANYYFGGISASEAT
                     PERPQWDTGTTVSPMVAIITSYRFSPHWVGMIAANYERYDDDIANSPIVQHSGELYGI
                     LGVGYTW"
     gene            42006..42461
                     /locus_tag="EAE_RS00225"
                     /old_locus_tag="EAE_00240"
                     /db_xref="GeneID:45318430"
     CDS             42006..42461
                     /locus_tag="EAE_RS00225"
                     /old_locus_tag="EAE_00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside deaminase"
                     /protein_id="WP_013878145.1"
                     /db_xref="GeneID:45318430"
                     /translation="MPTHDNHLQRAITLAAANVENGGRPFGAVIVRHGEVIAEAVNTL
                     HQSGDPTAHAELNAIRDVSLRLGNQVLRECVVYASGQPCPMCLSAMYLTGVREVYFAN
                     SNQDGERFNLSTAAIYQQLQQPLDNQSLPIHHCPQPEGLALYQRWADKA"
     gene            42461..43657
                     /locus_tag="EAE_RS00230"
                     /old_locus_tag="EAE_00245"
                     /db_xref="GeneID:45318431"
     CDS             42461..43657
                     /locus_tag="EAE_RS00230"
                     /old_locus_tag="EAE_00245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_013878146.1"
                     /db_xref="GeneID:45318431"
                     /translation="MSQTQRKTLTLFVLVLIGINMRPLLTSIGPLLPQLRHATGMSFT
                     LVSLLTALPVIAMGVLALAGGWVNRHVSENRSIALSLLAISIGAMLRELAPQSGLLLS
                     SALLGGIGIGVIQAIIPSVIKRLFHRRTPQVMGLWSAALMGGGGLGAAITPWLAQHSA
                     LWHHALAWWTLPALAAIIGWLPLCKMLPAAPVAASAQVAPAVFRHHRAWTLGLYFGLI
                     NGGYASLIAWLPPYYMQLGHSAQFSGTLLALMTVGQTAGALVLPMLARHEDRRKLLML
                     ALALQLFGFCGFIWWPQQWPLLWAVSCGVGLGGAFPLCLVLALDHSPQPAVAARLVAF
                     MQGIGFIIAGLSPWLSGLLRSLSGNYQLDWEFHAICVFILMALTLRFVPARYPHQWRA
                     PTTTAR"
     gene            44024..44095
                     /gene="ypdK"
                     /locus_tag="EAE_RS00235"
                     /db_xref="GeneID:45318432"
     CDS             44024..44095
                     /gene="ypdK"
                     /locus_tag="EAE_RS00235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006120362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein YpdK"
                     /protein_id="WP_077777854.1"
                     /db_xref="GeneID:45318432"
                     /translation="MKYFLMGISFMVIVWAGTFALMI"
     gene            complement(44140..45378)
                     /gene="alaC"
                     /locus_tag="EAE_RS00240"
                     /old_locus_tag="EAE_00250"
                     /db_xref="GeneID:45318433"
     CDS             complement(44140..45378)
                     /gene="alaC"
                     /locus_tag="EAE_RS00240"
                     /old_locus_tag="EAE_00250"
                     /EC_number="2.6.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_416880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine transaminase"
                     /protein_id="WP_013878147.1"
                     /db_xref="GeneID:45318433"
                     /translation="MAEFSPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMG
                     NPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQERYDVDIDPESEAI
                     VTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNE
                     LERAIRESYPKPKMMILGFPSNPTAQCVELDFFEKVVALAKRYDVLVVHDLAYADIVY
                     DGWKAPSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVNALARIKSYHDYG
                     TFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVECPKASMYVWAKI
                     PQPYAAMGSLEFAKKLLQEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAIRGIKS
                     MFRADGLLPAASKTVTEHHE"
     gene            45760..47457
                     /locus_tag="EAE_RS00245"
                     /old_locus_tag="EAE_00255"
                     /db_xref="GeneID:45318434"
     CDS             45760..47457
                     /locus_tag="EAE_RS00245"
                     /old_locus_tag="EAE_00255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013878148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_013878148.1"
                     /db_xref="GeneID:45318434"
                     /translation="MHDIFNMLLAVFDRAALMLICLFFLIRLRLFRELLHKSAHTPRE
                     LLAVTAIFSMFALFSTWSGVPVEGSLVNVRIIAVMSGGILFGPWVGAIVGVIAGVHRY
                     LIDIDGVTAIPCFITSIVAGLLSGLINRKIPKAQRWKVGILAGMLCETLTMILVVLWA
                     PTLALGIDIVSKIGIPMILGSICIGFIVLLVQSVEGEKEASAARQAKLALDIANKTLP
                     LFRHVNSESLRQVCDIIRRDINADAVAITTTDRVLAYVGYGENNYNDRNNDISPTTRQ
                     AIESDTIIIKNNDEAYRTPEIHSMLVIPLREKGVVTGTLKIYYCHAHRITSSLQEMAI
                     GLSQIISTQLEVSRAEQLREMANKAELRALQSKINPHFLFNALNAISSSIRMNPDTAR
                     QLIFNLSRYLRYNIELKDDEQIDIKRELYQIKDYIAIEQARFGDKLTVIYDIDEDVSC
                     VIPSLLIQPLVENAIVHGIQPCRGKGVVTIAINECGNRVRISVRDTGNGIDPAVVARV
                     EADEMPGNKIGLLNVHHRVKLLYGEGLHIRRLTPGTEIAFYVPNQHAPASEPVSLLP"
     gene            47454..48212
                     /locus_tag="EAE_RS00250"
                     /old_locus_tag="EAE_00260"
                     /db_xref="GeneID:45318435"
     CDS             47454..48212
                     /locus_tag="EAE_RS00250"
                     /old_locus_tag="EAE_00260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_161798743.1"
                     /db_xref="GeneID:45318435"
                     /translation="MSGENMKVIIVEDEFPAQQELTWLINTHSQMEIVGTFDDGLDVL
                     KFLQHNKVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFD
                     YILKPYQESRIINMLQKLSSAWQQQQQVAVSGAPAHNPTRENDTINLIKDERIIVTSI
                     HDIYYAEAHEKMTFVYTRRESFVMPMNITEFCSKLPAAHFFRCHRSYCVNLNKIREIE
                     PWFNNTYVLRLRDLEFQVPVSRSKVKEFRQLMNL"
     gene            complement(48256..49221)
                     /gene="glk"
                     /locus_tag="EAE_RS00255"
                     /old_locus_tag="EAE_00265"
                     /db_xref="GeneID:45318436"
     CDS             complement(48256..49221)
                     /gene="glk"
                     /locus_tag="EAE_RS00255"
                     /old_locus_tag="EAE_00265"
                     /EC_number="2.7.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucokinase"
                     /protein_id="WP_013878150.1"
                     /db_xref="GeneID:45318436"
                     /translation="MTKFALVGDVGGTNARLALCDIASGEISRAKTYSGLDYPSLEAV
                     VRVYLNEQAVKVDDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFT
                     AVSMAIPMLKDEHLIQFGGAQPAEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGH
                     VDFAPNSEEEGIILEELRNELGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDV
                     TERALADTCIDCRRALSLFCVIMGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASG
                     FRGGFEDKGRFKAYVQDIPVYLIVHDNPGLLGSGAHLRQTLGHIL"
     gene            49486..50721
                     /locus_tag="EAE_RS00260"
                     /old_locus_tag="EAE_00270"
                     /db_xref="GeneID:45318437"
     CDS             49486..50721
                     /locus_tag="EAE_RS00260"
                     /old_locus_tag="EAE_00270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ion channel protein"
                     /protein_id="WP_013878151.1"
                     /db_xref="GeneID:45318437"
                     /translation="MLHPRARTMLLLSIPAILIGIASSLVLIVAMKIAAILQSILWSD
                     LPAHVGIAADSPLWIIAILTLTGIAVGLVVRFSPGHGGPDPATESLIGAPIATNALPG
                     LLAALILGLAGGVSLGPEHPIMVVNIALAVALGSRLFPRVSSLDWTILAASGTIGALF
                     GTPVAAALIFSQTLNSSSDVPLWDRLFAPLLAAAAGALTTGIFFHPNFTLPIPHYPHL
                     RIVDIISGAIVTLIAIAVGMVAVWCLPRLHALIHRLKNPVLMLGIGGFLLGILGVIGG
                     HITLFKGLDEMQQLASSQTLGAGDFLLIAVVKLAALVLASACGFRGGRIFPAVFVGVS
                     LGLMLHAHVEAVPAAITISCAILGLVLVVTRDGWLSLFMASVVVPDTTLLPLLCIVML
                     PAWLLLAGKPLMIAKRRGD"
     gene            complement(50718..52379)
                     /locus_tag="EAE_RS00265"
                     /old_locus_tag="EAE_00275"
                     /db_xref="GeneID:45318438"
     CDS             complement(50718..52379)
                     /locus_tag="EAE_RS00265"
                     /old_locus_tag="EAE_00275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078213.1"
                     /note="thiamindiphosphate-dependent; catalyzes the
                     formation of indoleacetaldehyde from indolepyruvate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indolepyruvate decarboxylase"
                     /protein_id="WP_013878152.1"
                     /db_xref="GeneID:45318438"
                     /translation="MQPTYTIGDYLLDRLVDCGIDRLFGVPGDYNLQFLDHVIAHQDL
                     GWVGCANELNAAYAADGYARIKGAGALLTTYGVGELSALNGVAGSYAEHIPVLHIVGA
                     PSTGAQQRGELLHHTLGDGDFTHFSRMSEQITCTQATLTAGNACHEIDRVLSDMLTHH
                     RPGYLMLPADVAKARAVPPARALVIKGPAADENQLAGFREHAAKLLRSSRRVSLLADF
                     LAQRYGLQNTLQQWVKSAPITHATMLMGKGLFDEQGSGFAGTYSGIASAPQTREAMES
                     ADAIICVGTRFTDTITAGFTHHLPTEKTIEIQPFAARVGDHWFSRIPMDQALAALIDV
                     SGKLSAEWSAPDIIAPDASGAPQGNLTQKSFWSTVEKQLRPGDIILADQGTSAFGIAS
                     LKLPSQATLLVQPLWGSIGFTLPAAYGAQTAAADRRVVLIIGDGAAQLTIQEMSSMLR
                     DKQKLLILLLNNEGYTVERAIHGPEQRYNDIALWDWSRFPDAFAPDTPSRCWRVTQTG
                     ELAEAMADSINSDKLTMVEVMLPKMDIPDFLRAVTQALENRNNRG"
     gene            52555..53547
                     /gene="mgrA"
                     /locus_tag="EAE_RS00270"
                     /old_locus_tag="EAE_00280"
                     /db_xref="GeneID:45318439"
     CDS             52555..53547
                     /gene="mgrA"
                     /locus_tag="EAE_RS00270"
                     /old_locus_tag="EAE_00280"
                     /EC_number="1.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-glyceraldehyde 3-phosphate reductase"
                     /protein_id="WP_013878153.1"
                     /db_xref="GeneID:45318439"
                     /translation="MVYQASNTRYQAMEYRRCGRSGLKLPAISLGLWHNFGDKTLVEN
                     SRQLLRHAFDLGITHFDLANNYGPPPGSAESNFGRILKEDFLPYRDELIISSKAGYTM
                     WDGPYGDWGSRKYLVASLNQSLKRMGLEYVDIFYHHRPDPETPLEETMRALDHLVRQG
                     KALYVGLSNYPLEQARQAIAILNDLGTPCLIHQPKYSMFERWVEEGLLAMLQAEGVGS
                     IAFSPLAGGQLTNRYLNGIPPDSRAASNSRFLLPEQLTAERLEKVRQLDAIAGRRGQK
                     LSQMALAWVLREDKVTSVLIGASKTAQLDDAVGMLSNRQFSAEECAAIDAILAV"
     gene            53675..54031
                     /locus_tag="EAE_RS00275"
                     /old_locus_tag="EAE_00285"
                     /db_xref="GeneID:45318440"
     CDS             53675..54031
                     /locus_tag="EAE_RS00275"
                     /old_locus_tag="EAE_00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2502 domain-containing protein"
                     /protein_id="WP_013878154.1"
                     /db_xref="GeneID:45318440"
                     /translation="MFRSLILAAVLLACAPVIANAGEITLLPSVKLQIGDRDGYGNYW
                     DGGGWRDRDYWRRHYEWRDHRWHRHDNGWHRGWDKRGWDRGRAYERGYREGWNDRRGG
                     WGRGPGGGRGHGHGHH"
     gene            complement(54071..55306)
                     /locus_tag="EAE_RS00280"
                     /old_locus_tag="EAE_00290"
                     /db_xref="GeneID:45318441"
     CDS             complement(54071..55306)
                     /locus_tag="EAE_RS00280"
                     /old_locus_tag="EAE_00290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mn(2+) uptake NRAMP transporter MntH"
                     /protein_id="WP_013878155.1"
                     /db_xref="GeneID:45318441"
                     /translation="MTSSRVENSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQA
                     GASFGYQLLWVVVWANLMAMLIQVLSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAE
                     IIAMATDLAEFIGAAIGFKLLLGISLLQGAVLTGVATFLILMLQRRGQKPLEKVIGGL
                     LLFVAAAYVVELIFSQPALAPLTKGMIIPSLPNGEAVFLAAGVLGATIMPHVIYLHSS
                     LTQNLHDGSRKERYNATRWDVAIAMTIAGFVNLAMMATAAAAFHFNGHTGVADLDQAY
                     LTLEPLLSHAAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFIRFHIPLWFRRTITMLP
                     SFIVIMMGLDPTRILVMSQVLLSFGIALALVPLLIFTSDARLMGDLVNSRWVKHIGWL
                     IVAIVVALNGWLIIGSALD"
     gene            55652..56854
                     /gene="nupC"
                     /locus_tag="EAE_RS00285"
                     /old_locus_tag="EAE_00295"
                     /db_xref="GeneID:45318442"
     CDS             55652..56854
                     /gene="nupC"
                     /locus_tag="EAE_RS00285"
                     /old_locus_tag="EAE_00295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside permease NupC"
                     /protein_id="WP_013878156.1"
                     /db_xref="GeneID:45318442"
                     /translation="MDRVLHFVLAIVVVAILALLVSHNRKQIRIRYVIQLLVIEVLLA
                     WFFLNSDVGLGFVKGFSEMFEKLLGFANEGTNFVFGNMNDKGLAFFFLKVLCPIVFIS
                     ALIGILQHIRILPIVIRAIGTVLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGK
                     MSRNRMYTMAATAMSTVSMSIVGAYMTMLQPKYVVAALVLNMFSTFIVLSLINPYRVE
                     QSEENLQMSNLHEGQSFFEMLGEYILAGFKVAIIVAAMLIGFIALISALNALFATVTG
                     WFGYSISFQGILGYIFYPVAWVMGVPASEALQVGSIMATKLVSNEFVAMMDLQKVAAT
                     LSPRAEGIISIFLVSFANFSSIGIIAGAIKGLNEEQGNVVSRFGLKLVYGSTLVSVLS
                     ASIAALVL"
     gene            complement(56910..59093)
                     /locus_tag="EAE_RS00290"
                     /old_locus_tag="EAE_00300"
                     /db_xref="GeneID:45318443"
     CDS             complement(56910..59093)
                     /locus_tag="EAE_RS00290"
                     /old_locus_tag="EAE_00300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013878157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_013878157.1"
                     /db_xref="GeneID:45318443"
                     /translation="MTDIFNIKVKKTLLALIVCLIFIPLSRLISPQTLIDGKKIYLAW
                     LPLSVMYATICIFGRYAVAPLIVAFAITNTFVIDLTYTQAAILLFCQLFSVFFTFAIM
                     RSLSGKKWRSGRPAKRHIGRRIFWGGFFAPILLKLTMYLAGRFFAFPLAVSSYFSTAS
                     IIYSVIDIQALICAALIFTTAFYYPMRMMVCPRYRRVFWLRHCQPWLVKKRRAFTIYW
                     FMALITIMLVLCAPFDSDLIAGYLVPIIFILYFIGIGRLGHELIRITWAISAFFLVAY
                     NKNFLQGVQSGYSLSFVLSVLISFTICLFYMTDIYSRSERIKQRWRDRAEEDPLTGLP
                     NLRALEGHLRQSPRVVISSLRIENLDFLSRHYGMMMRVECKRQIARRLQPLLDHHDKI
                     YQLPGSELLLVIEGPEPAARLNHIVSMLNHAKFNWHNQDLDLEFGAAWGSYSGIETEL
                     HPMLGQLSWLSEQAGAVQRVLALDIAQEEVSDQTTEQVRMLTKIKQALNERSLLLYAQ
                     PIQNAEGEGYYEILTRMRCGETIITPDRFIPLIAQFNLSQRFDMLVLETLFSQIDHHP
                     GRRFSVNLLPYTLMQKDSAAQIIALFKRYRVSPAYITIEITEEQAFSNADTSMHNIQL
                     LSEFGCAIAIDDFGTGYANYERLKSLQADIVKIDGCFVHEIESDQLDAIIVKSIIEIA
                     RAKQLTVVAEYVETEAQKAMLLALGVDYLQGYLIGKPQPLSELKA"
     gene            complement(59304..59379)
                     /locus_tag="EAE_RS00295"
                     /old_locus_tag="EAE_t24802"
                     /db_xref="GeneID:45318444"
     tRNA            complement(59304..59379)
                     /locus_tag="EAE_RS00295"
                     /old_locus_tag="EAE_t24802"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(59344..59346),aa:Ala,seq:ggc)
                     /db_xref="GeneID:45318444"
     gene            complement(59421..59496)
                     /locus_tag="EAE_RS00300"
                     /old_locus_tag="EAE_t24804"
                     /db_xref="GeneID:45318445"
     tRNA            complement(59421..59496)
                     /locus_tag="EAE_RS00300"
                     /old_locus_tag="EAE_t24804"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(59461..59463),aa:Ala,seq:ggc)
                     /db_xref="GeneID:45318445"
     gene            59716..60069
                     /locus_tag="EAE_RS00305"
                     /old_locus_tag="EAE_00310"
                     /db_xref="GeneID:45318446"
     CDS             59716..60069
                     /locus_tag="EAE_RS00305"
                     /old_locus_tag="EAE_00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding transcriptional regulator"
                     /protein_id="WP_013878158.1"
                     /db_xref="GeneID:45318446"
                     /translation="MLKERMTPEEIAHLTGFSRQTINKWVRKEGWQTSPRPGVQGGKA
                     RLVHVNEQVREFIRNAQRVAETPSPYSVAETDLEPLLLTLCKEMTHREQKQLMSLLLR
                     EGITGLLNRLGIRGQ"
     gene            60077..60472
                     /locus_tag="EAE_RS00310"
                     /old_locus_tag="EAE_00315"
                     /db_xref="GeneID:45318447"
     CDS             60077..60472
                     /locus_tag="EAE_RS00310"
                     /old_locus_tag="EAE_00315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding transcriptional regulator"
                     /protein_id="WP_013878159.1"
                     /db_xref="GeneID:45318447"
                     /translation="MMKLKEKMTPAELAEVLGLARQTVNRWAREQKWRTEAIPGVKGG
                     RARLIVIDRPVIDFLTNIPAFRHLNEEYQLAEQPSGYFINEADAVWRQIADTLQLMTA
                     AEQTHLRDLLARDGISGFLARLGISPATK"
     gene            complement(60527..61945)
                     /gene="gltX"
                     /locus_tag="EAE_RS00315"
                     /old_locus_tag="EAE_00320"
                     /db_xref="GeneID:45318448"
     CDS             complement(60527..61945)
                     /gene="gltX"
                     /locus_tag="EAE_RS00315"
                     /old_locus_tag="EAE_00320"
                     /EC_number="6.1.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="WP_013878160.1"
                     /db_xref="GeneID:45318448"
                     /translation="MKIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDT
                     DLERSTPEAIEAIMDGMNWLNLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSK
                     ERLDALREEQMANGEKPRYDGRCRHDHQHHAADEPCVVRFANPQEGSVIFDDQIRGPI
                     EFSNQELDDLIIRRTDGSPTYNFCVVVDDWDMAITHVIRGEDHINNTPRQINILKALN
                     APVPVYAHVSMINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWSHGDQEI
                     FTREEMIEFFSLGAVSKSASAFNTDKLLWLNHHYINTLPAEYVATHLQWHIEQENIDT
                     RNGPQLSELVKLLGERCKTLKEIAQSCRYFYEEFAEFDADAAKKHLRPVARQPLEVVR
                     DKLAAISDWTAENVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGK
                     SRSIERINKALAFIAERESQQS"
     gene            62204..62279
                     /locus_tag="EAE_RS00320"
                     /old_locus_tag="EAE_t24806"
                     /db_xref="GeneID:45318449"
     tRNA            62204..62279
                     /locus_tag="EAE_RS00320"
                     /old_locus_tag="EAE_t24806"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:62237..62239,aa:Val,seq:tac)
                     /db_xref="GeneID:45318449"
     gene            62326..62401
                     /locus_tag="EAE_RS00325"
                     /old_locus_tag="EAE_t24808"
                     /db_xref="GeneID:45318450"
     tRNA            62326..62401
                     /locus_tag="EAE_RS00325"
                     /old_locus_tag="EAE_t24808"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:62359..62361,aa:Val,seq:tac)
                     /db_xref="GeneID:45318450"
     gene            62448..62523
                     /locus_tag="EAE_RS00330"
                     /old_locus_tag="EAE_t24810"
                     /db_xref="GeneID:45318451"
     tRNA            62448..62523
                     /locus_tag="EAE_RS00330"
                     /old_locus_tag="EAE_t24810"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:62481..62483,aa:Val,seq:tac)
                     /db_xref="GeneID:45318451"
     gene            62528..62603
                     /locus_tag="EAE_RS00335"
                     /old_locus_tag="EAE_t24812"
                     /db_xref="GeneID:45318452"
     tRNA            62528..62603
                     /locus_tag="EAE_RS00335"
                     /old_locus_tag="EAE_t24812"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:62561..62563,aa:Lys,seq:ttt)
                     /db_xref="GeneID:45318452"
     gene            62699..62836
                     /locus_tag="EAE_RS00340"
                     /db_xref="GeneID:45318453"
     ncRNA           62699..62836
                     /ncRNA_class="other"
                     /locus_tag="EAE_RS00340"
                     /product="RtT sRNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00391"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="rtT sRNA, processed from tyrT transcript; Derived
                     by automated computational analysis using gene prediction
                     method: cmsearch."
                     /db_xref="RFAM:RF00391"
                     /db_xref="GeneID:45318453"
     gene            complement(62922..64727)
                     /locus_tag="EAE_RS00345"
                     /old_locus_tag="EAE_00325"
                     /db_xref="GeneID:45318454"
     CDS             complement(62922..64727)
                     /locus_tag="EAE_RS00345"
                     /old_locus_tag="EAE_00325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013814761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_013878161.1"
                     /db_xref="GeneID:45318454"
                     /translation="MELSVPFMLVIISIASLLAQWLAWRLRIPSILPLLLIGVLLGPG
                     VHLLQPDILFGPLLFPLVSLSVAIILFEGALTLRFDEIRGLGGIVRNLVTVGMLITFA
                     VISLTCWGILGLTPQISALIGAVTVVTGPTVISPLMRVVRPTASINQVLRWEGIVIDP
                     VGAIFTLLVFEFITLQEQTGTWLHLLIMLTKTVVIGLVSGAVFGVFLGNALRRGWIPG
                     YLQNFAVLSFVLLTFGVSNTLADESGLLAVTVLGIWLANMREVETSDIVEFKEELSAI
                     LLSALFIILAARLDIHALWAMGWPLLILMLIVQFVARPLCILVSTWRSSLHWRDRLML
                     CWIAPRGIVAAAVSSLFALTLQKKGYENADQLVTVVFAIIIGTVVLQSLTSSQLARWL
                     GVQQRRPRGVLIVGANTVARTLAQALRKLDIPVQLSDNSWEYYRLARMEGLPTYYGNV
                     WSEHAENYLNLSEIRQVIALSPNRHQNALTTLHFQHIFGNNRVFSIRTGPVTKGRSEK
                     ETRHEQLFDTDMTWARLSSLIAKGAVMKVTRLNNNFGWPEYLSTNPGATPLFAQREDG
                     NLIAINNGIMPPPPCTVVAIIEPGVESEKIPSEAY"
     gene            complement(64977..65903)
                     /locus_tag="EAE_RS00350"
                     /old_locus_tag="EAE_00330"
                     /db_xref="GeneID:45318455"
     CDS             complement(64977..65903)
                     /locus_tag="EAE_RS00350"
                     /old_locus_tag="EAE_00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_013878162.1"
                     /db_xref="GeneID:45318455"
                     /translation="MNYSLRQLKVFVTVARARSFSRAGEIIGLSQSAVSHSVKELEHQ
                     TGVRLLDRTTREVVLTEAGHQLAGKLERLLDELHVTLREAGRVGQQLTGTVRVAASQT
                     ISAHLIPQCIAHSNRRYPDIDFVLHDRPQQWVLESIRQGEVDFGIVIDPGTATDLQCE
                     SVLAEPFLLLCREDHRFSRQLSVNWQELQGERLVLQDYASGSRPLIDAALARFAIKAD
                     IVQEIGHPATLFPMVESGIGISVLPALALPLPQGSRLQVKRLTPVVERQLMLAQRKNR
                     SLSTAAQALWEIVREEGANLTSARIEDPLYQR"
     gene            65993..66991
                     /locus_tag="EAE_RS00355"
                     /old_locus_tag="EAE_00335"
                     /db_xref="GeneID:45318456"
     CDS             65993..66991
                     /locus_tag="EAE_RS00355"
                     /old_locus_tag="EAE_00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013878163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="WP_013878163.1"
                     /db_xref="GeneID:45318456"
                     /translation="MKLFRILDPFTLTLITVVLLASFFPARGEFVPFVEHLTTAAIAL
                     LFFMHGAKLSREAIIAGGSHWRLHLWVMCSTFIVFPVLGVLFAWWAPIKVDPMLYSGF
                     IYLCILPATVQSAIAFTSLAGGNVAAAVCSASASSLLGIFVSPLLVGLLMHLHGAGGD
                     LEQVGKIMLQLLLPFVLGHLSRPWIGSWVAKHKKWIGKTDQTSILLVVYSAFSEAVVN
                     GIWHKVGVGSLLFIVVVSLVLLAIVIAINVFVARRCGFSKPDEITIVFCGSKKSLANG
                     IPMANILFPASILGIMVLPLMIFHQIQLMVCAVLARRYKAQTDAQQAQEKSRATAG"
     gene            complement(66988..67206)
                     /locus_tag="EAE_RS00360"
                     /old_locus_tag="EAE_00340"
                     /db_xref="GeneID:45318457"
     CDS             complement(66988..67206)
                     /locus_tag="EAE_RS00360"
                     /old_locus_tag="EAE_00340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013878164.1"
                     /db_xref="GeneID:45318457"
                     /translation="MDKAQLIEIANTEMPFGKYKGRRLIDVPEEYLLWFARKDQFPAG
                     HLGELMALTLLIKTEGLTQLVQPLKQPR"
     gene            complement(67208..69223)
                     /gene="ligA"
                     /locus_tag="EAE_RS00365"
                     /old_locus_tag="EAE_00345"
                     /db_xref="GeneID:45318458"
     CDS             complement(67208..69223)
                     /gene="ligA"
                     /locus_tag="EAE_RS00365"
                     /old_locus_tag="EAE_00345"
                     /EC_number="6.5.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_013878165.1"
                     /db_xref="GeneID:45318458"
                     /translation="MEPIEQKLTELRTTLRHHEYLYHVMDTPEIPDAEYDRLMRELRE
                     LEAQHPELITPDSPTQRVGAAPLASFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRL
                     SDTADLTWCCELKLDGLAVSILYENGVLMQAATRGDGTTGEDITSNVRTIRAIPLKLR
                     GDNIPARLEVRGEVFLPQAGFEKINEEARRTGGKVFANPRNAAAGSLRQLDPRITAKR
                     PLTFFCYGVGVLEGGELPASHSARLQQFKQWGLPVSDRVKLCHSPEEVLTYYRQVEED
                     RPKLGFDIDGVVIKVDSLALQEQLGFVARAPRWAVAFKFPAQEQMTFVNDVEFQVGRT
                     GAITPVARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVL
                     SERPEHTREIIFPTHCPVCHSDVERVEGEAVARCTGGLICGAQRKEALKHFVSRRALD
                     VDGMGDKIIDQLVEKEYVHTPADLFRLSAGKLTGLDRMGPKSAQNVVNALEKAKETTF
                     ARFLYALGIREVGEATAAGLAAHFGTIEALEQASIEELQKVPDVGIVVATHTFNFFAE
                     ESNREVIAQLRAEGVRWPAPVVVKAEEIDSPFAGKTVVLTGSLSQLSRDDAKARLVAL
                     GAKVAGSVSKKTDLVIAGEAAGSKLAKAQELGIEVIDEAEMMRLLGE"
     gene            complement(69298..70380)
                     /gene="zipA"
                     /locus_tag="EAE_RS00370"
                     /old_locus_tag="EAE_00350"
                     /db_xref="GeneID:45318459"
     CDS             complement(69298..70380)
                     /gene="zipA"
                     /locus_tag="EAE_RS00370"
                     /old_locus_tag="EAE_00350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZipA"
                     /protein_id="WP_047079280.1"
                     /db_xref="GeneID:45318459"
                     /translation="MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRM
                     KSRDDETSEGDDFDDDVEGVGEVRVHRVNHAPNGAYGEQEAPRQAPQHQYQPPYERQV
                     QQPVRQDEPVHQAPPHAPRPQQPVAPQPQAQPPHHVAPAQPVHPARPVHQPQPVPPQY
                     QQPVQPAPQQPVAQQSAPVPQPVAQQPAPVQQPAAPQPQPAPEAPAAEPQQPAAAPQP
                     KERKETVIVMNVAAHHGSQLNGELLINSIQQAGFKFGDMNIFHRHLSPDGSGQVLFSL
                     ANMVKPGTFNPDAMVDMTTPGVTIFMQVPSFGDELQNFKLMLQSAQYIADEVGGVVLD
                     DQRRMMTPQKLREYQDRIREVKEANA"
     gene            70611..71372
                     /gene="cysZ"
                     /locus_tag="EAE_RS00375"
                     /old_locus_tag="EAE_00355"
                     /db_xref="GeneID:45318460"
     CDS             70611..71372
                     /gene="cysZ"
                     /locus_tag="EAE_RS00375"
                     /old_locus_tag="EAE_00355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter CysZ"
                     /protein_id="WP_013878167.1"
                     /db_xref="GeneID:45318460"
                     /translation="MVSSSATTPRSGVYYFSQGWKLIRLPGIRRFVFLPLLVNVILMG
                     GAFWWLFTRLDSWIPSLMSHVPEWLQWLNYLLWPVAVISILLVFGYFFSTIANWIAAP
                     FSGLLAEQLEARLTGATPPDVGIFGIMKDVPRIMKREWQKFAWYLPRAIVLLLLYFIP
                     GIGQTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKTMREALRSRKVINMQFGALTSL
                     FTMIPVLNLVILPVAICGATAMWVDCYRDKHAMWK"
     gene            71550..72521
                     /gene="cysK"
                     /locus_tag="EAE_RS00380"
                     /old_locus_tag="EAE_00360"
                     /db_xref="GeneID:45318461"
     CDS             71550..72521
                     /gene="cysK"
                     /locus_tag="EAE_RS00380"
                     /old_locus_tag="EAE_00360"
                     /EC_number="2.5.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000034402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase A"
                     /protein_id="WP_013878168.1"
                     /db_xref="GeneID:45318461"
                     /translation="MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCR
                     IGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSVERRK
                     LLKALGANLVLTEGAKGMKGAIQKAEEIVASDPEKYLLLQQFSNPANPEIHEKTTGPE
                     IWEDTDGQVDVFISGVGTGGTLTGVSRYIKGTKGKKDLITVAVEPTDSPVIAQALAGE
                     ELKPGPHKIQGIGAGFIPGNLDLKLVDKVVAITNEEAISTARRLMEEEGILAGISSGA
                     AVAAALKLQEDEAFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ"
     gene            72901..73158
                     /gene="ptsH"
                     /locus_tag="EAE_RS00385"
                     /old_locus_tag="EAE_00365"
                     /db_xref="GeneID:45318462"
     CDS             72901..73158
                     /gene="ptsH"
                     /locus_tag="EAE_RS00385"
                     /old_locus_tag="EAE_00365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003038086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein Hpr"
                     /protein_id="WP_000487600.1"
                     /db_xref="GeneID:45318462"
                     /translation="MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASA
                     KSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE"
     gene            73203..74993
                     /gene="ptsI"
                     /locus_tag="EAE_RS00390"
                     /old_locus_tag="EAE_00370"
                     /db_xref="GeneID:45318463"
     CDS             73203..74993
                     /gene="ptsI"
                     /locus_tag="EAE_RS00390"
                     /old_locus_tag="EAE_00370"
                     /EC_number="2.7.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000623115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase
                     PtsI"
                     /protein_id="WP_015703130.1"
                     /db_xref="GeneID:45318463"
                     /translation="MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFL
                     NGRTKASAQLEVIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADA
                     AANEVIEGQATALEELDDEYLKERAADVRDIGKRLLRNILGLAIIDLSAIAEEVILVA
                     ADLTPSETAQLNLNKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNGDYL
                     ILDAVNNQVLVNPSNEKIEELRALQAQVAEEKAELAKLKDLPAITLDGHQVEVCANIG
                     TVRDVDGAERNGAEGVGLYRTEFLFMDRDSLPTEEEQFAAYKAVAEACGSQAVIVRTM
                     DIGGDKELPYMNFPKEENPFLGWRAVRIAMDRKEILRDQVRAILRASAFGKLRIMFPM
                     IISVEEVRALKKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFS
                     IGTNDLTQYTLAVDRGNDMISHLYQPMSPSVLTLIKQVIDASHAEGKWTGMCGELAGD
                     ERATLLLLGMGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVN
                     KFIEEKQSANPRDARPKLLLRRRSWVCSIN"
     gene            74972..75481
                     /gene="crr"
                     /locus_tag="EAE_RS00395"
                     /old_locus_tag="EAE_00375"
                     /db_xref="GeneID:45318464"
     CDS             74972..75481
                     /gene="crr"
                     /locus_tag="EAE_RS00395"
                     /old_locus_tag="EAE_00375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015833547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucose transporter subunit IIA"
                     /protein_id="WP_015365497.1"
                     /db_xref="GeneID:45318464"
                     /translation="MGLFDKLKSLVSDDKKDTGTIEIVAPLSGEIVNIEDVPDVVFAE
                     KIVGDGIAIKPTGNKMVAPVEGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGE
                     GFKRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVG
                     ETPVIRIKK"
     gene            complement(75524..75751)
                     /locus_tag="EAE_RS00400"
                     /old_locus_tag="EAE_00380"
                     /db_xref="GeneID:45318465"
     CDS             complement(75524..75751)
                     /locus_tag="EAE_RS00400"
                     /old_locus_tag="EAE_00380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703131.1"
                     /db_xref="GeneID:45318465"
                     /translation="MHSYRLVVRREGRTVGHFETMGMNALEDACRARTMFENESGCQC
                     ELWVADSERRILESSPQGMKILASEKCYRPA"
     gene            complement(75754..76617)
                     /gene="pdxK"
                     /locus_tag="EAE_RS00405"
                     /old_locus_tag="EAE_00385"
                     /gene_synonym="thiJ"
                     /db_xref="GeneID:45318466"
     CDS             complement(75754..76617)
                     /gene="pdxK"
                     /locus_tag="EAE_RS00405"
                     /old_locus_tag="EAE_00385"
                     /gene_synonym="thiJ"
                     /EC_number="2.7.1.35"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine/pyridoxal/pyridoxamine kinase"
                     /protein_id="WP_015703132.1"
                     /db_xref="GeneID:45318466"
                     /translation="MSQQDEIQSVLFNDHSRALEVDIVAVQSQVVYGSVGNSIAVPAI
                     KQHELRVMAVPTVLFSNTPHYDTFYGGVIPEEWFSGYLRALEERDALRELRAVTTGYM
                     GSAGQIALLAQWLQRIRVHHPDLCILVDPVIGDVDSGIYVKAEIPEAYRRHLLPLARG
                     ITPNLFELETLSGMPCHNQQEAVIAARSLLSDTLKWVVITSAPGLDASTINVLVVTDD
                     AVEVVVHPRVETDLKGTGDLFCAELISNLVCDMPLGDATRAAAQRVLAVMTWTESQGC
                     DELILPPSGAQ"
     gene            76700..77995
                     /gene="ptsJ"
                     /locus_tag="EAE_RS00410"
                     /old_locus_tag="EAE_00390"
                     /db_xref="GeneID:45318467"
     CDS             76700..77995
                     /gene="ptsJ"
                     /locus_tag="EAE_RS00410"
                     /old_locus_tag="EAE_00390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator PtsJ"
                     /protein_id="WP_015703133.1"
                     /db_xref="GeneID:45318467"
                     /translation="MFTGKTANEIFDNIRHLVQSGALQPGEALPPVRELAGDLAVNRN
                     TVAAAYKRLVTSGLAVSQGRNGTAIKALNTLNAVEGGDPTTSLIDISGGNPDPRRLPD
                     IGRFLPKLSRTPHLYGDAAVEPRLADWAREWVSRDIGHEFDINLTSGAIDALERLLCA
                     LLLPGDSVAVEDPCFLSSINMLRYAGFQPSPVAVDGEGMNPERLEEALRNGARAVILT
                     PRAHNPTGCSLTPERAQAIRTVLARYPQTLAIVDDHFALLSATCWHNPLPDGIQRWAL
                     VRSMSKTLGPDLRLAIVASDPTTSAALRLRLNAGSQWVSHLLQELAFACLNDSAFAAS
                     LTASQRHYQQQNQRLAAALARHGAGDYPPGDGLNFWLPLSAASQPLALRLARAGWLVR
                     EGEAFGVKTPAHGLRLSLGALTEAQIEQLAHDLSLVLPC"
     gene            78009..78725
                     /locus_tag="EAE_RS00415"
                     /old_locus_tag="EAE_00395"
                     /db_xref="GeneID:45318468"
     CDS             78009..78725
                     /locus_tag="EAE_RS00415"
                     /old_locus_tag="EAE_00395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="WP_015703134.1"
                     /db_xref="GeneID:45318468"
                     /translation="MRIHFIVHEVFEAPGAYLRWVNARGYQASWSRVYAGDPLPANAE
                     GFDMLVVLGGPQSPRTTLAECPWFDAHAEKNLIAQAIAAGRIVVGICLGSQLIGEALG
                     APVMQSPEKEIGHYPIILTTAGLQDDNIAHFGSSVVVGHWHNDMPGLTPAAEVLASSE
                     GCPRQIVKYSDRVYGFQCHMEFDAEVIELLITHSQYELAAAKGRRFIRSEDEMRQWDY
                     REMNQKLWAFLDKLVAKHAL"
     gene            complement(78769..79680)
                     /gene="cysM"
                     /locus_tag="EAE_RS00420"
                     /old_locus_tag="EAE_00400"
                     /db_xref="GeneID:45318469"
     CDS             complement(78769..79680)
                     /gene="cysM"
                     /locus_tag="EAE_RS00420"
                     /old_locus_tag="EAE_00400"
                     /EC_number="2.5.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase CysM"
                     /protein_id="WP_015365492.1"
                     /db_xref="GeneID:45318469"
                     /translation="MNTLEQTIGNTPLVKLQRLGPDNGSEIWLKLEGNNPAGSVKDRA
                     ALSMIVEAEKRGEIKPGDVLIEATSGNTGIALAMIAALKGYQMKLLMPDNMSQERRAA
                     MRAYGAELILVTKEQGMEGARDLAAAMAERGEGKLLDQFNNPDNPYAHYTTTGPEIWR
                     QTDGRITHFVSSMGTTGTITGVSRFLREQAKPVSIIGLQPEEGSSIPGIRRWPQEYMP
                     GIFNASLVDEVLDIHQQDAENTMRQLAVQEGIFCGVSSGGAVAGALRIARANPGAVVV
                     AIICDRGDRYLSTGVFGEEHFSQGAGI"
     gene            complement(79779..80873)
                     /gene="cysA"
                     /locus_tag="EAE_RS00425"
                     /old_locus_tag="EAE_00405"
                     /db_xref="GeneID:45318470"
     CDS             complement(79779..80873)
                     /gene="cysA"
                     /locus_tag="EAE_RS00425"
                     /old_locus_tag="EAE_00405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/thiosulfate ABC transporter ATP-binding
                     protein CysA"
                     /protein_id="WP_015365491.1"
                     /db_xref="GeneID:45318470"
                     /translation="MSIEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTL
                     LRIIAGLEHQSSGHIRFHGTDVSRMHARDRKVGFVFQHYALFRHMTVFDNIAFGLTVL
                     PRRERPNAAAIKAKVTKLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLL
                     DEPFGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEAMEVADRVVVMSQGNIEQA
                     DAPERVWREPSTRFVLEFMGEVNRLQGTIRGGQFHVGAHRWPLGYTPAYQGPVDLFLR
                     PWEVDISRRTSLDSPLPVQVLEASPKGHYTQLVVQPLGWYDEPLSVVLAGDEAPSRGE
                     RLFVGLQNARLYNGTERIEPRGELALAESA"
     gene            complement(80863..81738)
                     /gene="cysW"
                     /locus_tag="EAE_RS00430"
                     /old_locus_tag="EAE_00410"
                     /db_xref="GeneID:45318471"
     CDS             complement(80863..81738)
                     /gene="cysW"
                     /locus_tag="EAE_RS00430"
                     /old_locus_tag="EAE_00410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/thiosulfate ABC transporter permease
                     CysW"
                     /protein_id="WP_015703135.1"
                     /db_xref="GeneID:45318471"
                     /translation="MAEVTQLKRYDAPRINWGKWFLIGVGMLVSAFILVVPMIYIFVQ
                     AFSKGLMPVLENLANPDMLHAIWLTVMIALITVPVNLVFGTLLAWLVTRFTFPGRQLL
                     LTMLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNMQIMFAWPGMVLATIFVTCPF
                     VVRELVPVMMSQGSNEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEF
                     GAVSVVSGSIRGETLSLPLQIELLQQDYNTVGSFTAAALLTLMAILTLFLKSMLQWRL
                     ANQEKRAQQEGNHEH"
     gene            complement(81738..82571)
                     /gene="cysT"
                     /locus_tag="EAE_RS00435"
                     /old_locus_tag="EAE_00415"
                     /db_xref="GeneID:45318472"
     CDS             complement(81738..82571)
                     /gene="cysT"
                     /locus_tag="EAE_RS00435"
                     /old_locus_tag="EAE_00415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000458418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate/thiosulfate ABC transporter permease
                     CysT"
                     /protein_id="WP_015365489.1"
                     /db_xref="GeneID:45318472"
                     /translation="MLAVSSKRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLAQMSW
                     AQYWEVITNPQVVAAYKVTLLSAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDL
                     PFALPTAVAGLTLASLFSVNGLYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQ
                     PVLEELGPEYEEAAETLGATRLQSFRKVVLPELSPALLAGIALSFTRSLGEFGAVIFI
                     AGNIAWKTEVTSLMIFIRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVG
                     H"
     gene            complement(82571..83587)
                     /locus_tag="EAE_RS00440"
                     /old_locus_tag="EAE_00420"
                     /db_xref="GeneID:45318473"
     CDS             complement(82571..83587)
                     /locus_tag="EAE_RS00440"
                     /old_locus_tag="EAE_00420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005121936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_015365488.1"
                     /db_xref="GeneID:45318473"
                     /translation="MAVKSLKKGYLALAASMLLVAQAQATELLNSSYDVSRELFAALN
                     PPFEQQWAKENGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGNL
                     IPADWQSRLPNNSSPFYSTMAFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARY
                     TYLAAWGAADKADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFVERGLGDVLITFE
                     SEVNNIRKQYEAQGFEVVVPKVNILAEFPVAWVDKNVKANGTEKAAKAYLNYLYSPQA
                     QTIITDYYYRVNDPKVMASLKDKFPQTELFRVEDQFGSWPEVMKTHFVSGGELDKLLA
                     AGRQ"
     gene            complement(83802..84701)
                     /locus_tag="EAE_RS00445"
                     /old_locus_tag="EAE_00425"
                     /db_xref="GeneID:45318474"
     CDS             complement(83802..84701)
                     /locus_tag="EAE_RS00445"
                     /old_locus_tag="EAE_00425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Dyp-type peroxidase"
                     /protein_id="WP_015703136.1"
                     /db_xref="GeneID:45318474"
                     /translation="MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKIFVDNVATF
                     QAKFPDAKLGAVVAFGNTVWRQLSAGEGAEELKDFPVYGKGLAPSTQYDVLIHILSAR
                     HEVNFSVAQAAVAAFGDAIEVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVI
                     KDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKDANEEIDGDERPITSHLSR
                     VDLKEDGKGLKIVRQSLPYGTASGTNGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAM
                     LRFTKPVTGGYYFAPSLERIQAL"
     gene            complement(84796..85371)
                     /locus_tag="EAE_RS00450"
                     /old_locus_tag="EAE_00430"
                     /db_xref="GeneID:45318475"
     CDS             complement(84796..85371)
                     /locus_tag="EAE_RS00450"
                     /old_locus_tag="EAE_00430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpoE-regulated lipoprotein"
                     /protein_id="WP_015703137.1"
                     /db_xref="GeneID:45318475"
                     /translation="MKSLRLMLCALPLALTGCSTMSAVNWSAAYPWNWFGSSNEVTEQ
                     GVGKLTASTPLNEQAISDALGGSYRLRSGMKTADGKIVHYFEALKDDKLALTINGDGG
                     TVSRIDVRDSAIPAASGVKIGTPFSELYGKAFGNCEKGVPDNGAVVECKAPGSQHISY
                     AFTGHWSGPDELMPSDDTLKNWKVSKIIWRR"
     gene            complement(85433..85882)
                     /locus_tag="EAE_RS00455"
                     /old_locus_tag="EAE_00435"
                     /db_xref="GeneID:45318476"
     CDS             complement(85433..85882)
                     /locus_tag="EAE_RS00455"
                     /old_locus_tag="EAE_00435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016809551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2919 domain-containing protein"
                     /protein_id="WP_015365485.1"
                     /db_xref="GeneID:45318476"
                     /translation="MKNTEFIPADYDTQGRLRLPLLFWGVLLLQARTWVLFVMAGASR
                     QQGDALLSLFYPDHDNFWLGLLPGVPAVAAFLLSGQRQRFPRLWPLMRWLLIASQALL
                     LAWQPWLWFTGEAPSMLTIALLAADIYALWWLITSRRLHACFRLEAL"
     gene            complement(85869..86294)
                     /locus_tag="EAE_RS00460"
                     /old_locus_tag="EAE_00440"
                     /db_xref="GeneID:45318477"
     CDS             complement(85869..86294)
                     /locus_tag="EAE_RS00460"
                     /old_locus_tag="EAE_00440"
                     /EC_number="2.3.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_015365484.1"
                     /db_xref="GeneID:45318477"
                     /translation="MEIRVFRQQDFEEVITLWERCDLLRPWNDPEMDIERKLNHDVSL
                     FLVAEVNGEVVGTVMGGYDGHRGSAYYLGVHPEYRGRGIANALLNRLEKKLIARGCPK
                     ISIMVRDDNDVVQGMYERLGYEHSDVLTLGKRLIEDEEY"
     gene            86506..87378
                     /gene="amiA"
                     /locus_tag="EAE_RS00465"
                     /old_locus_tag="EAE_00445"
                     /db_xref="GeneID:45318478"
     CDS             86506..87378
                     /gene="amiA"
                     /locus_tag="EAE_RS00465"
                     /old_locus_tag="EAE_00445"
                     /EC_number="3.5.1.28"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase AmiA"
                     /protein_id="WP_015365483.1"
                     /db_xref="GeneID:45318478"
                     /translation="MSTFKPLKILASRRQVLKAGLAAMTLTGVASQATAKEQPLKTSN
                     GHSKPVAKKAGSRRLVMLDPGHGGIDTGAIGHNGSKEKHVVLAIAKNVRSILRSNGID
                     ARLTRSGDTFIPLYDRVEIAHQHGADLFMSIHADGFTNPSAAGASVFALSNRGASSAM
                     AKYLSERENRADEVAGKKATDKDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPVHK
                     LHSRNTEQAAFVVLKSPSIPSVLVETSFITNPNEEKLLGTTAFRQKIANAIASGIISY
                     FHWFDNQKAHSKRR"
     gene            87378..88277
                     /gene="hemF"
                     /locus_tag="EAE_RS00470"
                     /old_locus_tag="EAE_00450"
                     /db_xref="GeneID:45318479"
     CDS             87378..88277
                     /gene="hemF"
                     /locus_tag="EAE_RS00470"
                     /old_locus_tag="EAE_00450"
                     /EC_number="1.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-dependent coproporphyrinogen oxidase"
                     /protein_id="WP_015703138.1"
                     /db_xref="GeneID:45318479"
                     /translation="MKPDVQQVKAFLLQLQDAICAKLSAVDGKDFVEDSWQREGGGGG
                     RSRVLRDGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPRNPYV
                     PTSHANVRFFIAEKPGADPVWWFGGGFDLTPYYGFEEDAIHWHRTARDLCLPYGDEVY
                     PRYKKWCDDYFFLKHRNEQRGIGGLFFDDLNTPDFDHCFAFMQAVGNGFTDAYLPIVE
                     RRKTTPYGERERDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEY
                     DYHPQEGSPEAALSEFIKVKEWI"
     gene            complement(88336..90615)
                     /gene="maeB"
                     /locus_tag="EAE_RS00475"
                     /old_locus_tag="EAE_00455"
                     /db_xref="GeneID:45318480"
     CDS             complement(88336..90615)
                     /gene="maeB"
                     /locus_tag="EAE_RS00475"
                     /old_locus_tag="EAE_00455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent oxaloacetate-decarboxylating
                     malate dehydrogenase"
                     /protein_id="WP_015703139.1"
                     /db_xref="GeneID:45318480"
                     /translation="MDEQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVA
                     APCLEIEKDPLAAYKYTARGNLVAVVSNGTAVLGLGNIGALAGKPVMEGKGVLFKKFA
                     GIDVFDIEVDELDPDKFINVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFH
                     DDQHGTAIISTAAILNGLRVVEKNLSDVRMVVSGAGAAAIACMNLLVALGMQKHNIVV
                     CDSKGVIYKDREANMAETKAAYAVEDDGKRTLDDVIDGADIFLGCSGPKVLTPEMVKK
                     MARSPLILALANPEPEILPPLAKEVRDDVIICTGRSDYPNQVNNVLCFPFIFRGALDV
                     GATAINEEMKLAAVHAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKI
                     APAVAKAAMESGVATRPIADFDAYIEKLSEFVYKTNLFMKPIFSQARKEPKRVVLAEG
                     EETRVLHATQELVSLGLAKPILIGRPSVIEMRIQKLGLQIKAGVDFEIVNNESDPRFK
                     EYWSEYYQLMKRRGITQEQAQRAVISNTSVIGAIMVHRGEADAMICGTIGDYHEHYRV
                     VQPLFGFRDGVSTAGAMNALLLPSGNTFIADTYVNHDPSPEELAEITLMAAESVRRFG
                     IEPRVALLSHSNFGSADCPSASKMRKTLELVKASAPDLMIDGEMHGDAALVESIRNDR
                     MPDSPLKGAANILVMPNMEAARISYNLLRVSSSEGVTVGPVLMGIAKPVHILTPIASV
                     RRIVNMVALAVVEAQTQPL"
     gene            90909..91877
                     /gene="tal"
                     /locus_tag="EAE_RS00480"
                     /old_locus_tag="EAE_00460"
                     /db_xref="GeneID:45318481"
     CDS             90909..91877
                     /gene="tal"
                     /locus_tag="EAE_RS00480"
                     /old_locus_tag="EAE_00460"
                     /EC_number="2.2.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transaldolase"
                     /protein_id="WP_015703140.1"
                     /db_xref="GeneID:45318481"
                     /translation="MNQLDSIKQFTTVVADSGDIESIRHYQPEDATTNPSLLLKAAGL
                     DNYAGLIDDALAWAAKQGGNRETQVANACDKLAVNFGAEILKSIPGRVSTEVDARLSF
                     NREKSIEKARHLVALYQEMGIDKSRILIKLASTWEGIRAAEVLEKEGIHCNLTLLFSF
                     AQARACAEAGVFLISPFVGRIYDWYQARQPLDPYVVDEDPGVKSVRNIYDYFKLHKYN
                     TIVMGASFRRTEQILALVGCDRLTISPALLQELQASDAPVVRKLIPAHQILPRPVPMS
                     EAEFRWEHNQDPMAVEKLAEGIRQFAVDQRKLEDLLAAKLSSFVTE"
     gene            91884..93878
                     /gene="tkt"
                     /locus_tag="EAE_RS00485"
                     /old_locus_tag="EAE_00465"
                     /db_xref="GeneID:45318482"
     CDS             91884..93878
                     /gene="tkt"
                     /locus_tag="EAE_RS00485"
                     /old_locus_tag="EAE_00465"
                     /EC_number="2.2.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_015703141.1"
                     /db_xref="GeneID:45318482"
                     /translation="MSRRELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFL
                     KHNPTNPHWYDRDRFILSNGHASMLLYSLLHLTGYDLPMNELKNFRQLHSKTPGHPEH
                     GYTPGVETTTGPLGQGLANAVGMAIAERTLAAQFNRPGHDIVDHYTWVFMGDGCLMEG
                     ISHEASSLAGTLGLGKLIGFYDHNGISIDGHVEGWFTDDTAERFRAYHWHVIGDIDGH
                     DPQAVKQAIQEAQAVTDKPSLIICRTIIGFGSPNKAGSEESHGAALGEKEVALAREQL
                     GWKYPPFEIPKEIYQGWDARPRGEKAEHAWNEKFAAYQQQYPELAAELKRRMEGELPA
                     DWQKTAHDYVAKLQSEPAKIASRKASQNALNAYGPDLPELLGGSADLAPSNLTIWSGS
                     KSIKEDQAGNYIHYGVREFGMTAVANGIALHGGFIPYTSTFLMFVEYARNAARMAALM
                     KAHQIMVYTHDSIGLGEDGPTHQAVEQLASLRLTPNFSTWRPCDQVETAVAWQAAIER
                     KDGPTALILSRQNLAQMARTPEQVQEIARGGYVLKDAGGKPDLILIATGSEVEIAVQA
                     AETLLASGINVRVVSLPSTDVFDAQDEAWRESVLPSDVSARVAIEAGIADYWYKYVGL
                     KGAIVGMTRYGESAPADKLFPFFGFTAEHIVEVSRKVLNG"
     gene            complement(93868..94914)
                     /locus_tag="EAE_RS00490"
                     /old_locus_tag="EAE_00470"
                     /db_xref="GeneID:45318483"
     CDS             complement(93868..94914)
                     /locus_tag="EAE_RS00490"
                     /old_locus_tag="EAE_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014907129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1176 domain-containing protein"
                     /protein_id="WP_015703142.1"
                     /db_xref="GeneID:45318483"
                     /translation="MFHRVLMLLFFGFLPTSLAWAAPAQQLFGDWLVTCNNQNYCVTR
                     NVGLHHGLVMTLSRSAGAATDAALRIELGGVGNPVAALAAIGPRLQLDGKPLHFDGKH
                     WQIADKLIKTGDSVSIDAFLQQAQEGKEITLQNGLQSISLKGLKAALLFIDNRQKRVG
                     SETAWVGKGEEPPLSVPPAPALRTVGKAEVAQSPLSRDELNELIDYGNERMNASPCSL
                     DPFRREIRVTALTDEKVLLMTSCEAGAYNTVWLAWLVSRKMPHLARQVRLALPFQPPG
                     NAPRDIELINASFDEQRHELVTFDKGRAPGDCGIQTRWRYDGQRFNLTRYAQQPQCDN
                     WQGPDAWPTLWITR"
     gene            complement(95005..95589)
                     /gene="nudK"
                     /locus_tag="EAE_RS00495"
                     /old_locus_tag="EAE_00475"
                     /db_xref="GeneID:45318484"
     CDS             complement(95005..95589)
                     /gene="nudK"
                     /locus_tag="EAE_RS00495"
                     /old_locus_tag="EAE_00475"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004136531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose pyrophosphatase NudK"
                     /protein_id="WP_015365476.1"
                     /db_xref="GeneID:45318484"
                     /translation="MSLNIHVIKDKILSENYFLLRNMTYELTRRDGSVVRHKREVYDR
                     GNGATVLLYNPNKQSVVLVRQFRVATWVNGNPDGMLIETCAGLLDNDAPEVCIRKEAI
                     EETGYQVGEARKVFELYMSPGGVTELIHFFIAEYSEAQRANRGGGVDDEDIEVLELPF
                     VRALEMVASGEIQDGKAVILLQYLQNSGLMSRDL"
     gene            complement(95648..97618)
                     /gene="aegA"
                     /locus_tag="EAE_RS00500"
                     /old_locus_tag="EAE_00480"
                     /db_xref="GeneID:45318485"
     CDS             complement(95648..97618)
                     /gene="aegA"
                     /locus_tag="EAE_RS00500"
                     /old_locus_tag="EAE_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate-dependent uric acid utilization protein
                     AegA"
                     /protein_id="WP_015703143.1"
                     /db_xref="GeneID:45318485"
                     /translation="MNHFIMSDSRKCIGCRGCEVACVMAHNGEQHVLTPQRFLPRITV
                     IKNQKQRNAVTCRHCEGAPCVRSCPNGAISQQDDSVLVHGEKCIGCKSCVVACPFGVM
                     QIVVTPDGRATAHKCDLCHERQAGPACVQNCPAQALQLATDSTLSEMAKTRRLRAARA
                     DAASWQHRTLTALASTFGDKASQMAATPARGEADKLAANARKQHFGEIYLPFSAEQAR
                     RETQRCLKCGDRSICEWACPLHNHIPQWIERVKAGDIASAVELSHQTNCLPEITGRVC
                     PQDRLCEGACTLRDESGSVTIGNIERYISDQALADGWRPNLSAVKASGKKVAIIGAGP
                     AGLACADLLARSGVAPVVFDRHPEIGGLLTFGIPPFKLDKSLLARRREIFSQMGIRFE
                     LNCEVGKDIELAQLLADYDAVFVGAGTYRSMKADLPNEEAPGVYEALPFLIANTKQVM
                     GLEALADEPYIDTAGLNVVVLGGGDTAMDCVRTALRHGAQRVTCAYRRDEANMPGSKK
                     EVKNAREEGANFEFNVQPITLELGEDGRVSGVRFLRTQLGEPDAQGRRSPSPIPGSEF
                     VMPADAVIMAFGFHPHSMPWLEAAGVQLDSRGRIKANVESRYRYQTSNQKIFAGGDAV
                     RGADLVVTAMAEGRHAAQGIIDYLGVASALPH"
     gene            98002..101115
                     /gene="acrD"
                     /locus_tag="EAE_RS00505"
                     /old_locus_tag="EAE_00485"
                     /db_xref="GeneID:45318486"
     CDS             98002..101115
                     /gene="acrD"
                     /locus_tag="EAE_RS00505"
                     /old_locus_tag="EAE_00485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux RND transporter permease AcrD"
                     /protein_id="WP_015703144.1"
                     /db_xref="GeneID:45318486"
                     /translation="MANFFIDRPIFAWVLAILLVLTGTLAILSLPVEQYPDLAPPNVR
                     VTANYPGASAQTLENTVTQVIEQNMTGLDNLMYMSSQSSATGQATVTLSFTAGTDPDE
                     AVQQVQNQLQSAMRKLPQAVQNQGVTVRKTGDTNILTLAFVSTDGSMDKQDIADYVAS
                     NVQDPLSRVNGVGDIDAYGSQYSMRIWLDPAKLNSYQMTAKDVTDAIESQNAQIAVGQ
                     LGGTPSVDKQALNATINSQSLLQTPQQFRDITLRVNQDGSEVTLGDVASVEMGAEKYD
                     YLSRYNRQAASGLGIKLASGANEMATAERVIARLDELSQYFPHGLQYKVAYETTSFVK
                     ASITDVVKTLLEAILLVFLVMYLFLQNFRATLIPTIAVPVVLMGTFAVLYACGYSINT
                     LTMFATVLAIGLLVDDAIVVVENVERIMSEEGLSPREATRKSMKQIQGALVGIAMVLS
                     AVFVPMAFFGGTTGAIYRQFSITIVSAMVLSVLVAMILTPALCATLLKPIHKGEVHGQ
                     KGFFGWFNRAFNRSASRYETFVGKILHRSLRWILIYVLLLGGMVLLFLHLPTSFLPLE
                     DRGMFTTSIQLPSGSTQQQTLKVVQKAEDYFLNNEKSNVESVFATVGSGPGGNGQNVA
                     RMFVRLKDWDQRDPKTGSSFAIIERATKAFNKIKEARVFASSPPAISGLGSSAGFDME
                     LEDHAGNGHEALMSARDKLLELAANNDQLTRVRHNGLDDSPQLQVDIDQRKAQALGVS
                     IDDINDTLQTAWGSSYVNDFMDRGRVKKVYVQAAAKYRMLPDDINLWYVRNSSGTMVP
                     FSAFATSRWETGSPRLERYNGYSAVEIVGEAAPGVSTGTAMTIMEELAKQLPNGFGLE
                     WTAMSYQERLSGAQAPALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGVIGALLAT
                     WMRGLENDVYFQVGLLTVIGLSAKNAILIVEFANELNQKGEDLLIATLSACRQRLRPI
                     LMTSLAFIFGVLPMATSTGAGSGSQHAVGTGVMGGMLSATVLAIFFVPLFFVLVRRRF
                     PLKERPE"
     gene            complement(101200..101259)
                     /gene="ypfM"
                     /locus_tag="EAE_RS00510"
                     /db_xref="GeneID:45318487"
     CDS             complement(101200..101259)
                     /gene="ypfM"
                     /locus_tag="EAE_RS00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001165325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein YpfM"
                     /protein_id="WP_087867655.1"
                     /db_xref="GeneID:45318487"
                     /translation="MIEHELGNWKDFIEDMLRK"
     gene            101615..101971
                     /locus_tag="EAE_RS00515"
                     /old_locus_tag="EAE_00490"
                     /db_xref="GeneID:45318488"
     CDS             101615..101971
                     /locus_tag="EAE_RS00515"
                     /old_locus_tag="EAE_00490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsC family reductase"
                     /protein_id="WP_015703145.1"
                     /db_xref="GeneID:45318488"
                     /translation="MLTMYGIKNCDTIKKARRWLEAHQIDYRFHDYRVDGLDRELLNT
                     FIAELGWEALLNTRGTTWRKLDESVRTGIDNADAAAALMLEMPAIIKRPLLCAPGQPM
                     LLGFSEANYEKFINEV"
     gene            101975..103102
                     /gene="dapE"
                     /locus_tag="EAE_RS00520"
                     /old_locus_tag="EAE_00495"
                     /db_xref="GeneID:45318489"
     CDS             101975..103102
                     /gene="dapE"
                     /locus_tag="EAE_RS00520"
                     /old_locus_tag="EAE_00495"
                     /EC_number="3.5.1.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="WP_015365471.1"
                     /db_xref="GeneID:45318489"
                     /translation="MSCPVIELAQQLIRRPSLSPNDAGCQALMIERLRAIGFTVEAMD
                     FGDTQNFWAWRGQGETLAFAGHTDVVPAGDADRWINPPFEPTIRDGMLFGRGAADMKG
                     SLAAMVVAAERFVAQYPNHKGRLAFLITSDEEASATHGTVKVVETLMARNERLDYCLV
                     GEPSSTEVVGDVVKNGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLAELVAIE
                     WDKGNEYFPPTSMQIANVQSGTGSNNVIPGDMFVQFNFRFSTELTDEMIKARIIALLE
                     KYQLRYTVEWWLSGQPFLTGRGNLVDAVVNAIEHYNEVKPQLLTTGGTSDGRFIARMG
                     AQVVELGPVNATIHKINECVNAADLQLLARMYQRIMEQLVA"
     gene            103156..103356
                     /locus_tag="EAE_RS00525"
                     /old_locus_tag="EAE_00500"
                     /db_xref="GeneID:45318490"
     CDS             103156..103356
                     /locus_tag="EAE_RS00525"
                     /old_locus_tag="EAE_00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YpfN family protein"
                     /protein_id="WP_015365470.1"
                     /db_xref="GeneID:45318490"
                     /translation="MEWLINHWWILVLVFLVGVMINVIKDLNRVDPKKYLDNKPDLPP
                     HRDFNSKWDDDDDWPNKDQPKK"
     gene            complement(103458..104156)
                     /gene="ypfH"
                     /locus_tag="EAE_RS00530"
                     /old_locus_tag="EAE_00505"
                     /db_xref="GeneID:45318491"
     CDS             complement(103458..104156)
                     /gene="ypfH"
                     /locus_tag="EAE_RS00530"
                     /old_locus_tag="EAE_00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_015703146.1"
                     /db_xref="GeneID:45318491"
                     /translation="MKHDHFIVQSPATPAQQLLLLFHGVGDNPVSMGQIGSWFAPQFP
                     NALIVSIGGAEPCGPAPARQWFSVQGVTEENRQQRIDAIMPTFIETVRYWQKQSGLGP
                     QATALIGFSQGAIMSLESIKAEPGLASRVIAFNGRYASLPQTATTQTTVHLIHGGEDR
                     VIDLAWAVSAQERLQELGGDVTLDIVEDLGHAIDDRSMQFALDRLRYTVPKHYFDEAL
                     SGGTPKDDDIIEML"
     gene            complement(104264..106264)
                     /locus_tag="EAE_RS00535"
                     /old_locus_tag="EAE_00510"
                     /db_xref="GeneID:45318492"
     CDS             complement(104264..106264)
                     /locus_tag="EAE_RS00535"
                     /old_locus_tag="EAE_00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Met) cytidine acetyltransferase"
                     /protein_id="WP_015703147.1"
                     /db_xref="GeneID:45318492"
                     /translation="METLLDLTARMAREGIRRLLVLSGDEHWCLAQAVELRERLGGDS
                     LWVGALPQQEPCVAPGALKTLLGREFLHAFFDARHGFDVAAFAALGGTLRAGSWLVLL
                     APDFARWPEQADGDSLRWSETSEPIATPNFVHRCLQLFSADPEVALWRQGDGLRLPEA
                     APRRHWHAADGYPQAEQAAILSSLLSSPPEIAAVTAGRGRGKSALAGMLIHQLAGSAI
                     VTAPTRDATAVIAAFAGEKMRFMAPDALLASDAKADWLVVDEAAAIPAPTLRQLTARF
                     PHTLLTTTVQGYEGTGRGFLLKFCASFPTLRRYNLSSPIRWAPGCPLESVIDRLLLFN
                     DEAFLHVPHGEPQLETLSQDAWREQPTRPSEAYQLLSGAHYRTSPLDLRRMMDAPGQH
                     FTVARCGDGVAGAVWLVEEGGLEPELSRAVWAGYRRPRGNLVAQSLAAHGGSPLAATL
                     TGRRVSRIAVHPARQREGLGQRLIAHAVKQTHGCDYLSVSFGYTPELWRFWQRCGFLL
                     VRMGTHREASSGCYTAMALYPLSAAGQQLAWREHQRLARDERWLSQWRDERAPVTADE
                     TAMLTEEDWLEIAGFAFAHRPLLTAVGSLNRLLQVTPLPLVALRARLAQHDEAALCAN
                     LGLSGRKALLGRLREEAAAALSGLDPARAQRLDEWVRKLQFF"
     gene            complement(106274..107149)
                     /locus_tag="EAE_RS00540"
                     /old_locus_tag="EAE_00515"
                     /db_xref="GeneID:45318493"
     CDS             complement(106274..107149)
                     /locus_tag="EAE_RS00540"
                     /old_locus_tag="EAE_00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015365467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="neutral zinc metallopeptidase"
                     /protein_id="WP_015365467.1"
                     /db_xref="GeneID:45318493"
                     /translation="MRWQGRRESDNVEDRRSDSGSPLGGGGGGFRIPSGKGGIVLLII
                     VLVAGYYGVDLTGMLTGEPMPQQQTSTQRSISPKDDEAAKFTSVILATTEDTWGPIFE
                     KMGRQYVQPKLVMYRGATRTGCGTGQSVMGPFYCPADSTVYIDLSFYDEMKNKLGADG
                     DFAQGYVIAHEVGHHVQKLLGIEPKVRQMQQQASQTEVNRLSVKMELQADCFAGVWGN
                     NMQKQDVMETGDLQEALNAAEAIGDDRLQEQSQGRVVPDSFTHGTSQQRYTWFKRGFD
                     SGDPSQCNTFGSALR"
     gene            complement(107270..107983)
                     /gene="purC"
                     /locus_tag="EAE_RS00545"
                     /old_locus_tag="EAE_00520"
                     /db_xref="GeneID:45318494"
     CDS             complement(107270..107983)
                     /gene="purC"
                     /locus_tag="EAE_RS00545"
                     /old_locus_tag="EAE_00520"
                     /EC_number="6.3.2.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017458944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazolesuccinocarboxamide
                     synthase"
                     /protein_id="WP_015703148.1"
                     /db_xref="GeneID:45318494"
                     /translation="MKKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFD
                     RKGMVNNKFNHFIMSKLEEAGIPTQMEALLSDTECLVKKLDMVPVECVIRNRAAGSLV
                     KRLGIEEGIELTPPLFDLFLKNDAMHDPMVNESYCETFGWVNKENLARMKELSYKAND
                     VLSKLFDDAGLILVDFKLEFGLFKGEVVLGDEFSPDGSRLWDKNTLDKMDKDRFRQSL
                     GGLIEAYEEVAHRLGVKLD"
     gene            complement(108126..109160)
                     /gene="bamC"
                     /locus_tag="EAE_RS00550"
                     /old_locus_tag="EAE_00525"
                     /db_xref="GeneID:45318495"
     CDS             complement(108126..109160)
                     /gene="bamC"
                     /locus_tag="EAE_RS00550"
                     /old_locus_tag="EAE_00525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamC"
                     /protein_id="WP_015365465.1"
                     /db_xref="GeneID:45318495"
                     /translation="MAYSVQKSRLAKVAGVSLVLLLAACSSDSRYKRQVSGDEAYLDA
                     TPLSELHAPAGMILPLQTGDYNIPVAASTGAVGKALDIRPPAQPLALVSGARTQFNGD
                     TSTLMVENSRSGSLWAQVVSIVQAKNYTITKRDDAGQTLNTDWVEWNRLDEDQQYRGR
                     YQISVKPQGYQQAVVVKLVNLEQAGKPVSDPASLQRYSTSMLNVISSGLDSNATNAQN
                     AAQRSAGATFDVQSAADDTGLPMLVVRAPFNMVWQKLPAALEKVGMKVTDSTRSQGSM
                     AVTYKPLSDSSWQDLGASDPQLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDAL
                     VAVFQAAFNK"
     gene            complement(109177..110055)
                     /gene="dapA"
                     /locus_tag="EAE_RS00555"
                     /old_locus_tag="EAE_00530"
                     /db_xref="GeneID:45318496"
     CDS             complement(109177..110055)
                     /gene="dapA"
                     /locus_tag="EAE_RS00555"
                     /old_locus_tag="EAE_00530"
                     /EC_number="4.3.3.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001311023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate synthase"
                     /protein_id="WP_015365464.1"
                     /db_xref="GeneID:45318496"
                     /translation="MFTGSIVALVTPMDDNGNVCRSSLKKLIDYHVANGTSAIVSVGT
                     TGESATLSHEEHGDVVMMTLELADGRIPVIAGTGANATAEAISLTKRFNDSGVVGCLT
                     VTPYYNRPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVGRLAEIKNIVGI
                     KEATGNLSRVHQIKELVSDDFILLSGDDATGMDFIQLGGVGVISVTANVAAREMADMC
                     RLAMAGQFAEARAINQRLMPLHTKLFVEPNPIPVKWACKALGLVATDTLRLPMTPITE
                     AGTKAVTAALKHAGLL"
     gene            110209..110778
                     /locus_tag="EAE_RS00560"
                     /old_locus_tag="EAE_00535"
                     /db_xref="GeneID:45318497"
     CDS             110209..110778
                     /locus_tag="EAE_RS00560"
                     /old_locus_tag="EAE_00535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system transcriptional
                     repressor"
                     /protein_id="WP_015365463.1"
                     /db_xref="GeneID:45318497"
                     /translation="MTASLQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAML
                     GDEFTFIMLLSGSWNAINLIESTLPLKGAELDLLIVMKRTSARPPQAMPNTVWIQVEV
                     PDSPHIIERFTALCDTWNMNIAELVSRTQPGEDKDAAQLFIQITAHSPASQNTTNIEQ
                     AFKALCTELSAQGSINIVNYSQHDEQDGV"
     gene            110782..111252
                     /gene="bcp"
                     /locus_tag="EAE_RS00565"
                     /old_locus_tag="EAE_00540"
                     /db_xref="GeneID:45318498"
     CDS             110782..111252
                     /gene="bcp"
                     /locus_tag="EAE_RS00565"
                     /old_locus_tag="EAE_00540"
                     /EC_number="1.11.1.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-dependent thiol peroxidase"
                     /protein_id="WP_015365462.1"
                     /db_xref="GeneID:45318498"
                     /translation="MTPLKAGDIAPKFSLPDQDGEEVNLTDFQGQRVLVYFYPKAMTP
                     GCTVQACGLRDNMDDLKKAGVEVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQ
                     FGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDNFKTSNHHDVVLNWLKENA"
     gene            complement(111315..112379)
                     /locus_tag="EAE_RS00570"
                     /old_locus_tag="EAE_00545"
                     /db_xref="GeneID:45318499"
     CDS             complement(111315..112379)
                     /locus_tag="EAE_RS00570"
                     /old_locus_tag="EAE_00545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004136507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="WP_015365461.1"
                     /db_xref="GeneID:45318499"
                     /translation="MLEMLMQWYRRRFSDPEAIALLVILLAGFGIMFFFSGLLAPLLV
                     AIVLAYLLEWPTVRLERIGLSRTWATSLVLVLFVGILLLMAFVVMPVAWQQGIYLIRD
                     MPGMLNKLSDFAATLPRRYPALMDAGIIDAMAENMRSRMLTVGDSVVKYSLASLVGLL
                     TLAVYLVLVPLMVFFLLKDKQQMLNAVRRVLPRNRGLAGQVWKEMNQQITNYIRGKVL
                     EMIVVGVATWIGFILFGLNYSLLLAVLVGFSVLIPYIGAFVVTIPVVGVALFQFGAGT
                     EFWSLFAVYLIIQGLDGNLLVPVLFSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPL
                     ATLIKAVVHAWPDGMVIEDE"
     gene            112603..114066
                     /gene="bepA"
                     /locus_tag="EAE_RS00575"
                     /old_locus_tag="EAE_00550"
                     /db_xref="GeneID:45318500"
     CDS             112603..114066
                     /gene="bepA"
                     /locus_tag="EAE_RS00575"
                     /old_locus_tag="EAE_00550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-barrel assembly-enhancing protease"
                     /protein_id="WP_015703149.1"
                     /db_xref="GeneID:45318500"
                     /translation="MFRQLKKTLVAAAVASLTLGTILPAAADSADTLPDMGTSAGSTL
                     SIGQEMQMGDYYVRQLRGSAPLINDPLLVQYINGLGMRLVAHANSVRTPFHFYLINND
                     QINAFAFFGGNVVLHSALFRYADNESQLASVMAHEISHVTQRHLARAMEDQKRSAPLT
                     WVGALGSILLAMASPQAGMAALTGTLAGTQQGMISFTRQNEEEADRIGIQVLQRSGFD
                     PQAMPAFMGKLLDESRYSSRPPEMLLTHPLPESRLADARNRANQMRPVVVQSSADFYL
                     AKARTLGMYNSGENKLGSDLLDAWSKGNIREQHAAQYGRALLAMESNNYDQARKALQP
                     LLGADPQNPWYLDLATDIDLGQKKTTDAINRLKNAKEIRTDPVLQLNLANAYLQGGQP
                     AEAATILNRYTFNNKDDGNGWDLLAQAEGALGHRDQELAARAEGMALAGRLDQAISLL
                     SSASSQVKLGSLQQARYDARIDQLRQLQERFRPYQKM"
     gene            114076..114435
                     /gene="arsC"
                     /locus_tag="EAE_RS00580"
                     /old_locus_tag="EAE_00555"
                     /db_xref="GeneID:45318501"
     CDS             114076..114435
                     /gene="arsC"
                     /locus_tag="EAE_RS00580"
                     /old_locus_tag="EAE_00555"
                     /EC_number="1.20.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228190.1"
                     /note="This arsenate reductase requires both glutathione
                     and glutaredoxin to convert arsenate to arsenite, after
                     which the efflux transporter formed by ArsA and ArsB can
                     extrude the arsenite from the cell, providing resistance;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase (glutaredoxin)"
                     /protein_id="WP_015365459.1"
                     /db_xref="GeneID:45318501"
                     /translation="MSDAVKIYHNPRCSKSRDTLSLLKANGIDPEVVLYLETPPDAAT
                     LRQLLKMLNMSSARELMRQKEDLYKSLNLADPQLSEEALIQAMVENPKLIERPIVVSH
                     GQARIGRPPEQVLEIVS"
     gene            114571..115482
                     /locus_tag="EAE_RS00585"
                     /old_locus_tag="EAE_00560"
                     /db_xref="GeneID:45318502"
     CDS             114571..115482
                     /locus_tag="EAE_RS00585"
                     /old_locus_tag="EAE_00560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rpn family recombination-promoting
                     nuclease/putative transposase"
                     /protein_id="WP_015703150.1"
                     /db_xref="GeneID:45318502"
                     /translation="MKKAISTPHDAVFKTYLSHSDTARDFLRLYLPEALKEICDLRTL
                     HLESGNFIEEDLRPYYSDILYSLQTTAGDGYIYALIEHQSSPDRHMAFRLMRYAVAVM
                     QRHLDAGHEKLPLVIPVLFYHGLVTPYPFSMRWLDEFAAPELATTLYHGEFPLADITV
                     IPDDEIATHQRMATLELLQKHIRQRDLAQLLDKLSELLLTGLATQTQVHALMHYLVLA
                     GNSREPIKFIRELARRTPQHKETLMTIAEYLEQQGLERGLLQGRQEGRKEEAQRIAAA
                     MLRSGLAPALVAQLTGLAEQELASLSA"
     gene            complement(115479..116180)
                     /gene="hda"
                     /locus_tag="EAE_RS00590"
                     /old_locus_tag="EAE_00565"
                     /db_xref="GeneID:45318503"
     CDS             complement(115479..116180)
                     /gene="hda"
                     /locus_tag="EAE_RS00590"
                     /old_locus_tag="EAE_00565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaA inactivator Hda"
                     /protein_id="WP_026612247.1"
                     /db_xref="GeneID:45318503"
                     /translation="MNAPAQLSLPLYLPDDETFASFWPGDNPSLLAALQNVLRQEHSG
                     YIYIWSREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEQLALVCID
                     NIECVAGDEPWEMAIFNLYNRILESGKTRLLITGDCPPRQLHLGLPDLASRLDWGQIY
                     KLQPLSDEDKLQALQLRARLRGFEMPEDVCRFLLKRLDREMRSLFMTLDQLDHASITA
                     QRKLTIPFVKEILKL"
     gene            complement(116279..117565)
                     /gene="uraA"
                     /locus_tag="EAE_RS00595"
                     /old_locus_tag="EAE_00570"
                     /db_xref="GeneID:45318504"
     CDS             complement(116279..117565)
                     /gene="uraA"
                     /locus_tag="EAE_RS00595"
                     /old_locus_tag="EAE_00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil permease"
                     /protein_id="WP_015703151.1"
                     /db_xref="GeneID:45318504"
                     /translation="MTRRAIGVSERPPLLQTIPLSLQHLFAMFGATVLVPILFHINPA
                     TVLLFNGIGTLLYLLICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFC
                     IVSFIVKKAGTGWLDVMFPPAAMGAIVAVIGLELAGVAANMAGLLPADGQSPDSKTII
                     ISMVTLAVTVFGSVLFRGFLAIIPILIGVLVGYALSFVMGVVDTTPIAEAHWFALPTF
                     YTPRFEWFAIFTILPAALVVIAEHVGHLVVTANIVKRDLIRDPGLHRSMFANGLSTIV
                     SGFFGSTPNTTYGENIGVMAITRVYSTWVIGGAAIIAILLSCVGKLAAAIQIIPVPVM
                     GGVSLLLYGVIGASGIRVLIESKVDYSKAQNLILTSVILIIGVSGAKVHIGAAELKGM
                     ALATIVGICLSLIFKLISVLRPEEVVLDAADSEEAK"
     gene            complement(117662..118288)
                     /gene="upp"
                     /locus_tag="EAE_RS00600"
                     /old_locus_tag="EAE_00575"
                     /db_xref="GeneID:45318505"
     CDS             complement(117662..118288)
                     /gene="upp"
                     /locus_tag="EAE_RS00600"
                     /old_locus_tag="EAE_00575"
                     /EC_number="2.4.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="WP_015370402.1"
                     /db_xref="GeneID:45318505"
                     /translation="MKIVEVKHPLVKHKLGLMREHDISTKRFRELASEVGSLLTYEAT
                     ADLATERVTIEGWNGPVEVEQIKGKKITVVPILRAGLGMMEGVLEHVPSARISVVGIY
                     RDEETLEPVPYFQKLVSNIDERMALVVDPMLATGGSMIATIDLLKKAGCSSIKVLVLV
                     AAPEGIAALEKAHPDVELYTASVDQGLNEHGYIIPGLGDAGDKIFGTK"
     gene            complement(118485..119915)
                     /locus_tag="EAE_RS00605"
                     /old_locus_tag="EAE_00580"
                     /db_xref="GeneID:45318506"
     CDS             complement(118485..119915)
                     /locus_tag="EAE_RS00605"
                     /old_locus_tag="EAE_00580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009309507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_015703152.1"
                     /db_xref="GeneID:45318506"
                     /translation="MSGFKEGFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGAHGVP
                     RTITDGVLPGHNYPNHEAIDFYHRYKEDVALFAELGFKCFRTSIAWTRIFPRGDELEP
                     NEAGLQFYDDLFDECLKYGIEPVITLSHFEMPYHLVTEYGGWRNRKLIDFFVRFAKVV
                     FTRYQHKVKYWMTFNEINNQANFHEDFAPFTNSGLKYQPGEDREPVMFQAAHYELVAS
                     ALAVKAAREINSDLQIGCMIAMCPIYPLTCAPDDIMMAMNAMHRRYWFTDVHVRGRYP
                     QHLLNYFARRGFTLDITDADRLALKEGCVDYIGFSYYMSFATKATDDNPHLDYDESTS
                     LVSNPYVKKSDWGWQIDPVGLRYSLNWFWDHYQLPLFIVENGFGAIDVREADGSVDDQ
                     YRIEYLSAHIAEMKKAVVEDGVDLMGYTPWGCIDLVSAGTGEMKKRYGFIFVDKDNDG
                     RGTLARSRKKSFAWYQQVIASNGENL"
     gene            120165..121202
                     /gene="purM"
                     /locus_tag="EAE_RS00610"
                     /old_locus_tag="EAE_00590"
                     /db_xref="GeneID:45318507"
     CDS             120165..121202
                     /gene="purM"
                     /locus_tag="EAE_RS00610"
                     /old_locus_tag="EAE_00590"
                     /EC_number="6.3.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_416994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine cyclo-ligase"
                     /protein_id="WP_015703153.1"
                     /db_xref="GeneID:45318507"
                     /translation="MTDKTSLSYKDAGVDIDAGNALVDRIKGVVKKTRRPEVMGGLGG
                     FGALCALPQKYREPVLVSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEP
                     LFFLDYYATGKLDVDTAASVISGIAEGCLQSGCALVGGETAEMPGMYHGEDYDVAGFC
                     VGVVEKSEIIDGSKVADGDVLVALASSGPHSNGYSLVRKIIEVSGVDPQTTDLNGKPL
                     ADHLLAPTRIYVKSILNLIANVDVHAIAHLTGGGFWENIPRVLPDNTQAVIDESSWQW
                     PEVFNWLQTAGNVSSHEMYRTFNCGVGMLVALPAAEADKAITLLNEQGENAWKIGYIK
                     ASDAEQRVVIE"
     gene            121199..121840
                     /gene="purN"
                     /locus_tag="EAE_RS00615"
                     /old_locus_tag="EAE_00595"
                     /db_xref="GeneID:45318508"
     CDS             121199..121840
                     /gene="purN"
                     /locus_tag="EAE_RS00615"
                     /old_locus_tag="EAE_00595"
                     /EC_number="2.1.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycinamide formyltransferase"
                     /protein_id="WP_015370398.1"
                     /db_xref="GeneID:45318508"
                     /translation="MKNIVVLISGNGSNLQAIIDACARKQINGTLRAVFSNKAEAFGL
                     ERAREAGIPAFALSPKAFDSREAFDRELMQQIDVFQPDLVVLAGYMRILSPAFVGHYQ
                     GRLLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQARVPVFPE
                     DSEDDVTARVQAQEHDIYPLVVSWFVDGRLRMEANSAWLDNRKLPPQGYAAEE"
     gene            complement(121894..123234)
                     /locus_tag="EAE_RS00620"
                     /old_locus_tag="EAE_00600"
                     /db_xref="GeneID:45318509"
     CDS             complement(121894..123234)
                     /locus_tag="EAE_RS00620"
                     /old_locus_tag="EAE_00600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polygalacturonase"
                     /protein_id="WP_015703154.1"
                     /db_xref="GeneID:45318509"
                     /translation="MNIYLSQRHPHADGVTPDTELFQQALDELAQAGGGRLVVDCGRY
                     ALGGLRIGSNTCLWLSPGAELIVSENYDDFAQATALSRAESSDRAFLYAVDAQNITIC
                     GGGEIYGSADGWFSRGVDAMGYRTPAAARPRIILLENCRRVRLENITVRHAPMWTIHL
                     VSCAGVVVDGVTVDNDLTMANTDALDIDSCQQVHIANSYFSAADDAICLKTTDKPERI
                     QRPLRQVTIVNCTLRSKSCAFKIGTETWQDIEDVLVSNCTIFDSNRGIGLISRDGGRL
                     RRMIFSSIAFDCVSAPACHWGEADPVFLSARRRDPAIEPGEISQIQFRGLVGECEGAI
                     NLHSETPGQIRRILFDGVQLTQKLNLAAEQGLYDIRPPCNPMSPTGMGIDNAWCLNPQ
                     SGRVWGVEPYPGGLPVLYANGVAGLTLREFDYQRPIPLPAAWNPNALCLENGDN"
     gene            123656..125107
                     /locus_tag="EAE_RS00625"
                     /old_locus_tag="EAE_00605"
                     /db_xref="GeneID:45318510"
     CDS             123656..125107
                     /locus_tag="EAE_RS00625"
                     /old_locus_tag="EAE_00605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703155.1"
                     /db_xref="GeneID:45318510"
                     /translation="MGDIFGSGAMTITGLWLLYFYIEVAGLSPAAAASIFAIAKIWDG
                     ITDPVMGYITDNIRTRWGRRRIFFILGAPLSLCFALMWISGFGYAWYLGTYLLFSTVF
                     TLLMVPYDTLPAEMTTRYDLRSKMSGARMLFAQATAFLAALIPGQIMAHVADKSQAFL
                     YIGIIFALLFALPWIFVWRGTWEREHLPPPQTQQGLGKTLRSLYREMASTFRLRTFRI
                     HIMMYVGGAVALDIFGSLFMHYMTYVLRVGTSLASQAMSLMTLFQFFAIPLFTWLCIR
                     VGNGNAYKVAIALILCALLWFSQLTASFSHLSWLLLGGAIVMGIARGGTYLIPWNVYN
                     FLPDIDEAYTGVRREGIYAGVMMLTRKFSQALALFIVGLALEAFGFTKGAETQNTAAL
                     NGIWWVFLVGPGLLALLAMYGAFRFRLSQPRHQILISELERLRAGGHPQDASPQTRET
                     IELLTGHPHRNDRWQHAAVSSQGNHYVAEKQPS"
     gene            125082..126179
                     /locus_tag="EAE_RS00630"
                     /old_locus_tag="EAE_00610"
                     /db_xref="GeneID:45318511"
     CDS             125082..126179
                     /locus_tag="EAE_RS00630"
                     /old_locus_tag="EAE_00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 88"
                     /protein_id="WP_015370395.1"
                     /db_xref="GeneID:45318511"
                     /translation="MSQKNNRPELQSLIEALIGNLTAITDDSGEYLQRLADGRVVDTK
                     GWDGWEWTHGIALFGLFRYQQLTGSLRARELIDGWFSARFAEGTPEKNINTACPFLTL
                     ALCYQQTPRSDWRAYLESWGDAIYRQMPRTEEGCLQHVTYENPHHQQIWDDTLMMAVL
                     PLAMLGKMFDKPRWVEEAKFQFLQHLHYLSDHQSGLWFHGWHFDGRHHFAGALWARGN
                     SWITLAIPELLEMLELDEHDAFYRQLQNTLQIQVSALARCQAENGLWPTLLNDPDSYL
                     EASATAGFAAGIFKAVRLGYLDDAFLPVAGKACRGIIEHISPQGELTQVSFGTAMGND
                     LDHYRNIPLTAMPYGQAMAILCLVEALRRTL"
     gene            complement(126185..127843)
                     /locus_tag="EAE_RS00635"
                     /old_locus_tag="EAE_00615"
                     /db_xref="GeneID:45318512"
     CDS             complement(126185..127843)
                     /locus_tag="EAE_RS00635"
                     /old_locus_tag="EAE_00615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014230350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703156.1"
                     /db_xref="GeneID:45318512"
                     /translation="MWETRALELNNQDIWHWPSACRLIEYAIEHDFNTVVVGQTELFG
                     KLVSPQGYTPFDYNDRLSSQQRARCIYLNRLALRCREQGLRCYLQAKELSFPTELLLA
                     HPELLDTPRGVRFDVDFWSRWLTDKIRAVCQSVPALTGLIIALSSTDGLLPISRPQWD
                     RQHDDPRQPAQSLMLYRRCFNALSQAVAAQNKHLVLRVFPASNDDLSAVLDAIEPLPP
                     AVSVSIKLTPERFWPAFPNNPALLAVQTRDVWIDIDLAGEEVGWGVMPFLRIDELQGR
                     LLWCQSRNPRITGAICKTSWESIDNHWIPATLSECNLFACSQLLGEGAAKNQQQLLVQ
                     WLAQRYGWCPPADVAQQFQSLLEQATQTLYQSIYVRDHVFHRHSQLPESYGQAVWGLY
                     GQLARSHWLPGSAQDIHFTRDDPQKSMANLTQIAQEKDEVAASAQLLGKAAQAFALTA
                     DFPTALALRWREEWQGLAIYCQTFTHAQKAFFTLHFAREVENSWSMREICHINVQALY
                     RCASEMETLCQQTGEASPAFYVMFDPVRARNLADSLSTELTALR"
     gene            128021..130081
                     /gene="ppk1"
                     /locus_tag="EAE_RS00640"
                     /old_locus_tag="EAE_00620"
                     /db_xref="GeneID:45318513"
     CDS             128021..130081
                     /gene="ppk1"
                     /locus_tag="EAE_RS00640"
                     /old_locus_tag="EAE_00620"
                     /EC_number="2.7.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014171133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 1"
                     /protein_id="WP_015370393.1"
                     /db_xref="GeneID:45318513"
                     /translation="MGQEKLYIEKELSWLSFNERVLQEAADKSNPLIERMRFLGIYSN
                     NLDEFYKVRFAELKRRILISEEQGSTAHSRHLLGKIQARVLKADQEFDGLYNELLLEM
                     ARNQIFLINERQLSVNQQSWLRNYFKQYLRQHISPILINRETDLVQFLKDDYTYLAVE
                     IIRGDTINYALLEIPSDKVPRFVNLPPETPRRRKPMILLDNILRYCLDDIFKGFFDYD
                     ALNAYSMKMTRDAEYDLVHEMESSLMELMSSSLKQRLTAEPVRFVYQRDMPDAMVEML
                     RDKLSISNYDSMLPGGRYHNFKDFIGFPNVGKANLVNKPMPRLRHLWFDKFRNGFDAI
                     RERDVLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDSMIHAAHNGK
                     KVTVVVELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRKEGDEVVRY
                     AHIGTGNFNEKTARIYTDYSLLTADARITNEVRRVFNFIENPYRPVSFDYLLVSPQNS
                     RRLLYEMIDREIANAQNGQPSGITLKLNNLVDKGLVDRLYAASSTGVPVNLLIRGMCS
                     LIPGLEGISENIRVISIVDRFLEHDRVYCFENGGDKQVWLSSADWMTRNIDYRIEVAV
                     PLLDPRLKQRVLDILDILFNDTVKARYLDKELSNRYVPRGNRRKVRAQIAIYDYLKSL
                     EQPD"
     gene            130085..131611
                     /gene="ppx"
                     /locus_tag="EAE_RS00645"
                     /old_locus_tag="EAE_00625"
                     /db_xref="GeneID:45318514"
     CDS             130085..131611
                     /gene="ppx"
                     /locus_tag="EAE_RS00645"
                     /old_locus_tag="EAE_00625"
                     /EC_number="3.6.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002913839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exopolyphosphatase"
                     /protein_id="WP_015703157.1"
                     /db_xref="GeneID:45318514"
                     /translation="MPINEKTPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQR
                     VHLADGLDENSVLSEEAITRGLNCLSLFAERLQGFSPSSVCIVGTHTLRQAANAADFL
                     KRAEKVIPYPIEIISGNEEARLIFMGVEHTQPERGRKLVIDIGGGSTELVIGEDFEPR
                     LVESRRMGCVSFSQAYFAGGVINKENFQRARLAAVQKLETLAWQFRIQGWNVALGASG
                     TIKAAHEVLVAMGEKDGFITPERLEMLVSELLKNKNFDSLSLPGLSEDRKAVFAPGLA
                     ILCGVFDALAIKELRLSDGALREGVLYEMEGRFRHQDIRSRTAQSLANQYNIDREQAR
                     RVLETTTQMLEQWQEQNPKLANPHLSALLKWAVMLHEVGLNINHSGMHRHSAYILQNS
                     DLPGFNQEQQTLMATLVRYHRKAIKLDDLPRFTLFKKKQFLPLIQLLRLGVLLNNQRQ
                     ATTTPPKLTLKTEANHWTLIFPHDWFSQNALVLLDLEKEQQYWEGVPEWLLKITEEEV
                     "
     gene            complement(131660..133891)
                     /locus_tag="EAE_RS00650"
                     /old_locus_tag="EAE_00630"
                     /db_xref="GeneID:45318515"
     CDS             complement(131660..133891)
                     /locus_tag="EAE_RS00650"
                     /old_locus_tag="EAE_00630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor domain-containing phosphodiesterase"
                     /protein_id="WP_015703158.1"
                     /db_xref="GeneID:45318515"
                     /translation="MSIIKLYKRYQDKWWALPLILPTLLLPLARAANTFANLNGHTVF
                     LFYLPLALVLSLMLFFGWAAIPGIIVGLLLTITRGMTFEQSIGVLFHFLIPSVLCWGG
                     YRIFVPRRQQISHGNVALMPHRLFWQMLLPSVIFLIISQIAEYLGLHPRAAELVGSTP
                     FSLRSLITFQALMVGCLTGVPLCYFLLRVIRNPLHLRGFISQVRLQIDQKIKPLEIIV
                     WAIVLLIILALLFMPLNASSTIFSTNYTLSLLMPVMLWGAMRFGYRFISLAWPPILIL
                     VIHFHYSYLPFSPIYNNQLAITSSSYLVFSFIIAYMAMLATQQRMIHRRVRRMAFLDP
                     VVHMPNLRALSRALNHSTWSVLCFLRMPELELLGRHYGVMLRIQYKQQLSEYLSHILQ
                     PNEMVYHLSGHDLVIRLNSDDHQKRIVMLDERIKQFRFIWDGIPLQPPVGISYCNVRS
                     PVKHLYLLLGELNNIADMSLTSGHPENVQRRGAVHVQQGLKERVSMMNQILQALDQNR
                     FRLMAQPIIGMRGDSYHEVLLRMVGEQGELVAPDNFLPAAHEFGLASRIDNWVIDNTL
                     AFMNDNRHTLPGMRLAINLSPVSVSRSRFPDEVEEMLHHYNIEPWQLIFELTENHSLS
                     NPEQAQQTLARLQELGCRVAIDDFGTGYASYARLKTLNVDMLKIDGSFIRNLVTSSLD
                     YQVVASICRLAQIKNMQVVAEYVESPEIRQAVISLGIDYMQGYDIGMPVPIEQLACAA
                     DVA"
     gene            134263..134454
                     /locus_tag="EAE_RS00655"
                     /old_locus_tag="EAE_00635"
                     /db_xref="GeneID:45318516"
     CDS             134263..134454
                     /locus_tag="EAE_RS00655"
                     /old_locus_tag="EAE_00635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2633 family protein"
                     /protein_id="WP_015370389.1"
                     /db_xref="GeneID:45318516"
                     /translation="MRKRHRFNRRMTRIVLLISFLFFFGRFVYSSIGAWYHHQDKQES
                     QQSTITIDAPATPTTPAQE"
     gene            complement(134458..135351)
                     /locus_tag="EAE_RS00660"
                     /old_locus_tag="EAE_00640"
                     /db_xref="GeneID:45318517"
     CDS             complement(134458..135351)
                     /locus_tag="EAE_RS00660"
                     /old_locus_tag="EAE_00640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703160.1"
                     /db_xref="GeneID:45318517"
                     /translation="MTMLNLVNLTTFRLVAQRGSFSAAADVLGISQPAVSLQVRQLEQ
                     FLQTRLVERTGRGIKATAAGLALLAHSEIIEQAVNTAVQSVAEFNHKVHGTMSFGTGA
                     TACIHLLPPLLCHLREKHPLLTVGVTTGNTLDIVRAVEESRLDLGLVTLPASGRSLAV
                     TPVLEEEFVFITANDDEPLVGQLTPSLLQALSLIAFEAGSGTRELIDGWFRAAGVNSA
                     PVMQLGSIEAIKRMVRAGLGYSIVPKMAVAAEDDRTGIRVQSLSPRLYRQLGVVMRQD
                     KVINKGIAEMLRLLHQLKILP"
     gene            135450..136658
                     /locus_tag="EAE_RS00665"
                     /old_locus_tag="EAE_00645"
                     /db_xref="GeneID:45318518"
     CDS             135450..136658
                     /locus_tag="EAE_RS00665"
                     /old_locus_tag="EAE_00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703161.1"
                     /db_xref="GeneID:45318518"
                     /translation="MKTSILPGTAPLSLTLAAGGNQLINWGIVFYMPGTFAGAIANDT
                     GWGGTEIFLGLTFAMLMMAAISPFIARLLAWFGGQRVVFIGSLTIAASCLAMSQADSL
                     IFWYVAWLLAGVGMRLALYDALFAALVNLYGQRARVTISRVTLAGGLASAIFWPLGTA
                     LLALMGWRGALVIYSLFGLLSALLLWRMPNQRLPDRSAHQEKVPLSRRDQHMGLLYAS
                     LIALVTFISNGTSTHLPEFIASYGLPVMIGVLWGIGQTGARFLEVISGARLSPLRLTL
                     LTTALLPLCFLLGLNAASLSWTVGGFVFAYGAINGLTTVFKATLPLQLFAAEDYARRT
                     GRLLIPAQLLAAVSPFAYAWLNQHLGIERSLAISGLLSLVVLGLALRIGWLQRRQVVR
                     ISHGQSEERV"
     gene            complement(136693..137025)
                     /locus_tag="EAE_RS00670"
                     /old_locus_tag="EAE_00650"
                     /db_xref="GeneID:45318519"
     CDS             complement(136693..137025)
                     /locus_tag="EAE_RS00670"
                     /old_locus_tag="EAE_00650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015370386.1"
                     /db_xref="GeneID:45318519"
                     /translation="MEQQVTFEYTLTVKHCIDTIAGFLKRVDVEPRPVIADILTQFES
                     TVGQFPLGCQICPELLKIGCAKYREFNHAEGYRVLYSVDGTLVTAHAILAHRQDVQQL
                     LFKRLIVA"
     gene            complement(137056..137289)
                     /locus_tag="EAE_RS00675"
                     /old_locus_tag="EAE_00655"
                     /db_xref="GeneID:45318520"
     CDS             complement(137056..137289)
                     /locus_tag="EAE_RS00675"
                     /old_locus_tag="EAE_00655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002463661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system Phd/YefM family
                     antitoxin"
                     /protein_id="WP_004853132.1"
                     /db_xref="GeneID:45318520"
                     /translation="MKVETISYVKKNAATLDLSEPILVTQNGVPAYVIESYDQQQERE
                     NAIALLKLLTLSEKDKAEGRVFSKDQLLDGLAD"
     gene            complement(137431..139008)
                     /gene="guaA"
                     /locus_tag="EAE_RS00680"
                     /old_locus_tag="EAE_00660"
                     /db_xref="GeneID:45318521"
     CDS             complement(137431..139008)
                     /gene="guaA"
                     /locus_tag="EAE_RS00680"
                     /old_locus_tag="EAE_00660"
                     /EC_number="6.3.5.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-hydrolyzing GMP synthase"
                     /protein_id="WP_015703162.1"
                     /db_xref="GeneID:45318521"
                     /translation="MTDNIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEA
                     QIREFNPNGIILSGGPESTTEDNSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEA
                     SNEREFGYAQVEVQTDSALIKGIEDALSADGKPLLDVWMSHGDKVTAIPSDFVTVAST
                     ESCPFAIMANEEKRFYGVQFHPEVTHTRQGLRMLERFVRDICQCEALWTPAKIIDDAV
                     ERIRQQVGEDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDM
                     FGDRFGLNIVHVAAEDRFLTALKGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQ
                     GTIYPDVIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELG
                     LPYDMLFRHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYDKVSQAFTV
                     FLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGIS
                     RVVYDISGKPPATIEWE"
     gene            complement(139078..140544)
                     /gene="guaB"
                     /locus_tag="EAE_RS00685"
                     /old_locus_tag="EAE_00665"
                     /db_xref="GeneID:45318522"
     CDS             complement(139078..140544)
                     /gene="guaB"
                     /locus_tag="EAE_RS00685"
                     /old_locus_tag="EAE_00665"
                     /EC_number="1.1.1.205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004159092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_015370334.1"
                     /db_xref="GeneID:45318522"
                     /translation="MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPM
                     LSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVSDPQTVLP
                     TTTLREVKELTERNGFAGYPVVTEDNELVGIITGRDVRFVTDLNQPVSVYMTPKERLV
                     TVREGESREVVFAKMHEKRVEKALVVDDSFHLRGMITVKDFQKAERKPNACKDEHGRL
                     RVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGG
                     NVATGAGARALAEAGVSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGTGIP
                     VIADGGIRFSGDIAKAIAAGAAAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLG
                     AMSKGSSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTI
                     DALRTKAEFVRISGAGIQESHVHDVTITKESPNYRMGS"
     gene            140703..142076
                     /gene="xseA"
                     /locus_tag="EAE_RS00690"
                     /old_locus_tag="EAE_00670"
                     /db_xref="GeneID:45318523"
     CDS             140703..142076
                     /gene="xseA"
                     /locus_tag="EAE_RS00690"
                     /old_locus_tag="EAE_00670"
                     /EC_number="3.1.11.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="WP_015703163.1"
                     /db_xref="GeneID:45318523"
                     /translation="MLPSQSPAIFTVSRLNQTVRLLLEREMGQVWISGEISNFSQPSS
                     GHWYFTLKDDNAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESM
                     QPAGEGLLQQKYEQLKALLTAEGLFDQSHKQALPSPAHCVGVVTSKTGAALHDILHVL
                     KRRDPSLPVIIYPTAVQGDDAPGQIVRAIALANQRQECDVLIVGRGGGSLEDLWSFND
                     ERVARAIFASRIPVVSAVGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQLQS
                     GQQRLEMAMDYFLANRHRRFTQLFHRLQQQHPQLRLARQQTELERLRQRMRFALESQL
                     KRADQRQQRAVQRLNQQNPQPRIHRAQSRIQQLEYRLAENIRARLSEQRERFGNTVTH
                     LEAVSPLATLARGYSVTSAGDGKVLKKIKQVQAGDVVTTRLEDGWVESEVTVITPVKK
                     TRARKKV"
     gene            142157..143185
                     /locus_tag="EAE_RS00695"
                     /old_locus_tag="EAE_00675"
                     /db_xref="GeneID:45318524"
     CDS             142157..143185
                     /locus_tag="EAE_RS00695"
                     /old_locus_tag="EAE_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M4 family protein"
                     /protein_id="WP_015370332.1"
                     /db_xref="GeneID:45318524"
                     /translation="MPDTRPRFVIPPYILRRIVDHGSAQQQRCAQQTLSHVQTLMAHV
                     PGRPAAAHVATPGQLERDIYDARQTQELPGIQVRFEGQPSNGDVAVDEAYDYLGITHD
                     FFWKSYHRDSLDNRGLKLTGSVHYGHEYQNAFWNGQQMVFGDGDGEIFNRFTIAIDVV
                     AHELSHGVTESEAGLIYFEQSGALNESLSDVFGSLVKQYQRQQTADKADWIIGEGLLA
                     KGIHGQGLRSMSHPGTAYDDPILGKDPQPAHMKDFVHTQQDNGGVHINSGIPNHAFYL
                     AAIALGGFAWEKAGYAWYDAVCDKSLAKDADFPAFAKLTIHHGEKRFGKETAEAIRKA
                     WEDVGVTS"
     gene            143182..143520
                     /locus_tag="EAE_RS00700"
                     /old_locus_tag="EAE_00680"
                     /db_xref="GeneID:45318525"
     CDS             143182..143520
                     /locus_tag="EAE_RS00700"
                     /old_locus_tag="EAE_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004104472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703164.1"
                     /db_xref="GeneID:45318525"
                     /translation="MNEADLSDDAIIELAREGGVAWIPTLSGMRKIVVAQLNEQQKQR
                     IAAILQQSLPLGKPPGQPDSPGSGDQRFFRIQIISAQHYHSLIILIPEERAPEALVEL
                     WRNGEGCVSD"
     gene            complement(143517..143732)
                     /locus_tag="EAE_RS00705"
                     /old_locus_tag="EAE_00685"
                     /db_xref="GeneID:45318526"
     CDS             complement(143517..143732)
                     /locus_tag="EAE_RS00705"
                     /old_locus_tag="EAE_00685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000422355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703165.1"
                     /db_xref="GeneID:45318526"
                     /translation="MELNCPICHARLETQGNGAHCAHCEKEFAVEARCPDCHQPLEVL
                     KACGAVDYFCQHGHGLISKKRVEFVLG"
     gene            complement(143850..145328)
                     /gene="der"
                     /locus_tag="EAE_RS00710"
                     /old_locus_tag="EAE_00690"
                     /db_xref="GeneID:45318527"
     CDS             complement(143850..145328)
                     /gene="der"
                     /locus_tag="EAE_RS00710"
                     /old_locus_tag="EAE_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase Der"
                     /protein_id="WP_015370328.1"
                     /db_xref="GeneID:45318527"
                     /translation="MIPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGR
                     AEVEGREFICIDTGGIDGTEEGVETRMAEQSLLAIEEADVVLFMVDARAGLMPADSAI
                     AKHLRSREKPTFLVANKTDGIDVDQAMADFWSLGLGDIYPIAASHGRGVTSLLEHVLL
                     PWVDEVNPQEEVDEDAAYWAQFEAEQNGEEVEEPEDDFNPQDLPIKLAIVGRPNVGKS
                     TLTNRILGEDRVVVYDMPGTTRDSIYIPMQRDEREYVLIDTAGVRKRGKITDVVEKFS
                     VIKTLQAIEDANVVMLVIDAREGISDQDLSLLGFILNSGRSLVIVVNKWDGLSQEVRE
                     QVKETLDFRLGFIDFARVHFISALHGSGVGNLFESVREAYDSATRRVGTAMLTRIMTM
                     AAEDHQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYLMNYFRKSLDV
                     MGTPIRIQFKEGENPFANKRNTLTPNQMRKRKRLIKHIKKSK"
     gene            complement(145442..146620)
                     /gene="bamB"
                     /locus_tag="EAE_RS00715"
                     /old_locus_tag="EAE_00695"
                     /db_xref="GeneID:45318528"
     CDS             complement(145442..146620)
                     /gene="bamB"
                     /locus_tag="EAE_RS00715"
                     /old_locus_tag="EAE_00695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamB"
                     /protein_id="WP_015370327.1"
                     /db_xref="GeneID:45318528"
                     /translation="MQLRKLLLPGLLSVTLLSGCSLFNSEEDVVKMSPLPTVENQFTP
                     STSWSTSVGDGIGDFYSNLHPAFADGVVYAADRKGTVKALHAEDGKEVWSVNLAEKDG
                     WFSRAPALLSGGLTVSGGHVYVGTEKAQLFALNTSDGTVAWQSRVAGEAISRPVVSDG
                     MVLVHTSNGQLQALNETDGAVKWTVNLDMPALSLRGESAPATAYGAAIVGGDNGRVSA
                     VLMQQGQMIWQQRISTATGPTEIDRLNDVDTTPVIVNGVVYTLAYNGNLTALDLRSGQ
                     IIWKRELGSVNDFIVDGDRIYLVDQNDRLLALTTDGGVTLWTQSDLLHRLLTSPALYN
                     GSLVVGDSEGYMHWINPEDGHFVAQQKVDSSGFLTDPVIADGRLLIQAKDGTLYSITR
                     "
     gene            complement(146631..147251)
                     /locus_tag="EAE_RS00720"
                     /old_locus_tag="EAE_00700"
                     /db_xref="GeneID:45318529"
     CDS             complement(146631..147251)
                     /locus_tag="EAE_RS00720"
                     /old_locus_tag="EAE_00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfgM family protein"
                     /protein_id="WP_015370326.1"
                     /db_xref="GeneID:45318529"
                     /translation="METFNNENEQVDALKRFFAENGKALAVGVILGIGALVGWRYWTS
                     HQLDSARDSSLAYENAISALKSDSPETLTAAEKFAADSKNTYGAFASLELAQRLVDKN
                     DLQGAEKQLQQGLAAASDDNLKSVINMRLARVQLQLKQPDAALKTLEGIKGEGWTAIV
                     ADLRGEILLSKGDKQGARAAWESGVKSDASPALSEMMRMKINNLSI"
     gene            complement(147286..148560)
                     /gene="hisS"
                     /locus_tag="EAE_RS00725"
                     /old_locus_tag="EAE_00705"
                     /db_xref="GeneID:45318530"
     CDS             complement(147286..148560)
                     /gene="hisS"
                     /locus_tag="EAE_RS00725"
                     /old_locus_tag="EAE_00705"
                     /EC_number="6.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005120428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_015703166.1"
                     /db_xref="GeneID:45318530"
                     /translation="MAKNIQAIRGMNDYLPGETALWQRIEGSLKQVLGSYGYSEIRLP
                     IVEQTPLFKRAIGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQE
                     QRLWYVGPMFRHERPQKGRYRQFHQIGAEVFGLQGPDIDAELIMLTARWWRELGISDH
                     VSLELNSIGSLEARAAYRDALVAYLEQFKDKLDEDCKRRMYTNPLRVLDSKNPEVQAL
                     LNDAPALGDYLDDESKEHFAGLCALLDAAGIRYTVNQRLVRGLDYYNRTVFEWVTTSL
                     GSQGTVCAGGRYDGLVEQLGGRATPGVGFAMGLERLVLLVQAVNPEFKADPVVDIYLV
                     ASGTDTQSAAMRLAEQVRDALPGVKLMTNHGGGNFKKQFARADKWGARVALVVGESEI
                     ADGNVVVKDLRSGEQTTVTQDSVAAHLRTLLG"
     gene            complement(148650..149771)
                     /gene="ispG"
                     /locus_tag="EAE_RS00730"
                     /old_locus_tag="EAE_00710"
                     /gene_synonym="gcpE"
                     /db_xref="GeneID:45318531"
     CDS             complement(148650..149771)
                     /gene="ispG"
                     /locus_tag="EAE_RS00730"
                     /old_locus_tag="EAE_00710"
                     /gene_synonym="gcpE"
                     /EC_number="1.17.7.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin-dependent
                     (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase"
                     /protein_id="WP_015370324.1"
                     /db_xref="GeneID:45318531"
                     /translation="MHNQAPIQRRKSKRIYVGNVPIGDGAPIAVQSMTNTRTTDVAAT
                     VNQIKALERVGADIVRVSVPTMDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYGV
                     DCLRINPGNIGNEERIRMVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLES
                     AMRHVDHLDRLNFDQFKVSVKASDVFLAVESYRLLAKQIDQPLHLGITEAGGARSGAV
                     KSAIGLGLLLSEGIGDTLRVSLAADPVEEIKVGFDILKSLRIRSRGINFIACPTCSRQ
                     EFDVIGTVNALEQRLEDIITPMDVSIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGV
                     RKDRLDNNDMIDQLEARIRAKATMLDEARRIEVQQVEAK"
     gene            complement(149798..150796)
                     /gene="rodZ"
                     /locus_tag="EAE_RS00735"
                     /old_locus_tag="EAE_00715"
                     /db_xref="GeneID:45318532"
     CDS             complement(149798..150796)
                     /gene="rodZ"
                     /locus_tag="EAE_RS00735"
                     /old_locus_tag="EAE_00715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytoskeleton protein RodZ"
                     /protein_id="WP_015370323.1"
                     /db_xref="GeneID:45318532"
                     /translation="MNTEATQDHQEANSTGARLRNAREQLGLSQQAVAERLCLKVSTV
                     RDIEEDKAPADLASTFLRGYIRSYARLVHIPEEELLPMMAKQAPIRAAKVAPMQSFSL
                     GKRRKKRDGWLMSFTWLILFVVIGLSGAWWWQDHKAQQEEITSMADQSTSDLNSSDSG
                     SQSIPLDTSSANNAPDTTAANANSAPVDTSTAPAPSAPAATSAPVDNNAVVAPSQANV
                     DTAAAAPAAPAPTSALPTDQANAATTASAQDLVMNFSADCWLEVSDATGKKLFSGLQR
                     KGGNLNLSGQAPYKLKIGAPAAVQIQYLGKPVDLSRFIRTNQVARLTLNAEQSPAQ"
     gene            complement(151071..152237)
                     /gene="trmG/rlmN"
                     /locus_tag="EAE_RS00740"
                     /old_locus_tag="EAE_00720"
                     /db_xref="GeneID:45318533"
     CDS             complement(151071..152237)
                     /gene="trmG/rlmN"
                     /locus_tag="EAE_RS00740"
                     /old_locus_tag="EAE_00720"
                     /EC_number="2.1.1.-"
                     /EC_number="2.1.1.192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional tRNA
                     (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA
                     large subunit methyltransferase RlmN"
                     /protein_id="WP_015370322.1"
                     /db_xref="GeneID:45318533"
                     /translation="MSEQIVTPDTAALTVPNKDAKINLLDLNRQQMREFFKNMGEKPF
                     RADQVMKWMYHYCCDDFDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIA
                     VGDQRVETVYIPEEDRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAA
                     KIVGAVKTTGVRPITNVVMMGMGEPLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSG
                     VVPALDKLGDMIDVALAISLHAPNDTIRDEIVPINKKYNIETFLNSVRGYISKSNANQ
                     GRVTIEYVMLDHVNDGTEHAHELAALLKDTPCKINLIPWNPFPGAPYGRSSNSRIDRF
                     SKVLMEYGFTTIVRKTRGDDIDAACGQLAGDVIDRTKRTLRKRMQGEAIDVKAV"
     gene            complement(152588..153019)
                     /gene="ndk"
                     /locus_tag="EAE_RS00745"
                     /old_locus_tag="EAE_00725"
                     /db_xref="GeneID:45318534"
     CDS             complement(152588..153019)
                     /gene="ndk"
                     /locus_tag="EAE_RS00745"
                     /old_locus_tag="EAE_00725"
                     /EC_number="2.7.4.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="WP_004866348.1"
                     /db_xref="GeneID:45318534"
                     /translation="MAIERTFSIIKPNAVAKNVIGSIFSRFEAAGFKIVGTKMLHLTV
                     EQARGFYAEHEGRPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPDNALAGT
                     LRADYADSFTENGTHGSDSVESAAREIAFFFAEGEVCPRTR"
     gene            complement(153180..155504)
                     /gene="pbpC"
                     /locus_tag="EAE_RS00750"
                     /old_locus_tag="EAE_00730"
                     /db_xref="GeneID:45318535"
     CDS             complement(153180..155504)
                     /gene="pbpC"
                     /locus_tag="EAE_RS00750"
                     /old_locus_tag="EAE_00730"
                     /EC_number="2.4.1.129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228221.1"
                     /note="penicillin-binding protein 1C; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan glycosyltransferase PbpC"
                     /protein_id="WP_015703167.1"
                     /db_xref="GeneID:45318535"
                     /translation="MRALPRIKRRWRWLAAFIFLLWLAVLLADRLWPLPLHEVTPARV
                     VVAEDGTPLWRFADAQGVWRYPVTIADVSPRYLQALIQYEDRWFWKHPGVNPFAVLRA
                     AWQDLTSGRVISGGSTLTMQVARLLDPHPRTFGGKLRQLWRALQLEWHLSKSEILTLY
                     LNRAPFGGTLQGIGAASWAYLGKPPAQLSYGEAALLAVLPQAPSRLRPDRWPQRAQAA
                     RDKVLERMLSQGVWPQRAVQEAMEEPVWLFPRQMPQLAPLFARRVLATSGDEKVTTTL
                     DAGLQRQLEDLAMNWKSRLPPRSSLAIVVVDHTDMKVRGWVGSADIRDDSRFGHIDMV
                     SAVRSPGSVLKPFIYAMAMDDGLIHPASLLQDVPRRFSDYRPGNFDSGFHGPVSASEA
                     LVRSLNLPAVQVLEAYGPKRFAANLRNAGLPLMLPAGAEPNLSLILGGAGARLEDIVA
                     AYGAFARHGKAARLRMKPDDPLVERALMSPGAAWITRRILAGEAQPLPDASLPQAVPL
                     AWKTGTSYGYRDAWAVGLNARYLIGIWTGRPDGTPVVGQFGFASAVPLLNQVNNMLLA
                     RPLMSRGGLPVDPRPQSVSRGTVCWPGGQDLPVGDSNCRRRLASWLLDASQPPTLLLP
                     GQEGVRGIRFPVWRNAAGERVAADCPGATETSVDVWPLPLEPWLPVSERRRARLGTAS
                     KACPPLQTQDAAPLVLSGIREGAVIKRLPGEARVMLPVQTSGGEGRRWWFINGEPLEA
                     TGARTTITLDKPGEWQLVVMDEAGQTAAANFTLQ"
     gene            complement(155505..160448)
                     /locus_tag="EAE_RS00755"
                     /old_locus_tag="EAE_00735"
                     /db_xref="GeneID:45318536"
     CDS             complement(155505..160448)
                     /locus_tag="EAE_RS00755"
                     /old_locus_tag="EAE_00735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-2-macroglobulin family protein"
                     /protein_id="WP_015703168.1"
                     /db_xref="GeneID:45318536"
                     /translation="MKPFRLAALSLALLTALSLSGCDNSGEPQAVSAADKGAADSAKK
                     PDSAQLATLKEKSQGKALTLLDASEVQLDGAATLVLTFSIPLKPDQDFSHSVHLVDKK
                     SGKVDGAWELAPNLKELRLRHLEPKRELIVTVDPTLIALNDATLGSPFEKTIATRDIA
                     PSVGFASRGSLLPGKVVAGLPVMALNVDNVDVNFFRIKPESLSAFVSQWEYRNSLSNW
                     ESDELLKMADLVYSGRFDLNPARNTREKLLLPLNDIKPLQQPGVYVAVMNPAGHYSYS
                     NAATLFTLSDIGVSAHRYHNRLDVFTQSLENGAAQSGIEVQLLNAKGQTLAQAKSDSQ
                     GHVTLQTDKEAALLLARKDGQTTLLDLKLPALDLAEFSIAGAPGFSKQFFMFGPRDLY
                     RPGETVILNALLRDGDGKPLAEQPVKLEVVQPDGQVIRSVMSKPVNGLYQFTYPLDSG
                     AATGMWHIRASTGDNQPREWDFHVEDFMPERMALNLTPQAAPIAPDADVAFSVSGAYL
                     YGAPASGNQLQGKLFLRPLRDAVAALPGFQFGDIAEENLSRSLDEVQLTLDEKGHGEV
                     TTASQWQDSHSPLQVVLQASLLESGGRPVTRTVQQPIWPAEALPGIRPQFTLKDVYDY
                     RTDTTVKQPVVDENSNAAFDIVYADARGEKKAVSGLQVRLIRERRDYYWNWSDSEGWQ
                     SQFDQKDLQEGETSLDLQAGQIGKVSFPVGWGSYRLEVKGPDDVVSSVRFWAGYSWQD
                     NSEGTGAARPDRVTMKLDKPGYKPGDTIKLHIAAPAAGKGYAMVESSEGPLWWQEIDV
                     PAEGMDLSIPVDKAWNRHDLYLSTLVVRPGDKSRSATPKRAVGLLHLPLGDENRRLSL
                     ALEAPEKMRPNQPLTVKVKASVKEGEVPKQVNVLLSAVDSGVLNITDYATPDPWNAFF
                     GQKRYGADIYDIYGQVIEGQGRLASLRFGGDGDELKRGGKPPVNHVTIVAQQAQPVVL
                     DDRGEGSVTLPIGDFNGELRVMAQAWTADDFGSSEDKVVVAAPVIAELNTPRFLASGD
                     ATRLALDLSNLTDKPQTLQVHLTASGLVTLTEGQLPPVQLAPGARSTLFVPVTALAGF
                     GDGQVNATISGLSLPGETFASLQKQWKIGVRPAFPAQTVNSGAVLQPGESWQAPAAQS
                     QGFAPQTLQGQLLLSGKPPLNLARYIRELKAYPYGCLEQTASGLFPSLYTSAAQLKAL
                     GISGDSDEKRRAAVDVGISRLLQMQLENGGFALWDKAGPEEYWLTAYAMDFLVRAGEQ
                     GYSVPVNAINKGNERLLRYLQEPGLMTVRYSDDAQASRFAAQAYAALVLARQQKAPLG
                     VLREIWSRHEQARSGLPLLQLGIALKTMGDAPRGAEAMKLAVTTPRQDENRWLGDYGS
                     QLRDDALKLALLEENKLLPEVQNQLLSSLSEEAFGQRWLSTQETNALFLAGRTLADLP
                     GNWQAQTSLQAEPLASDKAQTRNLDGDRLAALQVTNTGNQPLWLRLDSSGYPQSAPQP
                     GGNVLGIERAIFDTHGQQKSLTSLRSGELVLVKLEVTAKRNVPDALVVDLLPAGLELE
                     NQNLANSSASLQENGEAVQNLLNQMQQADIQHIEFRDDRFVAAVAINEGQPVTLVYLA
                     RAVTPGTYQVPQPQVESMYVPQWRATGTASGPLTVTP"
     gene            160653..161501
                     /gene="sseA"
                     /locus_tag="EAE_RS00760"
                     /old_locus_tag="EAE_00740"
                     /db_xref="GeneID:45318537"
     CDS             160653..161501
                     /gene="sseA"
                     /locus_tag="EAE_RS00760"
                     /old_locus_tag="EAE_00740"
                     /EC_number="2.8.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-mercaptopyruvate sulfurtransferase"
                     /protein_id="WP_015370319.1"
                     /db_xref="GeneID:45318537"
                     /translation="MSTSFFVAADWLAEHIDDPQIQILDARMAPAGQEALRDMAAEYR
                     DGHIPGAVFFDIEALSDHTSPLPHMMPRAETFAVAMRELGVNSDKHLVVYDEGNLFSA
                     PRAWWMLRTFGVEKVSIVAGGLEGWRRDELPLEKGEPDLPEGEFEVNFDPEVIKRLTD
                     VLLVSHEGSAQIVDARPAARFNGLADEPRPGLRRGHIPGALNVPWTELVINGELKTVD
                     EMNDIFKRQGVDFARPIIASCGSGVTAAVVVLALTTLGVNGVCLYDGSWSEWGARTDL
                     PIEPAQ"
     gene            complement(161545..162321)
                     /gene="sseB"
                     /locus_tag="EAE_RS00765"
                     /old_locus_tag="EAE_00745"
                     /db_xref="GeneID:45318538"
     CDS             complement(161545..162321)
                     /gene="sseB"
                     /locus_tag="EAE_RS00765"
                     /old_locus_tag="EAE_00745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enhanced serine sensitivity protein SseB"
                     /protein_id="WP_015703169.1"
                     /db_xref="GeneID:45318538"
                     /translation="MSDTKNELETLLEKAATEPAHRPAFFTALLEATVWVPGSAADGE
                     QIVEDSALDLQHWEKEDGTSVIPFFTSLEALQQAVEDEQAFVMMPARTLMAMTLGESL
                     FLNPKLPSGKEFTPREISHLLGEEGSPLSTQTVLEGGEALLLSEVAEPPAQMVDSLTT
                     LFKTLKTVKRAFLCSIKESADAPTNLLIGIEAEGDIESIIQTTGSVATDTLPGDEPID
                     ICQVVEGEKGISHFMIAHITPFYEKRWGSFLRDFKQNRII"
     gene            complement(162406..163692)
                     /gene="pepB"
                     /locus_tag="EAE_RS00770"
                     /old_locus_tag="EAE_00750"
                     /db_xref="GeneID:45318539"
     CDS             complement(162406..163692)
                     /gene="pepB"
                     /locus_tag="EAE_RS00770"
                     /old_locus_tag="EAE_00750"
                     /EC_number="3.4.11.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase PepB"
                     /protein_id="WP_015370317.1"
                     /db_xref="GeneID:45318539"
                     /translation="MTEAMKITLSTLPADARWGEKATWSINNDGIALHLNGKDDLGLI
                     QRAARKIDGMGIKHVALSGEGWNTDRAWAFWAGYKGPKGQRQVEWPTLDDAQRSELDN
                     RLTIIDWVRDTINAPAEELGPEQLAQRAVDLLCGVAGEKVSYRITKGEDLREQNYLGL
                     HTVGRGSERPPVLLALDYNPTGDKDAPVYACLVGKGITFDSGGYSIKQSAFMDSMKSD
                     MGGAATVTGALAFAITRGLNKRVKLFLCCADNLISGNAFKLGDIIHYRNGKTVEIMNT
                     DAEGRLVLADGLIDASAQKPQLIIDAATLTGAAKTALGNDYHALFSFDDALANRLLAS
                     AQAENEAFWRLPLAEFHRNQLPSNFAELNNTGSAAYPAGASTAAGFLSHFVENYHQGW
                     LHIDCSATYRKAAVEQWSAGATGLGVRTIANLLTAE"
     gene            complement(163764..163964)
                     /gene="iscX"
                     /locus_tag="EAE_RS00775"
                     /old_locus_tag="EAE_00755"
                     /db_xref="GeneID:45318540"
     CDS             complement(163764..163964)
                     /gene="iscX"
                     /locus_tag="EAE_RS00775"
                     /old_locus_tag="EAE_00755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004104502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly protein IscX"
                     /protein_id="WP_002913954.1"
                     /db_xref="GeneID:45318540"
                     /translation="MALKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEEFDD
                     DPNASNEKILEAILLVWLDEAE"
     gene            complement(163966..164301)
                     /gene="fdx"
                     /locus_tag="EAE_RS00780"
                     /old_locus_tag="EAE_00760"
                     /db_xref="GeneID:45318541"
     CDS             complement(163966..164301)
                     /gene="fdx"
                     /locus_tag="EAE_RS00780"
                     /old_locus_tag="EAE_00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015683702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISC system 2Fe-2S type ferredoxin"
                     /protein_id="WP_015703170.1"
                     /db_xref="GeneID:45318541"
                     /translation="MPKIVFLPHQDLCPDGVVVEAESGETILDAALRSGIEIEHACEK
                     SCACTTCHCIVREGFDSLAESSEDEDDMLDKAWGLEPDSRLSCQARVTNEDLVVEIPR
                     YTINHAREH"
     gene            complement(164303..166153)
                     /gene="hscA"
                     /locus_tag="EAE_RS00785"
                     /old_locus_tag="EAE_00765"
                     /db_xref="GeneID:45318542"
     CDS             complement(164303..166153)
                     /gene="hscA"
                     /locus_tag="EAE_RS00785"
                     /old_locus_tag="EAE_00765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001559634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S protein assembly chaperone HscA"
                     /protein_id="WP_015703171.1"
                     /db_xref="GeneID:45318542"
                     /translation="MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETL
                     PDHQGRYLLPSVVNYHASGLTVGYEARLNAAQDPVNTISSVKRMMGRSLADIQTRYPH
                     LPYQLQASENGLPMLQTAGGLLNPVRVSADILKALAARATEALAGDLDGVVITVPAYF
                     DDAQRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGQEGVIAVYDLGGGTFDISIL
                     RLSRGVFEVLATGGDSALGGDDFDHLLADYLREQAGLSDRSDNRLQRELLDAAIAAKI
                     ALSDADVAHVEVGGWQGDISRSQFNDLIAPLVKRTLMACRRALKDAGVEAQEVLEVVM
                     VGGSTRVPLVRERVGEFFGRTPLTSIDPDKVVAIGAAIQADILVGNKPDSELLLLDVI
                     PLSLGLETMGGLVEKVIPRNTTIPVARAQEFTTFKDGQTAMSIHVMQGERELVQDCRS
                     LARFALRGIPALPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDGE
                     IANMIKDSMSYAEQDIQARMLAEQKVEAARVLESLESALAADAALLSAAERQVIDAAA
                     EQVRTAAAGEDADAIKEAIKNIDTQTQEFAARRMDQSVRAALKGQSVDEV"
     gene            complement(166169..166684)
                     /gene="hscB"
                     /locus_tag="EAE_RS00790"
                     /old_locus_tag="EAE_00770"
                     /db_xref="GeneID:45318543"
     CDS             complement(166169..166684)
                     /gene="hscB"
                     /locus_tag="EAE_RS00790"
                     /old_locus_tag="EAE_00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012131249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone HscB"
                     /protein_id="WP_012540869.1"
                     /db_xref="GeneID:45318543"
                     /translation="MDYFTLFGLPASYTLSLEQLAVRYQDLQRQYHPDKFASAPAAEQ
                     LAAVQHSATINQAWQTLRHPLTRAEYLLSLHGFDLASEQHTVRDTAFLMEQLELREEL
                     DEIGQAKDEARLEAFIKRVKALFDTRHQLMVEQLQNETWDAAADTVRKLRFLDKLRSS
                     AEELEEKLLDF"
     gene            complement(166759..167082)
                     /gene="iscA"
                     /locus_tag="EAE_RS00795"
                     /old_locus_tag="EAE_00775"
                     /db_xref="GeneID:45318544"
     CDS             complement(166759..167082)
                     /gene="iscA"
                     /locus_tag="EAE_RS00795"
                     /old_locus_tag="EAE_00775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017373466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly protein IscA"
                     /protein_id="WP_012540868.1"
                     /db_xref="GeneID:45318544"
                     /translation="MSITLSDSAAARVNSFLANRGKGFGLRLGVRTSGCSGMAYVLEF
                     VDEPAAEDTVFEDKGVKVVIDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCG
                     ESFNV"
     gene            complement(167102..167488)
                     /gene="iscU"
                     /locus_tag="EAE_RS00800"
                     /old_locus_tag="EAE_00780"
                     /db_xref="GeneID:45318545"
     CDS             complement(167102..167488)
                     /gene="iscU"
                     /locus_tag="EAE_RS00800"
                     /old_locus_tag="EAE_00780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000331707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly scaffold IscU"
                     /protein_id="WP_015703172.1"
                     /db_xref="GeneID:45318545"
                     /translation="MAYSEKVIDHYENPRNVGSFDNSDDSVGSGMVGAPACGDVMKLQ
                     IKVNNEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPV
                     KIHCSILAEDAIKAAIADYKSKREAK"
     gene            complement(167515..168729)
                     /gene="iscS"
                     /locus_tag="EAE_RS00805"
                     /old_locus_tag="EAE_00785"
                     /db_xref="GeneID:45318546"
     CDS             complement(167515..168729)
                     /gene="iscS"
                     /locus_tag="EAE_RS00805"
                     /old_locus_tag="EAE_00785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017900428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_015703173.1"
                     /db_xref="GeneID:45318546"
                     /translation="MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFG
                     WQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKT
                     EHKAVLDTCRQLEREGFEVTYLAPQSNGIIDLKELEAAMRDDTILVSIMHVNNEIGVV
                     QDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYV
                     RRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMESEMARLRGLRDR
                     LWNGVKDMEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLE
                     PSYVLRALGMTDELAHSSIRFSLGRFTTEEEIDYTIKLVRNSIGRLRDLSPLWEMFKQ
                     GVDLNSIEWSHH"
     gene            complement(168907..169398)
                     /gene="iscR"
                     /locus_tag="EAE_RS00810"
                     /old_locus_tag="EAE_00790"
                     /db_xref="GeneID:45318547"
     CDS             complement(168907..169398)
                     /gene="iscR"
                     /locus_tag="EAE_RS00810"
                     /old_locus_tag="EAE_00790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002913993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S cluster assembly transcriptional regulator
                     IscR"
                     /protein_id="WP_015370314.1"
                     /db_xref="GeneID:45318547"
                     /translation="MRLTSKGRYAVTAMLDVALNSETGPVPLADISERQGISLSYLEQ
                     LFSRLRKNGLVSSVRGPGGGYLLGKEAGSIAVGEVISAVDESVDATRCQGKGGCQGGD
                     KCLTHALWRDLSERLTGFLNNITLGELVNNQEILDVSGRQHNHESQRTTRSQDAIDVK
                     LRA"
     gene            complement(169643..170377)
                     /gene="trmJ"
                     /locus_tag="EAE_RS00815"
                     /old_locus_tag="EAE_00795"
                     /db_xref="GeneID:45318548"
     CDS             complement(169643..170377)
                     /gene="trmJ"
                     /locus_tag="EAE_RS00815"
                     /old_locus_tag="EAE_00795"
                     /EC_number="2.1.1.200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ"
                     /protein_id="WP_015370313.1"
                     /db_xref="GeneID:45318548"
                     /translation="MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDS
                     QAIALAAGASDVIGNAQIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVA
                     EGQHAPVALVFGRERVGLTNDELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAW
                     LATQEQAQPAVEHEETPYPLVDDLERFYGHLEQTLLATGFIRPNHPGQVMNKLRRLFT
                     RARPESQELNILRGMLASIEQQNKGK"
     gene            170498..171301
                     /gene="suhB"
                     /locus_tag="EAE_RS00820"
                     /old_locus_tag="EAE_00800"
                     /db_xref="GeneID:45318549"
     CDS             170498..171301
                     /gene="suhB"
                     /locus_tag="EAE_RS00820"
                     /old_locus_tag="EAE_00800"
                     /EC_number="3.1.3.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000553460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol-1-monophosphatase"
                     /protein_id="WP_015370312.1"
                     /db_xref="GeneID:45318549"
                     /translation="MHPMLNIAVRAARKAGNLIAKHYETPDSVETSQKGSNDFVTNVD
                     KAAEAIIIETIRKSYPQHTIITEESGEHAGEDQDIQWVIDPLDGTTNFVKRLPHFSVS
                     IAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSNARDLDGTIIATGFPFK
                     AKQHATAYMNILGNMFTECADFRRTGSAALDLAYVAAGRVDGYFEIALKPWDFAAGEL
                     IAREAGAIVCDFTGGHNYMLTGNIVAGNPRVVKAMLANMREQLSEALKR"
     gene            complement(171349..172329)
                     /locus_tag="EAE_RS00825"
                     /old_locus_tag="EAE_00805"
                     /db_xref="GeneID:45318550"
     CDS             complement(171349..172329)
                     /locus_tag="EAE_RS00825"
                     /old_locus_tag="EAE_00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel/cobalt transporter"
                     /protein_id="WP_015703174.1"
                     /db_xref="GeneID:45318550"
                     /translation="MSVVFTPRARAPRWKSFWPLALFLTLTVVGGIWLWLAWPQVLLQ
                     SAVWQRSLNLELSQLLQAVADNPSAAGLSLLGFSFVYGVLHALGPGHGKIVITTWLAT
                     HPSKLKSSIVLTLAASLLQGMVAIVLVVVVLTLLQLPARQLHLSSFWLEKGSYLLVGA
                     LGLLLCWRALKKLRVLLRRPTFTAFTPHHVHDEHCGCGHQHLPAPDQLQSGDDWRARL
                     AIVLSMGMRPCSGAIMVLLFSKVIGVFGWGMAAALVMAAGTSLTISGLALLVHGFRQL
                     AIRLSRHQAPAMWKQVGWATLALAGGVALLTAAVVMWSSAIPPGGGLRPF"
     gene            complement(172320..172958)
                     /locus_tag="EAE_RS00830"
                     /old_locus_tag="EAE_00810"
                     /db_xref="GeneID:45318551"
     CDS             complement(172320..172958)
                     /locus_tag="EAE_RS00830"
                     /old_locus_tag="EAE_00810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019725302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1007 family protein"
                     /protein_id="WP_015703175.1"
                     /db_xref="GeneID:45318551"
                     /translation="MKKVKHCVGAAFFMVLSLSAVAHPHSFINLQSEAVVNDGLLTGF
                     KMRWTMDEITSADLLYDAGNAKAGSEVWKKLAAEVMANVLGQHYFSELWHNGQRVKFA
                     NRPDGYGLARSGLQAVLTFTLPLATPQPVAGQTFTLSTFDPTYYVDMFYEQDSDFSLP
                     AALRASCKATVMTPKPNDKMLSYAQSLDKEDAPPEDMELGNYFAQKVTLTCQ"
     gene            173083..174360
                     /gene="csiE"
                     /locus_tag="EAE_RS00835"
                     /old_locus_tag="EAE_00815"
                     /db_xref="GeneID:45318552"
     CDS             173083..174360
                     /gene="csiE"
                     /locus_tag="EAE_RS00835"
                     /old_locus_tag="EAE_00815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stationary phase inducible protein CsiE"
                     /protein_id="WP_015703176.1"
                     /db_xref="GeneID:45318552"
                     /translation="MMTVIEPPSALSSPQRRSQVLLMFYLPGQSVTPQQLVRLNQVDE
                     ATAQQDIAETGREIQRYHRLTLASQMDGSYRIEGAALDQRLCLLHALRRGLRLCPHFV
                     HHHFTPALKTQLKQQGIARTLYDDTNLQALVNRCARALNRQFDCRDGQFLRLYLQYCL
                     LQHHLGQSPDFTREQRNWAQAAAEFNLAAEIVRHWQRRVSATPHAGEQLFLTLLFMLL
                     KTPDPIHDGHQQDRRLHLAISRLIHRFQDLAGRPFSDEQGLSDQLYIHLSQALNRSVF
                     AIGIDNALPEEIGRLYPRLMRTTQEALRDFETAYHIQFNQEEVSLIAVIFGAWLMQKA
                     DLHEKQVVLLTRENSELEQALEMQLRELTLLPLNIKYLSVTQFQQQGAPKDVTLVVTP
                     YTTALPLFSPPLFHAEENFSDHQRQQICKMLED"
     gene            complement(174357..175493)
                     /locus_tag="EAE_RS00840"
                     /old_locus_tag="EAE_00820"
                     /db_xref="GeneID:45318553"
     CDS             complement(174357..175493)
                     /locus_tag="EAE_RS00840"
                     /old_locus_tag="EAE_00820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004149349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-phenylpropionate MFS transporter"
                     /protein_id="WP_015370308.1"
                     /db_xref="GeneID:45318553"
                     /translation="MVLHSTRWLALSYFTYFFSYGIFLPFWSVWLAGVGLTPETIGVL
                     LGAGLVARFLGSLLIAPRVSDPSRLISALRILALLTLLFALAFWVGGQVAWLMVVIVG
                     FNLFFSPLVPLTDALANTWQKQITMDYGRVRLWGSIAFVIGSALTGKLVSLFDYRAIL
                     LLLSLGTASMLLGMLLKPSVMPQGESRHQEAAGLPAWLSLVRQSWRFLACVCLLQGAH
                     AAYYGFSALYWQQAGYSASAVGYLWSLGVVAEVVIFALSKKVFRRFSARDLLLLSAVC
                     GVARWTIMGWTTALPWLLVAQILHCGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVA
                     MGGSIAVMTVFAGFLYQHLHQGVFWVMALVALPALIVRPKAVSA"
     gene            175793..176215
                     /locus_tag="EAE_RS00845"
                     /old_locus_tag="EAE_00825"
                     /db_xref="GeneID:45318554"
     CDS             175793..176215
                     /locus_tag="EAE_RS00845"
                     /old_locus_tag="EAE_00825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="WP_015370306.1"
                     /db_xref="GeneID:45318554"
                     /translation="MNTLRYFDFGSSRPVLLLIARIAIVLLFIIFGYPKLMGFSGTVQ
                     YMASSGAPMPTLAAIIAVIMEVPAAILIILGFFTRPLAVIFIFYTLGTAVIGHHYWDM
                     TGDAVLPNMINFYKNVSIAGAFLLLAITGPGSISLDRR"
     gene            complement(176272..177525)
                     /locus_tag="EAE_RS00850"
                     /old_locus_tag="EAE_00830"
                     /db_xref="GeneID:45318555"
     CDS             complement(176272..177525)
                     /locus_tag="EAE_RS00850"
                     /old_locus_tag="EAE_00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019077397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_015370305.1"
                     /db_xref="GeneID:45318555"
                     /translation="MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVM
                     QAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQAN
                     FAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIIPYGIDESGKIDYEDMAK
                     QAQEHKPKMIIGGFSAYSGIVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVP
                     HAHVVTTTTHKTLAGPRGGLILAKGGSEELYKKLNSAVFPSAQGGPLMHVIAAKAVAL
                     KEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEAD
                     AALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDN
                     INDEAVIERVKGKVLDICARFPVYA"
     gene            177850..179040
                     /gene="hmpA"
                     /locus_tag="EAE_RS00855"
                     /old_locus_tag="EAE_00835"
                     /db_xref="GeneID:45318556"
     CDS             177850..179040
                     /gene="hmpA"
                     /locus_tag="EAE_RS00855"
                     /old_locus_tag="EAE_00835"
                     /EC_number="1.14.12.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NO-inducible flavohemoprotein"
                     /protein_id="WP_015370304.1"
                     /db_xref="GeneID:45318556"
                     /translation="MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFN
                     MSNQRNGDQREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSFQIKPEQYNIVGSHL
                     LATLDEMFSPGQEVLDAWGKAYGVLANVFINREAEIYQDNASKNGGWEGTRAFRIVKK
                     TPRSQLITSFELEPVDGQPVADYQPGQYLAIWLKPEAFEYQEIRQYSLTRRADGKGYR
                     IAVKRENGGQVSNWLHNHASEGDVVYLAAPAGDFFLNVEAQTPVTLLSGGVGQTPMLA
                     MLDTLAKSHHQGQVNWFHAAENGDVHAFADEVKALGAALPKFTSHVWYRSPSEADRQA
                     GRFDSEGLMDLAPLAENIRDPQMQFYLCGPVAFMQFAAKQLVELGVNKDNIHYECFGP
                     HKVL"
     gene            complement(179114..179452)
                     /gene="glnB"
                     /locus_tag="EAE_RS00860"
                     /old_locus_tag="EAE_00840"
                     /db_xref="GeneID:45318557"
     CDS             complement(179114..179452)
                     /gene="glnB"
                     /locus_tag="EAE_RS00860"
                     /old_locus_tag="EAE_00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013574351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen regulatory protein P-II"
                     /protein_id="WP_002914032.1"
                     /db_xref="GeneID:45318557"
                     /translation="MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTE
                     LYRGAEYMVDFLPKVKIEIVVTDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRI
                     RTGEEDDAAI"
     gene            complement(179518..180855)
                     /gene="glrR"
                     /locus_tag="EAE_RS00865"
                     /old_locus_tag="EAE_00845"
                     /db_xref="GeneID:45318558"
     CDS             complement(179518..180855)
                     /gene="glrR"
                     /locus_tag="EAE_RS00865"
                     /old_locus_tag="EAE_00845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system response regulator GlrR"
                     /protein_id="WP_015703177.1"
                     /db_xref="GeneID:45318558"
                     /translation="MTIRKPAHLLLVDDDPGLLKLLGMRLVSEGYSVVTAESGPEALR
                     VLTRERVDLVVSDLRMDEMDGLQLFAEIQKAQPGMPVIILTAHGSIPDAVAATQKGVF
                     SFLTKPVDKDALYKAIDDALEQSSPATDERWRQAIVTRSPQMLRLLEQAGMVAQSDVS
                     VLIIGQSGTGKEIVAQAIHNASPRHEKPFIAINCGALPEQLLESELFGHARGAFTGAV
                     SNREGLFQAAEGGTLFLDEIGDMPVALQVKLLRVLQERKVRPLGSNRDIDIDVRIVSA
                     THRDLPKAMARGEFREDLFYRLNVVNLKIPPLSERAEDIPLLANHLLRQSADRHKPFV
                     RAFSTDAMKRLMAAKWPGNVRQLVNVIEQCVALTSSPVISDALVEQALEGENTALPTF
                     VEARNQFELNYLRKLLQITKGNVTHAARMAGRNRTEFYKLLSRHELDANDFKE"
     gene            complement(180842..181534)
                     /gene="qseG"
                     /locus_tag="EAE_RS00870"
                     /old_locus_tag="EAE_00850"
                     /db_xref="GeneID:45318559"
     CDS             complement(180842..181534)
                     /gene="qseG"
                     /locus_tag="EAE_RS00870"
                     /old_locus_tag="EAE_00850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system QseEF-associated
                     lipoprotein QseG"
                     /protein_id="WP_026612244.1"
                     /db_xref="GeneID:45318559"
                     /translation="MSLFFALRRPLRGWLLSGLCCLTLAGCSAAMSPRAADGNAPPEL
                     PEHQVADFLSVDCANIWSLENDASDKNPLYWLRGIDCADRLAPVQARAEAKLHNDDNW
                     QDALKRGILLADAKITPDERREMVARIDSFSPQIAAQVRPLYRLWRDGQARQLQLFEE
                     RSRYGKLQQSSDAELETLRQQEQQLRSQLELTTRKLENLTDIERQLSSRKPGGNFNSG
                     SDKVPEVIHDDP"
     gene            complement(181552..182988)
                     /locus_tag="EAE_RS00875"
                     /old_locus_tag="EAE_00855"
                     /db_xref="GeneID:45318560"
     CDS             complement(181552..182988)
                     /locus_tag="EAE_RS00875"
                     /old_locus_tag="EAE_00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAMP domain-containing histidine kinase"
                     /protein_id="WP_015703178.1"
                     /db_xref="GeneID:45318560"
                     /translation="MKRFSLFPRSLRQLVTLSFVLIMLPLLVLAWQAWQSLNALSAQA
                     AHINRTTLTDARRSEAMVNASLEMERSYLQYCVLDDPTLERVYQNQRKRYSEMLEALS
                     GVLPDAHIWQTLRQNLADLAQLRCHNSAPDVKAAASLEAFADANSEMVQATRTVIFSR
                     GQQLQQEIAERGQFFGWQALVLFLLSLTLVLLFTRMIIGPVKGIEKMINRLGEGKSLD
                     DAALFTGPRELRSVGKRIIWLSERLAWLESQRHQFLRHLSHELKTPLASMREGTELLA
                     DRVAGPLTTEQQEIVEILDNSSRNLQKLIEQLLDYNRKLADGPVERQKVDIAELAQTV
                     VSAHSLPARAKMMSTELALGERFCLAEPTLLTSVLDNLYSNAVHYGAESGNIRIHSYR
                     HGEQVRIDVANSGEPIPVAERNMIFEPFYQGSHLRKGAVKGSGLGLSIARDCVRQMQG
                     ELSLVDDNPGFICFRISLPAAEPGKTNT"
     gene            complement(183551..187438)
                     /gene="purL"
                     /locus_tag="EAE_RS00880"
                     /old_locus_tag="EAE_00860"
                     /gene_synonym="purI"
                     /db_xref="GeneID:45318561"
     CDS             complement(183551..187438)
                     /gene="purL"
                     /locus_tag="EAE_RS00880"
                     /old_locus_tag="EAE_00860"
                     /gene_synonym="purI"
                     /EC_number="6.3.5.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_047079282.1"
                     /db_xref="GeneID:45318561"
                     /translation="MMDILRGSPALSAFRINKLLARFQAANLPVSTLYAEYVHFADLS
                     APLSDEERERLVRLLKYGPSLSSHTPTGKLLLVTPRPGTISPWSSKATDIAHNCGLSQ
                     VVRLERGVAYYVEAQGLSDAQWDAVAAELHDRMMESVFTELEEGEKLFAHHQPTPVAS
                     VDLLGQGRQALIDANLRLGLALADDEIDYLQDAFVKLGRNPNDIELYMFAQANSEHCR
                     HKIFNADWIIDGQQQPKSLFKMIKNTFEKNPEYVLSAYKDNAAVMEGSEVGRYFADYQ
                     TGRYDFHQEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVG
                     FSVSNLRIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALNGYFRTY
                     EEKVTSHNGEELRGYHKPIMLAGGIGNIRGEHVQKGEITVGAKLIVLGGPAMNIGLGG
                     GAASSMASGQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGL
                     SNAMPELVSDGGRGGKFQLRDILSDEPGMSPLEIWCNESQERYVLAVAPEQLPLFEEL
                     CRRERAPYAVIGEATAEQHLSLSDSHFNDRPIDLPLDVLLGKTPKMTRDVQTLKAQGS
                     ELDRQPMTIADAVNRVLHLPTVAEKTFLVTIGDRTVTGMVARDQMVGPWQIPVANCAV
                     TTASLDSYYGEAMAMGERAPVALLDFAASARLAVGEALTNIAATQIGELNRVKLSANW
                     MAAAGHPGEDAGLYEAVKAVGEELCPALGLTIPVGKDSMSMKTRWQEGSEQREMTSPL
                     SLVISAFARVEDVRGTVTPQLSTEDNALLLIDLGKGRNALGATALAQVYRQLGDQPAD
                     VRDVAQLKGFWDAMQALVAQRKLLAYHDRSDGGLLVTLAEMAFAGHCGVTADIAALGD
                     DRLAALFNEELGAVIQVRAADREAVEALLAMNGLADCVHYLGQATAGDRFVITADGQP
                     LFSESRTTLRMWWAETTWQMQRLRDNPECADQEHQAKSNDSDPGLNVKLSFDINEDVA
                     APYIATGARPKVAVLREQGVNSHVEMAAAFHRAGFDAIDVHMSDLLAGRTGLGDFHTL
                     VACGGFSYGDVLGAGEGWAKSILFNERVRDEFATFFHRPQTLALGVCNGCQMMSNLRE
                     LIPGSDLWPRFVRNHSDRFEARFSLVEVTQSPSLLLQGMAGSMMPIAVSHGEGQVEVR
                     DSAHLAALESKGLVALRFVDNFGKVTQTYPANPNGSVNGITAVTSESGRATIMMPHPE
                     RVFRTVSNSWHPENWGEDSPWMRIFRNARKQLG"
     gene            187612..189230
                     /gene="mltF"
                     /locus_tag="EAE_RS00885"
                     /pseudo
                     /db_xref="GeneID:45318562"
     CDS             187612..189230
                     /gene="mltF"
                     /locus_tag="EAE_RS00885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004853254.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound lytic murein transglycosylase
                     MltF"
                     /db_xref="GeneID:45318562"
     gene            complement(189227..189730)
                     /gene="tadA"
                     /locus_tag="EAE_RS00890"
                     /old_locus_tag="EAE_00875"
                     /db_xref="GeneID:45318563"
     CDS             complement(189227..189730)
                     /gene="tadA"
                     /locus_tag="EAE_RS00890"
                     /old_locus_tag="EAE_00875"
                     /EC_number="3.5.4.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA adenosine(34) deaminase TadA"
                     /protein_id="WP_015370298.1"
                     /db_xref="GeneID:45318563"
                     /translation="MSDHEFNDEYWMRHALTLAKRAWEEGEVPVGAVLVHNNQVIGEG
                     WNRPIGRHDPTAHAEIMALRQGGLVLQNYRLIDATLYVTLEPCVMCAGAMVHSRISRL
                     VFGARDAKTGAAGSLIDVLHHPGMNHRVEITEGILAESCSAMLSDFFRWRREEKKALK
                     KARQEEG"
     gene            complement(189810..190445)
                     /gene="aphA"
                     /locus_tag="EAE_RS00895"
                     /old_locus_tag="EAE_00880"
                     /db_xref="GeneID:45318564"
     CDS             complement(189810..190445)
                     /gene="aphA"
                     /locus_tag="EAE_RS00895"
                     /old_locus_tag="EAE_00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014728278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase AphA"
                     /protein_id="WP_015370297.1"
                     /db_xref="GeneID:45318564"
                     /translation="MNSNARRVVFFDLDGTLHQQDMFGSFIRYLLRRQPLNILSVAAL
                     SPIVLLGLLVNGRAARWPMSLLLWAATCGRRESHLKRLEAEFVSWFRQHVTAFPVVQG
                     RLNDYLTSTDADVWLITGSPQSLVEQVYADTLWLPRVKLIASRMSRRRGGWVLTLRCL
                     GHEKVAQLEQRIGAPLRLYSGYSDSEQDNPLLCFCQHRWRVTPQGDLQQLE"
     gene            190660..191508
                     /locus_tag="EAE_RS00900"
                     /old_locus_tag="EAE_00890"
                     /db_xref="GeneID:45318565"
     CDS             190660..191508
                     /locus_tag="EAE_RS00900"
                     /old_locus_tag="EAE_00890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="WP_015370295.1"
                     /db_xref="GeneID:45318565"
                     /translation="MNCLIRIRQRYPSLAASDKKLADFILAQPDQTRHLSSQQLAGEA
                     GVSQSSVVKFAQKMGFKGFPALKLALSEALASSPDPHSVPVHNQIRGDDPLRLVGEKL
                     IKDNIAAMHASLDVNSEEKLLEAVALLRDARRVIITGIGASGLVARNFSWKLMKIGIN
                     AVAEQDMHALLATVQAMSADDLLLAISYSGERREINMAAAEALRVGSKILAITGFTPN
                     ALQQQASQCLYTIAEEQATRSAAISSTSAQMMLTDLLFMALVQQDLEHAPERIRHSEA
                     LVKKLV"
     gene            complement(191543..191839)
                     /locus_tag="EAE_RS00905"
                     /old_locus_tag="EAE_00895"
                     /db_xref="GeneID:45318566"
     CDS             complement(191543..191839)
                     /locus_tag="EAE_RS00905"
                     /old_locus_tag="EAE_00895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005227164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_015703180.1"
                     /db_xref="GeneID:45318566"
                     /translation="MKDELFADLLASAEEMVRIEKGEQTPEPQHVHTFSPIDVKAIRE
                     ATGLKQQDFALAVGVSYDLVKSWETKRRQPTGAPRKLLLLLQINPFIINQLKTI"
     gene            complement(191906..192223)
                     /locus_tag="EAE_RS00910"
                     /old_locus_tag="EAE_00900"
                     /db_xref="GeneID:45318567"
     CDS             complement(191906..192223)
                     /locus_tag="EAE_RS00910"
                     /old_locus_tag="EAE_00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015486449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin RelE"
                     /protein_id="WP_015703181.1"
                     /db_xref="GeneID:45318567"
                     /translation="MYTFIELQGFSKRRQALLPDDEFRFFQEMLIEDPEAGDTIAGTG
                     GFRKIRWSRPGMGKRGGVRIIYYNVTRKGRIYLALVYPKNELDDLTEEQKKMLKQLSD
                     MLE"
     gene            192426..192686
                     /locus_tag="EAE_RS00915"
                     /old_locus_tag="EAE_00905"
                     /db_xref="GeneID:45318568"
     CDS             192426..192686
                     /locus_tag="EAE_RS00915"
                     /old_locus_tag="EAE_00905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017373573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfhL family 4Fe-4S dicluster ferredoxin"
                     /protein_id="WP_015370294.1"
                     /db_xref="GeneID:45318568"
                     /translation="MALLITKKCINCDMCEPECPNEAISMGESIYEINSDRCTECVGH
                     YDTPTCQKVCPIPNTILKDPAHVENEEQLWDKFVLMHHADKL"
     gene            complement(192695..193075)
                     /locus_tag="EAE_RS00920"
                     /old_locus_tag="EAE_00910"
                     /db_xref="GeneID:45318569"
     CDS             complement(192695..193075)
                     /locus_tag="EAE_RS00920"
                     /old_locus_tag="EAE_00910"
                     /EC_number="2.7.8.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holo-ACP synthase"
                     /protein_id="WP_015370293.1"
                     /db_xref="GeneID:45318569"
                     /translation="MAILGLGTDIVEIARIEAVIARSGDRLARRVLSDHEWSIWEQHQ
                     QPVRFLAKRFAVKEAAAKALGTGIRNGLAFNQFEVYNDELGKPKLRLWGEAKLLAERM
                     GVSAIHVTLADERHYACATVIVES"
     gene            complement(193075..193806)
                     /gene="pdxJ"
                     /locus_tag="EAE_RS00925"
                     /old_locus_tag="EAE_00915"
                     /db_xref="GeneID:45318570"
     CDS             complement(193075..193806)
                     /gene="pdxJ"
                     /locus_tag="EAE_RS00925"
                     /old_locus_tag="EAE_00915"
                     /EC_number="2.6.99.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxine 5'-phosphate synthase"
                     /protein_id="WP_015370292.1"
                     /db_xref="GeneID:45318570"
                     /translation="MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITV
                     HLREDRRHITDRDVRILRQTLHTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVT
                     TEGGLDVAGQRDKMRDACQRLADAGILVSLFIDADDEQIKAAAEVGAPYIEIHTGCYA
                     DAKTDAEQAKELERIAKAATYAASLGLKVNAGHGLTYHNVKAIAALPEMHELNIGHAI
                     IGRAVMSGLKEAVAEMKRLMLEARG"
     gene            complement(193818..194555)
                     /gene="recO"
                     /locus_tag="EAE_RS00930"
                     /old_locus_tag="EAE_00920"
                     /db_xref="GeneID:45318571"
     CDS             complement(193818..194555)
                     /gene="recO"
                     /locus_tag="EAE_RS00930"
                     /old_locus_tag="EAE_00920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecO"
                     /protein_id="WP_015370291.1"
                     /db_xref="GeneID:45318571"
                     /translation="MDGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRS
                     NLKGALQPFTPLLVRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYVNELISRVLEH
                     ETRFSELFFDYLHCIQALAGASGSPEPALRRFELALLGHLGYGVDFLHCAGSGDPVDD
                     TMTYRYREEKGFIASLVIDNSTFTGHHLKALASREFPDVDTLRAAKRFTRIALKPYLG
                     GKPLKSRELFRQFMPARKARADNTNND"
     gene            complement(194567..195472)
                     /gene="era"
                     /locus_tag="EAE_RS00935"
                     /old_locus_tag="EAE_00925"
                     /db_xref="GeneID:45318572"
     CDS             complement(194567..195472)
                     /gene="era"
                     /locus_tag="EAE_RS00935"
                     /old_locus_tag="EAE_00925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Era"
                     /protein_id="WP_015370290.1"
                     /db_xref="GeneID:45318572"
                     /translation="MSEEKSYCGFVAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTR
                     HRIVGIHTEGPYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWT
                     QDDEMVLNKLRDARAPVILAVNKVDNVQEKADLLPHLQFLASQMNFLDIVPISAETGT
                     NVDTIASIVRKHLPEAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEI
                     ERFVSNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLE
                     LWVKVKSGWADDERALRSLGYVDDL"
     gene            complement(195469..196149)
                     /gene="rnc"
                     /locus_tag="EAE_RS00940"
                     /old_locus_tag="EAE_00930"
                     /db_xref="GeneID:45318573"
     CDS             complement(195469..196149)
                     /gene="rnc"
                     /locus_tag="EAE_RS00940"
                     /old_locus_tag="EAE_00930"
                     /EC_number="3.1.26.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003848606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="WP_020078171.1"
                     /db_xref="GeneID:45318573"
                     /translation="MNPIVINRLQRKLGYTFVHQELLQQALTHRSASSKHNERLEFLG
                     DSILSFVIANALYHRFPRVDEGDMSRMRATLVRGNTLAEIAREFELGECLRLGPGELK
                     SGGFRRESILADTVEALIGGVFLDSDIQNVERLILSWYQTRLDEISPGDKQKDPKTRL
                     QEYLQGRHLPLPSYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQ
                     ALKKLELE"
     gene            complement(196403..197377)
                     /gene="lepB"
                     /locus_tag="EAE_RS00945"
                     /old_locus_tag="EAE_00935"
                     /db_xref="GeneID:45318574"
     CDS             complement(196403..197377)
                     /gene="lepB"
                     /locus_tag="EAE_RS00945"
                     /old_locus_tag="EAE_00935"
                     /EC_number="3.4.21.89"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="WP_015703182.1"
                     /db_xref="GeneID:45318574"
                     /translation="MANMFALILVIATLVTGLLWCLDKFIFAPKRRERQAAAQAATGE
                     QLDKKTLKKVGPKPGWLETGASVFPVLAIVLVVRSFIYEPFQIPSGSMMPTLLIGDFI
                     LVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPRLDYIKRAVGLPGDKVTYDP
                     VAKQVTIEPGCASGQSCGSALPITYSNVEPSDFVQTFSRRNGGEATSGFWQLPKGETK
                     ADGIRLTERKETLGEVTHRILTVPIAQDQVGMYYRQSGQPLATWVVPPGEYFMMGDNR
                     DNSADSRYWGFVPEANLVGKATAIWMSFEKQEGEWPTGVRLSRIGGIH"
     gene            complement(197392..199191)
                     /gene="lepA"
                     /locus_tag="EAE_RS00950"
                     /old_locus_tag="EAE_00940"
                     /db_xref="GeneID:45318575"
     CDS             complement(197392..199191)
                     /gene="lepA"
                     /locus_tag="EAE_RS00950"
                     /old_locus_tag="EAE_00940"
                     /EC_number="3.6.5.n1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009088658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor 4"
                     /protein_id="WP_015370288.1"
                     /db_xref="GeneID:45318575"
                     /translation="MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMAAQVLDSM
                     DLERERGITIKAQSVTLDYKASDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVV
                     DAGQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVADEIEDIVGIDAHDAVR
                     CSAKTGVGVPDVLERLVRDIPPPEGDPDAPLQALIIDSWFDNYLGVVSLVRIKNGTMR
                     KGDKIKVMSTGQVYNADRLGIFTPKQVDRTELKCGEVGWLVCAIKDILGAPVGDTLTA
                     ARNPADKALPGFKKVKPQVYAGLFPVSSDDYENFRDALGKLSLNDASLFYEPESSTAL
                     GFGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTSKEVIYVDSPSKLPP
                     LNNIQELREPIAECHMLLPQEFLGNVITLCIEKRGVQTNMVYHGKQVALTYEIPMAEV
                     VLDFFDRLKSTSRGYASLDYNFKRFQASNMVRVDVLINGERVDALALITHNDNAPYRG
                     RELVEKMKDLIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQ
                     KQKEGKKRMKQVGNVELPQEAFLAILHVGKDGK"
     gene            complement(199376..199855)
                     /gene="rseC"
                     /locus_tag="EAE_RS00955"
                     /old_locus_tag="EAE_00945"
                     /db_xref="GeneID:45318576"
     CDS             complement(199376..199855)
                     /gene="rseC"
                     /locus_tag="EAE_RS00955"
                     /old_locus_tag="EAE_00945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SoxR-reducing system protein RseC"
                     /protein_id="WP_015703183.1"
                     /db_xref="GeneID:45318576"
                     /translation="MIKEWATVVSWHNGVAQVHCDVKASCSSCASRAGCGSRVLNKLG
                     PQTSHTISVPCEQPLTAGQKVELGIAESSLLGSALLVYMAPLFGLFVMASIFQVLFAS
                     DIASLCGALLGGVGGFLVARGLSPQLAARQSWQPVILSVGLPPDLLRVDTPSSEMGQ"
     gene            complement(199852..200808)
                     /gene="rseB"
                     /locus_tag="EAE_RS00960"
                     /old_locus_tag="EAE_00950"
                     /db_xref="GeneID:45318577"
     CDS             complement(199852..200808)
                     /gene="rseB"
                     /locus_tag="EAE_RS00960"
                     /old_locus_tag="EAE_00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004144355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-E factor regulatory protein RseB"
                     /protein_id="WP_015703184.1"
                     /db_xref="GeneID:45318577"
                     /translation="MKQLWCAMSLMAGSLFFSTNASADTSSGALLQQMNLASQSLNYE
                     LSFVSINKQGVESLRYRHVRLNNQPLAQLLQLDGPRREVVLRGTEISYFEPGLDPFTL
                     NGDYIVDSLPSLVYTDFKKLASYYDFISVGRTRIADRLCDVVRVVARDGTRYSYIAWL
                     DAETKLPLRVDLLDRDGETLEQFRVVSFNIGDNVSSSMEALSKASLPPQLSVPESGNK
                     ANFNWAPTWLPQGVTEVSSSQRRLPTFDAPVESRLYSDGLFSFSVNVNRATVNSSDQL
                     LRTGRRTVSTSVRDNAEISVVGELPPQTAKRISDSIKFRAAQ"
     gene            complement(200808..201458)
                     /gene="rseA"
                     /locus_tag="EAE_RS00965"
                     /old_locus_tag="EAE_00955"
                     /db_xref="GeneID:45318578"
     CDS             complement(200808..201458)
                     /gene="rseA"
                     /locus_tag="EAE_RS00965"
                     /old_locus_tag="EAE_00955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anti-sigma-E factor RseA"
                     /protein_id="WP_015370285.1"
                     /db_xref="GeneID:45318578"
                     /translation="MQKEKLSALMDGETLDNELLNELSRSSEMQKTWESYHLIRDTLR
                     GDTAEMLQFDISARVMAAIENEPARQVAPLIPESQPAPHQWRQMPFWQKVRPWASSLT
                     QMGVAACVSLAVIVGVQQYNGHSDASQQPEAPVFNTMPMMGKASPVSLGVPADASAGS
                     GQQAQVQEQRRRINAMLQDYELQRRLHAEQLQFGQAQTQQAAVQVPGYQTLGTQSQ"
     gene            complement(201491..202066)
                     /gene="rpoE"
                     /locus_tag="EAE_RS00970"
                     /old_locus_tag="EAE_00960"
                     /db_xref="GeneID:45318579"
     CDS             complement(201491..202066)
                     /gene="rpoE"
                     /locus_tag="EAE_RS00970"
                     /old_locus_tag="EAE_00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005070454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoE"
                     /protein_id="WP_002914074.1"
                     /db_xref="GeneID:45318579"
                     /translation="MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPPG
                     DIADVVQESFVKAWRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDANE
                     AENFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIA
                     AIMDCPVGTVRSRIFRAREAIDNKVQPLIRR"
     gene            complement(202063..202164)
                     /gene="rseD"
                     /locus_tag="EAE_RS00975"
                     /db_xref="GeneID:45318580"
     CDS             complement(202063..202164)
                     /gene="rseD"
                     /locus_tag="EAE_RS00975"
                     /inference="COORDINATES: protein motif:HMM:NF033697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rpoE leader peptide RseD"
                     /protein_id="WP_157195214.1"
                     /db_xref="GeneID:45318580"
                     /translation="MFRHSKRLLAHNAVLGWCSEYAWELGLGRHYLG"
     gene            202489..204108
                     /gene="nadB"
                     /locus_tag="EAE_RS00980"
                     /old_locus_tag="EAE_00965"
                     /db_xref="GeneID:45318581"
     CDS             202489..204108
                     /gene="nadB"
                     /locus_tag="EAE_RS00980"
                     /old_locus_tag="EAE_00965"
                     /EC_number="1.4.3.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-aspartate oxidase"
                     /protein_id="WP_015703185.1"
                     /db_xref="GeneID:45318581"
                     /translation="MKTTPDFSCDVLIIGSGAAGLSLALRLAERHSVTVLSKGPVSEG
                     STFYAQGGIAAVFDETDSIESHVEDTLIAGAGLCDRHAVSFVASNAKPCVQWLIDQGV
                     LFDTQVQANGEESYHLTREGGHSHRRILHAADATGKEVETTLVGKALAHPNITILERS
                     NAVDLIISDKIGLPGTRRVVGAWIWNRNKEKVETCSARAVVLATGGAAKVYQYTTNPD
                     VSSGDGIAMAWRAGCRVANLEFNQFHPTALFHPQARNFLLTEALRGEGALLKRPDGSR
                     FMPDFDERGELAPRDIVARAIDHEMKRLGVDCMYLDISHKPEAFIRQHFPMIYEKLLG
                     LGIDLTKEPVPIVPAAHYTCGGVMVDDNGRTDVDGLYAIGEVSYTGLHGANRMASNSL
                     LECLVYGWSAAEDIAKRLPLAQAAEQLPPWDESQVEIPDELVVIQHNWHELRLLMWDY
                     VGIVRTTRRLERALRRITMLQQELDEYYARFRVSNNLLELRNLVQVAELIVRCAMQRK
                     ESRGLHYTLDYPDTLENSGPSVLSPLAHIKR"
     gene            complement(204093..204830)
                     /locus_tag="EAE_RS00985"
                     /old_locus_tag="EAE_00970"
                     /db_xref="GeneID:45318582"
     CDS             complement(204093..204830)
                     /locus_tag="EAE_RS00985"
                     /old_locus_tag="EAE_00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA1(Val) (adenine(37)-N6)-methyltransferase"
                     /protein_id="WP_015703186.1"
                     /db_xref="GeneID:45318582"
                     /translation="MSQSKFALPRNGFTFKQFFVAHDRCAMKVGTDGILLGAWAPIAQ
                     VKHVLDIGTGSGLLALMLAQRTANSVQLDAVELDEEAATQARDNVAASNWPGRITVYQ
                     APIQQWQPQPPRRYELIVSNPPFFAEGVPCATSQREQARYTTSLDHTTLLTCATDLIT
                     EEGFFCVVLPVDIGNAFVERAKAMGWHLRLRTDVAETEMRPPHRVLLAFSPSAGECFS
                     DRLVVRGPEQQYSEGFTALTRDFYLFM"
     gene            204961..206292
                     /gene="srmB"
                     /locus_tag="EAE_RS00990"
                     /old_locus_tag="EAE_00975"
                     /db_xref="GeneID:45318583"
     CDS             204961..206292
                     /gene="srmB"
                     /locus_tag="EAE_RS00990"
                     /old_locus_tag="EAE_00975"
                     /EC_number="3.6.4.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase SrmB"
                     /protein_id="WP_015370281.1"
                     /db_xref="GeneID:45318583"
                     /translation="MTVTTFSELELDENLLEALQDKGFTRPTAIQAAAIPPALDGRDI
                     LGSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAMQVADHARELAKH
                     THLDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEAD
                     RMLDMGFAQDIETIAGETRWRKQTMLFSATLEGDAIKDFAERLLEEPVEVSANPSTRE
                     RKKIHQWYYRADDIDHKTALLVNLLKQPEATRSIVFVRKRERVHELAAKLHEAGITTC
                     WLEGEMVQIKRNEAIKRLTDGRVNVLIATDVAARGIDIPDVSHVFNFDMPRTADIYLH
                     RIGRTGRAGKKGTAISLVEAHDHLLLGKIGRYVEEPLKARVIDELRPKTRAPSEKLTG
                     KPSKKVLAKRAEKKEKEKEKPRVKKRHRDTKNIGKRRKPSSAVTPSTSNEE"
     gene            complement(206338..206721)
                     /gene="grcA"
                     /locus_tag="EAE_RS00995"
                     /old_locus_tag="EAE_00980"
                     /db_xref="GeneID:45318584"
     CDS             complement(206338..206721)
                     /gene="grcA"
                     /locus_tag="EAE_RS00995"
                     /old_locus_tag="EAE_00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007728348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autonomous glycyl radical cofactor GrcA"
                     /protein_id="WP_002914084.1"
                     /db_xref="GeneID:45318584"
                     /translation="MITGIQITKAANDDLLNSFWLLDSEKGEARCLCAKGGFAEDDVV
                     AVSKLGEIEYREIPVDVKPEVRVEGGQHLNVNVLRRETLLDAVEHPEKYPQLTIRVSG
                     YAVRFNSLTPEQQRDVIARTFTESL"
     gene            207034..207723
                     /gene="ung"
                     /locus_tag="EAE_RS01000"
                     /old_locus_tag="EAE_00985"
                     /db_xref="GeneID:45318585"
     CDS             207034..207723
                     /gene="ung"
                     /locus_tag="EAE_RS01000"
                     /old_locus_tag="EAE_00985"
                     /EC_number="3.2.2.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_015703187.1"
                     /db_xref="GeneID:45318585"
                     /translation="MTTPLTWHDVLAEEKQQPYFLNTLKTVAEERQSGMTIYPPQKDV
                     FNAFRYTELGEVKVVILGQDPYHGPGQAHGMAFSVLPGVQIPPSLLNMYKELEGTIPG
                     FQRPAHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVIALINQHCEGVV
                     FLLWGAHAQKKGAIIDRQRHCVLKAPHPSPLSAHRGFFGCNHFVQTNQWLAERGEAPI
                     DWMPVLPAESE"
     gene            complement(207779..208849)
                     /locus_tag="EAE_RS01005"
                     /old_locus_tag="EAE_00990"
                     /db_xref="GeneID:45318586"
     CDS             complement(207779..208849)
                     /locus_tag="EAE_RS01005"
                     /old_locus_tag="EAE_00990"
                     /EC_number="2.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/rRNA methyltransferase"
                     /protein_id="WP_015703188.1"
                     /db_xref="GeneID:45318586"
                     /translation="MSDELKNKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPGKSRV
                     DGRSRPARDERNSRGDDRKRDDRKRNDFNRDDASPWRTVSRAPGDETPVKEDHGGISG
                     KSFIDPEVLRRQRAEETRVYGENACQALFQSRPEAIVRAWFIQSVTPRFKEALRWMAA
                     NRKAYHVVDEAELAKASGTEHHGGVCFLIKKRHGTSVAQWVAKAEAEDCVLALEDVGN
                     PHNLGAIMRSCAHFGVKGVVVQDAGVLESGAAIRTAEGGAEHVEPITGDSFIDTLTQF
                     RQAGYAIVSTSSHNGTPLFKAELPKKMVLVLGQERDGLSDAAISSSDLNVAIDGTGNV
                     ESLNVSVATGVLLAEWWRQNKA"
     gene            209054..209479
                     /gene="trxC"
                     /locus_tag="EAE_RS01010"
                     /old_locus_tag="EAE_00995"
                     /db_xref="GeneID:45318587"
     CDS             209054..209479
                     /gene="trxC"
                     /locus_tag="EAE_RS01010"
                     /old_locus_tag="EAE_00995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin TrxC"
                     /protein_id="WP_015370277.1"
                     /db_xref="GeneID:45318587"
                     /translation="MNTVCASCQALNRIPEDRSADGAKCGRCGHDLFDGDVINATGAT
                     LDKLLKDDLPVVIDFWAPWCGPCRSFAPIFEDVAEERSGEMRFVKVNTEAERELSARF
                     RIRSIPTIMMFKNGEMVDMLNGAVPKAPFDSWLNEANQQ"
     gene            209549..210247
                     /locus_tag="EAE_RS01015"
                     /old_locus_tag="EAE_01000"
                     /db_xref="GeneID:45318588"
     CDS             209549..210247
                     /locus_tag="EAE_RS01015"
                     /old_locus_tag="EAE_01000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DTW domain-containing protein"
                     /protein_id="WP_015703189.1"
                     /db_xref="GeneID:45318588"
                     /translation="MIDNAVLRLRAERLARATRPFLARGNRIRRCQRCLLPLKQCLCA
                     TLAPAQADSRFCLVMFDTEPMKPSNTGRLIADILPNTEAFQWSRTEPPQALLDLVANP
                     DYQPMVVFPASYAGAERQVLSAPPEGKPPLFIMLDGTWTEARKMFRKSPYLDALPVIS
                     VDLSRISAYHLREAHADGQYCTAEVAIALLDLAGDAQAAAALGDHFSLFRSRYLAGKT
                     QHKGSITAQQAESV"
     gene            210283..212958
                     /gene="pat"
                     /locus_tag="EAE_RS01020"
                     /old_locus_tag="EAE_01005"
                     /db_xref="GeneID:45318589"
     CDS             210283..212958
                     /gene="pat"
                     /locus_tag="EAE_RS01020"
                     /old_locus_tag="EAE_01005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein lysine acetyltransferase"
                     /protein_id="WP_015703190.1"
                     /db_xref="GeneID:45318589"
                     /translation="MSQRGLEALLRPKSIAVIGASMKPQRAGYLMMRNLLAGGFNGPV
                     LPVTPAWKAVLGVLAWPTIDSLPFTPDLAVLCTNARRNLELLEALGRKGCKTCIILSS
                     QPDQYPALLECAARYQMRLLGPNSLGLLAPWQGLNASFSPVPIQRGKLAFISQSAAVS
                     NTILDWAQQREMGFSYFIALGDSLDIDVDDLLDFLARDSKTSAILLYLEHLSDARRFV
                     SAARSASRNKPILVIKSGRSPAAQKLLHVNSGMDPAWDAAIQRAGLLRVQDTHELFSA
                     VETLSHMRPLRGEKLMIISNGAAPAALALDELWLRNGKLANLSEATCDQLRQVLPTGV
                     EVANPLDLRDDASSEHYLKALNVLLDSQDYDALLVIHSPSAAAPGTESALALIDALKR
                     HPRGKYVTVLTNWCGEYSSQEARRLFSEAGIPTYRTPEGTITAFMHMVEYRRNQKQLR
                     ETPVLSDTLTANTAEAHTLLQRALSEGATSLDTHEVSPLLRAYGIHTLPTWIAADSAE
                     AVHIAEQIGYPVALKLRSPDIPHKSEVQGVMLYLRTPAEVQQAADAIIDRVKMAWPQA
                     RIHGLLVQSMANRAGAQELRVVVEHDPLFGPLIMLGEGGVEWRAENQAAVALPPLNMN
                     LARYLVIQAIKSKKIRGRSALRPLDIPGLSQLLVQVSNLIVDCPEIQRLDIHPLLASG
                     NEFTALDVTLSLAPFSGDSESRLAVRPYPQQLEEWVEMKNGERCLFRPILPEDEPLLL
                     AFIERVTKEDLYYRYFSEINEFTHDDLANMTQIDYDREMAFVAVRATEQGSEILGVTR
                     AISDPDNIDAEFAVLVRSDLKGLGLGRQLLEKLIAYTQSHGLQRLNGITMPNNRGMIG
                     LARKLGFAVDIQLEDGIVSLSLALNTLHSVTSDSN"
     gene            213055..214410
                     /gene="pssA"
                     /locus_tag="EAE_RS01025"
                     /old_locus_tag="EAE_01010"
                     /db_xref="GeneID:45318590"
     CDS             213055..214410
                     /gene="pssA"
                     /locus_tag="EAE_RS01025"
                     /old_locus_tag="EAE_01010"
                     /EC_number="2.7.8.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005121216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="WP_015370274.1"
                     /db_xref="GeneID:45318590"
                     /translation="MLSKFKRNKHQQHLAQLPKLSQSVDDIEFFYAPADFRQALLAKI
                     AHATQRICIIALYLEQDDGGKGILQALYDAKRQRPELDVRVLVDWHRAQRGRIGAAAS
                     NTNADWYCRMAQENPGIDIPVYGVPVNTREALGVLHFKGFIIDDSVIYSGASLNDVYL
                     HQHDKYRYDRYQCIRNGKMADVMFDWVEQNLVQGRGVNRLDRPDRPKSPEIKNDIRQY
                     RQDLRESGYHFTGNADEDQLSVTPLVGLGKSSLLNKTIFHLMPCAEHKLTICTPYFNL
                     PAVLVRNIISLLRSGKKVEIIVGDKTANDFYIPEDQPFKIIGALPYLYEINLRRFLSR
                     LQYYVNTDQLIVRLWKDDDNSYHLKGMWVDNEWMLLTGNNLNPRAWRLDLENAVLIHD
                     PKHQLREMREKELQLIRTHTTVVKHYRDLQSIADYPVKVKKLIRRLRRIRIDRLISRI
                     L"
     gene            214453..214776
                     /locus_tag="EAE_RS01030"
                     /old_locus_tag="EAE_01015"
                     /db_xref="GeneID:45318591"
     CDS             214453..214776
                     /locus_tag="EAE_RS01030"
                     /old_locus_tag="EAE_01015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfiM family lipoprotein"
                     /protein_id="WP_015370273.1"
                     /db_xref="GeneID:45318591"
                     /translation="MRYFIIIAPLLLSGCSHMANDAWSGQDKAQHFLASAMLSAAGNE
                     YAQHQGYSRDRSAAIGLMFSVSLGASKELWDSRPAGSGWSWKDFAWDVAGATTGYTVW
                     QLAHQ"
     gene            complement(214779..216077)
                     /locus_tag="EAE_RS01035"
                     /old_locus_tag="EAE_01020"
                     /db_xref="GeneID:45318592"
     CDS             complement(214779..216077)
                     /locus_tag="EAE_RS01035"
                     /old_locus_tag="EAE_01020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015370272.1"
                     /db_xref="GeneID:45318592"
                     /translation="MTESSINEQGSLEQGDTRRRVWAIVGASSGNLVEWFDFYVYSFC
                     SLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIADRRGRKASMLISVCM
                     MCFGSLVIACLPGYATIGTWAPALLLLARLFQGLSVGGEYGTSATYMSEVAVEGKKGF
                     YASFQYVTLIGGQLLAVLVVVALQQILSDEDLHAWGWRIPFALGAVLAIVALWLRRQL
                     DETSKQETRALKEAGSFKGLWRNRRAFVMVLGFTAAGSLTFYTFTTYMQKYLVNTAGM
                     TASTASMIMTAALFVYMLVQPLFGAFSDKVGRRTSMLCFGVLATLFTVPILSALQNVS
                     SPYAAFALVICALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANALFGGSAEYV
                     ALSLKSIGMENAFYWYVTVMAAIAFLVSLMLHGKGKGLRL"
     gene            complement(216635..216750)
                     /gene="rrf"
                     /locus_tag="EAE_RS01040"
                     /old_locus_tag="EAE_r24970"
                     /db_xref="GeneID:45318593"
     rRNA            complement(216635..216750)
                     /gene="rrf"
                     /locus_tag="EAE_RS01040"
                     /old_locus_tag="EAE_r24970"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
                     /db_xref="GeneID:45318593"
     gene            complement(216826..219756)
                     /locus_tag="EAE_RS01045"
                     /old_locus_tag="EAE_r25004"
                     /db_xref="GeneID:45318594"
     rRNA            complement(216826..219756)
                     /locus_tag="EAE_RS01045"
                     /old_locus_tag="EAE_r25004"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:45318594"
     gene            complement(219938..220013)
                     /locus_tag="EAE_RS01050"
                     /old_locus_tag="EAE_t24814"
                     /db_xref="GeneID:45318595"
     tRNA            complement(219938..220013)
                     /locus_tag="EAE_RS01050"
                     /old_locus_tag="EAE_t24814"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(219977..219979),aa:Glu,seq:ttc)
                     /db_xref="GeneID:45318595"
     gene            complement(220089..221638)
                     /locus_tag="EAE_RS01055"
                     /old_locus_tag="EAE_r24988"
                     /db_xref="GeneID:45318596"
     rRNA            complement(220089..221638)
                     /locus_tag="EAE_RS01055"
                     /old_locus_tag="EAE_r24988"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:45318596"
     gene            complement(222107..224680)
                     /gene="clpB"
                     /locus_tag="EAE_RS01060"
                     /old_locus_tag="EAE_01025"
                     /db_xref="GeneID:45318597"
     CDS             complement(222107..224680)
                     /gene="clpB"
                     /locus_tag="EAE_RS01060"
                     /old_locus_tag="EAE_01025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002461515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent chaperone ClpB"
                     /protein_id="WP_015703191.1"
                     /db_xref="GeneID:45318597"
                     /translation="MRLDRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGG
                     SVHPLLTSAGVNAVALRSQIEQALSRLPQVEGTGGDVQPSQDLVRILNLCDKLAQKRK
                     DNFISSELFVLAALESRGTLTDLLKSAGATTANVTQAIEQMRGGESVNDQGAEDQRQA
                     LKKFTVDLTERAEQGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEG
                     LAQRIVNGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILF
                     IDELHTMVGAGKADGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQ
                     KVFVAEPTVEDTIAILRGLKERYELHHHVQITDPAIVAAATLSHRYIADRQLPDKAID
                     LIDEAASSIRMQIDSKPEELDRLDRRIIQLKLEQQALKKEADEASLKRLDMLNEELAD
                     KESQYSVLEEEWKAEKASLSGTQTIKAELEQAKIAIEQARRLGDLARMSELQYGKIPE
                     LEKQLAAATQSEGKTMRLLRNKVTDAEIAEVLARWTGIPVARMMESEREKLLRMEQDL
                     HHRVIGQDEAVEAVSNAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFMFD
                     SDDAMVRIDMSEFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKA
                     HPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQERFGELDYGHMKDL
                     VLGVVSQRFRPEFINRIDEVVVFHPLGEKHIASIAQIQLQRLYKRLEERGYEVHMSDE
                     ALKLLSENGYDPVYGARPLKRAIQQQIENPLAQQILSGELVPGKTVELVVKDDRIVAV
                     Q"
     gene            complement(224810..225541)
                     /gene="pgeF"
                     /locus_tag="EAE_RS01065"
                     /old_locus_tag="EAE_01030"
                     /db_xref="GeneID:45318598"
     CDS             complement(224810..225541)
                     /gene="pgeF"
                     /locus_tag="EAE_RS01065"
                     /old_locus_tag="EAE_01030"
                     /EC_number="1.10.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphenol oxidase"
                     /protein_id="WP_015703192.1"
                     /db_xref="GeneID:45318598"
                     /translation="MTKLIVPQWPMPKGVAACSSTRVGGVSLPPYDSLNLGAHCGDDL
                     LHVEENRRRMFAAGGLPSYPVWLEQVHGTTVLKLDGGPYVSKRADASYCNTPGTVCAV
                     MTADCLPVLFCNRAGTEVAAAHAGWRGLCEGVLEETVACFNDKPENILAWLGPAIGPE
                     AFEVGAEVREAFIAKDAQAESAFRPAGEKYFANIYQLARQRLANVGVEQIFGGDRCTL
                     SEKDDFFSYRRDKTTGRMASFIWLI"
     gene            complement(225538..226518)
                     /gene="rluD"
                     /locus_tag="EAE_RS01070"
                     /old_locus_tag="EAE_01035"
                     /db_xref="GeneID:45318599"
     CDS             complement(225538..226518)
                     /gene="rluD"
                     /locus_tag="EAE_RS01070"
                     /old_locus_tag="EAE_01035"
                     /EC_number="5.4.99.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017383977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine(1911/1915/1917) synthase
                     RluD"
                     /protein_id="WP_015370269.1"
                     /db_xref="GeneID:45318599"
                     /translation="MAQRVQLTATVSENQLGQRLDQALAELFPDYSRSRIKEWILDQR
                     VLVNGNVIDKPKEKVFGGEAVSIDVEIEEDVRFEPQDIPLNIVYEDDDILVINKPRDL
                     VVHPGAGNPDGTVLNALLHYYPPIADVPRAGIVHRLDKDTTGLMVVAKTIPAQTRLVE
                     SLQLREITREYEAVAIGHMTAGGTVEEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF
                     RIHTRLRLRLETGRTHQIRVHMAHITHPLVGDQVYGGRPRPPKGASDEFISALRKFDR
                     QALHATMLRLYHPITGIEMEWHAPIPQDMVELIDAMRADFEAHKDDIDWL"
     gene            226650..227387
                     /gene="bamD"
                     /locus_tag="EAE_RS01075"
                     /old_locus_tag="EAE_01040"
                     /db_xref="GeneID:45318600"
     CDS             226650..227387
                     /gene="bamD"
                     /locus_tag="EAE_RS01075"
                     /old_locus_tag="EAE_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="WP_015370268.1"
                     /db_xref="GeneID:45318600"
                     /translation="MTRMKYLVAAATLSLALVGCSGSKEEVPDNPPNEIYATAQQKLQ
                     DGNWKQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFARLNPTH
                     PNIDYVIYMRGLTNMALDDSALQGFFGVDRSDRDPQHARDAFNDFSKLVRGYPNSQYA
                     TDAYKRLVFLKDRLAKYELSVVDYYTDRGAWVAVVNRVDGMLRNYPDTQATRDALPKM
                     ENAYRQMQMNAQADKVAKIIAANGKNT"
     gene            227660..227995
                     /gene="raiA"
                     /locus_tag="EAE_RS01080"
                     /old_locus_tag="EAE_01045"
                     /db_xref="GeneID:45318601"
     CDS             227660..227995
                     /gene="raiA"
                     /locus_tag="EAE_RS01080"
                     /old_locus_tag="EAE_01045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated translation inhibitor RaiA"
                     /protein_id="WP_002914111.1"
                     /db_xref="GeneID:45318601"
                     /translation="MTMNITSKQMEITPAIRQHVADRLAKLDKWQTHLINPHIILSKE
                     PQGFIADATINTPNGHLVASARHEDMYAAINELINKLERQLNKVQHKGEARRAATSVK
                     EAGFVEEEE"
     misc_feature    228109..228233
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF01859"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Phe leader region; Derived by automated
                     computational analysis using gene prediction method:
                     cmsearch."
                     /db_xref="RFAM:RF01859"
     gene            228110..228157
                     /locus_tag="EAE_RS01085"
                     /db_xref="GeneID:45318602"
     CDS             228110..228157
                     /locus_tag="EAE_RS01085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_417089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_100279143.1"
                     /db_xref="GeneID:45318602"
                     /translation="MKRLPFFFAFFFTFP"
     gene            228259..229419
                     /gene="pheA"
                     /locus_tag="EAE_RS01090"
                     /old_locus_tag="EAE_01050"
                     /db_xref="GeneID:45318603"
     CDS             228259..229419
                     /gene="pheA"
                     /locus_tag="EAE_RS01090"
                     /old_locus_tag="EAE_01050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional chorismate mutase/prephenate
                     dehydratase"
                     /protein_id="WP_015370267.1"
                     /db_xref="GeneID:45318603"
                     /translation="MTEENPLLALRDKISALDEKLLALLAERRGLAVEVGKAKLESHR
                     PVRDIDRERDLLERLMTLGKKHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNKINPR
                     SARIAFLGPKGSYSHLAARQYAARHFEQFIESGCAKFADIFEQVETGQADYAVVPIEN
                     TSSGGINDVYDLLQHTSLSIVGELTLPIDHCVLVSSSTDADKIETVYSHPQPFQQCSQ
                     YLSRYPHWKIEYTESTSAAMEKVAQAKSPTVAALGSEAGGALYGLQVLEHCQANQTQN
                     ITRFLVLARKAVNVSDQVPAKTTLLIATGQQAGALVEALLVLRNHNLIMSKLESRPIH
                     GNPWEEMFYLDIQANLESLPLRKALKELAEITRSMKVLGCYPSENVVPVDPA"
     gene            complement(229416..230288)
                     /locus_tag="EAE_RS01095"
                     /old_locus_tag="EAE_01055"
                     /db_xref="GeneID:45318604"
     CDS             complement(229416..230288)
                     /locus_tag="EAE_RS01095"
                     /old_locus_tag="EAE_01055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014839236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMP-30/gluconolactonase/LRE family protein"
                     /protein_id="WP_015703193.1"
                     /db_xref="GeneID:45318604"
                     /translation="MAQPQPLFDYVGHLPECPTWSDAEQALYWADILECEIHRYDTRN
                     KEHQVLQFPEEVGCFALREKGGFIVALRSGIWLCDARGLLQRKICDNPSNPDLARFND
                     GGTDRDGRFYAGTFWGPGDYNGALLVRIDNDLTPKVVQCDIHGANGLAFSDDKRWMYT
                     SDTPNAVIYRTPLDEQGEPGIREVFRRFHPGEGIPDGAAVDEEGCYWSAMFDGWRIAR
                     FSPNGEQLEEYRVPVRCPTMVCFGGADMKTLYITTTRENMDADEVAQYPLSGAIFTLP
                     VAVAGMKKRQFIER"
     gene            complement(230357..231478)
                     /gene="tyrA"
                     /locus_tag="EAE_RS01100"
                     /old_locus_tag="EAE_01060"
                     /db_xref="GeneID:45318605"
     CDS             complement(230357..231478)
                     /gene="tyrA"
                     /locus_tag="EAE_RS01100"
                     /old_locus_tag="EAE_01060"
                     /EC_number="1.3.1.12"
                     /EC_number="5.4.99.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional chorismate mutase/prephenate
                     dehydrogenase"
                     /protein_id="WP_015703194.1"
                     /db_xref="GeneID:45318605"
                     /translation="MVAELTALRDQIDEVDKALLDLLAKRLELVAEVGEVKSKYGLPI
                     YVPEREAAMLASRREEAAALGVPPDLIEDVLRRVMRESYSSENDKGFKTLHPNLRPVV
                     IVGGGGQMGRLFEKMLTLSGYQVRVLEKEDWPRATEIVADAGMVIVSVPIHTTAETIS
                     RLPPLPADCILVDLASIKAEPLQAMLAAHNGPVLGLHPMFGPDSGSLAKQVVVYCDGR
                     QPEAYQWFLEQIQVWGARLHRISAVEHDQNMAFIQALRHFATFAYGLHLAEENVRLEQ
                     LLALSSPIYRLELAMVGRLFAQDPQLYADIIMSSENNLALIKRYYQRFGEAIGLLEQG
                     DKQAFIDSFRKVEHWFGDYAQRFQSESRTLLRQANDNRQ"
     gene            complement(231488..232558)
                     /gene="aroF"
                     /locus_tag="EAE_RS01105"
                     /old_locus_tag="EAE_01065"
                     /db_xref="GeneID:45318606"
     CDS             complement(231488..232558)
                     /gene="aroF"
                     /locus_tag="EAE_RS01105"
                     /old_locus_tag="EAE_01065"
                     /EC_number="2.5.1.54"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004866527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase AroF"
                     /protein_id="WP_015370264.1"
                     /db_xref="GeneID:45318606"
                     /translation="MQKDALNNVHITDEQVLITPDQLKAEFPLTVEQEAQIAHSRQTI
                     SNIIAGRDPRLLVVCGPCSIHDPEAAIEYARRFKALAAEVSDSLYLVMRVYFEKPRTT
                     VGWKGLINDPHMDGSFDVEGGLKIARRLLVDLVNMGLPLATEALDPNSPQYLGDLFSW
                     SAIGARTTESQTHREMASGLSMPVGFKNGTDGSLATAINAMRAAAMPHRFVGINQAGQ
                     VCLLQTQGNPDGHVILRGGKAPNYGPEDVEKCEKEMAQAGLKPSLMIDCSHGNSNKDY
                     RRQPAVAESVVAQIKDGNRSIIGLMIESNIHEGNQSSEQPRCDMKYGVSVTDACISWE
                     TTDALLRELDSDLRGHLAARLG"
     gene            232902..233411
                     /locus_tag="EAE_RS01110"
                     /old_locus_tag="EAE_01070"
                     /db_xref="GeneID:45318607"
     CDS             232902..233411
                     /locus_tag="EAE_RS01110"
                     /old_locus_tag="EAE_01070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YfiR family protein"
                     /protein_id="WP_026612240.1"
                     /db_xref="GeneID:45318607"
                     /translation="MKEFYRLFLLFFLLIAGVPAFAAETSENVRAIVSGIVTYTRWPN
                     LSGPPKLCVFSTSRYIRSLAQEAPENLPYQPVIVRNSQEALKASCDGLYFGSETPDQQ
                     SALTKKYGSRPLLLIAEQNTDCSFGSAFCLLINDDRVRFSVNLDVLTHSGVRVNPDVL
                     MLARKKSHE"
     gene            233404..234627
                     /gene="dgcN"
                     /locus_tag="EAE_RS01115"
                     /old_locus_tag="EAE_01075"
                     /db_xref="GeneID:45318608"
     CDS             233404..234627
                     /gene="dgcN"
                     /locus_tag="EAE_RS01115"
                     /old_locus_tag="EAE_01075"
                     /EC_number="2.7.7.65"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014839238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase DgcN"
                     /protein_id="WP_015370262.1"
                     /db_xref="GeneID:45318608"
                     /translation="MNKDFSQAPRPTFKNALRRISMISVVISMTLVWLLLSAASVITL
                     KQYAQKNLELTAATMGRSLEAALVFGDATAAEDTLATLGRQGQFSEATLLDSHQRHFA
                     DWRNDALVKNEKFSGYISKWLFPEPTVQPIWHQGKIIGELRLKALDRLISHFLGTSLI
                     VLTGSILLASVIALMLTHSLHRGIVAALQSITEVVHDIRENRHFSRRVPEERIEEFHL
                     FAQDFNSLLGEMEDWQRQLQAKNAQLLRSSLHDPLTGLANRAAFRNVIGKLMDDDAAR
                     HSSALLFLDGDNFKLINDNWGHAAGDKVLIEVASRLMAFVGDQHQAWRLGGDEFAILL
                     HDVHTETEVQALCATLSEQFLQPFNLHNGHTATLSLSIGYALTWEHTSVEELQELADQ
                     NMYRMKNQRFHHTQK"
     gene            234640..235119
                     /locus_tag="EAE_RS01120"
                     /old_locus_tag="EAE_01080"
                     /db_xref="GeneID:45318609"
     CDS             234640..235119
                     /locus_tag="EAE_RS01120"
                     /old_locus_tag="EAE_01080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_015370261.1"
                     /db_xref="GeneID:45318609"
                     /translation="MLRQFIAPTLLAAFLLTGCQAPGKFSKEQVAAMKSYGFTEAAGD
                     WSLGLSDSILFDKNDYRLRPDSQQQIHSMAARLAETGITHSRLEGHTDNYGEDSYNEA
                     LSLKRANSVADAWAEGAKIPRSNLTTRGLGKKYPIASNNTAAGRAENRRVTVVISTP"
     gene            complement(235125..236495)
                     /locus_tag="EAE_RS01125"
                     /old_locus_tag="EAE_01085"
                     /db_xref="GeneID:45318610"
     CDS             complement(235125..236495)
                     /locus_tag="EAE_RS01125"
                     /old_locus_tag="EAE_01085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY domain-containing protein"
                     /protein_id="WP_015703197.1"
                     /db_xref="GeneID:45318610"
                     /translation="MTTCTSRAAWLNLLRRLHFYIGLFIGPFIFVAALTGTLYVATPQ
                     LENWLYHEALQGSLNGERQPLSAQIAVAKEATQNNLRLQAVRPGITAGETTRVMFADP
                     RLGESENRAIFVDPVTLRVKGDLTVYGTSGILPLRQWIDYAHKSLLLGDGGRLYSELA
                     ASWMWVAALGGIALWAMTRPKRRIHNRLQNTRRLHVTLGWMLLVGMLLFSATGLTWSQ
                     WAGGNVDKMRAAFGWLTPQVNTQLHGGEAMPPDPHAGHHMAHMAMDEPQMKVTADRFD
                     SVLQVAQAAGLTASKLEIRPPKSAGMAWTVNEIDRSWPTRVDAVAIDGETLQVVDRTR
                     FSDFPLMAKLTRWGVDFHMGILFGLANQLLLVAFGLALCVMIIVGYRLWWIRRPAQSA
                     FNPAQTLVQAWLGLSVAARALALLIALLLGLAVPLMGVSLAACLVVDYLRWRAASAMR
                     LVKSVD"
     gene            complement(236552..237001)
                     /locus_tag="EAE_RS01130"
                     /old_locus_tag="EAE_01090"
                     /db_xref="GeneID:45318611"
     CDS             complement(236552..237001)
                     /locus_tag="EAE_RS01130"
                     /old_locus_tag="EAE_01090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2946 domain-containing protein"
                     /protein_id="WP_015370259.1"
                     /db_xref="GeneID:45318611"
                     /translation="MNGTIFSQSALQRRAAWLALFAILLIVVAPLISVSLQKDPMSVM
                     PGMHHAMPMGESHDGMSGHEMVMMHGADSASQPAHSMPVDHAEACGYCVLLAHVPGLL
                     FALALFFAMILRRIRLPASRPVLKHWHYFPWLYPETRAPPRLSAFSL"
     gene            237025..237129
                     /locus_tag="EAE_RS01135"
                     /pseudo
                     /db_xref="GeneID:45318612"
     CDS             237025..237129
                     /locus_tag="EAE_RS01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228299.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:45318612"
     gene            complement(237122..237469)
                     /gene="rplS"
                     /locus_tag="EAE_RS01140"
                     /old_locus_tag="EAE_01095"
                     /db_xref="GeneID:45318613"
     CDS             complement(237122..237469)
                     /gene="rplS"
                     /locus_tag="EAE_RS01140"
                     /old_locus_tag="EAE_01095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012768745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_002914145.1"
                     /db_xref="GeneID:45318613"
                     /translation="MSNIIKQLEQEQMKQDVPSFRPGDTVEVKVWVVEGSKKRLQAFE
                     GVVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVVDSIAVKRRGAVRKAKLYYLRE
                     RTGKSARIKERLN"
     gene            complement(237509..238276)
                     /gene="trmD"
                     /locus_tag="EAE_RS01145"
                     /old_locus_tag="EAE_01100"
                     /db_xref="GeneID:45318614"
     CDS             complement(237509..238276)
                     /gene="trmD"
                     /locus_tag="EAE_RS01145"
                     /old_locus_tag="EAE_01100"
                     /EC_number="2.1.1.228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(37)-N1)-methyltransferase TrmD"
                     /protein_id="WP_008806092.1"
                     /db_xref="GeneID:45318614"
                     /translation="MWIGIISLFPEMFRAITDYGVTGRAVKNGLLSIESWSPRDFAHD
                     RHRTVDDRPYGGGPGMLMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSEL
                     ATNQKLILVCGRYEGIDERVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVSRFIPGVL
                     GHEASATEDSFADGLLDCPHYTRPEVLEEMEVPPVLLSGNHAEIRRWRLKQSLGRTWL
                     RRPELLENLALTEEQAKLLAQFKSEHAQQQHKHDGQA"
     gene            complement(238308..238856)
                     /gene="rimM"
                     /locus_tag="EAE_RS01150"
                     /old_locus_tag="EAE_01105"
                     /db_xref="GeneID:45318615"
     CDS             complement(238308..238856)
                     /gene="rimM"
                     /locus_tag="EAE_RS01150"
                     /old_locus_tag="EAE_01105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000043333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor RimM"
                     /protein_id="WP_015703198.1"
                     /db_xref="GeneID:45318615"
                     /translation="MSKQHTAQAPVDPIVLGKMGSSYGIRGWLRVFSSTEDAESIFDY
                     QPWLIQKAGQWQVVELESWRHHNQDIIIKLKGIDDRDAANLLTNCEIIVDSSQLPALE
                     EGDYYWKDLMGCQVVTTEGYSLGKVIDMMETGSNDVLVIKANLKDAFGIKERLVPFLD
                     GQVIKKVDLATRTIEVDWDPGF"
     gene            complement(238875..239123)
                     /gene="rpsP"
                     /locus_tag="EAE_RS01155"
                     /old_locus_tag="EAE_01110"
                     /db_xref="GeneID:45318616"
     CDS             complement(238875..239123)
                     /gene="rpsP"
                     /locus_tag="EAE_RS01155"
                     /old_locus_tag="EAE_01110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_015370257.1"
                     /db_xref="GeneID:45318616"
                     /translation="MVTIRLARHGAKKRPFYQVVVTDSRNARNGRFIERVGFFNPIAT
                     EKEEGTRLDLDRIAHWVGQGATVSDRVAALIKAANKAA"
     gene            complement(239362..240726)
                     /gene="ffh"
                     /locus_tag="EAE_RS01160"
                     /old_locus_tag="EAE_01115"
                     /db_xref="GeneID:45318617"
     CDS             complement(239362..240726)
                     /gene="ffh"
                     /locus_tag="EAE_RS01160"
                     /old_locus_tag="EAE_01115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_015370256.1"
                     /db_xref="GeneID:45318617"
                     /translation="MFDNLTDRLSRTLRNISGRGRLTEDNIKDTLREVRMALLEADVA
                     LPVVRDFISRVKESAVGHEVNKSLTPGQEFVKIVRNELVAAMGEENQTLDLAAQPPAV
                     VLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFF
                     PSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHVAINPVETL
                     FVVDAMTGQDAANTAKAFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVG
                     EKTEALEPFHPDRIASRILGMGDVLSLIEDIESKVDRAQAEKLASKLKKGDGFDLTDF
                     LEQLRQMKNMGGMASLMGKLPGMGQIPDNVKAQMDDKVLVRMEAIINSMTMKERAKPE
                     IIKGSRKRRIAAGCGMQVQDVNRLLKQFDDMQRMMKKMKSKGGMMKMMRGMKGMMPPG
                     FPGR"
     gene            240893..241684
                     /locus_tag="EAE_RS01165"
                     /old_locus_tag="EAE_01120"
                     /db_xref="GeneID:45318618"
     CDS             240893..241684
                     /locus_tag="EAE_RS01165"
                     /old_locus_tag="EAE_01120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane protein YpjD"
                     /protein_id="WP_015703199.1"
                     /db_xref="GeneID:45318618"
                     /translation="MPVFALLALVAYSISLALIIPGLLQKNSSWRRMAILSATIALIC
                     HAFALESRIFPGGEGGQNLSLLNVGSLVSLMICTVMTIVASRNRGWLLLPIVYAFALI
                     NLAFATFVPNEYITHLETTPGMLVHIGLSLFAYATLIIAALYALQLAWIDYQLKNKKL
                     AFSSEMPPLMSIERKMFHITQVGVVLLTLTLCTGLFYMHNLFNTENIDKAVLSIVAWF
                     VYIVLLWGHYHEGWRGRRVVWFNVAGAGLLTLAYFGSRVLQQFVS"
     gene            241702..242988
                     /locus_tag="EAE_RS01170"
                     /old_locus_tag="EAE_01125"
                     /db_xref="GeneID:45318619"
     CDS             241702..242988
                     /locus_tag="EAE_RS01170"
                     /old_locus_tag="EAE_01125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_026171.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyC/CorC family transporter"
                     /protein_id="WP_026612238.1"
                     /db_xref="GeneID:45318619"
                     /translation="MEHISTTTLIVTLIIMVIISAYFSGSETGMMTLNRYRLRHMAKQ
                     GNRPAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLYGDAGVAIATGVLT
                     FVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQVLMMPLVWLLNTITRVLMRMMGIK
                     TDHVISGALSKDELRTIVNESRSQISRRNQDMLLSVLDLEKVSVNDIMVPRNEIVGID
                     INDDWKSIVRQLTHSPHGRIVLYRDSLDDAISMLRVREAYRLMTEKKEFTKEIMLRAA
                     DEIYFVPEGTPLSTQLVKFQRNKKKVGLVVDEYGDIQGLVTVEDILEEIVGDFTTSMS
                     PTLAEEVTPLNDGSVIIDGGANVREINKAFNWHLPEDDARTVNGIILEALEEIPVPGT
                     RVRIEQYDIDILDVQDNMIKQVKVMPVKSLRESVAE"
     gene            complement(243092..243682)
                     /gene="grpE"
                     /locus_tag="EAE_RS01175"
                     /old_locus_tag="EAE_01130"
                     /db_xref="GeneID:45318620"
     CDS             complement(243092..243682)
                     /gene="grpE"
                     /locus_tag="EAE_RS01175"
                     /old_locus_tag="EAE_01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide exchange factor GrpE"
                     /protein_id="WP_015370253.1"
                     /db_xref="GeneID:45318620"
                     /translation="MSSKEQKTPEGQAPEEIITEQHDNVEAVEPEVSAEQVDPRDEKI
                     ANLEAQLAEAQKRERDVMLRAKAEEDNLRRRTEQDIEKAHKFALEKFVNELLPVIDSL
                     DRALEVADKANPDMAPMVEGIELTLKSMLDVVRKFGVEVVADTNVPLDPNVHQAIAMV
                     ESDDVAAGNVLGVMQKGYTLNGRTIRAAMVTVAKAK"
     gene            243806..244684
                     /gene="nadK"
                     /locus_tag="EAE_RS01180"
                     /old_locus_tag="EAE_01135"
                     /db_xref="GeneID:45318621"
     CDS             243806..244684
                     /gene="nadK"
                     /locus_tag="EAE_RS01180"
                     /old_locus_tag="EAE_01135"
                     /EC_number="2.7.1.23"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020239499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) kinase"
                     /protein_id="WP_015370252.1"
                     /db_xref="GeneID:45318621"
                     /translation="MKNHFKCIGIVGHPRHPTALTTHEMLWRWLCGKGYEVLVEQQIA
                     HELQLSNVKTGTLAEIGQQADLAVVVGGDGNMLGAARTLARYDINVIGINRGNLGFLT
                     DLDPDNALQQLADVLEGHYIAEKRFLLEAQVCQHDCQKRISTAINEVVLHPGKVAHMI
                     EFEVYIDEVFAFSQRSDGLIISTPTGSTAYSLSAGGPILTPSLDAITLVPMFPHTLSA
                     RPLVINGDSTIRLRFSQRCNDLEISCDSQIALPIQDGEDVLIRRCDYHLNLIHPKDYS
                     YFNTLSTKLGWSKKLF"
     gene            244771..246432
                     /gene="recN"
                     /locus_tag="EAE_RS01185"
                     /old_locus_tag="EAE_01140"
                     /db_xref="GeneID:45318622"
     CDS             244771..246432
                     /gene="recN"
                     /locus_tag="EAE_RS01185"
                     /old_locus_tag="EAE_01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="WP_015370251.1"
                     /db_xref="GeneID:45318622"
                     /translation="MLAQLTISNFAIVRELEIDFHSGMTAITGETGAGKSIAIDALGL
                     CLGGRAEADMVRRGASRADLCARFALKDTPAAQRWLEENQLESGRECLLRRVISADGR
                     SRGFINGTAVPLSQLRELGQLLIQIHGQHAHQLLTKAEHQKTLLDGYTGEYALTQRMA
                     ERYRQWHQSCRELAQHQQQSQERAARADLLQYQLKELNEFNPLPGEFEQIDEEYKRLA
                     NSGQLLSTCQHALTVLADGEEANLQSQLYTAKQLVSELVGMDSKLSGVLDMLEEASIQ
                     LSEATDELRHYNDRLDLDPNRLFELEQRISRQIALARKHQIAPEELPAFYQAMLDEQR
                     LLDDSAGSLESLSQLVVEHHRLALETAQELHALRQRSADELTQLITESMHSLSMPHGV
                     FAIDVAFDERHLTAEGADHIEFRVTTNPGQPLQPIAKVASGGELSRIALAIQVITARK
                     METPALIFDEVDVGISGPTAAVVGKLLRQLGESTQVMCVTHLPQVAGCGHHHFFVCKE
                     TDGEMTETHMHALDKRARLQELARLLGGSEVTRNTLANAKELLAA"
     gene            246458..246598
                     /locus_tag="EAE_RS01190"
                     /db_xref="GeneID:45318623"
     CDS             246458..246598
                     /locus_tag="EAE_RS01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_161798744.1"
                     /db_xref="GeneID:45318623"
                     /translation="MNSKLPIDLQSKVPNRAKVYYYRHITDEPRIARAQKGIKSLCAV
                     KR"
     gene            246580..246918
                     /gene="bamE"
                     /locus_tag="EAE_RS01195"
                     /old_locus_tag="EAE_01145"
                     /db_xref="GeneID:45318624"
     CDS             246580..246918
                     /gene="bamE"
                     /locus_tag="EAE_RS01195"
                     /old_locus_tag="EAE_01145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamE"
                     /protein_id="WP_015703201.1"
                     /db_xref="GeneID:45318624"
                     /translation="MRCKTLTAAAAVLLMLTAGCSTLERVVYRPDINQGNYLAPNDVA
                     KIRVGMTQQQVAYALGTPMMSDPFGSNTWFYVFRQQPGHEKVTQQTLTLTFDSSGVLT
                     NIDNKPALTK"
     gene            complement(246982..247272)
                     /locus_tag="EAE_RS01200"
                     /old_locus_tag="EAE_01150"
                     /db_xref="GeneID:45318625"
     CDS             complement(246982..247272)
                     /locus_tag="EAE_RS01200"
                     /old_locus_tag="EAE_01150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RnfH family protein"
                     /protein_id="WP_015370249.1"
                     /db_xref="GeneID:45318625"
                     /translation="MSANIVVEVAYALPEKQYLQRVKLQAGATVEQAIISSGILALRE
                     DIDLAKNKVGIYSRPVKLHDEVHDGDRVEIYRPLIADPKELRRQRAEKHAEK"
     gene            complement(247262..247738)
                     /locus_tag="EAE_RS01205"
                     /old_locus_tag="EAE_01155"
                     /db_xref="GeneID:45318626"
     CDS             complement(247262..247738)
                     /locus_tag="EAE_RS01205"
                     /old_locus_tag="EAE_01155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015875096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RatA family
                     toxin"
                     /protein_id="WP_071609891.1"
                     /db_xref="GeneID:45318626"
                     /translation="MILFALCLNVEPAMPQISRTALVPFSVEQMYQLVNDVKSYPDFL
                     PGCTGSRVLEAGPTQMTAAVDVSKAGISKTFTTRNTLTDNQSILMSLVDGPFKKLIGG
                     WKFIPLSPDACKIEFHLDFEFTNKLIEMAFGRIFKELAANMVQAFTTRAKEVYRVG"
     gene            247853..248335
                     /gene="smpB"
                     /locus_tag="EAE_RS01210"
                     /old_locus_tag="EAE_01160"
                     /db_xref="GeneID:45318627"
     CDS             247853..248335
                     /gene="smpB"
                     /locus_tag="EAE_RS01210"
                     /old_locus_tag="EAE_01160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SsrA-binding protein SmpB"
                     /protein_id="WP_015370247.1"
                     /db_xref="GeneID:45318627"
                     /translation="MTKKKAHKPGSATIALNKRARHEYFIEDEYEAGLALQGWEVKSL
                     RAGKANIGDSYVILRDGEAYLFGANFTPMAVASTHYVCDPTRTRKLLLNQRELDALYG
                     RINREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRTDVKDREWAVDKARIMKNAGR
                     "
     gene            248480..248842
                     /gene="ssrA"
                     /locus_tag="EAE_RS01215"
                     /db_xref="GeneID:45318628"
     tmRNA           248480..248842
                     /gene="ssrA"
                     /locus_tag="EAE_RS01215"
                     /product="transfer-messenger RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00023"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00023"
                     /db_xref="GeneID:45318628"
     gene            249046..>249147
                     /locus_tag="EAE_RS01220"
                     /old_locus_tag="EAE_01165"
                     /pseudo
                     /db_xref="GeneID:45318629"
     CDS             249046..>249147
                     /locus_tag="EAE_RS01220"
                     /old_locus_tag="EAE_01165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_708468.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing C-terminus; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase"
                     /db_xref="GeneID:45318629"
     gene            complement(249306..250106)
                     /locus_tag="EAE_RS01225"
                     /old_locus_tag="EAE_01170"
                     /db_xref="GeneID:45318630"
     CDS             complement(249306..250106)
                     /locus_tag="EAE_RS01225"
                     /old_locus_tag="EAE_01170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004113131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703203.1"
                     /db_xref="GeneID:45318630"
                     /translation="MLSTLPDLHRSFAEQLKLKFQSDSRIHSLLAGGSIVHGGFDKYS
                     DLDFVVVVDTLHYDEIMTQRRELAGTLGHLLHAFTGEHVGEPRLLICLYGPELLHVDL
                     KFVTLEMLTQRVEEPAVLFTRDNTALQRQLAKFSAHWPDMTPEWFESRAWIWLHYAVV
                     KLGRGELFEAIGMLSFFREQVLGPMLYRRANLPQRGVRRIEFHGIDPDGLLTSTLATH
                     DRDSVSMAIRMAVDAYIILRADALPENIADDAARWAVLAMLKAYSDRG"
     gene            complement(250282..250818)
                     /locus_tag="EAE_RS01230"
                     /old_locus_tag="EAE_01175"
                     /db_xref="GeneID:45318631"
     CDS             complement(250282..250818)
                     /locus_tag="EAE_RS01230"
                     /old_locus_tag="EAE_01175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000258888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_015703204.1"
                     /db_xref="GeneID:45318631"
                     /translation="MVTTHVFIAVSLDGYIARQDGDIDWLLKRDDPTEDHGYAAFIAD
                     KDWIIMGRGSYEKVLTFDEWPYDRPVLVLSRQLTDTPVPEALKDKVQFSCFTPGEALA
                     HLKEKNVHRVYIDGGQLIQSFLREGLVADIVITTVPVLLGSGKPLFGVLPHDIDLTLL
                     SSRSFPSGLVQSHYRLMS"
     gene            complement(251018..251380)
                     /locus_tag="EAE_RS01235"
                     /old_locus_tag="EAE_01180"
                     /db_xref="GeneID:45318632"
     CDS             complement(251018..251380)
                     /locus_tag="EAE_RS01235"
                     /old_locus_tag="EAE_01180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005226315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_015370120.1"
                     /db_xref="GeneID:45318632"
                     /translation="MYSPVNLEQKFSLFDTHWQPKVIAQMNDYQFKIVKIAGDFIWHS
                     HPETDESFIVVEGVLRIDFRDGYVLVKPGEMFVVPKGVEHKTSAETTVKMMMIEPCGV
                     RNTGHEGGERTAENDIWI"
     gene            complement(251456..252274)
                     /locus_tag="EAE_RS01240"
                     /old_locus_tag="EAE_01185"
                     /db_xref="GeneID:45318633"
     CDS             complement(251456..252274)
                     /locus_tag="EAE_RS01240"
                     /old_locus_tag="EAE_01185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014729384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_032712659.1"
                     /db_xref="GeneID:45318633"
                     /translation="MPNAQKNKDWVKLAHTPGKIERLEAYFSGHGYEPHRHDTYAIGR
                     TLSGVQRFRYRGSKQHSLPGGTMVLHPDEIHDGEAGTLEGFQYRMFYIEPALIQKILG
                     GKPLPFIHSGISSDPRLFAATGPLLKAPEDSIDTLEEEDALYDLAQTLAVVSGQRFRR
                     CLVDYQSVERAREYIQSEFSQNITLDTLSSVCGKDRWSLSRDFRTLFGTSPYRYVTMR
                     RLAYCRHLIQLGLSLAESALEAGFSDQSHMTRQFIKAYGISPGRWQTFIQKRRP"
     gene            complement(252602..252829)
                     /locus_tag="EAE_RS01245"
                     /old_locus_tag="EAE_01190"
                     /db_xref="GeneID:45318634"
     CDS             complement(252602..252829)
                     /locus_tag="EAE_RS01245"
                     /old_locus_tag="EAE_01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004140530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1272 domain-containing protein"
                     /protein_id="WP_015703206.1"
                     /db_xref="GeneID:45318634"
                     /translation="MLELRPNCECCDKDLPPESKEAYICSFECTFCIDCVTQRFDGQC
                     PNCGGELVRRPIRPEASLLRYPASSERHYKQ"
     gene            253272..253658
                     /locus_tag="EAE_RS01250"
                     /old_locus_tag="EAE_01195"
                     /db_xref="GeneID:45318635"
     CDS             253272..253658
                     /locus_tag="EAE_RS01250"
                     /old_locus_tag="EAE_01195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020454818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703207.1"
                     /db_xref="GeneID:45318635"
                     /translation="MQLTEAQLMTRVPVWHALSGLFTGRELQDYDYRWMAQKLKDSGL
                     SREEIFMILDEEVAPALQSNLLYNPTPVMDGWSEEDIKQLVTEYVYKKPTIIERIIPT
                     HLLLKQRRKHIQDELNKLSDELGKCS"
     gene            complement(253839..256361)
                     /gene="torA"
                     /locus_tag="EAE_RS01255"
                     /old_locus_tag="EAE_01200"
                     /db_xref="GeneID:45318636"
     CDS             complement(253839..256361)
                     /gene="torA"
                     /locus_tag="EAE_RS01255"
                     /old_locus_tag="EAE_01200"
                     /EC_number="1.7.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006820357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trimethylamine-N-oxide reductase TorA"
                     /protein_id="WP_047079365.1"
                     /db_xref="GeneID:45318636"
                     /translation="MMKKNNDYDMADQSQEPGMNLTRRRFLAGASALMAAPLLAGLWP
                     RSALAEAISQAMPQFIALRQAESGILTGAHWGAFEAIVRDSKMVDVRPIKDDPYPNEL
                     ITMAPYQVHAENRIKYPMVRKSWLEGGAKNGKPELRGRDEWVRVSWDKALHLVAGEIS
                     RLQKEHGPSSIYAGSYGWKSVGMFHNPRTLLQRMMNLAGGFVGYSGDYSTGAAQVIMP
                     HVVGSVEVYEQQTAWPNVIDNSELVVMIGCNPMITLKNSWNLPDHVGQTGFEALKKKG
                     TRMICIDPVRSDSARELGAEWIAPRSYTDCALMAGVAHTLLAENLHNPDFLKTYTVGF
                     DKFEAYLNGKEDGVVKDANWAADISGVDAETIKQLARDMAKHRTMIMGGWGIQRQHHG
                     EQAHWMMVTLAAMLGQIGLPGGGFGFSYHYSSGGSPTARGGILAGISAGSPTSPAAKD
                     ITPFPVARIADALANPGKTIDYNGTKVTYPDIKMVYVAGGNTFHQHQDTNNLVKAWQH
                     PETVVVNEPYWTATAKHADIVLPVTTTYERNDMDMGGDYSQLYVFPLRQCVPPQNEAK
                     NDFDVFAGISEILGVHEAFTEGKDEMLWLKGMYDEMKAQARNARVALPPFDMFWASNN
                     YIRFPIPQENTQWVRFADFRENPLLNPLGTPSGKIEIYSDAIAKMGYEDCKAIPTWMP
                     PHEWYRGPEAEKYPLSLNTGHPINRLHSQLDNTPLRKKYAVADREAIWIHPKDASARG
                     ISEGDLVRAFNDRGQILVGAVVTDNVREGVVRISEGAWFDPADPSQPGSLCKNGNVNC
                     LTFDVGSSSLAQGNCGQMSQLQIEKYTGPALKNTAHDVPVGA"
     gene            complement(256368..257531)
                     /locus_tag="EAE_RS01260"
                     /old_locus_tag="EAE_01205"
                     /db_xref="GeneID:45318637"
     CDS             complement(256368..257531)
                     /locus_tag="EAE_RS01260"
                     /old_locus_tag="EAE_01205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006798114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c"
                     /protein_id="WP_006798114.1"
                     /db_xref="GeneID:45318637"
                     /translation="MSKLSLERSGRRKIIFIALLVGIIIGVVLLAGTATIMHKTSDTE
                     FCVSCHTMQQPLAEYQGSVHFQNDKGIRAECADCHVPHQPIDYMLTKIGALKDVWGEM
                     TGKIDTPEKYEAHKLAMAQSVWDGLKKSDSATCRSCHDYKAMDILAQTPEARKQHPVA
                     IKEGETCIDCHKGVAHILPNMSGLAAAGASELANAAAKTPATATTLYTIQTQPFWLSE
                     KAGDHNDGNLMASTEVKVVKREGDMVLADVHGWQQDGVTEAFYAARGKRIMSALLGEE
                     ARKALKVSGSVTDEETKQVWHEVDLQVWLPAKNLIGDQQKIWSYASELMANNCTGCHG
                     LTELNRFNANQWIGVVKGMSGRTSLTQEQVRLLTQYVQKHASDMPAAANQDKQ"
     gene            complement(257757..258623)
                     /gene="ccmI"
                     /locus_tag="EAE_RS01265"
                     /old_locus_tag="EAE_01210"
                     /db_xref="GeneID:45318638"
     CDS             complement(257757..258623)
                     /gene="ccmI"
                     /locus_tag="EAE_RS01265"
                     /old_locus_tag="EAE_01210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="c-type cytochrome biogenesis protein CcmI"
                     /protein_id="WP_015703209.1"
                     /db_xref="GeneID:45318638"
                     /translation="MIVALLIMLVLLLGTAALLFIPWSGRQRVDRNTMNHMIYRARLQ
                     ELDEDLSAVNAAQQQQLVDDLRLNLLEDLPESAETNHKNSSYWVYILGVIILTSLCVG
                     VFIRTSYMTRVVEWQQVVQQTPQLMQRVMDPQGKPLSEEELFRLALGLRTRLQQYPAD
                     QLSWTMLGRLQLVLNNPGAALQAFDKARQLAPGNADAQLGYTEALLHSTDPNDSREAQ
                     QLLDTLLKNNHNDVRVLSLAAFNAFEHQQYDKAIAAWQLMLQLLPADDAQREIIIRSI
                     DRAKKEQAAILQ"
     gene            complement(258620..259087)
                     /locus_tag="EAE_RS01270"
                     /old_locus_tag="EAE_01215"
                     /db_xref="GeneID:45318639"
     CDS             complement(258620..259087)
                     /locus_tag="EAE_RS01270"
                     /old_locus_tag="EAE_01215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c-type biogenesis protein CcmH"
                     /protein_id="WP_015703210.1"
                     /db_xref="GeneID:45318639"
                     /translation="MKYLLITLLTALFSFQALAAIDTYPFKDEAQEQQFRQLTEQLRC
                     PKCQNNSIADSNSMIAADMRKKVWQLMEQGQSNQQITDYMVARYGNFVTYEPPVTPAT
                     IILWLLPACFVVGGALVIFRLSRRSRAERISELSAQEQERLKALLDDNKRTLK"
     gene            complement(259084..259641)
                     /locus_tag="EAE_RS01275"
                     /old_locus_tag="EAE_01220"
                     /db_xref="GeneID:45318640"
     CDS             complement(259084..259641)
                     /locus_tag="EAE_RS01275"
                     /old_locus_tag="EAE_01220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017373333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DsbE family thiol:disulfide interchange protein"
                     /protein_id="WP_015370115.1"
                     /db_xref="GeneID:45318640"
                     /translation="MNRKVLYLPLAIFLILAAALMWQLMRNSDGDDPTVLESALVGKP
                     LPDFRLASLEKPDVMLDPSNIINGKPVLINVWATWCPTCRAEHQYLRSLAAQGIRIVG
                     INYKDDRQKAVNWLHELGNPYALGVFDGDGMLGLDLGVYGAPETFLIDGKGIIRYRHA
                     GDVNERVWQQEILPLWNKYSQQGGA"
     gene            complement(259641..261593)
                     /locus_tag="EAE_RS01280"
                     /old_locus_tag="EAE_01225"
                     /db_xref="GeneID:45318641"
     CDS             complement(259641..261593)
                     /locus_tag="EAE_RS01280"
                     /old_locus_tag="EAE_01225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004387032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme lyase CcmF/NrfE family subunit"
                     /protein_id="WP_015703211.1"
                     /db_xref="GeneID:45318641"
                     /translation="MIPEIGLFLLCLALGISCLLALFPSWGAMRQDARMMALAKPLSV
                     AMFAAILGAFLILVYAFVVNDFTVLYVVSNSNTLLPVWYRVAATWGAHEGSLLLWVLL
                     MSGWTCAVAALSRNIPLEASSRVLAVMGMISFCFLAFILLTSNPFVRTLPDFPIEGRD
                     LNPMLQDIGLIFHPPMLYMGYVGFSVAFAFAIASLMTGRLDSAWARWSRPWTLAAWSF
                     LTVGIVLGSAWAYYELGWGGWWFWDPVENASLMPWLAGTALIHSLSVTEKRGSFKSWT
                     VLLAILAFSLCLLGTFLVRSGVLISVHSFASDPTRGMFILALLVITIGGSLLLFAIKG
                     GKVRSRVRHELWSRESLLLGNNVLLIAAMLVVLLGTLLPLIHKLLGLGSISIGEPFFN
                     SLFIALMIPFSLLLGIGPLVHWRRDEFHKLRKRLLIAAVVAVVLAIALPWLMQDRIKA
                     MTVVGLLMSLWAFVLTVMEVVERATDRHPFWRGLTRLGRSHWGMVAGHVGLVVTVIGI
                     AFSQNYSIERDVRMKPGDSVDIHQYHFVFRDVRDITGPNYFGGEGVIEVSQNGRHVST
                     LRAEKRIYSSSRMEMTEAAIDGGLVRDLYAALGEELADGSWAVRLYYKPFVRWIWFGG
                     MLMAFGGVLCILDPRYRLRKSLPENA"
     gene            complement(261590..262066)
                     /gene="ccmE"
                     /locus_tag="EAE_RS01285"
                     /old_locus_tag="EAE_01230"
                     /db_xref="GeneID:45318642"
     CDS             complement(261590..262066)
                     /gene="ccmE"
                     /locus_tag="EAE_RS01285"
                     /old_locus_tag="EAE_01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c maturation protein CcmE"
                     /protein_id="WP_015703212.1"
                     /db_xref="GeneID:45318642"
                     /translation="MNPRRKVRLWLACGVIGGLALTVGLVMYALSSNIDLFYTPGEVI
                     YGKRENGQKPEPGQRLRIGGMVMPGSVKRDDKTLDVTFKLYDARGVVEVSYTGILPAL
                     FREGQGVVAQGTLQDGTHIRAKEVLAKHDENYTPPEVKEAMEENHHPAEKPQGAAQ"
     gene            complement(262063..262287)
                     /gene="ccmD"
                     /locus_tag="EAE_RS01290"
                     /old_locus_tag="EAE_01235"
                     /db_xref="GeneID:45318643"
     CDS             complement(262063..262287)
                     /gene="ccmD"
                     /locus_tag="EAE_RS01290"
                     /old_locus_tag="EAE_01235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmD"
                     /protein_id="WP_006798167.1"
                     /db_xref="GeneID:45318643"
                     /translation="MTSAFHSWSDFWQMGGYAFYVWLAVAVTVIALLILFIHTRWQRR
                     ALLADVRRQMARERRVSAARKQSTMKGDAL"
     gene            complement(262284..263030)
                     /locus_tag="EAE_RS01295"
                     /old_locus_tag="EAE_01240"
                     /db_xref="GeneID:45318644"
     CDS             complement(262284..263030)
                     /locus_tag="EAE_RS01295"
                     /old_locus_tag="EAE_01240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006798169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter permease"
                     /protein_id="WP_006798169.1"
                     /db_xref="GeneID:45318644"
                     /translation="MWKVLHQLAIPERLYSVCGRFIPLMAILSALFLVVGCVWGFVYA
                     PADYQQGESYRIMYLHVPAAMWSMGIYGSMAVTAFVGLVWQMKMADKAVIAMALPGAV
                     YTFIALVTGSAWGKPMWGTWWVWDARLTSELVLLFLYVGVIGLYHAFDDRRLAGRAAG
                     ILVLVGVVNLPIIHYSVEWWNTLHQGSTNMQKTIDPSMRMPLRLTIFGFLFLFITLTL
                     MRMRNLILLQERRRPWVVALAGASKREENS"
     gene            complement(263064..263723)
                     /gene="ccmB"
                     /locus_tag="EAE_RS01300"
                     /old_locus_tag="EAE_01245"
                     /db_xref="GeneID:45318645"
     CDS             complement(263064..263723)
                     /gene="ccmB"
                     /locus_tag="EAE_RS01300"
                     /old_locus_tag="EAE_01245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016537518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme exporter protein CcmB"
                     /protein_id="WP_015370111.1"
                     /db_xref="GeneID:45318645"
                     /translation="MIKQIFWRDLRLAFRNYAEIINPLWFFLIIITLFPLSIGPEPQL
                     LRQIAPGIVWVAALLSSLLAMDRLFRDDWLDGSLQQLMLMPVPLSLVVLAKIAAHWVV
                     SGLPLLIISPLIAMLFGLSTAEWQVLALTLLMGTPTLSFIGAIGVGLTVGLRRGGVLL
                     SLLVLPLMIPLLIFATAAVGAAQMQLPVDGYMAILGAFLAGSATLSPFATAAALRISV
                     Q"
     gene            complement(263720..264343)
                     /gene="ccmA"
                     /locus_tag="EAE_RS01305"
                     /old_locus_tag="EAE_01250"
                     /db_xref="GeneID:45318646"
     CDS             complement(263720..264343)
                     /gene="ccmA"
                     /locus_tag="EAE_RS01305"
                     /old_locus_tag="EAE_01250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis heme-transporting ATPase
                     CcmA"
                     /protein_id="WP_015370110.1"
                     /db_xref="GeneID:45318646"
                     /translation="MLEIKNIACLRDERTLFTHLSFAVQPGEIIQISGPNGAGKTSLL
                     HLLTGLSTPEEGEILWQGKPLRRTRDSWHAQLLWLGHQVGVKGALTADENLRFYHPEA
                     TIEARWQALAQVELVGFEDVPVAQLSAGQQRRVALARLWLSRATFWILDEPFTALDAA
                     GVQTLTTRLEQHVGQGGAVILTTHQPLRPLCVPLRTIMLSDDEAVAA"
     gene            complement(264528..265910)
                     /locus_tag="EAE_RS01310"
                     /old_locus_tag="EAE_01255"
                     /db_xref="GeneID:45318647"
     CDS             complement(264528..265910)
                     /locus_tag="EAE_RS01310"
                     /old_locus_tag="EAE_01255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013575196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DHA2 family efflux MFS transporter permease
                     subunit"
                     /protein_id="WP_015703213.1"
                     /db_xref="GeneID:45318647"
                     /translation="MSLVSSCSLDQGFEAPRRYLAAAAILIGVLMAALDSSIVNVALP
                     SIASALRVDSASGIWITNGYQVASAATMLICASLGSRIGEKRFYTAGMVLFTLSSLGC
                     SLAPTFGVLVTMRILQGVSYAVMISVGLGLYRVIFPPCALGTIFGLNALAFAVGTAIG
                     PALGGFIISSLSWPWLFYINILPGGAAIVFSLISLGEDNEKEQGFDWAGAVSSAAALG
                     LMVVAVDQIGRWEGRTLIYCAVASVALFAFFFIAQTRAKHPLLPLDIFRSRQYTLAVI
                     SSSSLFIAQGMALVGLPFVLQHTYHYSVLESAFIFTPWPVAVAICAPLAGSLSNRFNP
                     TQISTVGVVIFCLGLGSLALLPGAATVNDFLWRTAVCGVGYGLFLPPNNKEMFANVSA
                     NRTATASGVLSTARTTGLSIGAALVAMVIALLNGLTGLAGAQFSVYVFGLACVIAAIS
                     SLASTLRLHR"
     gene            266140..267027
                     /locus_tag="EAE_RS01315"
                     /old_locus_tag="EAE_01260"
                     /db_xref="GeneID:45318648"
     CDS             266140..267027
                     /locus_tag="EAE_RS01315"
                     /old_locus_tag="EAE_01260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013575192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703214.1"
                     /db_xref="GeneID:45318648"
                     /translation="MKLNELLAFVTVVETGNITLAAERLNRVQSSISHRIRSLESSLD
                     ATLLDRKNEGCIPTEQGKILYEYALKMLNLADDCKHNITLSKRRRLTIKIGIIECLPP
                     YVISALIDSGHDLGWDIDVSIGNTSSLLNAFDRHEYDAVIIGAGFSSPQHTRAMLLTS
                     ELVIITAKDHPAITATSALDDNVFLLSSKKCATSTRNLDMLFREGNITPRRVVECGSY
                     PVLFSNIADGKGVSLVLRCSISDEIQQKIKIHPLTGEFNDFGIELLCRPEGAHFDLQQ
                     LNLMVASVFQDPRLRETGY"
     gene            complement(266975..267865)
                     /locus_tag="EAE_RS01320"
                     /old_locus_tag="EAE_01265"
                     /db_xref="GeneID:45318649"
     CDS             complement(266975..267865)
                     /locus_tag="EAE_RS01320"
                     /old_locus_tag="EAE_01265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_015703215.1"
                     /db_xref="GeneID:45318649"
                     /translation="MNTTFPSIVLGDMRVTAVSDGYLQVGFGLLTKIDEDECRNIQAN
                     ARIAQPNAVNINTFLVQQAGMNILIDSGAGGVKGWGGQLINNLAKLGVKPEDIDAVLL
                     THAHPDHIGGLINSQQDAVFPHAELIIPQDEFSYLEDDRNLVTASERVKGNVMFARSV
                     FKQYQHRLRLIDEGEVFAGISALALKGHTPGHTGYLLSGSIERVLVWGDIVHFPHIQL
                     LDPEVTIAFDFDPLLAQETRIRLLEKVCAEQILVAGMHFDTAGFARIKKCSSGYQIIP
                     ADGINSQSHAAVDPEIRMPP"
     gene            268161..268487
                     /locus_tag="EAE_RS01325"
                     /old_locus_tag="EAE_01270"
                     /db_xref="GeneID:45318650"
     CDS             268161..268487
                     /locus_tag="EAE_RS01325"
                     /old_locus_tag="EAE_01270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015387201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703216.1"
                     /db_xref="GeneID:45318650"
                     /translation="MKTNITEKDLVDNGFSDKNISRLKEILSRQENSGESLTTLITDL
                     RKRFYAGALCLALLFSLAIFALIFYPIAVGLSYIPAMIIGIAIIYYVIPLDLSWKAWR
                     FVKGSK"
     gene            complement(268495..269307)
                     /locus_tag="EAE_RS01330"
                     /old_locus_tag="EAE_01275"
                     /db_xref="GeneID:45318651"
     CDS             complement(268495..269307)
                     /locus_tag="EAE_RS01330"
                     /old_locus_tag="EAE_01275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015699883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4225 domain-containing protein"
                     /protein_id="WP_015703217.1"
                     /db_xref="GeneID:45318651"
                     /translation="MDIYIGNYRFSTYFSTLAAMEANSLMNTAVAVSAFHLSDALTRI
                     RFQEEVKNFAHQQLLFIKSSASNEECQHYIRNLIEERNNLKIQDRMLRTGESVVAASV
                     KIYQENRKVASYIIDGIGVVVAGLQMVAGTGVFATSLPTGNVIGMLAGATLFLNGVSS
                     VAEGVQKLSGSDNPSNLMRDAYENSAQFLGFDRKLGLLAYQFVDLATSYYGLFKLTLK
                     PDVWRLYRYTAPDFYRKVSAMSRAALVIKGTGAGWKGLQIGNNIYEIQHGRN"
     gene            269671..270465
                     /locus_tag="EAE_RS01335"
                     /old_locus_tag="EAE_01280"
                     /db_xref="GeneID:45318652"
     CDS             269671..270465
                     /locus_tag="EAE_RS01335"
                     /old_locus_tag="EAE_01280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020884512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_015703218.1"
                     /db_xref="GeneID:45318652"
                     /translation="MNIDLSGKVALVTASTAGIGYAIAKGMAASGAEVIINGRSEHSV
                     NAAMARLQQEVPGFRPYPAVADLSDAAGVGQLLQAVNEVDILVNNAGIYGPQDFYATD
                     DATWENYWQTNVMSGVRLSRALLPAMVRKGWGRVVFISSESARNIPADMIHYGVTKTA
                     QLSLARGLAKYVAGSGVTVNSVLPGPTLSDGFAEMMKDEVTRTGKPLEQLAKEFVMAQ
                     RPASVIQRAASVDEVANMVVYVCSPQASATSGAALRVDGGVVDDIV"
     gene            270637..271245
                     /locus_tag="EAE_RS01340"
                     /old_locus_tag="EAE_01290"
                     /db_xref="GeneID:45318653"
     CDS             270637..271245
                     /locus_tag="EAE_RS01340"
                     /old_locus_tag="EAE_01290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_047079396.1"
                     /db_xref="GeneID:45318653"
                     /translation="MSVIRSLLFFLGAAAASAIAVLCLWMDIRVFGNDIPEISLTEVV
                     QEGVLAVIVLMHFLLAKKYELLRYCNILVGGFFLAMLIRELDALFDLITHGSWVWFAL
                     ATTIAALIAPLRHARQTLSQLAQYTRTPYYGMMISGLLAILVFSRLFGMHGLWYAVLD
                     ENYARVVKNTVEEGSESFGYMLCLTASIGYYCYFRYQARQKS"
     gene            complement(271296..272057)
                     /locus_tag="EAE_RS01345"
                     /old_locus_tag="EAE_01295"
                     /db_xref="GeneID:45318654"
     CDS             complement(271296..272057)
                     /locus_tag="EAE_RS01345"
                     /old_locus_tag="EAE_01295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter substrate-binding domain-containing
                     protein"
                     /protein_id="WP_015703221.1"
                     /db_xref="GeneID:45318654"
                     /translation="MKLKLGVALMAAVIACGAQARDMQSIQQSGELKVGVPGDYAPLA
                     FHNGAGELIGYDVDMAHDLGKTLGVKVTFIITSWPTLSTDLKADKFDIAMGGVTETAA
                     RAKDFSLSHPVVANGKIALANCSAASALGSLEKIDQPNVKVIVNPGGTNQSFVDEHIK
                     HAQIIRVQNNVDNLQALRQKTADMMVTDLIEGDYYQSKEPGVFCVANETPFPGTASYK
                     VYMMNKDNPALLEKVNHWLDSQDKNVLKRKWKIQG"
     gene            complement(272068..272853)
                     /locus_tag="EAE_RS01350"
                     /old_locus_tag="EAE_01300"
                     /db_xref="GeneID:45318655"
     CDS             complement(272068..272853)
                     /locus_tag="EAE_RS01350"
                     /old_locus_tag="EAE_01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CatB-related O-acetyltransferase"
                     /protein_id="WP_015703222.1"
                     /db_xref="GeneID:45318655"
                     /translation="MKIAFGEIRSLLQSQRIFLGGQRLVCDHPFYRDEQPIEVPENLC
                     TEPYTTYWGRCGERLASLGAFSYTRTLLPAFIQVGRYTSIADRLQVLGDRHPLEWASS
                     SPVFYARHSALMETLAADNGRENHFYAFEKQTRPIVIGNDVWIGQNVTLAQGITIGDG
                     AVIAANALVVKDVAPYTMVGGNPAKLIKYRFAEPIVEQLLALRWWQYSAQDIAMFPVN
                     EVARFCELLRHAQEQGELTPLALPKLTATVVKTVVSGGMKMKS"
     gene            273163..274029
                     /locus_tag="EAE_RS01355"
                     /old_locus_tag="EAE_01305"
                     /db_xref="GeneID:45318656"
     CDS             273163..274029
                     /locus_tag="EAE_RS01355"
                     /old_locus_tag="EAE_01305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="WP_015370101.1"
                     /db_xref="GeneID:45318656"
                     /translation="MNDSNGLFHIIESTFSQLTPSEKRIGSWLLSHREHIPFETADSI
                     AQATGTSGITVGRYLRKLGYRNLDDVKHSLKEPASTPYRQWGVIDRLDSWSQQQAQPD
                     RASLSLQMELDAIRYVYQLAQEPTFARVSQRIAEADAVIIIGIQSTRGIANTFFSHLE
                     YLRPRVTYADGSSGSWLESLNSEYQRPYVVLTDTRAYSVAARQFCRVACERGVATALV
                     TDIWCPWARDYPVDLLQVKTDTGHFWDSLAPIGCLFNLLLSAVVERLGPSLSSRLAAN
                     RALQQEFGQFER"
     gene            274041..274622
                     /gene="ddpX"
                     /locus_tag="EAE_RS01360"
                     /old_locus_tag="EAE_01310"
                     /db_xref="GeneID:45318657"
     CDS             274041..274622
                     /gene="ddpX"
                     /locus_tag="EAE_RS01360"
                     /old_locus_tag="EAE_01310"
                     /EC_number="3.4.13.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine dipeptidase"
                     /protein_id="WP_015370100.1"
                     /db_xref="GeneID:45318657"
                     /translation="MSHLSLVDIAARFPTLPVDLKYATADNITGQPIYREARCLLHPD
                     AAVALEKSIAIAALAGYRLLVLDAYRPQRAQQLLWNACPNQDYVVPANIGSNHSRGTA
                     IDVTLLDEHNNLLDMGTAFDEMDDRSHPYHPAVAQEAQRNRLLLNAIMFGGGFKGITT
                     EWWHFELPDAAGYPLLDDVFACFSPAQIDGVSP"
     gene            274619..276181
                     /locus_tag="EAE_RS01365"
                     /old_locus_tag="EAE_01315"
                     /db_xref="GeneID:45318658"
     CDS             274619..276181
                     /locus_tag="EAE_RS01365"
                     /old_locus_tag="EAE_01315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_015370099.1"
                     /db_xref="GeneID:45318658"
                     /translation="MNMTRPASVGFRPLLLAAALCAAIPSAFAAVPKDMLVIGKAADP
                     QTLDPAVTIDNNDWTVTYPAYQRLVKYKTDNGKGSTDVEGDLAENWQASDDGKTWTFT
                     LRKGAQFADGSPVTAEAVKLSFERLMRIKQGPSEAFPSGLKVDVVDPATVRFTLPESF
                     APFLHTLANDGASIINPAVLKANAADDARAYLAEHTAGSGAYSLQRWQKGQQLVLVPN
                     PHFSGNKPAFKRVTVKIIGESAARRLQLTKGDLDIADALPVDQFAALKKEDKVTVYDY
                     PALRVTYLYLNNSKAPMNQADLRRAVSWATDYKGMVDGILGGNGKQMRGPIPDGMWGY
                     DASAMQYSLDLDKAKAALDKVADKPKTLTFLYSDNDPNWEPIALSTQANLQALGIQVK
                     LEKLANATMRERVGKGDYDIAIGNWSPDFADPYMFMNYWFESDKKGLPGNRAFYDNPQ
                     VDALLKQAVATTDQAARTKDYQQAQKTVIDDAAYVYLFQKNYQVAMNKEVKGFVFNPM
                     LEQIYNIADMHK"
     gene            276242..277261
                     /locus_tag="EAE_RS01370"
                     /old_locus_tag="EAE_01320"
                     /db_xref="GeneID:45318659"
     CDS             276242..277261
                     /locus_tag="EAE_RS01370"
                     /old_locus_tag="EAE_01320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_015370098.1"
                     /db_xref="GeneID:45318659"
                     /translation="MSFWGLIRQRCWGLILVVAGVCVITFIISHLIPGDPARLLAGDR
                     ASDEIVRHIRQQLGLDLPLWQQFARYVDALLHGDLGTSIRTGRPVLEDLKTFFPATLE
                     LAFCALLIALLVGIPLGVLSAVYRNRWTDHLVRLMALTGISTPAFWLGLGVIVLFYGK
                     LDWLPGSGRLDDWFDPPTRVSGFYLLDSLLEGNIEVFFNALQHLILPAATLAFVHLGI
                     VARQIRSAMLEQLNEDYIRTALASGLPKFTIVVRYALPNALIPSITVLGLALGDLLYG
                     AVLTETVFAWPGMGAYVVSSIQALDFPAVMGFAIVVSFAYVLVNLVVDLLYLWIDPRM
                     GRGES"
     gene            277265..278155
                     /locus_tag="EAE_RS01375"
                     /old_locus_tag="EAE_01325"
                     /db_xref="GeneID:45318660"
     CDS             277265..278155
                     /locus_tag="EAE_RS01375"
                     /old_locus_tag="EAE_01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-dipeptide ABC transporter permease"
                     /protein_id="WP_015370097.1"
                     /db_xref="GeneID:45318660"
                     /translation="MMTQEQPLPRPKAEKSGHWKRRWWLIRQSPLTLIGAAIMLIMLF
                     LMIFSPWLTPHDPNAINLAARLQAPSFDHWFGTDEVGRDLFSRVLIGSQQSVAAGLAV
                     VLIAGISGSLLGCLSGVLGGRSDALIMRLMDIMLSIPSLVLTMALAAALGPSLFNAML
                     AIAIVRIPFYVRLARGQTLVVRQHTFVEASVTFGASRWHLISWHILRNALPPLVVQAS
                     LDIGSAILMAATLGFIGLGAQQPTAEWGAMVANGRNYVLDQWWYCAFPGAAILITAVG
                     FNLFGDGIQDLLDPKAGGRN"
     gene            278155..279144
                     /locus_tag="EAE_RS01380"
                     /old_locus_tag="EAE_01330"
                     /db_xref="GeneID:45318661"
     CDS             278155..279144
                     /locus_tag="EAE_RS01380"
                     /old_locus_tag="EAE_01330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013027597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_015703224.1"
                     /db_xref="GeneID:45318661"
                     /translation="MENRVLTIDNVRLSFPVYQGQVNVLNNISLHIDRGEIVGVVGES
                     GSGKSVTAMLAMRLLPAGSYHIHSGAITLMGHDMLNLTEKTLRDIRGSKVAMIFQEPM
                     TALNPTRRIGKQMADVIRQHRPMSLREARARAVELLADMQIADPQSVLKRYPFELSGG
                     MRQRVMIAIAFSCEPDLLIADEPTTALDVTVQRQVLRLLKQKAQATGTAVLFISHDMA
                     VVSQVCDRLYVMYAGAVIESGNTGEVLQQPQHPYSIGLLNSAPDNGEPRTPLRSIPGT
                     VPNLARLPAGCAFRERCFAAGEACGITPTLQAHDSAADRQAACWYPQRENAHV"
     gene            279137..280081
                     /locus_tag="EAE_RS01385"
                     /old_locus_tag="EAE_01335"
                     /db_xref="GeneID:45318662"
     CDS             279137..280081
                     /locus_tag="EAE_RS01385"
                     /old_locus_tag="EAE_01335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_015703225.1"
                     /db_xref="GeneID:45318662"
                     /translation="MSETLLTLNDVHLTFAAQKNWRGKVIERVYALNGLDMTARRGET
                     LGIVGESGCGKSTLAKLLMGMLKPSSGHFTRAPARGENQSGRMQMVFQDPLSSLDPRL
                     PVWRTITEPVWIQSRMPEKARRDLAEQLALQVGIRSEYLDRLPHAFSGGQRQRIAIAR
                     ALSSQPEIIVLDEPTSALDISVQAQILNLLVELQQRQNLTYVLISHNVSVIRHMSDRV
                     AVMYLGQIVEMGEARQVLDSPAHPYTRLLMESVPRIGSPLGAGVRNTELPGNRRLPTG
                     CFFRERCPYASQGCERPQPLEAQANGAQVRCWKAQTIR"
     gene            complement(280404..281924)
                     /locus_tag="EAE_RS01390"
                     /old_locus_tag="EAE_01340"
                     /db_xref="GeneID:45318663"
     CDS             complement(280404..281924)
                     /locus_tag="EAE_RS01390"
                     /old_locus_tag="EAE_01340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_015703226.1"
                     /db_xref="GeneID:45318663"
                     /translation="MRYVHPGKPGALVSFKSAYGNFIDGKFVEPLSGEYFMNTSPVDG
                     SNIAQFPRSDAKDIDLALDAAHRAADAWGRTSVQQRSHLLLQVADRIQENLEYLAVAE
                     SWDNGKPIRETLNADLPLAVDHFRYFAGCLRAQEGSTAEIDDTTVAYHFHEPLGVVGQ
                     IIPWNFPLLMAAWKLAPALAAGNCVVLKPAEQTPLSITLLMEIIGDLFPAGVLNVVQG
                     FGKEAGEALATSKRIAKIAFTGSTPVGRHIMACAAENIIPCTVELGGKSPNIYFADVM
                     DGEEEFIEKAVEGLVLGFFNQGEVCTCPSRALIHESIYEPFMERVMAKVMQIRRGDPF
                     DTETMIGAQASRQQFDKILSYIKIARDEGGQILTGGDRASITAELDSGFYIQPTLIKG
                     HNEMRSFQEEIFGPVIGVTTFKDEAEALAIANQTQFGLGAGVWTRDTNLAYRMGRGIK
                     AGRVWTNCYHVYPAHAAFGGYKQSGVGRETHKMALEAYQQTKNLLVSYGTAPLGLF"
     gene            282190..283971
                     /locus_tag="EAE_RS01395"
                     /old_locus_tag="EAE_01345"
                     /db_xref="GeneID:45318664"
     CDS             282190..283971
                     /locus_tag="EAE_RS01395"
                     /old_locus_tag="EAE_01345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_015703227.1"
                     /db_xref="GeneID:45318664"
                     /translation="MQGNPFTITPEAQSSTLLSDSWQRSQRYGLQPTSDEFPRLRGGE
                     LADVLESNRSLQRLAQPVATPLAQRAAGLQSVVILSDASGLVLQTFGNSAAMEKAQSF
                     ALEPGNIWSESGRGTNAIGTALAIDDSCEVEGRQHYLTRNQDLYCAAVPLQSPDGQIA
                     GALDISGPAHIPHPHSLAWIKEAAKQIEYLWVKQSLHPQQWLMSLHSRVQKLDSAEEL
                     LLVFSDNLLTAANRLAIRELGLQAGQIGQMTFQQLFPRLTQTAVSVPLPMTFQQRGYY
                     YRLRAPTRASVAVPAQPALNLPFCASGEGEKMVRLLNAGIALCIEGETGCGKEFLSRE
                     LHAHSRWRSGKFVAINCAAIPESLIESELFGYQAGAFTGANKNGYIGKIREADGGVLF
                     LDEIGDMPLALQTRLLRVLQEKEVMPLGGNRSAPVNFALICATHRHLAQRVAEGAFRE
                     DLLYRLREYAFTIPPLRQWPELKQFIPALWRSLGAAERHITLSDALIHQLTLCRWPGN
                     VRQLQSLLKVLLALADDGECLGVAALPEEYQSAQQTSAPGGLQQHDAKLIADTLARFN
                     GNVSKAAQALGVARSTLYRRAARVQRK"
     gene            complement(283972..284568)
                     /locus_tag="EAE_RS01400"
                     /old_locus_tag="EAE_01350"
                     /db_xref="GeneID:45318665"
     CDS             complement(283972..284568)
                     /locus_tag="EAE_RS01400"
                     /old_locus_tag="EAE_01350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl-diphosphatase"
                     /protein_id="WP_015370092.1"
                     /db_xref="GeneID:45318665"
                     /translation="MNLLETFNQNAFLTLNAGPGTPDSLLLLAQFSASWLILIVPAIL
                     LGLWFLGGRQGHRQALFCAMTILIALGLGVACGTLWFHPRPFMMPLGHTWISHPADNS
                     FPSDHGTVMFSAAFALLSLRLRGIGLLVLAAALPVAWARIFLGVHFPLDMLGAALISA
                     LSLCVAKVVWQRLGQTLVALCEALSRRLFSWLPARFTP"
     gene            complement(284628..285566)
                     /locus_tag="EAE_RS01405"
                     /old_locus_tag="EAE_01355"
                     /db_xref="GeneID:45318666"
     CDS             complement(284628..285566)
                     /locus_tag="EAE_RS01405"
                     /old_locus_tag="EAE_01355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703228.1"
                     /db_xref="GeneID:45318666"
                     /translation="MRIDLNAIPVFVAVVECGNFAQAAEKLNVTRSAVGKSISRLEQR
                     LGVALFQRTTRRQALTEEGEVFYLQSRRALDNLRDAENEIQRGKTLVQGRLRISLPVL
                     FGQRCVAPILFPLSQRYPELKLELSFSDRQVNLFEEGFDMAIRIGALSDSSFLKARRL
                     GQHGMILCASPLYLHNQPAPQTAEELHEHLTIGYLYAGQMQKWHLRDTQGAALAFRPQ
                     PGLAMDDFAAIAAAAKSGLGIAWLPDWLVADEIARGELQQILPSSVSGSFAISAVWPE
                     AVWVPQKIRVVVDELLARLPQQLAGGENQEDSSASG"
     gene            285669..286274
                     /locus_tag="EAE_RS01410"
                     /old_locus_tag="EAE_01360"
                     /db_xref="GeneID:45318667"
     CDS             285669..286274
                     /locus_tag="EAE_RS01410"
                     /old_locus_tag="EAE_01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228365.1"
                     /note="FMN-dependent; requires NADH; catalyzes the
                     cleavage of azo bond in aromatic azo compounds; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent NADH-azoreductase"
                     /protein_id="WP_015703229.1"
                     /db_xref="GeneID:45318667"
                     /translation="MSNVLILKSSINGPASLTNQLIDEYMQTRRDAGHQDSVVEHDLT
                     TLALPKLDGALFAALRGAQDSRPAIQQGVALSDSLIGELKASDLLVIGAPMYNLNVPT
                     DLKNWFDLVARARETFRYTETWPQGLVEGVRAVVISSRGGVHDGQPSDAVTPYLRAVL
                     GLMGISDVEFIYAEGMDIRPHGRDAGIAHARQHIARAAQQA"
     gene            286352..286651
                     /locus_tag="EAE_RS01415"
                     /old_locus_tag="EAE_01365"
                     /db_xref="GeneID:45318668"
     CDS             286352..286651
                     /locus_tag="EAE_RS01415"
                     /old_locus_tag="EAE_01365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_015370089.1"
                     /db_xref="GeneID:45318668"
                     /translation="MTTAQQLQASAGEAAVLLKAMSNPHRLLILCMLCEAPRTTAGEL
                     AQITGLSPSATSQHLARMRDEGLIDCERDAQRLRYFITHPAVQQVIATLKTIYCP"
     gene            286661..287182
                     /locus_tag="EAE_RS01420"
                     /old_locus_tag="EAE_01370"
                     /db_xref="GeneID:45318669"
     CDS             286661..287182
                     /locus_tag="EAE_RS01420"
                     /old_locus_tag="EAE_01370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2892 domain-containing protein"
                     /protein_id="WP_015703230.1"
                     /db_xref="GeneID:45318669"
                     /translation="MTIATVSANEAQALIAQGARLIDIRAADEYAREHIPAATLLPLE
                     QLTHGAALNAQPGDTIIFHCQAGSRTQNNASFLAAAAAPAQVKLLAGGIQAWRAAGLP
                     IVEDKSQPLPLMRQVQIAAGALILLGVVLGYAVNSGFFLLSGFVGAGLTFAGLTGFCG
                     MARLLAVMPWNQR"
     gene            complement(287179..288081)
                     /gene="lpxO"
                     /locus_tag="EAE_RS01425"
                     /old_locus_tag="EAE_01375"
                     /db_xref="GeneID:45318670"
     CDS             complement(287179..288081)
                     /gene="lpxO"
                     /locus_tag="EAE_RS01425"
                     /old_locus_tag="EAE_01375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A hydroxylase LpxO"
                     /protein_id="WP_015370087.1"
                     /db_xref="GeneID:45318670"
                     /translation="MKYIILLIIIIAVLYVHYRGKVRYRFWRQLSDHSTFTAPLNGFM
                     YLFSRVPNTPYLRPETFPELAILQKNWLVIREEGINLQRLEQIKAAEKYNDAGFNSFF
                     KTGWKRFYLKWYEDAHPSASQLCPKTTELLRGIPSVKAAMFATLPDGSRLPRHRDPYA
                     GSLRFHLGLATPNDDRCFIEVDGERYSWRDGEGVLFDETYIHYAENTSGENRLILFCD
                     IERPMRYRWAQKVNHWLGRNLMSAAAAPNDVGDRTGGINRSFRYIYQIRIIGKRLKKW
                     NKTVYYIVKWLLFGGIALLIWQAF"
     gene            288290..288469
                     /locus_tag="EAE_RS01430"
                     /old_locus_tag="EAE_01380"
                     /db_xref="GeneID:45318671"
     CDS             288290..288469
                     /locus_tag="EAE_RS01430"
                     /old_locus_tag="EAE_01380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015370085.1"
                     /db_xref="GeneID:45318671"
                     /translation="MFATGDLVQPRVGGPKLKVVEVNGDSLVVVQASNEQGEKFTLKA
                     VDVTPYTEEGDFGVC"
     gene            complement(288512..288931)
                     /gene="stpA"
                     /locus_tag="EAE_RS01435"
                     /old_locus_tag="EAE_01385"
                     /db_xref="GeneID:45318672"
     CDS             complement(288512..288931)
                     /gene="stpA"
                     /locus_tag="EAE_RS01435"
                     /old_locus_tag="EAE_01385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein StpA"
                     /protein_id="WP_026612230.1"
                     /db_xref="GeneID:45318672"
                     /translation="MGFLIFMSFMLQKLNNIRSLRAMAREFSTDVLEEMLEKLRIVTE
                     EKRAEQQKTQQQQAEYQEKINTWLELMVADGISPDELVLHEMAPAKSSKKRKPRPAKY
                     RYTDHTGAEKTWTGQGRMPKPIALAVAQGKSLESFLI"
     gene            289630..290079
                     /gene="alaE"
                     /locus_tag="EAE_RS01440"
                     /old_locus_tag="EAE_01390"
                     /db_xref="GeneID:45318673"
     CDS             289630..290079
                     /gene="alaE"
                     /locus_tag="EAE_RS01440"
                     /old_locus_tag="EAE_01390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-alanine exporter AlaE"
                     /protein_id="WP_015370082.1"
                     /db_xref="GeneID:45318673"
                     /translation="MFSAQSRLRHAVADTFAMVVYCTVVNMMIEIFLSGMTFEQSLSS
                     RLVAIPVNIIIAVPYGFYRDFAMRQARRISTSGWMKNIADVVAYVTFQSPVYVLILLS
                     VGADWHQIAAAVSSNILVSMMMGAVYGYFLDFCRRLFRVSPYQQAKA"
     gene            complement(290144..290506)
                     /locus_tag="EAE_RS01445"
                     /old_locus_tag="EAE_01395"
                     /db_xref="GeneID:45318674"
     CDS             complement(290144..290506)
                     /locus_tag="EAE_RS01445"
                     /old_locus_tag="EAE_01395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgaC family protein"
                     /protein_id="WP_015370081.1"
                     /db_xref="GeneID:45318674"
                     /translation="MYLRPDEVARVLEKAGFTMDVVTQKAYGYRRGDNYVYVNREARM
                     GRTALVIHPALKERSNSLAEPASEIKTCDHYEQFPLYLAGDAQQHYGIPHGFSSRMAL
                     ERFLNGLFGEAQPQMSHG"
     gene            290656..291003
                     /locus_tag="EAE_RS01450"
                     /old_locus_tag="EAE_01400"
                     /db_xref="GeneID:45318675"
     CDS             290656..291003
                     /locus_tag="EAE_RS01450"
                     /old_locus_tag="EAE_01400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF883 family protein"
                     /protein_id="WP_015370080.1"
                     /db_xref="GeneID:45318675"
                     /translation="MANRVNRNDIDESAEDIHNEVSQLADTLEEVLKSWGSDAKDEAE
                     NARKKAQSLLKETRARLNGNTRLRQAAYDTVERARDAAGCADSYVRDKPWQSVGAAAA
                     VGVFIGVLLNLRR"
     gene            complement(291080..292438)
                     /locus_tag="EAE_RS01455"
                     /old_locus_tag="EAE_01405"
                     /db_xref="GeneID:45318676"
     CDS             complement(291080..292438)
                     /locus_tag="EAE_RS01455"
                     /old_locus_tag="EAE_01405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004104761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_047079397.1"
                     /db_xref="GeneID:45318676"
                     /translation="MEAKKVPHYQRIARQLKSAIENGELAPGSRLPASRGYAQELGVS
                     RATIENAWGELVAQGWLERRGQAGTFVSERLSPRQVTAQRPTAGQGSSAPQPFQMGLP
                     ALDLFPRGVWARVMGRRLRTQSRFDLAPGDPCGEPVLRQAIVDYLRLSRSIECQPEQV
                     VISGNYAASMALILRTLAQPGQHMWMEDPGYPFIRPVVSAAGVNIDPVPIDQQGMDID
                     WAQAHFPQARFALLTPAHQSPLGVALSLERRRQVLQWAAQRDSWIIEDDYDSEFRYQG
                     KPLPPLKSLDAPQRVLYAGSFSKSMFPALRVAWLVVPLPLAARFRRQAELSHCNVPTL
                     WQQTLADFINEGHFWRHLKKMRASYVLRRQWLESALQAQGFQVVPQSGGIQLVMAVKG
                     DDREQARRCQRAGLAVQALSDWRMLSRGEGGLLMSFTNITSAVMAREVVGELKQALAS
                     VE"
     gene            292529..292960
                     /locus_tag="EAE_RS01460"
                     /old_locus_tag="EAE_01410"
                     /db_xref="GeneID:45318677"
     CDS             292529..292960
                     /locus_tag="EAE_RS01460"
                     /old_locus_tag="EAE_01410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxymuconolactone decarboxylase family
                     protein"
                     /protein_id="WP_015703232.1"
                     /db_xref="GeneID:45318677"
                     /translation="MTTLRQPYSELSPEIYKGLVQASIALEKSELGSTMVELVYLRVS
                     QINGCAFCLEMHSKALRKAGVAQDKLDALAGWRVSAHFSAAERAALAWAESVTDIAAS
                     HAEDEVYLPLEEHFTPRQISDLTFAISLMNAFNRLAVAMRM"
     gene            293144..293389
                     /gene="nrdH"
                     /locus_tag="EAE_RS01465"
                     /old_locus_tag="EAE_01415"
                     /db_xref="GeneID:45318678"
     CDS             293144..293389
                     /gene="nrdH"
                     /locus_tag="EAE_RS01465"
                     /old_locus_tag="EAE_01415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004104766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin-like protein NrdH"
                     /protein_id="WP_015703233.1"
                     /db_xref="GeneID:45318678"
                     /translation="MRIIIYTRNDCVQCHATKRAMESRGFAFDMVNIDQHPEAIDMLR
                     EQGFQQLPVVMAGETRWSGFRPDMINRLRPTAATASL"
     gene            293386..293796
                     /gene="nrdI"
                     /locus_tag="EAE_RS01470"
                     /old_locus_tag="EAE_01420"
                     /db_xref="GeneID:45318679"
     CDS             293386..293796
                     /gene="nrdI"
                     /locus_tag="EAE_RS01470"
                     /old_locus_tag="EAE_01420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class Ib ribonucleoside-diphosphate reductase
                     assembly flavoprotein NrdI"
                     /protein_id="WP_015370076.1"
                     /db_xref="GeneID:45318679"
                     /translation="MSLIVYFSSSSENTHRFVQRLALPAVRIPLNERERIQVDEPYIL
                     IVPSYGGGGTAGAVPRQAIRFLNDPHNRRLIRGVIAAGNRNFGEAYGRAGEVIAQKCG
                     VPYLYRFELMGTQQDVDNVRKGVSEFWQRQPQNV"
     gene            293769..295913
                     /gene="nrdE"
                     /locus_tag="EAE_RS01475"
                     /old_locus_tag="EAE_01425"
                     /db_xref="GeneID:45318680"
     CDS             293769..295913
                     /gene="nrdE"
                     /locus_tag="EAE_RS01475"
                     /old_locus_tag="EAE_01425"
                     /EC_number="1.17.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1b ribonucleoside-diphosphate reductase
                     subunit alpha"
                     /protein_id="WP_015703234.1"
                     /db_xref="GeneID:45318680"
                     /translation="MATTTAERVTAGASDFHALNAMLNLYDSNGRIPLEKDQQAVEAF
                     IHNHVRPNSVPFAGLEEKLQWLSDEGYYDPAVLARYERRFVLALFAHAHQHGFRFRTF
                     LGAWKFYTSYALRTFDGKRYLEHFADRACMVALTLAQGDETLARQLADEILAGRFQPA
                     TPTFLNAGKQQRGELVSCFLLRIEDNMESIGRAVNSALQLSKRGGGVAFLLSNLREAG
                     APIKRIENQSSGVVPVMKMLEDAFSYANQLGARQGAGAVYLHAHHPDILRFLDTKREN
                     ADEKIRIKTLSLGVVIPDITFQLAKEDAQMALFSPYDVERLYGKAFGDIAVSEMYAQL
                     VADDRVRKRWIRARDLFQRLAEIQFESGYPYIMFEDTVNRANPIAGRINMSNLCSEIL
                     QVNSASTFDENLDYATVGEDISCNLGSLNIAHAMDSPDFARTVEVAVRGLTAVSDMSD
                     IRSVPSVAAGNAASHAIGLGQMNLHGYLAREGIAYGSPEGLDFTNLYFYTVTWHALRT
                     SMAMARERGVRFAGFEQSRYASGDYFQQYLQGDWQPKTTTVRELFARAGITLPDREMW
                     RQLRDDVMRYGIYNRNLQAIPPTGSISYINHATSSIHPIVAKIEIRKEGKTGRVYYPA
                     PFMTNDNLALYQDAWEIGPQKIIDTYAEATRHVDQGLSLTLFFPDTATTRDINKAQIY
                     AWKKGIKTLYYIRLRQLALEGTEIEGCVSCAL"
     gene            295924..296886
                     /gene="nrdF"
                     /locus_tag="EAE_RS01480"
                     /old_locus_tag="EAE_01430"
                     /db_xref="GeneID:45318681"
     CDS             295924..296886
                     /gene="nrdF"
                     /locus_tag="EAE_RS01480"
                     /old_locus_tag="EAE_01430"
                     /EC_number="1.17.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class 1b ribonucleoside-diphosphate reductase
                     subunit beta"
                     /protein_id="WP_015703235.1"
                     /db_xref="GeneID:45318681"
                     /translation="MTHLSRISAINWNKIEDDKDLEVWNRLTSNFWLPEKVPLSNDIP
                     HWQTLTAQEQQLTIRVFTGLTLLDTIQNSVGAPALMTDALTPHEEAVLSNISFMEAVH
                     ARSYSSIFSTLCQSKDVDAAYAWSEENAPLQRKAQLMLNYYQADEPLKKKIASVFLES
                     FLFYSGFWLPMHFSSRGKLTNTADLIRLIIRDEAVHGYYIGYKYQKGLEIVSAAKREE
                     LKNFAFDLLMDLYDNELAYTRELYADSPWLDDVNAFLCYNANKALMNLGYEALFPAEM
                     AAVNPAILAALSPNADENHDFFSGSGSSYVMGKTEATADDDWDF"
     gene            297232..298434
                     /gene="proV"
                     /locus_tag="EAE_RS01485"
                     /old_locus_tag="EAE_01435"
                     /db_xref="GeneID:45318682"
     CDS             297232..298434
                     /gene="proV"
                     /locus_tag="EAE_RS01485"
                     /old_locus_tag="EAE_01435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine/L-proline ABC transporter
                     ATP-binding protein ProV"
                     /protein_id="WP_015370073.1"
                     /db_xref="GeneID:45318682"
                     /translation="MAIKLEIKNLYKIFGEHPQRAFKYIEKGLTKEQILEKTGLSLGV
                     KDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELRE
                     VRRKKIAMVFQSFALMPHMNVLNNTAFGMELAGVSAEERQQKALDALRQVGLENYAHA
                     YPDELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELTKLQAKHQRTI
                     VFISHDLDEAMRIGDRIAIMQNGEVVQIGTPDEILNNPANDYVRTFFRGVDISQVFSA
                     KDIARRSPVGLIRKTPGFGPRSALKLLQDEDREYGYVIERGNKFVGIVSIDSLKSALS
                     ENQGLDAALIDSPQAVEAQTPLSDLLSHVGQAPCAVPVVDEGHQYLGIISKRMLLQAL
                     DREGANNG"
     gene            298427..299491
                     /gene="proW"
                     /locus_tag="EAE_RS01490"
                     /old_locus_tag="EAE_01440"
                     /db_xref="GeneID:45318683"
     CDS             298427..299491
                     /gene="proW"
                     /locus_tag="EAE_RS01490"
                     /old_locus_tag="EAE_01440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine/L-proline ABC transporter
                     permease ProW"
                     /protein_id="WP_015370072.1"
                     /db_xref="GeneID:45318683"
                     /translation="MADQSNPWDTAAPADNAAQSADAWGNPTPAPADGGGADWLNSAP
                     APQPEHFNIMDPFHKTLIPLDSWVTHAIDWIVLHFRPLFQGIRVPVDYILSAFQQLLL
                     GMPAPVAIILFALIAWQISSVGMGIATLISLVAIGAIGAWSQAMVTLALVLTALLFCM
                     IIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFA
                     LPPIVRLTILGINQVPADLIEASRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLAL
                     SMVVIASMIAVGGLGQMVLRGIGRLDMGLASVGGVGIVILAIILDRLTQAVGRDSRSR
                     GNRRWYTTGPLGLITRPFCK"
     gene            299506..300501
                     /gene="proX"
                     /locus_tag="EAE_RS01495"
                     /old_locus_tag="EAE_01445"
                     /db_xref="GeneID:45318684"
     CDS             299506..300501
                     /gene="proX"
                     /locus_tag="EAE_RS01495"
                     /old_locus_tag="EAE_01445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine/L-proline ABC transporter
                     substrate-binding protein ProX"
                     /protein_id="WP_015370071.1"
                     /db_xref="GeneID:45318684"
                     /translation="MRHTTLLATAFTALVTTSAFAAELPGKGITVKPAQSTISEETFQ
                     TLLVSRALEKLGYNVEKPSEVDYNVAYTSIASGDATFIATNWQPLHDDMYAAAGGDKK
                     FYREGTFVTGAAQGYLIDKKTAEQYHIKSIDQLKDPKIAKLFDTNGDGKADLTGCTPG
                     WGCEAVINHQIDAYGLNNKVVHNQGNYAAMMADTIARYKEGKPILYYTWTPYWVSDVL
                     KPGKDVVWLQVPFSSLPGEQKDIDTKLPNGVNYGFPVNTMHIVANKAWAEKNPAAAKL
                     FSLMKLPIADINAENAMMHAGHASEADINGHVDGWIKAHQQLFDGWVKEALAAQK"
     gene            complement(300860..300976)
                     /locus_tag="EAE_RS01500"
                     /db_xref="GeneID:45318685"
     CDS             complement(300860..300976)
                     /locus_tag="EAE_RS01500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_161798745.1"
                     /db_xref="GeneID:45318685"
                     /translation="MLNGSKRTIHLGITSLITADIITIVTNKANELLVTINT"
     gene            300947..301477
                     /gene="mprA"
                     /locus_tag="EAE_RS01505"
                     /old_locus_tag="EAE_01450"
                     /db_xref="GeneID:45318686"
     CDS             300947..301477
                     /gene="mprA"
                     /locus_tag="EAE_RS01505"
                     /old_locus_tag="EAE_01450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor MprA"
                     /protein_id="WP_015370069.1"
                     /db_xref="GeneID:45318686"
                     /translation="MDSSFTPIEQMLKFRASRHEDFPFQEILLTRLCMHMQGKLLENR
                     NKMLKAQGINETLFMALITLESQENHSIQPSELSCALGSSRTNATRIADELEKRGWIE
                     RRESDNDRRCLHLQLTDKGHQFLREVLPPQHNCLHQLWSSLSTAEKDQLEHITRKLLG
                     RLDQMEEDGALAGSLR"
     gene            complement(301474..301632)
                     /locus_tag="EAE_RS01510"
                     /pseudo
                     /db_xref="GeneID:45318687"
     CDS             complement(301474..301632)
                     /locus_tag="EAE_RS01510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228388.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /db_xref="GeneID:45318687"
     gene            301609..302781
                     /gene="emrA"
                     /locus_tag="EAE_RS01515"
                     /old_locus_tag="EAE_01455"
                     /db_xref="GeneID:45318688"
     CDS             301609..302781
                     /gene="emrA"
                     /locus_tag="EAE_RS01515"
                     /old_locus_tag="EAE_01455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter periplasmic
                     adaptor subunit EmrA"
                     /protein_id="WP_015370068.1"
                     /db_xref="GeneID:45318688"
                     /translation="MSENAASQTPQQSGSKKGKRKGALLLLTLLFVIVAVAYGIYWFL
                     VLRHYEETDDAYVAGNQVQIMAQVSGSVTKVWADNTDFVQQGDPLVTLDQTDAQQAFE
                     KAKTQLAASVRQTRQQMINSKQLQANIDVKKTALAQAQADLNRRIPLGAANLIGREEL
                     QHARDTVASAQAELDVAIQQYNANQAIVLGTKLEQQPAVLQAATEVRNAWLALQRTQI
                     VSPISGYVSRRSVQPGAQIGTTTPLMAVVPATNLWVDANFKETQLAHMRIGQPATIVS
                     DIYGDDVKYTGKVVGLDMGTGSAFSLLPAQNATGNWIKVVQRLPVRIEIDAKQLAQHP
                     LRIGLSTLVEVDTSNREGEMLASQVRSSPVYESNAREIGLEPVNKLIDGIIQANAG"
     gene            302797..304335
                     /gene="emrB"
                     /locus_tag="EAE_RS01520"
                     /old_locus_tag="EAE_01460"
                     /db_xref="GeneID:45318689"
     CDS             302797..304335
                     /gene="emrB"
                     /locus_tag="EAE_RS01520"
                     /old_locus_tag="EAE_01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux MFS transporter permease
                     subunit EmrB"
                     /protein_id="WP_015703236.1"
                     /db_xref="GeneID:45318689"
                     /translation="MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNL
                     GSSLSQGTWVITSFGVANAISIPITGWLAKRVGEVKLFVWSTVAFAIASWACGVSNSL
                     TMLIFFRVIQGIVAGPLIPLSQSLLLSNYPPAKRSIALALWSMTVIVAPICGPILGGY
                     ISDNYHWGWIFFINVPIGVAVVLMTLQTLRGRETRTEQRRIDGVGLALLIIGIGSLQV
                     MLDRGKELDWFASNEIIILTIVAVVAISFLIVWELTDDNPIVDLSLFKSRNFTIGCLC
                     ISLAYMLYFGAIVLLPQLLQEVYGYTATWAGLASAPVGVIPVILSPIIGRFAHKLDMR
                     RLVTFSFIMYAVCFYWRAWTFEPGMDFGASAWPQFIQGFAVACFFMPLTTITLSGLPP
                     ERLAAASSLSNFTRTLAGSIGTSITTTMWTNREALHHAQLTESVTPFNPNAQQMYDQL
                     QGMGMTHQQASGWIAQQITNQGLIISANEIFWVSAGIFILLLGLVWFARPPFSAGGGG
                     GGAH"
     gene            304473..306131
                     /gene="leuA"
                     /locus_tag="EAE_RS01525"
                     /old_locus_tag="EAE_01465"
                     /db_xref="GeneID:45318690"
     CDS             304473..306131
                     /gene="leuA"
                     /locus_tag="EAE_RS01525"
                     /old_locus_tag="EAE_01465"
                     /EC_number="2.3.3.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-isopropylmalate synthase"
                     /protein_id="WP_015703237.1"
                     /db_xref="GeneID:45318690"
                     /translation="MLTNPCEKYSPYPPIALPDRRWPERQITTAPRWLSTDLRDGNQA
                     LAEPMDAARKLQFWDLLLECGFKEIEVAFPSASQTDFNFVRQLIEEQRIPEDVTIQVL
                     TQAREELIARTFEALRGARQATIHLYNATAPLFRELVFGMEKAEVIELATRATRLIRQ
                     HCEQQPDTRWQYEYSPETFCFTEPEFALEICEAVAEIWQPCGERPMIINLPATVEVNT
                     PNVYADRIEYFCRHFSRRQDVCISVHPHNDRGTGVASAELAVMAGADRVEGCLFGNGE
                     RTGNVCLVTLAMNLYSQGVDPQLRFTQMNRVVEIVENCNQLPVHPRHPWAGSLAYTAF
                     SGSHQDAIKKGFDARKPGDRWQMPYLPIDPQDIGCSYEAVIRVNSQSGKSGSAWLIEQ
                     NHGLKLPRALQQDFSQYVQQETDSHGKEMTHNALWQLFRSRYGLLAQPTLALLDYQSD
                     GQQDGELTLQAALRMNGETRRLNGRGNGLLSAAANGLSALLKRHFVIKDYHEHTLGAR
                     SDSRSVAYIRCVFANGESRWGVGIDNDVARASLQALCNAVHARD"
     gene            complement(306128..306895)
                     /locus_tag="EAE_RS01530"
                     /old_locus_tag="EAE_01470"
                     /db_xref="GeneID:45318691"
     CDS             complement(306128..306895)
                     /locus_tag="EAE_RS01530"
                     /old_locus_tag="EAE_01470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004853468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix transcriptional regulator"
                     /protein_id="WP_015370065.1"
                     /db_xref="GeneID:45318691"
                     /translation="MSTTLSFSFQHRALVPFAHDYAHGDSEPMHCHDCAQLLHILSGV
                     VRVETPVGFWVVPPGRGVWLPAHTPHALRITGNVAARTLFIDPLARADLPSTCQIVQI
                     SPLLRELIVASLALEERYFPGTRDERIYELMLDEIRGMSVLPFGLPEPHSDSLRRLCQ
                     RVREAPGEPWGSREAAQAGGMSERTLNRHFQQQTSLTWSEWVRRAKLMEALVRLAQGQ
                     SVLRVALDLGYGSHSAFSAMFRRVMGTAPSDYFRPLD"
     gene            complement(306944..307459)
                     /gene="luxS"
                     /locus_tag="EAE_RS01535"
                     /old_locus_tag="EAE_01475"
                     /db_xref="GeneID:45318692"
     CDS             complement(306944..307459)
                     /gene="luxS"
                     /locus_tag="EAE_RS01535"
                     /old_locus_tag="EAE_01475"
                     /EC_number="4.4.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008458247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteine lyase"
                     /protein_id="WP_015370064.1"
                     /db_xref="GeneID:45318692"
                     /translation="MPLLDSFTVDHTRMEAPAVRVAKKMNTPHGDQITVFDLRFCVPN
                     QEVMPERGIHTLEHLFAGFMRDHLNGNGVEIIDISPMGCRTGFYMSLIGTPEEQRVAD
                     AWKAAMADVLKVKDQNQIPELNVYQCGTYTMHSLEEAQDIARHIIERDVRINSNDELA
                     LPKEKLQELHI"
     gene            complement(307623..309179)
                     /gene="gshA"
                     /locus_tag="EAE_RS01540"
                     /old_locus_tag="EAE_01480"
                     /db_xref="GeneID:45318693"
     CDS             complement(307623..309179)
                     /gene="gshA"
                     /locus_tag="EAE_RS01540"
                     /old_locus_tag="EAE_01480"
                     /EC_number="6.3.2.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_015370063.1"
                     /db_xref="GeneID:45318693"
                     /translation="MIPDVSQALAWLEKNPQALQGIKRGLERETLRVNADGTLATTGH
                     PLALGSALTHKWITTDFAEALLEFITPVDGDVDHMLTFLRDVHRFTARQLGDERMWPL
                     SMPCYIAPGQDIELAQYGTSNVGRLKTLYREGLKNRYGALMQTISGVHYNFSLPMAFW
                     QAKCGVEDAESGKEAISAGYFRSIRNYYRFGWVIPYLFGASPAICSSFLQGKPTTLPF
                     EKAGNGMYYLPYATSLRLSDLGYTNKSQSNLGITFNDLHEYVAGLKRAIKTPSEEYAK
                     IGLEKDGKHLQINSNILQIENELYAPIRPKRVTRSGETPSDALLRGGIEYIEVRSLDI
                     NPFSPIGVDEQQVRFLDLFMVWCVLADAPEMSSSELLCTRTNWNRVILEGRKPGLTLG
                     IGCESAQFPLAQVGKDLFRDLRRVAQTLDSIHGGEAYQQVCDELLACFDDPELTFSAR
                     ILRSMIEEGIGGTGRKLADEYRTMLRDEPLEILSEEDFIAERDASVARQKKVEAEDSE
                     PFEALLARHA"
     gene            complement(309246..309674)
                     /locus_tag="EAE_RS01545"
                     /old_locus_tag="EAE_01485"
                     /db_xref="GeneID:45318694"
     CDS             complement(309246..309674)
                     /locus_tag="EAE_RS01545"
                     /old_locus_tag="EAE_01485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DedA family protein"
                     /protein_id="WP_015370062.1"
                     /db_xref="GeneID:45318694"
                     /translation="MSDALSLLSLFASSFLSATLLPGNSEVVLVAMLLTGASQPWMLV
                     LIATIGNSLGGVTNVILGRLFPLRKQSRWQERATGWLKRYGAVTLLLSWAPVIGDLLC
                     LLAGWMRISWGPVLFFLCLGKALRYIVIAAATLQGMTWWH"
     gene            complement(309671..310237)
                     /gene="yqaB"
                     /locus_tag="EAE_RS01550"
                     /old_locus_tag="EAE_01490"
                     /db_xref="GeneID:45318695"
     CDS             complement(309671..310237)
                     /gene="yqaB"
                     /locus_tag="EAE_RS01550"
                     /old_locus_tag="EAE_01490"
                     /EC_number="3.1.3.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1-phosphate/6-phosphogluconate
                     phosphatase"
                     /protein_id="WP_015703238.1"
                     /db_xref="GeneID:45318695"
                     /translation="MYQRYAGLIFDMDGTILDTEPTHRKAWREVLGRYGMRFDEKAVV
                     ALNGSPTWRIAQAIIELNQADLDPHRLAQEKTVAVKAMLLDSVRPLPLIEVVKEWHGR
                     RPMSVGTGSESAVAEALLAHLGLRHYFSAVVAADHVAQHKPAPDTFLLCAERMGVAPE
                     TCVVFEDADFGLEAAKLAGMDAVDVRLL"
     gene            complement(310364..310678)
                     /locus_tag="EAE_RS01555"
                     /old_locus_tag="EAE_01495"
                     /db_xref="GeneID:45318696"
     CDS             complement(310364..310678)
                     /locus_tag="EAE_RS01555"
                     /old_locus_tag="EAE_01495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BON domain-containing protein"
                     /protein_id="WP_015370060.1"
                     /db_xref="GeneID:45318696"
                     /translation="MKWFKAIPAFCATLLVAVSLAGCAGSSTKESTGGYIDDTVVTTK
                     VKSALFNEKDIKSSEISVQTFKGRVQLSGFVSSAESAKRAVEVTRRVQGVRVVENDLR
                     IK"
     gene            complement(310974..311050)
                     /locus_tag="EAE_RS01560"
                     /old_locus_tag="EAE_t24816"
                     /db_xref="GeneID:45318697"
     tRNA            complement(310974..311050)
                     /locus_tag="EAE_RS01560"
                     /old_locus_tag="EAE_t24816"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(311014..311016),aa:Arg,seq:acg)
                     /db_xref="GeneID:45318697"
     gene            complement(311229..311305)
                     /locus_tag="EAE_RS01565"
                     /old_locus_tag="EAE_t24818"
                     /db_xref="GeneID:45318698"
     tRNA            complement(311229..311305)
                     /locus_tag="EAE_RS01565"
                     /old_locus_tag="EAE_t24818"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(311269..311271),aa:Arg,seq:acg)
                     /db_xref="GeneID:45318698"
     gene            complement(311495..311571)
                     /locus_tag="EAE_RS01570"
                     /old_locus_tag="EAE_t24820"
                     /db_xref="GeneID:45318699"
     tRNA            complement(311495..311571)
                     /locus_tag="EAE_RS01570"
                     /old_locus_tag="EAE_t24820"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(311535..311537),aa:Arg,seq:acg)
                     /db_xref="GeneID:45318699"
     gene            complement(311722..311798)
                     /locus_tag="EAE_RS01575"
                     /old_locus_tag="EAE_t24822"
                     /db_xref="GeneID:45318700"
     tRNA            complement(311722..311798)
                     /locus_tag="EAE_RS01575"
                     /old_locus_tag="EAE_t24822"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(311762..311764),aa:Arg,seq:acg)
                     /db_xref="GeneID:45318700"
     gene            complement(311803..311895)
                     /locus_tag="EAE_RS01580"
                     /old_locus_tag="EAE_t24824"
                     /db_xref="GeneID:45318701"
     tRNA            complement(311803..311895)
                     /locus_tag="EAE_RS01580"
                     /old_locus_tag="EAE_t24824"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(311859..311861),aa:Ser,seq:gct)
                     /db_xref="GeneID:45318701"
     gene            complement(312233..312418)
                     /gene="csrA"
                     /locus_tag="EAE_RS01585"
                     /old_locus_tag="EAE_01505"
                     /db_xref="GeneID:45318702"
     CDS             complement(312233..312418)
                     /gene="csrA"
                     /locus_tag="EAE_RS01585"
                     /old_locus_tag="EAE_01505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001774971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator CsrA"
                     /protein_id="WP_000906486.1"
                     /db_xref="GeneID:45318702"
                     /translation="MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHR
                     EEIYQRIQAEKSQQSSY"
     gene            complement(312782..315409)
                     /gene="alaS"
                     /locus_tag="EAE_RS01590"
                     /old_locus_tag="EAE_01510"
                     /db_xref="GeneID:45318703"
     CDS             complement(312782..315409)
                     /gene="alaS"
                     /locus_tag="EAE_RS01590"
                     /old_locus_tag="EAE_01510"
                     /EC_number="6.1.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine--tRNA ligase"
                     /protein_id="WP_015703239.1"
                     /db_xref="GeneID:45318703"
                     /translation="MSKSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGM
                     NQFKDVFLGLDKRNYSRATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDY
                     FKQDAIKYAWELLTGENWFALPKEKLWVTVYETDDEAFDIWANEVGVPRERIIRIGDN
                     KGAPFASDNFWQMGDTGPCGPCTEIFFDHGDHIWGGPPGSPEEDGDRYIEIWNIVFMQ
                     FNRQADGTMEPLPKPSVDTGMGLERIAAVLQHVNSNYDIDLFRNLIASVAKVTGATDL
                     TNKSLRVIADHIRSCAFLIADGVIPSNENRGYVLRRIIRRAIRHGNMLGAKDTFFWKL
                     VAPLIDVMGAAGEELKQQQALVEQVLKTEEEQFARTLERGLALLDEELSKLKGDTLDG
                     ETAFRLYDTYGFPVDLTADVCRERNIKVDEAGFEAAMEEQRRRARESSGFGADYNAMI
                     RVDGASEFKGYDHLELNGKVTALFIDGKAVDSVSAGQDAVVVLDQTPFYAESGGQVGD
                     KGELKGAGFSFAVSDTQKYGQAIGHIGKVASGSLKVGDAVQADVDQARRQRIRLNHSA
                     THLMHAALRQVLGTHVAQKGSLVNDKALRFDFSHFEAMKPEEIRAVEDLVNAQIRRNL
                     AIETNIMDIDAARESGAMALFGEKYDDRVRVLRMGDFSTELCGGTHAARTGDIGLFRI
                     TSESGTAAGVRRIEAVTGEGAIASLHAQSDQLSDIAQLLKGDSHSIGDKVRAALERTR
                     QLEKELQQLKEQAAAQESANLSSKAEEINGVKLLVSELAGVEPKMLRTMVDDLKNQLG
                     STVVVLATVADGKVSLIAGVSKDVTDRVKAGELVGMVAQQVGGKGGGRPDMAQAGGTD
                     ASALPAALASVKGWVSAKL"
     gene            complement(315661..316161)
                     /gene="recX"
                     /locus_tag="EAE_RS01595"
                     /old_locus_tag="EAE_01515"
                     /db_xref="GeneID:45318704"
     CDS             complement(315661..316161)
                     /gene="recX"
                     /locus_tag="EAE_RS01595"
                     /old_locus_tag="EAE_01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombination regulator RecX"
                     /protein_id="WP_015703240.1"
                     /db_xref="GeneID:45318704"
                     /translation="MTETSPRRSGYARLLDRAIRILAMRDHSEQELRRKLAAPVMSKN
                     GPEKLDITSEELEQVVGWCLENRYLDDQRFVRQFIASRSRKGYGPARIRQELNQKGIG
                     RSDIESAMRECEIDWAALAKEQAQRKYGEPLPTTFTEKVKIQRFLLYRGYLMEDIQEI
                     WRNFAD"
     gene            complement(316232..317290)
                     /gene="recA"
                     /locus_tag="EAE_RS01600"
                     /old_locus_tag="EAE_01520"
                     /db_xref="GeneID:45318705"
     CDS             complement(316232..317290)
                     /gene="recA"
                     /locus_tag="EAE_RS01600"
                     /old_locus_tag="EAE_01520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_015370055.1"
                     /db_xref="GeneID:45318705"
                     /translation="MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTG
                     SLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDP
                     VYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEI
                     GDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKF
                     YASVRLDIRRIGAVKEGDNVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFFGELV
                     DLGVKEKLIEKAGAWYSYNGDKIGQGKANAISWLKDNPAAAKEIEKKVRELLLNNQDS
                     TPDFAVDGNDAEETEQDF"
     gene            complement(317380..317877)
                     /gene="pncC"
                     /locus_tag="EAE_RS01605"
                     /old_locus_tag="EAE_01525"
                     /db_xref="GeneID:45318706"
     CDS             complement(317380..317877)
                     /gene="pncC"
                     /locus_tag="EAE_RS01605"
                     /old_locus_tag="EAE_01525"
                     /EC_number="3.5.1.42"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinamide-nucleotide amidase"
                     /protein_id="WP_015703241.1"
                     /db_xref="GeneID:45318706"
                     /translation="MTDSELMQLSEQVGLALKAQGATVTTAESCTGGWIAKALTDIAG
                     SSAWFERGFVTYSNEAKSQMIGVSEVTLLDNGAVSEPVVVEMAIGALRAARATYAVSV
                     SGIAGPDGGSAEKPVGTVWFGVACANEQGVTRRECFAGDREAVRRQATAYALNLLWQQ
                     FLQNT"
     gene            complement(318016..318894)
                     /locus_tag="EAE_RS01610"
                     /old_locus_tag="EAE_01530"
                     /db_xref="GeneID:45318707"
     CDS             complement(318016..318894)
                     /locus_tag="EAE_RS01610"
                     /old_locus_tag="EAE_01530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter substrate-binding protein"
                     /protein_id="WP_015703242.1"
                     /db_xref="GeneID:45318707"
                     /translation="MKRSAVVMALAVGLMAQGAIAKTLNVVSSFSVLGDMVQQVGGEH
                     VHVDTLVGPDGDPHTFEPSPKDSALLSKADVVVVNGLGLEGWLDRLVKASGFKGELVV
                     ASKGVKTHTLDEDGKTVTDPHAWNSAANGALYAQNILDGLVKADPQDKAALQSRGKRY
                     IEQLTAIDGWAKAQFSAIPQVKRKVLTSHDAFGYFGRAYHVTFLAPQGLSSESEASAA
                     QVAALIKQIKADGVHTWFMENQLDPRLVQQIAGATGAQPGGELYPEALSKPGGVADSY
                     VKMLRHNVELIVNSMK"
     gene            complement(318902..319765)
                     /locus_tag="EAE_RS01615"
                     /old_locus_tag="EAE_01535"
                     /db_xref="GeneID:45318708"
     CDS             complement(318902..319765)
                     /locus_tag="EAE_RS01615"
                     /old_locus_tag="EAE_01535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_015370052.1"
                     /db_xref="GeneID:45318708"
                     /translation="MIWHTFFQPFIEFGFMRRALVVCFALSLSTTMLGVLLLLRRMSL
                     MGDALSHAILPGVAAGYLLNGMSLLAMSVGGFIAGIAVALVAGWVSRRTPLKEDASFA
                     GFYLGSLALGVTLVSLRGSSVDLLHLLFGSILAVDSDAAFFVTGVASLTLLCIALFYR
                     GLVSEAFDSAWLQVNARRLPALLHGLFLALLVLNLVAGFQVLGTLMAVGLMMLPAVAA
                     RCWARTLPGILLLAAAIGAFCAWMGLSLSWAVNLPAGPAIVLTASVLFFISVFFGTRS
                     RLVVGWRKLMG"
     gene            complement(319762..320472)
                     /locus_tag="EAE_RS01620"
                     /old_locus_tag="EAE_01540"
                     /db_xref="GeneID:45318709"
     CDS             complement(319762..320472)
                     /locus_tag="EAE_RS01620"
                     /old_locus_tag="EAE_01540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding cassette domain-containing protein"
                     /protein_id="WP_072033712.1"
                     /db_xref="GeneID:45318709"
                     /translation="MAGHMVGGGAAMIELDHLVAGYEGMAITPAMSGVIAAGSLTAIV
                     GLNGCGKSTLLKTLAGFIPPVSGRLNWRKGRPVVGWLAQRHALESQFPLLVRDVVSQG
                     AWPRVSLLRGLGGDERRRIAAALERVGISALTNTPIEELSGGQFQRMLFARVMVQQAP
                     LVMLDEPFTGVDEATSRELMALIVDMHRQGQTILAVLHDNQCVADFFPETLLLEPQHA
                     RWGETSSVLPAFNTARQA"
     gene            complement(320778..321857)
                     /gene="mltB"
                     /locus_tag="EAE_RS01625"
                     /old_locus_tag="EAE_01550"
                     /db_xref="GeneID:45318710"
     CDS             complement(320778..321857)
                     /gene="mltB"
                     /locus_tag="EAE_RS01625"
                     /old_locus_tag="EAE_01550"
                     /EC_number="4.2.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic murein transglycosylase B"
                     /protein_id="WP_020078114.1"
                     /db_xref="GeneID:45318710"
                     /translation="MLKRRYLALLPLCALLAACSSKPKTPAEAEMASGTGGFLLEPQH
                     NVMQMGGDFANNPAAAQFIDKMVAKHGFDRQQLQEILSQAKRLDYVLRLMDRQAPSGL
                     PPTGPNGAWLRYKKQFITPDNVQNGVVFWNQYQDALNRAYQVYGVPPEIIVGIIGVET
                     RWGRVMGKTRILDALATLSFNYPRRAEYFSSELETFLLMARSESDDPLDLKGSFAGAM
                     GYGQFMPSSYKQYAVDFNGDGHINLWDPVDAIGSVANYFKQHGWVSGDTVAVQALGQA
                     PGLDNGFKTKYSVSQLSAAGLTPTQPLGNHQQASLLRLDIGTGYQYWYGLPNFYTITR
                     YNHSTHYAMAVWQLGLAVSQARGGY"
     gene            322134..322697
                     /gene="srlA"
                     /locus_tag="EAE_RS01630"
                     /old_locus_tag="EAE_01555"
                     /db_xref="GeneID:45318711"
     CDS             322134..322697
                     /gene="srlA"
                     /locus_tag="EAE_RS01630"
                     /old_locus_tag="EAE_01555"
                     /EC_number="2.7.1.69"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228408.1"
                     /note="catalyzes the phosphorylation of incoming sugar
                     substrates along with their translocation across the cell
                     membrane; the IIC domain forms the PTS system
                     translocation channel and contains the specific
                     substrate-binding site; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sorbitol transporter subunit IIC"
                     /protein_id="WP_015370048.1"
                     /db_xref="GeneID:45318711"
                     /translation="MIEIVTHGAEWFIGLFQKGGEVFTGMVTGILPLLISLLVIMNAL
                     INFIGQQRIEKLAQRCAGNPLTRYLLLPCIGTFVFCNPMTLSLGRFMPEKYKPSYYAA
                     ASYSCHSMNGLFPHINPGELFVYLGIANGLTTLGLPLGPLAVSYLLVGLVTNFFRGWV
                     TDLTTSIFERKMAIQLDQKVRLSGATS"
     gene            322694..323665
                     /locus_tag="EAE_RS01635"
                     /old_locus_tag="EAE_01560"
                     /db_xref="GeneID:45318712"
     CDS             322694..323665
                     /locus_tag="EAE_RS01635"
                     /old_locus_tag="EAE_01560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucitol/sorbitol transporter subunit IIB"
                     /protein_id="WP_015703246.1"
                     /db_xref="GeneID:45318712"
                     /translation="MTRIRIEKGIGGWGGPLELDVVEGKKIVYITAGTRPAIVDTLAS
                     LTGWQAVDGFKEGEPAESEIGIAIIDCGGTLRCGLYPKRRIPTINIHATGKSGPLAQY
                     IVEDIYVSGVKEENIKLLEDSGETAVQPLPAAGRDYDASKKITEQSDGLLAKVGMGMG
                     SVVAVLFQAGRDTIDTVLKTILPFMAFVSALIGIIMASGIGDWIAHGLAPLASHPLGL
                     VTLALICSFPLLSPFLGPGAVIAQVIGVLIGVQIGLGNIPPHLALPALFAINAQAACD
                     FIPVGLSLAEARQDTVRVGVPSVLVSRFLTGAPTVLIAWFVSGFIYQ"
     gene            323679..324041
                     /gene="srlB"
                     /locus_tag="EAE_RS01640"
                     /old_locus_tag="EAE_01565"
                     /gene_synonym="gutB"
                     /db_xref="GeneID:45318713"
     CDS             323679..324041
                     /gene="srlB"
                     /locus_tag="EAE_RS01640"
                     /old_locus_tag="EAE_01565"
                     /gene_synonym="gutB"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucitol/sorbitol transporter subunit IIA"
                     /protein_id="WP_015703247.1"
                     /db_xref="GeneID:45318713"
                     /translation="MTVIYHTTITRIGASAATALEEQMLITFREGAPADIEEYCFIHN
                     HGELCGELRPGAELQLGDRHYPVTAVGEVAEQNLRELGHITLRFDGHRQAEFPGTVHV
                     AGPVPDAIATGCVLKFVA"
     gene            324054..324833
                     /gene="srlD"
                     /locus_tag="EAE_RS01645"
                     /old_locus_tag="EAE_01570"
                     /db_xref="GeneID:45318714"
     CDS             324054..324833
                     /gene="srlD"
                     /locus_tag="EAE_RS01645"
                     /old_locus_tag="EAE_01570"
                     /EC_number="1.1.1.140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sorbitol-6-phosphate dehydrogenase"
                     /protein_id="WP_008806161.1"
                     /db_xref="GeneID:45318714"
                     /translation="MNQVAVVIGGGQTLGEFLCRGLAAEGYRVAVVDIQSEKASRVAQ
                     EINAEYGEGTAYGFGADATSEASVTALAHGVDEIFTRVDLLVYSAGIAKAAFISDFAL
                     GDFDRSLQVNLVGYFLCAREFSRLMIRDGIKGRIIQINSKSGKVGSKHNSGYSAAKFG
                     GVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLLPQYATKLGIDESEVEQYYIDK
                     VPLKRGCDYQDVLNVLMFYASPQASYCTGQSINVTGGQVMF"
     gene            324958..325317
                     /gene="gutM"
                     /locus_tag="EAE_RS01650"
                     /old_locus_tag="EAE_01575"
                     /db_xref="GeneID:45318715"
     CDS             324958..325317
                     /gene="gutM"
                     /locus_tag="EAE_RS01650"
                     /old_locus_tag="EAE_01575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008806162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator GutM"
                     /protein_id="WP_015703248.1"
                     /db_xref="GeneID:45318715"
                     /translation="MVTALITVAAIAWLCQLAFGGWQIRRFNRAFDSLCQQGRVGVGR
                     SSGRFKPRAIVAIAVDENDRICDTLLMKGLTVFASPQKIPTLSGKHLEELQPDVIFPN
                     DPLCQNALSLALNPKHA"
     gene            325385..326158
                     /locus_tag="EAE_RS01655"
                     /old_locus_tag="EAE_01580"
                     /db_xref="GeneID:45318716"
     CDS             325385..326158
                     /locus_tag="EAE_RS01655"
                     /old_locus_tag="EAE_01580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional repressor"
                     /protein_id="WP_015703249.1"
                     /db_xref="GeneID:45318716"
                     /translation="MKPRQRQAAILEHLQSQGKCSVEELAQHFDTTGTTIRKDLVILE
                     NAGTVIRTYGGVVLNKDEADPPIDHKTLINTHKKAQIAEAAVRYIHDGDSLILDAGST
                     VLQMVPLLSRFNNITVMTNSLHIVNALSELDNEQTILMPGGTFRKKSASFHGQLAENA
                     FEQFSFDKLFMGTDGIDLVAGVTTFNEVYTVSKAMCNAAREVILMADSSKFGRKSPNI
                     VCGLERVDKLITDADIDPEFQRALEAKGIEVIITGEHHE"
     gene            326151..327116
                     /gene="gutQ"
                     /locus_tag="EAE_RS01660"
                     /old_locus_tag="EAE_01585"
                     /db_xref="GeneID:45318717"
     CDS             326151..327116
                     /gene="gutQ"
                     /locus_tag="EAE_RS01660"
                     /old_locus_tag="EAE_01585"
                     /EC_number="5.3.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arabinose-5-phosphate isomerase GutQ"
                     /protein_id="WP_015703250.1"
                     /db_xref="GeneID:45318717"
                     /translation="MSNFLLEAGRQTLMLELQEASRLPERLGDDFIRAAETIIHCEGK
                     LIVSGIGKSGHIGKKLAATFASTGTPAFFVHPAEALHGDLGMLDSRDVMLFISYSGSA
                     KELDLIVPRLEEKSIPLLAMTGKSTSPLALAAKAVLDIAVEREACPMHLAPTSSTVNT
                     LMLGDALAMAVMQARGFNEEDFARSHPAGALGARLLNKVHHLMRRDEEVPRVNAEANV
                     MDAMLELSRTGLGLVAVCDETNRVQGVFTDGDLRRWLVAGGTLNDSVTRAMTRNGVTL
                     QAESRAVEAKERLMKHKISAAPVVDENGQLVGAINLQNFYQSGIL"
     gene            complement(327079..328629)
                     /gene="norR"
                     /locus_tag="EAE_RS01665"
                     /old_locus_tag="EAE_01590"
                     /db_xref="GeneID:45318718"
     CDS             complement(327079..328629)
                     /gene="norR"
                     /locus_tag="EAE_RS01665"
                     /old_locus_tag="EAE_01590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitric oxide reductase transcriptional regulator
                     NorR"
                     /protein_id="WP_015703251.1"
                     /db_xref="GeneID:45318718"
                     /translation="MSFSVDELARIAIDLQSDIGHADRFSRLITTLRQILGCDASALL
                     RYEAHQFVPLAIDGLAQDVLGRRFALDGHPRLEAIARAGDVVRFPADSDLPDPYDGLI
                     PGHESLKVHACVGLPLFAGQTLIGALTLDGMDADRFDSFSDEELRLIAALVAGALNNA
                     LLIARLEAQNVLPVQPVNDAQPERQEIIGLSAPMLQLKKEIDIVAASDLNVLISGETG
                     TGKELVAKAVHQGSPRAANPLVYLNCAALPESVAESELFGHVKGAFTGAISNRSGKFE
                     MADNGTLFLDEIGELSLALQAKLLRVLQYGDIQRVGDDRSLRVDVRVLAATNRDLRQE
                     VVEGRFRADLYHRLSVFPLSVPALRERENDVVLLAGYFCEQCRLRMGLARVILAEAAR
                     NRLQQWSWPGNVRELEHAIHRAVVLARATQAGDEVVLEPQHFQFAVTAPMLPTETAAA
                     APATENVNLREATDSFQREAISRALEANQRNWAATARALELDVANLHRLAKRLGLKGS
                     LTGKSSAG"
     gene            328817..330259
                     /gene="norV"
                     /locus_tag="EAE_RS01670"
                     /old_locus_tag="EAE_01595"
                     /db_xref="GeneID:45318719"
     CDS             328817..330259
                     /gene="norV"
                     /locus_tag="EAE_RS01670"
                     /old_locus_tag="EAE_01595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic nitric oxide reductase
                     flavorubredoxin"
                     /protein_id="WP_015703252.1"
                     /db_xref="GeneID:45318719"
                     /translation="MSIAVKNNILWVGQRDWEVRDFHGTEYKTLRGSSYNSYLIREEK
                     NVLIDTVDHKFSREFVQNLRSEIDLADLDYIVINHAEEDHAGALTELMMQIPDTPIYC
                     TANAIDSINGHHHHPEWNFHVVKTGDTLDIGNGKQLIFVETPMLHWPDSMMTYLTGDA
                     VLFSNDAFGQHYCDEHLFNDEVDQIELYEQCQRYYANILTPFSRLVTPKITEILGFNL
                     PVDMIATSHGVVWRDNPTQIVEKYLEWAADYQEDRITIFYDTMSNNTRMMADAIAQGI
                     TEVDPRVAVKIFNVARSDKNDILTNVFRSKGVLVGTSTMNNVMMPKIAGLVEEMTGLR
                     FRNKRASAFGSHGWSGGAVDRLSTRLQDAGFEMSLSLKAKWRPDIDALELCRQHGRDI
                     ARQWALSPLPVAEAATTPEPQDCACAAAADLGPMMQCSVCQWVYDPAKGEPNQDVQPG
                     TPWSEVPDNFLCPECSLGKDVFDVLATEAK"
     gene            330256..331389
                     /gene="norW"
                     /locus_tag="EAE_RS01675"
                     /old_locus_tag="EAE_01600"
                     /db_xref="GeneID:45318720"
     CDS             330256..331389
                     /gene="norW"
                     /locus_tag="EAE_RS01675"
                     /old_locus_tag="EAE_01600"
                     /EC_number="1.18.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004866860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavorubredoxin reductase NorW"
                     /protein_id="WP_015703253.1"
                     /db_xref="GeneID:45318720"
                     /translation="MSDGIVIIGSGFAARQLVKNIRKQDTQIPLTLIAADSMDEYNKP
                     DLSHVISRGQKADDLTLQSAGEFAEQYNLRLFPHTWVSDIDAKNRLVKSQDNQWRYDK
                     LVLATGATPFIPPVPGRELMLTLNSQREYGAAQSQLHDAKRVLIVGGGLIGCELAMDF
                     CRAGKAVTVVDNSASVLAALMPPEASSRLQHRLTEMGVHLMLKAQLEGLEQTADGIRV
                     SLDRQRAITVDAVVAAAGLRPETSLARHAGLQINRGVVVNSHLQTSDPAIYALGDCAE
                     INGTVLPFLQPILLSAMCLSKNLLAQTGELTLPPMLVKVKTPDLPLHLAGDTRRDDLT
                     WNIVAAKEGLVAKGVDAENQLRAFVVSEDKMKEAFALLKHLVR"
     gene            complement(331486..332499)
                     /locus_tag="EAE_RS01680"
                     /old_locus_tag="EAE_01605"
                     /db_xref="GeneID:45318721"
     CDS             complement(331486..332499)
                     /locus_tag="EAE_RS01680"
                     /old_locus_tag="EAE_01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HoxN/HupN/NixA family nickel/cobalt transporter"
                     /protein_id="WP_015703254.1"
                     /db_xref="GeneID:45318721"
                     /translation="MITMILRQQPRAAALVLGLIAANALAWLWAFQAFGDSGALMAAS
                     LLAWGYGLRHAVDADHIAAIDNVTRKMMQQGRRPFGVGAWFSLGHSSIVVLASAAIAA
                     TATAFSQQMSWLHETGSVIGTAVSALFLLAMALVNLVILRSVWRSFQAWKRGEKVSDE
                     IVSGGGMMSWLFGKTFRLISRSWQMYLVGFLFGLGFDTATEIGVLGISAAGASSGISI
                     WSIMVFPALFASGMALVDTLDNVLMVGAYGWAFSKPQRKLYYNMTITATSVVVALFIG
                     GLEALGLLMDKFALSGGVWRWVGALNDNLGDAGFVVVGLFVVCWALSVINYRWRGYDN
                     LAR"
     gene            complement(332501..334729)
                     /gene="hypF"
                     /locus_tag="EAE_RS01685"
                     /old_locus_tag="EAE_01610"
                     /db_xref="GeneID:45318722"
     CDS             complement(332501..334729)
                     /gene="hypF"
                     /locus_tag="EAE_RS01685"
                     /old_locus_tag="EAE_01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyltransferase HypF"
                     /protein_id="WP_015703255.1"
                     /db_xref="GeneID:45318722"
                     /translation="MNGVQIRIRGKVQGVGFRPFVWQLARQMARGGDVCNDGDGVLVR
                     LTGDDGGFSAALARHCPPLARIDSTDCTPFHWHRLPQDFTIRHSDGGSMRTQIVPDAA
                     TCPACLAEMNDPQERRYRYPFINCTHCGPRFTIIRAMPYDRPFTAMAPFPLCPRCAAE
                     YRQPADRRFHAQPVACADCGPQLEWRAGTLTLFAEAALQAAIARLAAGDIVAIKGIGG
                     FHLACDAGNSEAVAALRARKRRPAKPLAVMLPTATGLPAAAATLLRSPAAPIVLLAKA
                     QVPGLCDEIASGLAEVGVMLPSNPLQHLLLQALARPIVMTSGNLSGRPPALSNHEALT
                     DLAAIADGFLLHNRDIVQRMDDSLVRSSGEMLRRARGYVPDALPLPPGLDNIPPLLAL
                     GADMKNTFCLARGDEAVLSQHFGDLGEEGVEQQWRSALRLMQSIYAFAPQRVAVDAHP
                     GYRSTRWAASMSLPVEPVLHHHAHAAACLAEHRWPLDGGDVIALTLDGIGMGENGALW
                     GGECLRVNYRECEHLGGLPAVALPGGDLAARQPWRNLLAQCLAFIPDWQSYPQTAALG
                     QRNWPLLAQAIERGINSPRASSCGRLFDAVACALDCAPETLSYEGEAACRLEALAASC
                     PGVSHPITLPWRGGELDLATFWRQWLRWQATPAQKAWAFHDALACGLAALARDRAASC
                     GIATIVCSGGVLHNQLLAARLSDYLSDFTLLLPQQLPAGDGAIAYGQAVVAAARWQSQ
                     RI"
     gene            complement(334738..335265)
                     /gene="hydN"
                     /locus_tag="EAE_RS01690"
                     /old_locus_tag="EAE_01615"
                     /db_xref="GeneID:45318723"
     CDS             complement(334738..335265)
                     /gene="hydN"
                     /locus_tag="EAE_RS01690"
                     /old_locus_tag="EAE_01615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transport protein HydN"
                     /protein_id="WP_015370036.1"
                     /db_xref="GeneID:45318723"
                     /translation="MNRFIIADASKCIGCRTCEVACVVSHQENQDCAALTPQSFLPRI
                     HVIKGVNVSTATACRQCEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYG
                     AMEVVVRPVVRHSGAGLNVMAEKAEANKCDLCHQRDSGPACIEACPTHALVCVDRNKL
                     EQMNLEKRRRTALAW"
     gene            complement(335400..336413)
                     /locus_tag="EAE_RS01695"
                     /old_locus_tag="EAE_01620"
                     /db_xref="GeneID:45318724"
     CDS             complement(335400..336413)
                     /locus_tag="EAE_RS01695"
                     /old_locus_tag="EAE_01620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_015703256.1"
                     /db_xref="GeneID:45318724"
                     /translation="MATMLEVAKRAGVSKATVSRVLSGNGYVSQETKDRVFQAIAESG
                     YRPNLLARNLATKKSQTIGLVVTNTLYHGVYFSELLFHVARLTEDQGRQLILADGKHS
                     AQEEREAIQYLLDMRCDAIIIYPRFLSVDEMDEIIDNHEQPIVVLNRRLRRHASHCVW
                     SDHKASARMAVEKLITSGHRDIAFITGSLDSPTGVERLSGYKDALAGLGLPVRQELIV
                     EGRWTPQTGAAAVEALCQRGVSFSALVASNDDMAIGAIKQLHQQGIAVPQQVSVIGFD
                     DIALAPYVIPSLSSVKIPVTEMMKESINRLIFMLDGGEFKYQQTFPGELIERESLARG
                     PHA"
     gene            336681..338117
                     /gene="ascF"
                     /locus_tag="EAE_RS01700"
                     /old_locus_tag="EAE_01625"
                     /db_xref="GeneID:45318725"
     CDS             336681..338117
                     /gene="ascF"
                     /locus_tag="EAE_RS01700"
                     /old_locus_tag="EAE_01625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS cellobiose/arbutin/salicin transporter
                     subunit IIBC"
                     /protein_id="WP_015703257.1"
                     /db_xref="GeneID:45318725"
                     /translation="MSKNYAALANQILTALGGADNVVAVTHCMTRLRFVVKDNQRVDA
                     PALKALQGVLGVVRSDNQCQVIIGNTVSQAYREVLNLLPGELRPAEPQGKPPLTLKRV
                     GAGILDALIGTMSPLIPAIIGGSMVKLLAMILEMSGALPKGSPTLTILTLIGDGAFFF
                     LPLMVAASAAVKFKTNMSLAIAIAGVLVHPGFIELMAKAAQGEHVEFAFIPVTAVKYT
                     YTVIPALVMTWCLSYIERWVDRITPAVTKNFLKPMLIVLIAAPLAILLIGPLGIWIGS
                     AISALVYTIHSYLGWLSVAIMGGLWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSE
                     IGANLSLGGSSLAVAWKTKNPELRQTALAAAASAILAGISEPALYGVAVRLKRPLVAS
                     LISGFICGAVAGIAGLASHSMAAPGLFTSVQFFDPANPMTIVWVFGVMALSVVLSFVL
                     TLLLGFEDIPVENAAADARQRQGAATHA"
     gene            338144..339568
                     /locus_tag="EAE_RS01705"
                     /old_locus_tag="EAE_01630"
                     /db_xref="GeneID:45318726"
     CDS             338144..339568
                     /locus_tag="EAE_RS01705"
                     /old_locus_tag="EAE_01630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase"
                     /protein_id="WP_015703258.1"
                     /db_xref="GeneID:45318726"
                     /translation="MSSFPHGFLWGGALAANQSEGAYLEGGKGLTTVDTIPHGAHRLA
                     VKLGQEKRFTLREDEFYPSHVAIDFYHRYKEDIALMAEMGFSVFRTSIAWSRLFPRGD
                     EQQPNPEGIAFYRAMFEECRKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKMVDFFSHY
                     ARTCFEAFDGLVKYWLTFNEINIMLHSPYSGAGLVFEEGENQEQVKYQAAHHELVASA
                     LATKIAHQVNPQNQVGCMLAGGNFYPYSCKPEDVWMALEKDRENLFFIDVQARGAYPV
                     WAARVFREKGVTIAKQPGDDEILKNTVDFVSFSYYASRCASAEMNASNTNAANIVKSL
                     KNPYIAASEWGWGIDPLGLRITMNMMYDRYQKPLFLVENGLGARDEIDANGEINDDYR
                     ISYLREHIKAMRDAIDDGIPVIGYTSWGCIDLVSASTGEMSKRYGFVYVDRDDAGNGT
                     LARKRKKSFWWYKKVIASNGADLE"
     gene            complement(339944..340435)
                     /gene="hycI"
                     /locus_tag="EAE_RS01710"
                     /old_locus_tag="EAE_01635"
                     /db_xref="GeneID:45318727"
     CDS             complement(339944..340435)
                     /gene="hycI"
                     /locus_tag="EAE_RS01710"
                     /old_locus_tag="EAE_01635"
                     /EC_number="3.4.23.51"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase maturation peptidase HycI"
                     /protein_id="WP_015370032.1"
                     /db_xref="GeneID:45318727"
                     /translation="MTDVLLCVGNSMMGDDGAGPLLAEMCAANPVGGWVVIDGGSAPE
                     NDIVAIRELRPTRLLIVDATDMGLNPGEIRIVDPDDIADMFMMTTHNMPLNYLIDQLK
                     EDVGEVIFVGIQPDIVGFYYPMTQPVKDAVATVYARLDGWQEQGGFAALEAAEEQAFP
                     GLR"
     gene            complement(340428..340838)
                     /locus_tag="EAE_RS01715"
                     /old_locus_tag="EAE_01640"
                     /db_xref="GeneID:45318728"
     CDS             complement(340428..340838)
                     /locus_tag="EAE_RS01715"
                     /old_locus_tag="EAE_01640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HycH family protein"
                     /protein_id="WP_015370031.1"
                     /db_xref="GeneID:45318728"
                     /translation="MSETVVFSQLSRKFIDENDATPDQAQQVVYYSLAIGHHLGVIDC
                     LEAALSCPWEDYLAWIGTLEAGSAARRKMEGVPKYGEIVIDSNHVAMLANAFDKAQSA
                     QTPQQQAWSKTLLSMLHDIHQESAIYLMVRRLRD"
     gene            complement(340835..341602)
                     /locus_tag="EAE_RS01720"
                     /old_locus_tag="EAE_01645"
                     /db_xref="GeneID:45318729"
     CDS             complement(340835..341602)
                     /locus_tag="EAE_RS01720"
                     /old_locus_tag="EAE_01645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase subunit B family
                     protein"
                     /protein_id="WP_015703259.1"
                     /db_xref="GeneID:45318729"
                     /translation="MSNLLGPRDENGIPLPMSVDESIASMKASLLKKIKRSAYVYRVD
                     CGGCNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQS
                     APDPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMAL
                     GLLEQKIHARQPGELDDQPTELLHPNMVQPLRVRIDREARRLAGYRYGRQIADDYMRL
                     LGQGDNQVLRWLEAEKDPRLTEIVTHLNQVVEGARIR"
     gene            complement(341602..342144)
                     /locus_tag="EAE_RS01725"
                     /old_locus_tag="EAE_01650"
                     /db_xref="GeneID:45318730"
     CDS             complement(341602..342144)
                     /locus_tag="EAE_RS01725"
                     /old_locus_tag="EAE_01650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S dicluster domain-containing protein"
                     /protein_id="WP_015370029.1"
                     /db_xref="GeneID:45318730"
                     /translation="MFTFIKKVIKTGTATHSYPLEPMPVDKNFRGKPEHNPQQCIGCA
                     ACVNACPSNALTVETDLATNQLAWQFNLGRCIFCGRCEEVCPTAAIKLSQEYELAVWK
                     KEDFLQQSRFAICHCRVCERPFAVQKEIDYAIALLKHNGDTRAELHRESFETCPECKR
                     QKCLVPSDRIELTRHMREAS"
     gene            complement(342154..343863)
                     /gene="hycE"
                     /locus_tag="EAE_RS01730"
                     /old_locus_tag="EAE_01655"
                     /db_xref="GeneID:45318731"
     CDS             complement(342154..343863)
                     /gene="hycE"
                     /locus_tag="EAE_RS01730"
                     /old_locus_tag="EAE_01655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate hydrogenlyase subunit HycE"
                     /protein_id="WP_015370028.1"
                     /db_xref="GeneID:45318731"
                     /translation="MSEEKIGQHYLAALHQAFPGVVLDEAWQTKDQLTVTVKVNYLPE
                     VVEFLYYKQGGWLSVLFGNDERKLNGHYAVYYVLSMEQGTKCWITVRVEVDANKPEYP
                     SVTPRVPAAVWGEREVRDMYGLVPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPA
                     PTTDAETYEFINELGSKKNNVVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHR
                     GMEKLAETRMGYNEVTFLSDRVCGICGFAHSTAYTTSVENAMGIVVPERAQMIRAILL
                     EVERLHSHLLNLGLACHFTGFDSGFMQFFRVRETSMKMAEILTGARKTYGMNLIGGIR
                     RDLLKEDMIQTRQLAQQMRRDVQELVDMLLSTPNMEQRTVGIGRLDPEIARDFSNVGP
                     MVRASGHARDTRADHPFVGYGLLPMEVHSEQGCDVISRLKVRINEVYTALNMIDFGLD
                     NLPGGPLMVDGFTYIPHRFALGFSEAPRGDDIHWSMTGDNQKLYRWRCRAATYANWPT
                     LRYMLRGNTVSDAPLIIGSLDPCYSCTDRMTVVDVRKKKSKVVPYKELERYSIERKNS
                     PLK"
     gene            complement(343880..344803)
                     /locus_tag="EAE_RS01735"
                     /old_locus_tag="EAE_01660"
                     /db_xref="GeneID:45318732"
     CDS             complement(343880..344803)
                     /locus_tag="EAE_RS01735"
                     /old_locus_tag="EAE_01660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="respiratory chain complex I subunit 1 family
                     protein"
                     /protein_id="WP_015703260.1"
                     /db_xref="GeneID:45318732"
                     /translation="MNLFVALIQALVLFAVAPLLSGLTRVARARLHNRRGPGVLQEYR
                     DILKLLGRQSVGPDASGWVFRLTPFVMVGVMLTIAAALPVVTVDSPLPGLGDLITLIY
                     LFAIARFFFAISGLDTGSPFTAIGSSREAMLGVLVEPILLLGLWVAAQVAGSTHISAI
                     TDTVYHWPAARSIPLILALCACAFATFIEMGKLPFDLAEAEQELQEGPLSEYSGSGFA
                     VLKWGISLKQLVVLQMFVGVFIPWGQMTSFSAPGLLLALVVAVVKLVLGVLIIALFEN
                     SMARLRFCATSRVTWAGFGFAFLAFVSLLVA"
     gene            complement(344806..346632)
                     /gene="hycC"
                     /locus_tag="EAE_RS01740"
                     /old_locus_tag="EAE_01665"
                     /db_xref="GeneID:45318733"
     CDS             complement(344806..346632)
                     /gene="hycC"
                     /locus_tag="EAE_RS01740"
                     /old_locus_tag="EAE_01665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate hydrogenlyase subunit 3"
                     /protein_id="WP_015703261.1"
                     /db_xref="GeneID:45318733"
                     /translation="MSVVALVNQAVAWYTASAVLAFLFSLRKPLSGAIAGIGGAVASA
                     MLIVAGFSALIAPERINGGMLQYLHLAMRVGGINALWLLAIGLSALPISLFNISWHRH
                     PQVKSNGLLVNLLLAAATCAVVVTNFGSLVVMAEIMALCAAFLTGCAQSGKLWFALGR
                     LGTLLLAWTCWLVWSFYGTLDLAAISQLAAGAPQNMALWLPGLLGFALLAGVIPLHGW
                     APQAHAGASAPAAALFSTVVMKVGLYGILTVSLAGSVPPLWWGVLLLVLGMITAFIGG
                     LYALMEHNIQRLLAYHTLENIGIILLGLGAFVTGIATGNNALMVLGFIGGMYHLINHS
                     LFKTTLFLGAGAVWFRTGHRDIEKLGGIGKKMPLISLAMLVGLMAMAALPPLNGFAGE
                     WVIYQSFFKLSTGEVFIGRLLGPLLAVGLAITGALAVMCMAKVYGVTFLGAPRSKEAE
                     NATCAPWLMTLSVVLAAACCVIGGVAAPWLLPLVGHVIPVPAQATSVVSQPLIAILLI
                     ACPLLPFLLMIFFKGDRLPARSRGAAWVCGYDHEQAMVVTAHGFAMPVKEAFAPLLKL
                     RHWLNPVRLVPGWQNAAAPALLRGVALIELAVLVVIVISRGA"
     gene            complement(346629..347237)
                     /locus_tag="EAE_RS01745"
                     /old_locus_tag="EAE_01670"
                     /db_xref="GeneID:45318734"
     CDS             complement(346629..347237)
                     /locus_tag="EAE_RS01745"
                     /old_locus_tag="EAE_01670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S dicluster domain-containing protein"
                     /protein_id="WP_015370025.1"
                     /db_xref="GeneID:45318734"
                     /translation="MNRFVIADSSVCIGCRTCEAACSETHRQYGLQSMPRLQVMRNEK
                     ESAPQMCHHCEDAPCAAVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGS
                     RPLDIPANANTPMAPAAPPAPARVSSLLDWVPGVRAIAVKCDLCHFDEQGPACVRTCP
                     TKALVLVDIRDIAKSSKRKRELTFNTDLGDLSLFQAQQGGVK"
     gene            complement(347320..347769)
                     /gene="hycA"
                     /locus_tag="EAE_RS01750"
                     /old_locus_tag="EAE_01675"
                     /db_xref="GeneID:45318735"
     CDS             complement(347320..347769)
                     /gene="hycA"
                     /locus_tag="EAE_RS01750"
                     /old_locus_tag="EAE_01675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate hydrogenlyase regulator HycA"
                     /protein_id="WP_015703262.1"
                     /db_xref="GeneID:45318735"
                     /translation="MTIWELSEKADYIADRHRQHQEQWHTYCNSLVQGITLSKARLHH
                     AMSCAPDKELCFVLFGHFQVYVALAEGFNSHTIEYYVESKNGDDKRLIAQATLDAEGV
                     IDGRISNRSREAVLEHYLAIIATVYDRLYEAMERDQPVDLNHLAQVH"
     gene            347982..348326
                     /gene="hypA"
                     /locus_tag="EAE_RS01755"
                     /old_locus_tag="EAE_01680"
                     /db_xref="GeneID:45318736"
     CDS             347982..348326
                     /gene="hypA"
                     /locus_tag="EAE_RS01755"
                     /old_locus_tag="EAE_01680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase maturation nickel metallochaperone
                     HypA"
                     /protein_id="WP_015370023.1"
                     /db_xref="GeneID:45318736"
                     /translation="MHEITLSQRALEIIEQQARQNGARRVTGVWLKVGAFSCVEASAL
                     TFCFELVCRGTLAEGCALHIAEQQAECWCERCQQYVHLVSQHVRRCPHCDNDQLQIVA
                     DDGLQIQRLELE"
     gene            348333..349205
                     /gene="hypB"
                     /locus_tag="EAE_RS01760"
                     /old_locus_tag="EAE_01685"
                     /db_xref="GeneID:45318737"
     CDS             348333..349205
                     /gene="hypB"
                     /locus_tag="EAE_RS01760"
                     /old_locus_tag="EAE_01685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase nickel incorporation protein HypB"
                     /protein_id="WP_015703263.1"
                     /db_xref="GeneID:45318737"
                     /translation="MCTTCGCGEGNLYIEGDEHNPHSAFRSAPFAPAPRQTMTITGVK
                     TDNFSPTRSAQGDLHYGHGEAGTHAPGQSQRRMLEVEIDVLDKNNRLAARNRARFAAN
                     NQLVLNLVSSPGSGKTTLLTETLTRLKGIVDCAVIEGDQQTVNDAARIRATGTPAIQV
                     NTGKGCHLDAQMITDASARLPAGDNGILFIENVGNLVCPASFDLGERHKVAVLSVTEG
                     EDKPLKYPHMFAAASLMLLNKVDLLPYLNFDVEKCLACAREVNPHIEIILLSATSGEG
                     MDQWLNWLETQRCA"
     gene            349196..349468
                     /locus_tag="EAE_RS01765"
                     /old_locus_tag="EAE_01690"
                     /db_xref="GeneID:45318738"
     CDS             349196..349468
                     /locus_tag="EAE_RS01765"
                     /old_locus_tag="EAE_01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HypC/HybG/HupF family hydrogenase formation
                     chaperone"
                     /protein_id="WP_015703264.1"
                     /db_xref="GeneID:45318738"
                     /translation="MCIGIPGQIRTIDGVMAKVEVCGIQREVDLTLVGAVDEQGQPRI
                     GQWVLVHVGFAMSVINEAEARDTLEALQNMFEVEPDVGALLYGEER"
     gene            349468..350589
                     /gene="hypD"
                     /locus_tag="EAE_RS01770"
                     /old_locus_tag="EAE_01695"
                     /db_xref="GeneID:45318739"
     CDS             349468..350589
                     /gene="hypD"
                     /locus_tag="EAE_RS01770"
                     /old_locus_tag="EAE_01695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_708530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase formation protein HypD"
                     /protein_id="WP_015703265.1"
                     /db_xref="GeneID:45318739"
                     /translation="MRFVDEYRAPEQVLQLVEHLQQRARLLDYSEARPLRMMEVCGGH
                     THAIFKFGLDQLLPNNIEFIHGPGCPVCVLPMGRIDACIEIASRPGVIFCTFGDAMRV
                     PGKNGSLLQAKSRGADVRIVYSPMDALRLAQQNPQREVVFFGLGFETTMPATALTLRQ
                     ARERNVGNFYFFCQHITLLPTLRSLLDQPDNGIDAFLAPGHVSMVIGTDAYGFIASDY
                     HRPLVVAGFEPVDLLQGVIMLVEQKIAQRSQVENQYRRVVPDAGNALAQAAIAEVFCL
                     SGDSEWRGLGTINDSGVCLTPDYQRFDAEAHFRPAPQRVCDDPRARCGEVLTGRCKPH
                     QCPLFGRVCNPQSAFGALMVSSEGACAAWYQYRSQENKA"
     gene            350586..351596
                     /gene="hypE"
                     /locus_tag="EAE_RS01775"
                     /old_locus_tag="EAE_01700"
                     /db_xref="GeneID:45318740"
     CDS             350586..351596
                     /gene="hypE"
                     /locus_tag="EAE_RS01775"
                     /old_locus_tag="EAE_01700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression/formation protein HypE"
                     /protein_id="WP_015703266.1"
                     /db_xref="GeneID:45318740"
                     /translation="MKSIQLAHGSGGQAMQQLIGELFMQAFANPWLAEQEDQARLDLA
                     GLAAQGDRLAFSTDSYVIDPLFFPGGDIGKLAVCGTANDVAVSGAVPRYLSCGFILEE
                     GLEMATLEAVVRSMATTAQQAGIAIVTGDTKVVPRGAADKIFINTAGIGAIPGDIHWG
                     AQQISAGDVLLVSGTLGDHGATILNLREQLGLDGALSSDCAVLTPLIQTLREIPGIKA
                     LRDATRGGVNAVAHEFAAASGCGIELHEAKLPVNDTVRGVCELLGLDALNFANEGKLV
                     IAVAREAAPRVLEHLRSHPLGQNAAIIGDVVERAGVRSVGLYGVKRTLDLPHAEPLPR
                     IC"
     gene            351735..353807
                     /gene="flhA"
                     /locus_tag="EAE_RS01780"
                     /old_locus_tag="EAE_01705"
                     /db_xref="GeneID:45318741"
     CDS             351735..353807
                     /gene="flhA"
                     /locus_tag="EAE_RS01780"
                     /old_locus_tag="EAE_01705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004151050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate hydrogenlyase transcriptional activator
                     FlhA"
                     /protein_id="WP_015703267.1"
                     /db_xref="GeneID:45318741"
                     /translation="MSYTPMGDLGQQGLFDITRILLQQPDLAALSETLTRLVQQSALA
                     DRAAIILWNHGNHRAARYACDDAGQPASYEDETVLAHGPVRRLLSRPDALHCDNVTFA
                     ETWPQLAASGIYPEFGYYCLLPLAAEGRIFGGCEFIRDDNRPWSEKEYQRLHTFAQIV
                     AVVTEQIQSRVSNNVDYDLLCHERDNFRILVAITNAVLSRLDIDELVSEVAKEIHRYF
                     RIDAISVVLRSNRKGKLNIYSTHYLDASHPVHDQSEVDEAGTLTERVFKSKEMLLLNL
                     HEHDSLAPYEKMLFEMWDNQIQTLCLLPLMSGNTLLGVLKLAQCDEQVFTTTNLKLLR
                     QIAERVSIAIDNALAYREIQRLKERLVDENLALTEQLNNVESEFGEIIGRSEAMHSVL
                     KQVEMVAQSDSTVLILGETGTGKELIARAIHNLSGRNGRRMVKMNCAAMPAGLLESDL
                     FGHERGAFTGASAQRIGRFELADKSSLFLDEVGDMPLELQPKLLRVLQEQEFERLGSN
                     KLIQTDVRLIAATNRDLKQMVIDREFRSDLYYRLNVFPIHLPPLRERPDDIPLLVKAF
                     TFKIARRLGRNIDSIPAETLRTLSRMEWPGNVRELENVVERAVLLTRGNVLQLSLPEM
                     HIEQETLAPEVLPEEGEDEYQLIVRVLKESNGVVAGPKGAAQRLGLKRTTLLSRMKRL
                     GINKDRLV"
     gene            354111..355028
                     /locus_tag="EAE_RS01785"
                     /old_locus_tag="EAE_01710"
                     /db_xref="GeneID:45318742"
     CDS             354111..355028
                     /locus_tag="EAE_RS01785"
                     /old_locus_tag="EAE_01710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014226544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter substrate-binding protein"
                     /protein_id="WP_015703268.1"
                     /db_xref="GeneID:45318742"
                     /translation="MPHLPPFKCLLFSAALALLAIAPAQAQEKFKVITTFTVIADMAQ
                     NVAGDAADVSSITKPGAEIHEYQPTPGDIKRAQGAKLILANGLNLELWFARFYQHLNG
                     VPEVVVSNGIQPMGISDGPYNGKPNPHAWMSADNALIYVDNIRDALVKYDPVNADTYR
                     RNAEAYKEKIRQTMAPLKAELAKLPADKRWLVTSEGAFSYLARDNGLQERYLWPINAD
                     QQGTPQQVRKTIDTMKKEHIPTIFSESTISDKPARQVAREAGAHYGGVLYVDSLSAAD
                     GPVPTYLDLLRVTTETIVKGINDGLRKQS"
     gene            355025..355846
                     /locus_tag="EAE_RS01790"
                     /old_locus_tag="EAE_01715"
                     /db_xref="GeneID:45318743"
     CDS             355025..355846
                     /locus_tag="EAE_RS01790"
                     /old_locus_tag="EAE_01715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="manganese/iron ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_015703269.1"
                     /db_xref="GeneID:45318743"
                     /translation="MIAPQAGLIVDQVTVTYRNGHTALRDASFSVPRGSIAALVGVNG
                     SGKSTLFKALMGFVRVGHGDIAILGQPVNRALRQNLVAYVPQSEEVDWSFPVLVEDVV
                     MMGRYGHMGWLRRAKPRDRQIVDDALARVGMSEYRKRQIGELSGGQKKRVFLARAIAQ
                     EGKVILLDEPFTGVDVQTEARIIALLRELRDEGCTMLVSTHNLGSVSEFCDYTVMVKG
                     TVLASGPTETTFTAENLELAFSGVLRHVTLTGAEERIITDDERPFISHRAAGGQR"
     gene            355843..356691
                     /gene="sitC"
                     /locus_tag="EAE_RS01795"
                     /old_locus_tag="EAE_01720"
                     /db_xref="GeneID:45318744"
     CDS             355843..356691
                     /gene="sitC"
                     /locus_tag="EAE_RS01795"
                     /old_locus_tag="EAE_01720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron/manganese ABC transporter permease subunit
                     SitC"
                     /protein_id="WP_015370015.1"
                     /db_xref="GeneID:45318744"
                     /translation="MSWLLEPFGYQYMLNAMWVSALVGGVCAFLSCYLMLKGWSLIGD
                     ALSHSIVPGVAGAYMLGLPFALGAFLSGGLAAGSMLFLNQRSRLKEDAIIGLIFSSFF
                     GIGLFMVSLNPTSVNIQTIILGNILAIAPEDIIQLAAIGFISMAILLLKWKDLMVTFF
                     DENHARSIGLNTSGLKLLFFTLLAACTVAALQTVGAFLVICLVVTPGATAWLLTDRFP
                     RLLAIAVAIGSLTSFFGAWLSYYLDGATGGIIVVAQTLLFLATFVFAPKHGLLANRRR
                     AREASC"
     gene            356685..357539
                     /locus_tag="EAE_RS01800"
                     /old_locus_tag="EAE_01725"
                     /db_xref="GeneID:45318745"
     CDS             356685..357539
                     /locus_tag="EAE_RS01800"
                     /old_locus_tag="EAE_01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_015703270.1"
                     /db_xref="GeneID:45318745"
                     /translation="MLTMLLEPLQFPFMVNAMLVATIVAVPCALLSVFLVLKGWALMG
                     DAMSHAVFPGVVVAYIIGIPFAIGAFIAGLFCAVATGFLDDNSRIKRDTIMGIVFSGM
                     FGAGLVLYVAIQSEVHLDHILFGDMLGISTSDIGQTAVIALAIALIIGLKWRDFLLHA
                     FDPNQAKASGLRCGLLHYGLLCMIALTIVATLKSVGIILSISLLIAPGAIALLLTRRF
                     VSALLLATVIAVGCSLAGVWLSFYLDSAPAPTIVVLFTALFVLAFVASTVRDGQKQRA
                     SATLPGGG"
     gene            complement(358031..358372)
                     /locus_tag="EAE_RS01805"
                     /old_locus_tag="EAE_01730"
                     /db_xref="GeneID:45318746"
     CDS             complement(358031..358372)
                     /locus_tag="EAE_RS01805"
                     /old_locus_tag="EAE_01730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrous oxide-stimulated promoter family
                     protein"
                     /protein_id="WP_015703271.1"
                     /db_xref="GeneID:45318746"
                     /translation="MGKRIDREKKTIGNMIRLYQRRCPDARNDGEHYLALNAYADKRL
                     DKCVFGEEKPACKQCPVHCYQPAKREEMKRIMRWAGPRMLWRHPILTIRHLIDDRRPA
                     PELPEKYRPKK"
     gene            complement(358433..359320)
                     /locus_tag="EAE_RS01810"
                     /old_locus_tag="EAE_01735"
                     /db_xref="GeneID:45318747"
     CDS             complement(358433..359320)
                     /locus_tag="EAE_RS01810"
                     /old_locus_tag="EAE_01735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703272.1"
                     /db_xref="GeneID:45318747"
                     /translation="MAMKIKQIQAFLTVASEGNLTLAAEKMGITQSGLSRLLLTLEED
                     LNATLFERHKHGMALSEYGSAFLPYAMTMLNTENKAREEMALIRGAGKGILRIGCVSS
                     LLTSHFIDKLAAFHKRHPQIHIKIFDRIDSELFKLLLMHEIDIALCGPLPHDDKIVVR
                     GKINWQDRICIISRPGHPLQKEKRLSLAAMLDYPWIMPPPLSTPMLILEDIFRSHQLP
                     CPVPIIECASSAAIKSFIAESDLLTSMPAPVYRLEEKLGLLRPLEAKGSVFVRDFYAW
                     SHFGVLSGAALQLIQHLKQ"
     gene            359504..360445
                     /locus_tag="EAE_RS01815"
                     /old_locus_tag="EAE_01740"
                     /db_xref="GeneID:45318748"
     CDS             359504..360445
                     /locus_tag="EAE_RS01815"
                     /old_locus_tag="EAE_01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="receptor protein"
                     /protein_id="WP_015703273.1"
                     /db_xref="GeneID:45318748"
                     /translation="MTQNNILLILGAILPVIITVLIGYISGKRKDFNWQQAGDINKIV
                     MLYALPLSIFSNMVMTPRHIVMSMGPVAIAIILALIPSFLIPLAIARYICKRSLALST
                     LQALAIGSPAVPFIGTSVLAFLFGTVSASLITVSSITQNVFQLPLVMILMSVATGDKS
                     QNISFATRVINAIKQPVVWSPVVALILVLMDIHIPETVSMSLGLLGKASGGLALFAAG
                     IVLYTRSIVITSATIITVIARNILVPGACYLILLKMGFSMEQIKQVVLTMAIPVGSIA
                     IIIAMQYKSGEQEMASTMALSIITSIITMGAFIFLTF"
     gene            360481..362190
                     /locus_tag="EAE_RS01820"
                     /old_locus_tag="EAE_01745"
                     /db_xref="GeneID:45318749"
     CDS             360481..362190
                     /locus_tag="EAE_RS01820"
                     /old_locus_tag="EAE_01745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate-requiring protein"
                     /protein_id="WP_015703274.1"
                     /db_xref="GeneID:45318749"
                     /translation="MTSITVSAAELLLHRLQALDVAYIFINSGTDYPPVIEAWAKMRA
                     TGQQVPELVICPHENAAIGMAHGYYLGSGKVQAVMVHTNVGLANAACGVINLANSNIP
                     VLIFGGRTPISEHSHFGCRNTPIGYGQEMRDQAALIRESVKWDFELRIADQIGEHVDR
                     AWAIARSLPKGPVYLSLPREPLCETFTIDEQALHASPTQQPVRYAPTRADIASAADAI
                     ANARQPVIFAQRGARTSGGFARLNTLVKEWAIPVVEYWGTEVTLSSDNPMLAGSDPEG
                     WLSAADVIIVIDSQAPWIIEESRCNDSCKVIQIGPDPLFSRYPVRGYRADINLAGETD
                     EVFELLQEALQPLVAAKQRQVAEREKHVLNLIQHAKNQREALLHANQKGAIGKPWMSY
                     CLGQLANQHQGKIVSELTTMPQFAGLTQADSYYQEALAGGLGEALPIALGLQLARRGE
                     LIIAAVGDGSYLFANPAVCHHIAEVMKLPVLVVVGNNGGWGAVAGGTRALYPDGYAAK
                     MDAIPATAFSSSPDFAALAASSRAAALTVSLAEDLPGVLEEAVAIIRTRRQSVLVNVE
                     LGR"
     gene            complement(362206..362499)
                     /locus_tag="EAE_RS01825"
                     /old_locus_tag="EAE_01750"
                     /db_xref="GeneID:45318750"
     CDS             complement(362206..362499)
                     /locus_tag="EAE_RS01825"
                     /old_locus_tag="EAE_01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015370009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SelT/SelW/SelH family protein"
                     /protein_id="WP_015703275.1"
                     /db_xref="GeneID:45318750"
                     /translation="MSHKAMITIHYCSQCNWMLRASWMAQELLHTFSTDIASVTLVPG
                     TGGIFVVTVDGVQIWERKQDGGFPDAAELKRRVRDVCFPEKALGHVDNAGKQI"
     gene            362699..365050
                     /locus_tag="EAE_RS01830"
                     /old_locus_tag="EAE_01755"
                     /db_xref="GeneID:45318751"
     CDS             362699..365050
                     /locus_tag="EAE_RS01830"
                     /old_locus_tag="EAE_01755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_015703276.1"
                     /db_xref="GeneID:45318751"
                     /translation="MYKSTQSAAWCKKSLLATSLLAAIAQNAAIAAVTQDNTTDSAEQ
                     MVVTAPAPQLKAGSEHSVSAQELQDKGANNFGSIMRYEPLISATGASGGSGNGKSGFD
                     RGGYTGYNIRGLESNRVGIDVDGIAQPNATGRGYVGRSGLNTFGIGRDYIDPYMYGSV
                     DIQSGATSTETANSSIGGNVSFRPKSADDYLRPGKTSAFGYQSGYDSSDRSWHNGVTV
                     AGGDETLRGIFVYSRRDGQETENNSGSVDAYPANWHSDAFMASGIWQPNDEHKFTSTF
                     DYYHKTNHSHFDSWDSSGNSVIGAANQTNQTRRWGLSLKDDWTPMNDYIDSVSTKVYY
                     QHTEAHDWTWMPDSVTRKMQTVNSDYDTDTWGLQTALAKSIGRHDLSAGFNASTTKTQ
                     RPFSQSPIPSVYSEIMQPEADSRSYTLGGYVQDQINFDLDSHYFAIIPGVRVTHQSTK
                     PEDLSDLSANSSVLTESSVANLYGKNSDTQVLPSLTFQYDITPRLMTYLQYQRGAQFP
                     NASQLYGSWNLGSSYAGSQQYALIGNNDLKTETSDNIEWGIKGEVTEGITVRTALFYN
                     SYKNFIAYTRYSRANNPGKFTNVPSNIYTIYQAENRDKAYIYGGEISTKFNFGTWFEQ
                     VDGLSATLAWGYSEGKSKSSYYGDKYVDLDSVAPMKAIVGVAWDDPAKRYGTALTATF
                     VKGKQATATSRESYNNTGSAIADSSTEYMRVPGYGMLDWTAYWQVAKNVRLNGGVYNI
                     TDRKYWDYLSSRNIETSTNQDANDKALAVMPGRTWQLGVNIDF"
     gene            365124..366155
                     /locus_tag="EAE_RS01835"
                     /old_locus_tag="EAE_01760"
                     /db_xref="GeneID:45318752"
     CDS             365124..366155
                     /locus_tag="EAE_RS01835"
                     /old_locus_tag="EAE_01760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin-degrading factor"
                     /protein_id="WP_015703277.1"
                     /db_xref="GeneID:45318752"
                     /translation="MQNAHDDLWQRYQATKARSTAKYARDIAAEMGISEAELTAARVG
                     HDAVRLHDDVRAIIAVLESVGETKCICRNEYAVHEQVGEFTHQHLSGHAGLVLNPRAL
                     DLRLFLSQWSSVFHLNDNGRQSIQFFDPHGDALLKVYATGKTDMAAWQTLVAKFSETA
                     PGALTIRPADRVKYADSADAAALEKEWRAMTDVHQFFGLLRKHNLSRQQAFRLVSDDL
                     ACRIDNNALPGLLETVRQDGNEIMIFVGNRGCVQIFTGALEKLAPMRGWINIFNSAFT
                     LHLREDSVDEIWVTRKPTSDGHVTSVELFAKDGTQIAQLYGQRSEGHPEQQQWRAQVA
                     RLCAEGQPA"
     gene            366152..366970
                     /locus_tag="EAE_RS01840"
                     /old_locus_tag="EAE_01765"
                     /db_xref="GeneID:45318753"
     CDS             366152..366970
                     /locus_tag="EAE_RS01840"
                     /old_locus_tag="EAE_01765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter substrate-binding protein"
                     /protein_id="WP_015703278.1"
                     /db_xref="GeneID:45318753"
                     /translation="MKRWLILLAALPLFASAAAERVISLGGDVTEIVYALNAGQQLVA
                     KDSTSTWPAAAHKLPDVGYLRQLNAEGILSLRPQLVLASAQAQPSLVLQKVQDSKVTV
                     VNVPGGDNLAAIDNKIAVIAKALGKTPAGDVLRQQVKQRIAAIPSRPIAKRVLFILSH
                     GGMNTMVAGQHTAADGAIRAAGLQNAMQGFDHYRAMSQEGVAASQADLVVISADGLKG
                     MGGESGLWKLPGLAQTPAGRHKQLLAIDDMALLGFGPRTPQAILELRKKAELLP"
     gene            366970..367965
                     /locus_tag="EAE_RS01845"
                     /old_locus_tag="EAE_01770"
                     /db_xref="GeneID:45318754"
     CDS             366970..367965
                     /locus_tag="EAE_RS01845"
                     /old_locus_tag="EAE_01770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_015703279.1"
                     /db_xref="GeneID:45318754"
                     /translation="MRPALVRHLLLMALLLVVLTLYATTLGAMRLPLVNLLPSGDEIL
                     RHIWLTIRLPRVLLALLVGAALALSGCVMQGLFRNPLADPGLLGISSGAALAVACWLV
                     LPLSVPALLALYMPMLAAFIGSLAVMAVIFILSRAGDGSLSRLLLVGIAINALCGALV
                     GVLAWLSNDAQLRQLSLWGMGSLGQAEWSTLLVAASLIIPASIAVWRMATRLNLLQLG
                     DEEAHYLGVNVRAIQRLLLLCSAVLVAAAVAISGVIGFIGLVVPHLMRMWLGADHRGL
                     IPGSLLAGAILLLIADTLARTVAAPAEMPVGLLTSLLGAPWFLWLIFRREKPIHG"
     gene            367958..368737
                     /locus_tag="EAE_RS01850"
                     /old_locus_tag="EAE_01775"
                     /db_xref="GeneID:45318755"
     CDS             367958..368737
                     /locus_tag="EAE_RS01850"
                     /old_locus_tag="EAE_01775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="WP_015703280.1"
                     /db_xref="GeneID:45318755"
                     /translation="MDKDYRAQGLSLRLGQRQVIDQVSLTLRGGEMTALIGPNGAGKS
                     TLLRLLTGFLTPDSGERMMDGKALERWSPQALSRRRAVMLQRTPLQADWTVETVIAMG
                     RSPWEATASPQTLRDVMAETGCDHLRGRRYPSLSGGEQQRVQLARCLAQLWQNGAPQG
                     WLFLDEPTSALDLYYQQHLLRLLKRLTASGQLHVCVVLHDLNLAALWADQILLLHQGQ
                     VVAQGTPHQVIQQEIISRWYGADVRLGQHPEKAIPQVYLAP"
     gene            368918..371479
                     /gene="mutS"
                     /locus_tag="EAE_RS01855"
                     /old_locus_tag="EAE_01780"
                     /db_xref="GeneID:45318756"
     CDS             368918..371479
                     /gene="mutS"
                     /locus_tag="EAE_RS01855"
                     /old_locus_tag="EAE_01780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_015703281.1"
                     /db_xref="GeneID:45318756"
                     /translation="MSTIDNLDAHTPMMQQYLKLKAQHPEILLFYRMGDFYELFYDDA
                     KRASQLLDISLTKRGASAGEPIPMAGIPHHAVENYLAKLVNQGESVAICEQIGDPATT
                     KGPVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEP
                     ADRETMAAELQRTNPAELLYAEDFAESSLIEGRRGLRRRPLWEFEIDTARQQLNLQFG
                     TRDLVGFGVENAPRGLCAAGCLLQYVKDTQRTSLPHIRSITMERQQDSIIMDAATRRN
                     LEITQNLAGGVDNTLASVLDCTVTPMGSRMLKRWLHMPVRDTAVLVERQQTIGALQER
                     YTELQPVLRQVGDLERILARLALRTARPRDLARMRHAFQQLPLLRELLADVDCQPVQQ
                     LREKMGEFAELRELLERAIIDAPPVLVRDGGVIAPGYNEELDEWRALADGATDYLDKL
                     EIRERERLGLDTLKVGYNAVHGYYIQISRGQSQHAPIHYVRRQTLKNAERYIIPELKE
                     YEDKVLTSKGKALALEKQLYDDLFEKLLPHLADLQTSASALAELDVLVNLAERAETLN
                     YCCPTFIDKPGIRITEGRHPVVEQVLKEPFIANPLQLAPQRRMLIITGPNMGGKSTYM
                     RQTALIALLAYIGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILH
                     NATEHSLVLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKME
                     GVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELES
                     ISPNAAATQVDGTQMSLLSAPEETSPALEALENLDPDSLSPRQALEWIYRLKSLA"
     gene            complement(371536..372678)
                     /locus_tag="EAE_RS01860"
                     /old_locus_tag="EAE_01785"
                     /db_xref="GeneID:45318757"
     CDS             complement(371536..372678)
                     /locus_tag="EAE_RS01860"
                     /old_locus_tag="EAE_01785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015703282.1"
                     /db_xref="GeneID:45318757"
                     /translation="MLKFLYATLLLLGLFPLAAQAVCHRTDDTPSQSYVAMPQQLLVS
                     SKNYAPGEILYDSGYMSGGTTTIKNCAGTYYVGFHYAGALTTASPLQDNVYPLTNGST
                     ATGLGIRVYTINQAGPFDDERAIDNSWQEHDAGAGSDHTLNNSAYRVQIIATGGPITS
                     GTFNVPSPLARVDYRETQSIDSSDGDIASTLTLSTTTVEVHAMGCTASVSSLLFDMGS
                     VDVSSFDNQQTVEGPEQSVGLSCEPGTNVTLKFSGAVASGDNDNGSVFALTDAGSDGV
                     ATGVGVKILTYNPNRQSFISLPIGQTFGVFSSDRDAAAAANSGQDADGNAISDIGSAT
                     TYSDDANRGGAGASEAIRFRADYYKTGSAVTPGTANATGTITLQYN"
     gene            complement(372700..373251)
                     /locus_tag="EAE_RS01865"
                     /old_locus_tag="EAE_01790"
                     /db_xref="GeneID:45318758"
     CDS             complement(372700..373251)
                     /locus_tag="EAE_RS01865"
                     /old_locus_tag="EAE_01790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015703283.1"
                     /db_xref="GeneID:45318758"
                     /translation="MSKFLYAVLFFAGMLVSAMPALAGDNNLRETRDITFHGRIAAGT
                     CNVTNPETVDLGKYYKGDFSVAGGNTGNVPVTISFDSCTAEISQATVTFTGTPYSEDP
                     TYGSVIYANQVTPDADGATDVGLQLFDYPAIHVALANGVSYPVPIENGAGALKFIARM
                     YTPHGAPTAGKFSSAVTLNVTYN"
     gene            complement(373275..373826)
                     /locus_tag="EAE_RS01870"
                     /old_locus_tag="EAE_01795"
                     /db_xref="GeneID:45318759"
     CDS             complement(373275..373826)
                     /locus_tag="EAE_RS01870"
                     /old_locus_tag="EAE_01795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015703284.1"
                     /db_xref="GeneID:45318759"
                     /translation="MSRFHFATVRRMAATSLLFVAGLPSALAYNTQDVINFSVTGNIV
                     AGSCNVSYPATVELGTYLPTDFINEGDSTDNVPFTVSFTNCSPSLTKATVAFTGAVDG
                     TQPFYFANGITAEGGGATDVALELLTDADHWQMSNGQSHDVTLESDSHAGEIIFIARM
                     ATPGHNPGTGEFQSVVTLNVVYN"
     gene            complement(373826..376417)
                     /locus_tag="EAE_RS01875"
                     /old_locus_tag="EAE_01800"
                     /db_xref="GeneID:45318760"
     CDS             complement(373826..376417)
                     /locus_tag="EAE_RS01875"
                     /old_locus_tag="EAE_01800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis outer membrane usher
                     protein"
                     /protein_id="WP_015703285.1"
                     /db_xref="GeneID:45318760"
                     /translation="MEKVKHTYVLSLGLGLSIAFSSFSAIAQEHFNPRLLETDSTETP
                     MMDLSLFAKDEVPPGDYNVDIYINGSLVDTKTISFRKLSDDKNTTAGQVVGACLSVSE
                     LKAWNVRVDNYFSEQDKTSECASLQAIPGLEQKMDLANQRFDLTIPQVALLNTARGYV
                     SPERWDEGIAAGLLNYSVSGQQDLHHRNGVDSSNQFVSLQPGLNLGAWRLRNYSTYSH
                     SESESEWDSVYTYASRDIKSLKSQLVLGQGTTRGGVFDSVGFTGVQMYSDNDMKPDSM
                     QGFAPVIRGIARSNAEVTVYQNGHSIYKATVPPGPFEFSDMYPTGSSGDLKVVIKESD
                     GSQSSFIVPYATLPVLQREGQVQYGLVAGRTRQDGSDSRAEDFNFVQGSAAWGVGKGV
                     TLYGGYIQAEDKYSNLIAGTGFNLGSAGALSFDISQSWADVPQPDNIRQMEHHSGQSY
                     RVRYSKTLQQTNTDIAVAGYKFSTRGYLSFQDFLNDWDPGNSAIDNGRERNRFDVTIS
                     QTLPFGTLSLTMYDASYWNSQHADSLNLGFSSTLGPVSYSLNYAHTKNVDGGYGNDSD
                     EYDDDNVFSLNFSVPFSAFSNSEAAQSISANYSMNSSKHGDTTHNIGISGTAMQQNQL
                     NWQVSEGYNADSEATNGNVTVGYQSSYADVSAGYSYDDYSRRLNYSLRGGMVVHSGGI
                     TLARQLNDSVALVETPGVSGVPINGQTNVHTDYFGNAIVPYVRPYHSNQISLNTVEAS
                     DATAAIDNVAKTVVPTKGAVVRVKYNTWIGRKAMMTLIFNGKPVPFGAVVTQTSDDSD
                     DTRSSIVGDSGEVYLVGLADKGQLMVKWGDGANKRCAVDYTLAGAKSQADILFINGIC
                     HPVQGAH"
     gene            complement(376456..377142)
                     /locus_tag="EAE_RS01880"
                     /old_locus_tag="EAE_01805"
                     /db_xref="GeneID:45318761"
     CDS             complement(376456..377142)
                     /locus_tag="EAE_RS01880"
                     /old_locus_tag="EAE_01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_015703286.1"
                     /db_xref="GeneID:45318761"
                     /translation="MKPIAAFVFCVAAVASLNASASIVTGGTRVIFDGSHQAASLSVE
                     NSDKVTNLVQSWVSPAEGSALKKETMIITPPLFRLEAGKKASIRIVRSGMPVPEDRES
                     LLWLNVKGIPATDDSSAGKNTMQIAINSKIKLIYRPVALKGQSPESSANKVVWKPAAG
                     GVQVNNPTPFYMNFSRIEINNHALSGQYFVAPFSTLNISEGKIPSHGKVTWSLINDYG
                     VKGQDKVSSY"
     gene            complement(377192..377728)
                     /locus_tag="EAE_RS01885"
                     /old_locus_tag="EAE_01810"
                     /db_xref="GeneID:45318762"
     CDS             complement(377192..377728)
                     /locus_tag="EAE_RS01885"
                     /old_locus_tag="EAE_01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703287.1"
                     /db_xref="GeneID:45318762"
                     /translation="MKLTKIGAALVLTFGMSAAAMASNTITFNGEVLETGCNITVDGG
                     TPDATVELGSVAATDLVAKGDLGAPKQFVFNLDQCPTASNVNIVFSAPVDPVAGDDSY
                     FANTASGVGVTAAQNVAVQLKQGGSNGTIVKNNADNDPITLDSGSATETYTASMIAVD
                     QAVAGTVQSVVTYNVRYN"
     gene            complement(378142..378378)
                     /locus_tag="EAE_RS01890"
                     /old_locus_tag="EAE_01815"
                     /db_xref="GeneID:45318763"
     CDS             complement(378142..378378)
                     /locus_tag="EAE_RS01890"
                     /old_locus_tag="EAE_01815"
                     /EC_number="4.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015369996.1"
                     /db_xref="GeneID:45318763"
                     /translation="MICPRCADEQIEVMATSPVKGVWIVYQCQHCLYTWRNTEPLRRT
                     SREHYPEAFRMTQKDIDEAPQVPHIPPLLAADKR"
     gene            complement(378389..379816)
                     /locus_tag="EAE_RS01895"
                     /old_locus_tag="EAE_01820"
                     /db_xref="GeneID:45318764"
     CDS             complement(378389..379816)
                     /locus_tag="EAE_RS01895"
                     /old_locus_tag="EAE_01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UbiD family decarboxylase"
                     /protein_id="WP_015369995.1"
                     /db_xref="GeneID:45318764"
                     /translation="MAFDDLRSFLQALDEQGQLLKISEEVNAEPDLAAAANATGRIGD
                     GAPALWFDNIRGFTDARVAMNTIGSWQNHAISLGLPPNTPVKKQIDEFIRRWDKFPVT
                     PERRANPAWAENTVDGDDINLFDILPLFRLNDGDGGFYLDKACVVSRDPLDPDHFGKQ
                     NVGIYRMEVKGKRKLGLQPVPMHDIALHLHKAEERGEDLPIAITLGNDPIITLMGATP
                     LKYDQSEYEMAGALRESPYPIATAPLTGFDVPWGSEVILEGVIEGRKREIEGPFGEFT
                     GHYSGGRNMTVVRIDKVSYRTKPIFESLYLGMPWTEIDYLMGPATCVPLYQQLKAEFP
                     EVQAVNAMYTHGLLAIISTKKRYGGFARAVGLRAMTTPHGLGYVKMVIMVDEDVDPFN
                     LPQVMWALSSKVNPAGDLVQLPNMSVLELDPGSSPAGITDKLIIDATTPVAPDLRGHY
                     SQPVQDLPETKAWAEKLTAMLANRK"
     gene            complement(379819..380409)
                     /locus_tag="EAE_RS01900"
                     /old_locus_tag="EAE_01825"
                     /db_xref="GeneID:45318765"
     CDS             complement(379819..380409)
                     /locus_tag="EAE_RS01900"
                     /old_locus_tag="EAE_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012134854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UbiX family flavin prenyltransferase"
                     /protein_id="WP_015703288.1"
                     /db_xref="GeneID:45318765"
                     /translation="MKLIIGMTGATGAPLGVALLQALNEMPDVETHLVMSKWAKTTIE
                     LETPYSARDVAALADFCHSPADQAATISSGSFRTDGMIVIPCSMKTLAGIRAGYAEGL
                     VGRAADVVLKEGRKLVLVPREMPLSTIHLENMLALSRMGVAMVPPMPAYYNHPETVED
                     ITNHIVTRVLDQFGLEYHKARRWNGLRAVENLSQEN"
     gene            380582..381001
                     /locus_tag="EAE_RS01905"
                     /old_locus_tag="EAE_01830"
                     /db_xref="GeneID:45318766"
     CDS             380582..381001
                     /locus_tag="EAE_RS01905"
                     /old_locus_tag="EAE_01830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_015703289.1"
                     /db_xref="GeneID:45318766"
                     /translation="MELRNEAFHLLRQLFQQHTARWQHELPELTKPQYAVMRSVAEHP
                     GIEQVTLIEAAVSTKATLAEMLSRMEKRGLVRREHDPSDKRRRFVYLTNEGQALLANS
                     MPQGNRVDEEFLSRLNEEERAQFSRLVLKMMENKNAD"
     gene            complement(380998..381885)
                     /locus_tag="EAE_RS01910"
                     /old_locus_tag="EAE_01835"
                     /db_xref="GeneID:45318767"
     CDS             complement(380998..381885)
                     /locus_tag="EAE_RS01910"
                     /old_locus_tag="EAE_01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703290.1"
                     /db_xref="GeneID:45318767"
                     /translation="MLNLQRVTMFVAVVDAGSFTAAAAALGQTKAVVSFNVRQLESEL
                     GVTLLLRSTRRLTLTEAGAVFYQRGVGLLKAAENLQDEVRASHAGLSGELRITTTPEY
                     GAQVIIPALAEFACRHPALRVRHVSSSYHADLISERFDVAIRLGTLADSRYHAARISR
                     FAIVPVASPIWLDKHPLRTLADLAQAAWIVNERLATPLRWQLLTAEGQSIAFEITQPP
                     RISADSAQALMGFALAGSGVALLPEWLVAEAIARQELVRVVPEYIFPSQGVYAVYPDA
                     QHVPTKVRAFIDFLRERTA"
     gene            382008..382385
                     /locus_tag="EAE_RS01915"
                     /old_locus_tag="EAE_01840"
                     /db_xref="GeneID:45318768"
     CDS             382008..382385
                     /locus_tag="EAE_RS01915"
                     /old_locus_tag="EAE_01840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703291.1"
                     /db_xref="GeneID:45318768"
                     /translation="MNPWIQEVIDAHVIIEQWLGRKEGSAQALMSRFAQEFTMVPISG
                     AKMDYPTVSGFFHSAGGSRPGLSIVVDNAQVLSEWHDGGAVLYRESQTLPEQGEVVRW
                     STAIFQRIEGKILWRHLQETRIG"
     gene            complement(382438..383430)
                     /gene="rpoS"
                     /locus_tag="EAE_RS01920"
                     /old_locus_tag="EAE_01845"
                     /db_xref="GeneID:45318769"
     CDS             complement(382438..383430)
                     /gene="rpoS"
                     /locus_tag="EAE_RS01920"
                     /old_locus_tag="EAE_01845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000081498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoS"
                     /protein_id="WP_015703292.1"
                     /db_xref="GeneID:45318769"
                     /translation="MSQNTLKVHDLNEDAEFDENGMEVFDEKALVEEEPSDSDLAEEE
                     LLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLV
                     VKIARRYSNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMN
                     QTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNER
                     ITSVDTPLGGDSEKALLDILADEKDNGPEDTTQDDDMKQSIVKWLFELNAKQREVLAR
                     RFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQGQGLNIEALFRE"
     gene            complement(383588..384730)
                     /gene="nlpD"
                     /locus_tag="EAE_RS01925"
                     /old_locus_tag="EAE_01850"
                     /db_xref="GeneID:45318770"
     CDS             complement(383588..384730)
                     /gene="nlpD"
                     /locus_tag="EAE_RS01925"
                     /old_locus_tag="EAE_01850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein hydrolase activator NlpD"
                     /protein_id="WP_015703293.1"
                     /db_xref="GeneID:45318770"
                     /translation="MSAGSPKFTVSRIAALSLVSLWLAGCTNTNNPPAPVNSASGAAS
                     SSTNSGMLITPPSSGAQQVPPAQPIQPMQTQPIQTQPTQVQPMAQQPVQTVNGKIVYN
                     RKYGDIPKGSYTGGSTYTVKRGDTLFYIAWVTGNDFRDLAERNNVPAPYALNVGQVLQ
                     VGNSAGQPITGENPVSQASAQASGGATATTTSAQKSTAVVASQPTITYSESSGEQSAT
                     KMLPNNKPATTTTAVAPVTAPSTVSTTQPTASSTSTSSPISSWRWPTDGKVIENFSGA
                     EGGNKGIDIAGSKGQAIVATADGRVVYAGNALRGYGNLIIIKHNDDYLSAYAHNDTML
                     VREQQEVKAGQKIATMGSTGTSSTRLHFEIRYKGKSVNPLQYLPQR"
     gene            complement(384855..385481)
                     /locus_tag="EAE_RS01930"
                     /old_locus_tag="EAE_01855"
                     /db_xref="GeneID:45318771"
     CDS             complement(384855..385481)
                     /locus_tag="EAE_RS01930"
                     /old_locus_tag="EAE_01855"
                     /EC_number="2.1.1.77"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-L-isoaspartate(D-aspartate)
                     O-methyltransferase"
                     /protein_id="WP_015369988.1"
                     /db_xref="GeneID:45318771"
                     /translation="MVSKRVESLLNQLRTQGIVDERVLEAIAQVPREKFVDEAFEHKA
                     WENTALPIGQGQTISQPYMVARMTELLELTPDSRVLEIGTGSGYQTAILAHLVHHVCS
                     VERIKSLQWQARRRLKQLDLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPAALMA
                     QLDEGGVLVLPVGEEHQYLKRIRRRGGEFFIDTVEAVRFVPLVRGELA"
     gene            complement(385475..386236)
                     /gene="surE"
                     /locus_tag="EAE_RS01935"
                     /old_locus_tag="EAE_01860"
                     /db_xref="GeneID:45318772"
     CDS             complement(385475..386236)
                     /gene="surE"
                     /locus_tag="EAE_RS01935"
                     /old_locus_tag="EAE_01860"
                     /EC_number="3.1.3.5"
                     /EC_number="3.1.3.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'/3'-nucleotidase SurE"
                     /protein_id="WP_015703294.1"
                     /db_xref="GeneID:45318772"
                     /translation="MRILLSNDDGIHAPGIQTLAKALREFAEVQVVAPDRNRSGASNS
                     LTLESSLRTFTFENGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVI
                     YSGTVAAAMEGRHLGFPALAVSLDGYQHYDTAAAVTCTILRALSREPLRTGRILNINV
                     PDLPLEQIKGIRVTRCGNRHPADQVIPQKDPRGNTLYWIGPPGDKRDAGPGTDFAAVD
                     EGYVSVTPLHVDLTAHQAHEVVTDWLERVGVDTQW"
     gene            complement(386217..387266)
                     /gene="truD"
                     /locus_tag="EAE_RS01940"
                     /old_locus_tag="EAE_01865"
                     /db_xref="GeneID:45318773"
     CDS             complement(386217..387266)
                     /gene="truD"
                     /locus_tag="EAE_RS01940"
                     /old_locus_tag="EAE_01865"
                     /EC_number="5.4.99.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(13) synthase TruD"
                     /protein_id="WP_015703295.1"
                     /db_xref="GeneID:45318773"
                     /translation="MIAFDDLTYLHGKPLGQGRLKANPEDFLVVEDLGFAPDGEGEHV
                     LVRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLS
                     KFQLEGCQVLEYARHKRKLRLGALKGNQFTLILREISDRDDVEKRLQAIADGGVPNYF
                     GAQRFGIGGSNLQGALRWAENGEPVRDRNKRSFWLSAARSALFNQQVAIRLKKTEFNQ
                     VVDGDALQLAGRGSWFVATTEELAELQARVDNRELMITAALPGSGDWGSQRDALAAEQ
                     AAIAEETSLQALLAREKVEAARRAMLLYPQQLCWNWWDDVTVELRFWLPAGSFATSVV
                     RELINTTGDYANIAE"
     gene            complement(387263..387742)
                     /gene="ispF"
                     /locus_tag="EAE_RS01945"
                     /old_locus_tag="EAE_01870"
                     /db_xref="GeneID:45318774"
     CDS             complement(387263..387742)
                     /gene="ispF"
                     /locus_tag="EAE_RS01945"
                     /old_locus_tag="EAE_01870"
                     /EC_number="4.6.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_015703296.1"
                     /db_xref="GeneID:45318774"
                     /translation="MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHAL
                     TDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQA
                     PKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLRKAAQ"
     gene            complement(387742..388452)
                     /gene="ispD"
                     /locus_tag="EAE_RS01950"
                     /old_locus_tag="EAE_01875"
                     /db_xref="GeneID:45318775"
     CDS             complement(387742..388452)
                     /gene="ispD"
                     /locus_tag="EAE_RS01950"
                     /old_locus_tag="EAE_01875"
                     /EC_number="2.7.7.60"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="WP_015703297.1"
                     /db_xref="GeneID:45318775"
                     /translation="MAATFPGVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVAA
                     LLANERVQRVVIAVSPGDVRFSQLPLAHHPQVTVVDGGAERADSVLAGLKALADAQWV
                     LVHDAARPCLHQDDLSRLLALSATSRVGGILAAPVRDTMKRAEPGKTAIAHTVERNDL
                     WHALTPQFFPRELLFDCLTRALDEGATITDEASALEYCGFHPELVAGRADNIKVTRPE
                     DLALAEFYLTRSRHQEKA"
     gene            complement(388472..388783)
                     /gene="ftsB"
                     /locus_tag="EAE_RS01955"
                     /old_locus_tag="EAE_01880"
                     /db_xref="GeneID:45318776"
     CDS             complement(388472..388783)
                     /gene="ftsB"
                     /locus_tag="EAE_RS01955"
                     /old_locus_tag="EAE_01880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsB"
                     /protein_id="WP_015369983.1"
                     /db_xref="GeneID:45318776"
                     /translation="MGKLTLLLLALLVWLQYSLWFGKNGLHDYSRVNDDVSAQQATNA
                     KLKARNDQLFAEIDDLNGGQEAIEERARNELSMTRPGETFYRLVPDASKRNQGSAQNN
                     R"
     gene            complement(388922..389248)
                     /locus_tag="EAE_RS01960"
                     /old_locus_tag="EAE_01885"
                     /db_xref="GeneID:45318777"
     CDS             complement(388922..389248)
                     /locus_tag="EAE_RS01960"
                     /old_locus_tag="EAE_01885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3561 family protein"
                     /protein_id="WP_015369982.1"
                     /db_xref="GeneID:45318777"
                     /translation="MRNTQNLSIIRSEPPPAASDETTWSLSGAAVGFISWLLALGIPF
                     LLYGGNTLFFFLYTWPFFLAIMPVAVVVGIALHSLLDGKLIYSVCATILTVGLMFGLL
                     FLWLLG"
     gene            complement(389299..389904)
                     /gene="cysC"
                     /locus_tag="EAE_RS01965"
                     /old_locus_tag="EAE_01890"
                     /db_xref="GeneID:45318778"
     CDS             complement(389299..389904)
                     /gene="cysC"
                     /locus_tag="EAE_RS01965"
                     /old_locus_tag="EAE_01890"
                     /EC_number="2.7.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylyl-sulfate kinase"
                     /protein_id="WP_015369981.1"
                     /db_xref="GeneID:45318778"
                     /translation="MARHDENVVWHAHPVTREQREQHHGHRGVVLWFTGLSGSGKSTV
                     AGALEEALHELGVSTYLLDGDNVRHGLCSDLGFSDDDRKENIRRVGEVAKLMVDAGLV
                     VLTAFISPHRAERQMVRERLGEGRFIEVFVDTPLAICETRDPKGLYKKARAGELRNFT
                     GIDSVYESPENAEIHLDGEQLVTNLVHQLLDLLRQSDIIRS"
     gene            complement(389904..391331)
                     /gene="cysN"
                     /locus_tag="EAE_RS01970"
                     /old_locus_tag="EAE_01895"
                     /db_xref="GeneID:45318779"
     CDS             complement(389904..391331)
                     /gene="cysN"
                     /locus_tag="EAE_RS01970"
                     /old_locus_tag="EAE_01895"
                     /EC_number="2.7.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit CysN"
                     /protein_id="WP_015703298.1"
                     /db_xref="GeneID:45318779"
                     /translation="MNTTIAQQIAKEGGVEAYLHAQQHKSLLRFLTCGSVDDGKSTLI
                     GRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYF
                     STEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFISTLLGI
                     KHLVVAVNKMDLVEFSEARFNEIREDYLTFAEQLPGKLDIRFVPLSALEGDNVATQSD
                     KMPWYSGPTLLEVLETVDIQREVESQPLRFPVQYVNRPNLDFRGFSGTVASGTVTVGQ
                     RLKVLPSGVESNVARIVTFDGDLPQAGAGEAITIVLKDEIDISRGDLLVDAEASLPAV
                     QSASIDVVWMAEQALSPGQSYDIKVAGKKTRARVDAIRYQVDINNLTQREVETLPLNG
                     IGLVELTFDEPLVLDPYQNNPVTGGLIFIDRLSNVTVGAGMVNEPHLQAQAPTSQYSA
                     FELELNQLIRKHFPHWDARDLLGGK"
     gene            complement(391341..392249)
                     /gene="cysD"
                     /locus_tag="EAE_RS01975"
                     /old_locus_tag="EAE_01900"
                     /db_xref="GeneID:45318780"
     CDS             complement(391341..392249)
                     /gene="cysD"
                     /locus_tag="EAE_RS01975"
                     /old_locus_tag="EAE_01900"
                     /EC_number="2.7.7.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit CysD"
                     /protein_id="WP_015369979.1"
                     /db_xref="GeneID:45318780"
                     /translation="MDQKRLTHLRQLEAESIHIIREVAAEFSNPVMMYSIGKDSSVML
                     HLARKAFYPGTLPFPLLHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINP
                     FVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDP
                     KNQRPELWHNYNGQINKGESIRVFPLSNWTELDIWQYIYLENIEIVPLYLAAERPVLE
                     RDGMLMMIDDDRIDLQPGEMIKKQMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVST
                     TSERQGRVIDRDQAGSMELKKRQGYF"
     gene            complement(392259..393665)
                     /gene="cobA"
                     /locus_tag="EAE_RS01980"
                     /old_locus_tag="EAE_01905"
                     /db_xref="GeneID:45318781"
     CDS             complement(392259..393665)
                     /gene="cobA"
                     /locus_tag="EAE_RS01980"
                     /old_locus_tag="EAE_01905"
                     /EC_number="2.1.1.107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_162870458.1"
                     /db_xref="GeneID:45318781"
                     /translation="MPLFAELKERPVLVIGGGEVAVRKIKFLLRAQAKVQVVAAVLSP
                     ELAEQVERQQISWRATAFDEQQVDDVFLVIAATDDRELNQRVFAAANARYRLVNVVDD
                     QQLCSFVFPSIVDRSPLLVAISSSGKAPVLSRILREKIEALLPTNLGRLAETASYWRH
                     HLKTRLTTTEARRRFWERVFTGRFASLMVAGNHAAAERALQDELDRPERSVGEIILVG
                     AGPGDAGLLTLRGLQAIQQADVVFYDHLVTESVRELVRRDAEMICVGKRAGEHSVPQH
                     ETNQMLVEAAKAGKTVVRLKGGDPFIFGRGGEELQAAAAAGIPFQVVPGVTAAAGATA
                     YAGIPLTHRDYAQSAVFVTGHYKSDSAPFDWALLAKSQQTLAIYMGTMKAADISAQLI
                     AHGRDANTPVAVISRGTREDQQTLTGTLQQLEHLAKDAPMPALLVVGEVVQLHQQLAW
                     FQHTTTAEGFNSSVVNLA"
     gene            393912..394958
                     /locus_tag="EAE_RS01985"
                     /old_locus_tag="EAE_01910"
                     /db_xref="GeneID:45318782"
     CDS             393912..394958
                     /locus_tag="EAE_RS01985"
                     /old_locus_tag="EAE_01910"
                     /EC_number="3.4.11.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_015703300.1"
                     /db_xref="GeneID:45318782"
                     /translation="MFSAMCRRLLPLALGTGFVFSAAPAFSALGDTANTQARHIATVF
                     PGRMTGTPAEMLSADYLRQQFAQMGYQSDVRSFNTRYIYTDSNQRKNWHNATGSTVIA
                     AHEGQSRQQIIIMAHLDTYAPQSDKDVENNLGGLTLQGIDDNAMGLGVLLELAEHLKN
                     VPTRYGIRFIATSGEEEGRLGAQNILKRMSEAEKKNTLLVINLDNLVVGDKLYFNSGR
                     STPASVRKLTRDRALAIARSHGIAAFTNPGLNPEFPKGTGCCNDASVFDNAGIPVLSV
                     EATNWSLGKKDGYQQRSKTRSFPQGTSWHDVQLDNQQYIDKALPGRIEHRGRDVVKVM
                     LPLVKELAKVEKKN"
     gene            complement(395032..395766)
                     /gene="cysH"
                     /locus_tag="EAE_RS01990"
                     /old_locus_tag="EAE_01915"
                     /db_xref="GeneID:45318783"
     CDS             complement(395032..395766)
                     /gene="cysH"
                     /locus_tag="EAE_RS01990"
                     /old_locus_tag="EAE_01915"
                     /EC_number="1.8.4.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenosine phosphosulfate reductase"
                     /protein_id="WP_015369976.1"
                     /db_xref="GeneID:45318783"
                     /translation="MSKLDLNALNDLPKVERVMALAEVNTQLEKLSAEERVAWALENL
                     PGDYALSSSFGIQAAVSLHLVNQLRPDIPVILTDTGYLFPETYQFIDELTEKLNLNLK
                     VYRATESAAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELNTRTWFAGLRREQ
                     SGSRAHLPVLAIQRGVFKLLPIIDWDNRTVYQYLQKHGLKYHPLWEQGYLSVGDTHTT
                     RKWEPGMAEEETRFFGLKRECGLHEG"
     gene            complement(395868..397580)
                     /gene="cysI"
                     /locus_tag="EAE_RS01995"
                     /old_locus_tag="EAE_01920"
                     /db_xref="GeneID:45318784"
     CDS             complement(395868..397580)
                     /gene="cysI"
                     /locus_tag="EAE_RS01995"
                     /old_locus_tag="EAE_01920"
                     /EC_number="1.8.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="assimilatory sulfite reductase (NADPH)
                     hemoprotein subunit"
                     /protein_id="WP_015369975.1"
                     /db_xref="GeneID:45318784"
                     /translation="MSEKHPGPLVVEGKLSDAERMKIESNYLRGTIAEDLNDGLTGGF
                     KGDNFLLIRFHGMYQQDDRDIRAERAAQKLEPRHAMLLRCRLPGGVITTKQWQAIDKF
                     AADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSN
                     PFESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKT
                     TVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGY
                     LPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGVETFKAEVERRAGIKFEPI
                     RPYEFTGRGDRIGWVKGIDNNWHLTLFIENGRILDYPGRPLKTGLLEIAKIHKGEFRI
                     TANQNLIIASVPEDQKARIEKLARDHGLMNAVTAQRENSMACVSFPTCPLAMAEAERF
                     LPSFIDKVEEVMSKHGVGDEHIVTRVTGCPNGCGRAMLAEVGLVGKAPGRYNLHIGGN
                     RSGTRIPRMYRENITEPEILASLDELVGRWAKEREAGEGFGDFTVRAGIIRPVLDPAR
                     DFWE"
     gene            complement(397580..399379)
                     /gene="cysJ"
                     /locus_tag="EAE_RS02000"
                     /old_locus_tag="EAE_01925"
                     /db_xref="GeneID:45318785"
     CDS             complement(397580..399379)
                     /gene="cysJ"
                     /locus_tag="EAE_RS02000"
                     /old_locus_tag="EAE_01925"
                     /EC_number="1.8.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_417244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent assimilatory sulfite reductase
                     flavoprotein subunit"
                     /protein_id="WP_015703301.1"
                     /db_xref="GeneID:45318785"
                     /translation="MTTQAPPSNLLPLNPEQLARLQAATTDFTPTQLAWVSGYFWGML
                     NQQPGAVVSAPVQAVEAPAITLISASQTGNARRVAEALRDDLQAAQLNVKLVNAGDYK
                     FKQIAGEKLLVVVTSTQGEGEPPEEAVALHKLLFSKKAPKLDGTAFAVFGLGDTSYEF
                     FCQSGKDFDSKLAELGGERLLDRVDADVEYQAAAAEWRARVVDVLKARAPTAAPAQLA
                     TSGAVNEIHTSPYTKEAPLTATLAVNQKITGRDSEKDVRHIEIDLGDSGLRYQPGDAL
                     GVWYQNDPALVKELVELLWLKGDEPVTVEGKTLPLAQALEWHFELTVNTANIVENYAT
                     LTRSETLLPLVGDKAQLQHYAATTPIVDMVRFSPAQLNAEALIGLLRPLTPRLYSIAS
                     SQAEAENEVHVTVGVVRYDIEGRARAGGASSFLADRVEEDGEVRIFIEHNDNFRLPAN
                     PQTPVIMIGPGTGIAPFRAFMQQRAAEGAEGKNWLFFGNPHFTEDFLYQVEWQSYVKE
                     GVLSRIDLAWSRDQQQKIYVQDKLREQGAEVWRWINDGAHIYVCGDANRMAKDVEQAL
                     LEVIAEYGAMDAEAADEFLSELRVERRYQRDVY"
     gene            399697..400062
                     /gene="queD"
                     /locus_tag="EAE_RS02005"
                     /old_locus_tag="EAE_01930"
                     /db_xref="GeneID:45318786"
     CDS             399697..400062
                     /gene="queD"
                     /locus_tag="EAE_RS02005"
                     /old_locus_tag="EAE_01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxytetrahydropterin synthase QueD"
                     /protein_id="WP_162866946.1"
                     /db_xref="GeneID:45318786"
                     /translation="MMSTTLFKDFTFEAAHHLPHVPKGHKCGRLHGHSFMVRLEITGE
                     VDPHTGWIMDFAELKAAFKPTYDRLDHYYLNDIPGLENPTSEVLAKWIWDQMKPQVPL
                     LSAVMVKETCTAGCVYRGE"
     gene            complement(400129..400917)
                     /locus_tag="EAE_RS02010"
                     /old_locus_tag="EAE_01935"
                     /db_xref="GeneID:45318787"
     CDS             complement(400129..400917)
                     /locus_tag="EAE_RS02010"
                     /old_locus_tag="EAE_01935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_015703303.1"
                     /db_xref="GeneID:45318787"
                     /translation="MQPIDPSTAFSMDFFSLKGKTAIVTGGNSGLGQAFAVALATAGA
                     NLFVPALREEHTQTRKLIEQQGVELEFMLADITDGGMPQRIIAACCERFGTVDILVNN
                     AGICQLNKVLRFGRTDWDPMIETNLTAAFELSHEAAKIMVPRRSGKIINICSVFSYLG
                     GSWSPAYAATKHALAGLTKAYCDELGPHNIQVNGIAPGYYETAMTAITRSIPKENRRV
                     LAHIPAGRWGEAQDLMGAVVFLASRASDYVNGHILAVDGGYLVR"
     gene            complement(401109..401780)
                     /gene="queE"
                     /locus_tag="EAE_RS02015"
                     /old_locus_tag="EAE_01940"
                     /db_xref="GeneID:45318788"
     CDS             complement(401109..401780)
                     /gene="queE"
                     /locus_tag="EAE_RS02015"
                     /old_locus_tag="EAE_01940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001199960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-carboxy-7-deazaguanine synthase QueE"
                     /protein_id="WP_015369971.1"
                     /db_xref="GeneID:45318788"
                     /translation="MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTW
                     DKLADREVSLFSILAKTKESDKWGPATSDDLLAIIGRQGWTARHVVITGGEPCIHDLT
                     PLTDLLEQHGFSCQIETSGTHEVRCSHNTWVTVSPKVNMRGGYDVLSQALQRADEIKH
                     PVGRVRDIEALDELLETLADEKPRIIALQPISQKEDATRLCIETCIARNWRLSMQTHK
                     YLNIA"
     gene            402295..403404
                     /locus_tag="EAE_RS02020"
                     /old_locus_tag="EAE_01945"
                     /db_xref="GeneID:45318789"
     CDS             402295..403404
                     /locus_tag="EAE_RS02020"
                     /old_locus_tag="EAE_01945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase family
                     protein"
                     /protein_id="WP_015703304.1"
                     /db_xref="GeneID:45318789"
                     /translation="MNTLLITGVTGFLGGAVLENILNNENGINLLLLVRANNDEAALA
                     RVKENLRKFNIAEEKLAALTPRQILLGDLSSPEAFLSDPRLEQVTHVINSAAVASFGN
                     NPLIWKVNVEGTFKFAQRMSRVAGLQRFLHVGTAMSCTPEPDSLVAESAEFREHAEHL
                     VEYTHSKSTIERLMQEQCPTLPLAIARPSIVVGHTHHGCQPSSSIFWVFSMGLMLQKF
                     LCSLEDRVDVIPVDYCADALLMLLQRPLARGEVVHISAGEENSVKFAEIDRAMASALE
                     QAPVGDRYAQVSYETLVKMRRELKDIFGPCNERLMLKAMRLYGAFATLNVRFSNDKLL
                     SMGMPKPPRFTDYIDRCVQTTRGLSIPQQMAVDFK"
     gene            complement(403471..404769)
                     /gene="eno"
                     /locus_tag="EAE_RS02025"
                     /old_locus_tag="EAE_01950"
                     /db_xref="GeneID:45318790"
     CDS             complement(403471..404769)
                     /gene="eno"
                     /locus_tag="EAE_RS02025"
                     /old_locus_tag="EAE_01950"
                     /EC_number="4.2.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020456663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="WP_015369968.1"
                     /db_xref="GeneID:45318790"
                     /translation="MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTG
                     SREALELRDGDKSRFLGKGVTKAVAAVNGPIAQAVLGKDAKDQAGIDKIMIDLDGTEN
                     KSNFGANAILAVSLANAKAAAASKGQPLFEHIAELNGTPGKYSMPVPMMNIINGGEHA
                     DNNVDIQEFMIQPVGAPTLKEAVRMGSEVFHHLAKVLKSKGMNTAVGDEGGYAPNLGS
                     NAEALAVIAEAVKAAGYELGKDITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHF
                     LEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKG
                     IANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQI
                     KTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA"
     gene            complement(404851..406488)
                     /gene="pyrG"
                     /locus_tag="EAE_RS02030"
                     /old_locus_tag="EAE_01955"
                     /db_xref="GeneID:45318791"
     CDS             complement(404851..406488)
                     /gene="pyrG"
                     /locus_tag="EAE_RS02030"
                     /old_locus_tag="EAE_01955"
                     /EC_number="6.3.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase (glutamine hydrolyzing)"
                     /protein_id="WP_015703305.1"
                     /db_xref="GeneID:45318791"
                     /translation="MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPY
                     INVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMTRRNNFTTGRIYSDVLRK
                     ERRGDYLGATVQVIPHITNAIKERVLAGGEGHDVVLVEIGGTVGDIESLPFLEAIRQM
                     AVEIGREHTLFMHLTLVPYMAAAGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPA
                     NERAKIALFCNVPEKAVISLKDVDSIYKIPGLLKSQGLDDYICKRFSLTCPEANLAEW
                     EQVIYEEANPAGEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVTVNIKLIDSQDVE
                     TRGVEILKDLDAILIPGGFGYRGVEGKIATARYARENNIPYLGICLGMQVALIEFARN
                     VAGMENANSTEFVPDCKYPVVALITEWRDEEGNVEVRSEKSDLGGTMRLGAQQCQLGD
                     DSLVRQLYGEPTITERHRHRYEVNNMLLKPIEAAGLRVAGRSGDDQLVEIIEVPNHPW
                     FVACQFHPEFTSTPRDGHPLFAGFVKAASEYQKRQAK"
     gene            complement(406768..407559)
                     /gene="mazG"
                     /locus_tag="EAE_RS02035"
                     /old_locus_tag="EAE_01960"
                     /db_xref="GeneID:45318792"
     CDS             complement(406768..407559)
                     /gene="mazG"
                     /locus_tag="EAE_RS02035"
                     /old_locus_tag="EAE_01960"
                     /EC_number="3.6.1.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="WP_015703306.1"
                     /db_xref="GeneID:45318792"
                     /translation="MTQIDRLLGIMRRLRDPENGCPWDKEQTFATIAPYTLEETYEVL
                     DAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHIFGD
                     ASAGNSAEVLARWEQIKSAERAEKAQHSALDDIPHSLPALMRAHKIQRRCSAVGFDWT
                     SLGPVLDKVHEEIDEVMHEAQQAVVDEAKLEEEVGDLLFATVNLSRHLGVKAEVALQK
                     ANLKFERRFREVERIVAARGLEMTGVDLETMEEVWQEVKRQETDL"
     gene            complement(407631..409868)
                     /gene="relA"
                     /locus_tag="EAE_RS02040"
                     /old_locus_tag="EAE_01965"
                     /db_xref="GeneID:45318793"
     CDS             complement(407631..409868)
                     /gene="relA"
                     /locus_tag="EAE_RS02040"
                     /old_locus_tag="EAE_01965"
                     /EC_number="2.7.6.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP diphosphokinase"
                     /protein_id="WP_015703307.1"
                     /db_xref="GeneID:45318793"
                     /translation="MVAVRSAHLNKAGEFDPKKWIASLGISSQQSCERLAETWDYCRV
                     TTQGHPQADLLLWRGVEMVEILSMLNMDIDTLRAALLFPLADGNVVSEEVLQESVGKS
                     VVTLIHGVRDMAAIRQLKATHTDTVSSEQVDNIRRMLLAMVDDFRCVVIKLAERIAHL
                     REVKDEPEDERVLAAKECTNIYAPLANRLGIGQLKWELEDYCFRYLHPAEYKRIAKLL
                     HERRIDREHYIDEFVGHLRSEMKNEGVKAEVYGRPKHIYSIWRKMQKKHLAFDELFDV
                     RAVRIVAERLQDCYAALGIVHTHYRHLPDEFDDYVANPKPNGYQSIHTVVLGPGGKTV
                     EIQIRTKQMHEDAELGVAAHWKYKEGTSAGASGGRGHEDRIAWLRKLIAWQEEMADSG
                     EMLDEVRSQVFDDRVYVFTPKGDVVDLPAGSTPLDFAYHIHSDVGHRCIGAKIGGRIV
                     PFTYQLQMGDQIEIITQKQPNPSRDWLNPNLGYVTTSRGRSKIHAWFRKQDRDKNILA
                     GRQILDDELEHLGISLKDAEKHLLPRYNFNELDELLAAIGGGDIRLNQMVNFLQAQFN
                     KPSAAEQDAAALKQLQQKTYTPQNRSKDNGRVVVEGVGNLMHHIARCCQPIPGDEIVG
                     FITQGRGISVHRADCDQLAELQSHAPERIVDAVWGESYSAGYSLVVRVVANDRSGLLR
                     DITTILANEKVNVLGVASRSDTKQQLATIDMTIEIYNLQVLGRVLGKLNQVPDVIDAR
                     RLHGG"
     gene            complement(409997..411301)
                     /gene="rlmD"
                     /locus_tag="EAE_RS02045"
                     /old_locus_tag="EAE_01970"
                     /db_xref="GeneID:45318794"
     CDS             complement(409997..411301)
                     /gene="rlmD"
                     /locus_tag="EAE_RS02045"
                     /old_locus_tag="EAE_01970"
                     /EC_number="2.1.1.190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (uracil(1939)-C(5))-methyltransferase
                     RlmD"
                     /protein_id="WP_015703308.1"
                     /db_xref="GeneID:45318794"
                     /translation="MAQFYSAKRRVTTRQIITVTVNDLDPFGQGVARHQGKALFIPGL
                     LPQEQAEVVLVEDKKQYARAQVKRRLNDSPQRVAPRCPHFGVCGGCQQQHASIELQQQ
                     SKRAALSRLMKRDVDDIIAAEPWGYRRRARLSLNYQPKTQQLQMGFRKANSSEIIDVV
                     QCPVLAPQLEALLPAVRECLTSLQSQRQLGHVELVQADNGPLMVLRHTAALTAADKEK
                     LERFSQTHGLSLYLAPQSEILEHIRGDEPWYTSDGLRLVFSPRDFIQVNDGVNQKMVR
                     TALAWLDIQPQDRVLDLFCGMGNFTLPLAKAAASVVGVEGVPALVAKGRENAALNELQ
                     NVTFFHENLEEDVTRQAWAKHGFDKILLDPARAGAPGVMAHIIKLAPRRVVYVSCNPA
                     TLARDSEALLQVGYRIQRLAMLDMFPHTGHLESIVLFERELT"
     gene            411412..414162
                     /gene="barA"
                     /locus_tag="EAE_RS02050"
                     /old_locus_tag="EAE_01975"
                     /db_xref="GeneID:45318795"
     CDS             411412..414162
                     /gene="barA"
                     /locus_tag="EAE_RS02050"
                     /old_locus_tag="EAE_01975"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase BarA"
                     /protein_id="WP_015369963.1"
                     /db_xref="GeneID:45318795"
                     /translation="MTNYSLRARMMILILAPTVLIGLLLSIFFVAHRYNDLQRQLEDA
                     GASIIEPLAVSSEYGMNLQNREAIGQLISVLHRRHSDIVRAISIYDAKNRLFVTSNFQ
                     LDPREIQLPRGAPFPRRLSVTRHGDIMVLRTPIVSESYLPDESPESDAKMPDNMLGYV
                     ALELDLKSVRLQQYKEIFISSVMMLFCIGIALIFGWRLMRDVTGPIRNMVNTVDRIRR
                     GQLDSRVEGFMLGELDMLKNGINSMAMSLAAYHEEMQHNVDQATSDLRETLEQMEIQN
                     VELDLAKKRAQEAARIKSEFLANMSHELRTPLNGVIGFTRLTLKTDLNATQRDHLTTI
                     ERSANNLLAIINDVLDFSKLEAGKLILESIPFLLRNTLDEVVTLLAHSAHDKGLELTL
                     NIKSDVPDNVIGDPLRLQQVITNLVGNAIKFTEHGNIDVLVEQRAMSNSRVQIEVQIH
                     DTGIGIPERDQSRLFQAFRQADASISRRHGGTGLGLVITQRLVKEMGGDISFHSQPNR
                     GSTFWFHISLDLNPNAITDGFDTHCLAGKKLAYIEANTTAAQSTMELLATTPLEVVYS
                     PTLSALPDAHYDILLAGIPVSMRDLSNQREKLVRACSLSDTLVLGLPCHAQVSAEELK
                     RNGVTACLLKPLTSTRLFPVLMASCRAQPPVPQPYIDSDKLAMTVMAVDDNPANLKLI
                     GALLDDLVQHVILCDSGQDAVEQAKQSQLDLILMDIQMPDMDGIRACELIRHLPHQQQ
                     TPVIAVTAHALEGQREKLLAAGMNDYLAKPIEEDKLSTLLLRYQPGMHVAAPQLAEPV
                     EPVIDHNVTLNWQLALRQAAMKPDLAREMLQMLLAFMPEVRNKVEEQLVGETPEGLLD
                     LIHKLHGSCSYSGVPRLKKLCHTLESQLRAGTAPEELEPELLELLDEMDNVAREACKM
                     GV"
     gene            complement(414312..415451)
                     /locus_tag="EAE_RS02055"
                     /old_locus_tag="EAE_01980"
                     /db_xref="GeneID:45318796"
     CDS             complement(414312..415451)
                     /locus_tag="EAE_RS02055"
                     /old_locus_tag="EAE_01980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerate kinase"
                     /protein_id="WP_015703309.1"
                     /db_xref="GeneID:45318796"
                     /translation="MKIVIAPDSYKESLSALDVATAIETGFREIYPHAEYVKVPVADG
                     GEGTVEAMVAATQGHIVQVSVTGPLGEPVNAFYGLSGDMRCAYIEMAAASGLESVPPT
                     RRNPLLTTSWGTGELIRHALDAGVSQIIIGIGGSATNDGGAGMAQALGAKLLSAGQQQ
                     IAPGGGALETLARIDLSELDPRLADCRIDVACDVTNPLTGPQGASAVFGPQKGATAAM
                     IERLDRGLQHFAQIIDRDLDIDVLSLEGGGAAGGMGAALYAFCGANLRPGIEIVTDAL
                     GLADLVADADLVITGEGRIDSQTIHGKVPVGVAKVAKRFNVPVIGIAGSLTADVGVVH
                     QHGLDAVFSVLYSVCTLDEALANAAANVRMTARNVAAVLEMGGKR"
     gene            complement(415518..416858)
                     /gene="gudD"
                     /locus_tag="EAE_RS02060"
                     /old_locus_tag="EAE_01985"
                     /db_xref="GeneID:45318797"
     CDS             complement(415518..416858)
                     /gene="gudD"
                     /locus_tag="EAE_RS02060"
                     /old_locus_tag="EAE_01985"
                     /EC_number="4.2.1.40"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucarate dehydratase"
                     /protein_id="WP_015703310.1"
                     /db_xref="GeneID:45318797"
                     /translation="MTTSSSTPIVTAMQVIPVAGHDSMLMNLSGAHAPYFTRNIVIIK
                     DNSGHTGVGEIPGGEKIRQTLEDAAPLVVGKTLGEYKNVLSAVRNQFADRDAGGRGLQ
                     TFDLRTTIHVVTGIEAALLDLLGQHLGVNVASLLGDGQQRSEVEMLGYLFFVGNRHAT
                     PLAYQSQPDEQCDWYRIRHEEAMTPEAVVRLAEAAYEKYGFNDFKLKGGVLAGFEEAE
                     AISALAKRFPDARVTLDPNGAWLLDEAIQIGKQLKGVLAYAEDPCGAEQGFSGREVMA
                     EFRRATGLPTATNMIATDWRQMGHTLSLQSVDIPLADPHFWTMQGSVRVAQMCHEFGL
                     TWGSHSNNHFDVSLAMFTHVAAAAPGKITAIDTHWIWQEGNQRLTKQPFEIKGGMVQV
                     PTTPGLGVELDMDRVMQANELYKKHGLGARDDAMAMQYLIPNWTFDNKRPCMVR"
     gene            complement(416876..418216)
                     /locus_tag="EAE_RS02065"
                     /old_locus_tag="EAE_01990"
                     /db_xref="GeneID:45318798"
     CDS             complement(416876..418216)
                     /locus_tag="EAE_RS02065"
                     /old_locus_tag="EAE_01990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucarate dehydratase"
                     /protein_id="WP_015703311.1"
                     /db_xref="GeneID:45318798"
                     /translation="MNTQSSPIVTEMKVIPVAGHDSMLMNIGGAHNAWFTRNIVVLTD
                     NAGHTGVGEAPGGEVIYQTLVDAIPQVVGQEVARLNRVVQQVHKGNQAADFDTFGKGA
                     WTFELKVNAVAALEAALLDLLGKVLNVPVCELLGPGKQRDAVTVLGYLFYIGDREKTD
                     LDYLARTPGDHEWYRLRHQQALNSDAVVRLAEAAQDRYGFKDFKLKGGVLPGEQEIDT
                     ARALKKRFPDARITVDPNGAWLLDEAITLCKGLQDVLTYAEDPCGAEQGFSGREVMAE
                     FRRATGLPVATNMIATNWREMGHAVMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLT
                     WGCHSNNHFDISLAMFTHVGAAAPGNPTAIDTHWIWQEGDARLTQNPLQIINGKIAVP
                     DAPGLGVELDWEQVHKAHEAYKALPGGARNDAGPMQYLIPGWTFDRKRPVFGRH"
     gene            complement(418219..419571)
                     /locus_tag="EAE_RS02070"
                     /old_locus_tag="EAE_01995"
                     /db_xref="GeneID:45318799"
     CDS             complement(418219..419571)
                     /locus_tag="EAE_RS02070"
                     /old_locus_tag="EAE_01995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703312.1"
                     /db_xref="GeneID:45318799"
                     /translation="MSSLSQAASAAEKRTNARYWIVVMLFIVTSFNYGDRATLSIAGS
                     EMAKDIGLDPVGMGYVFSAFSWAYVIGQIPGGWLLDRFGSKRVYFWSIFIWSVFTLLQ
                     GFVDIFSGFGIIIALFTLRFLVGLAESPSFPGNSRIVAAWFPAQERGTAVSIFNSAQY
                     FATVIFAPIMGWLTHEVGWSHVFFFMGGLGIVISFVWLKVIHDPNNHPGVNQKELDYI
                     AEGGALINMDQKSSAQKVPFNVKMGQIKQLIGSRMMVGIYIGQYCINALTYFFITWFP
                     VYLVQARGMSILKAGFVASIPAVCGFVGGVLGGIISDWLMRRTGSLNIARKTPIVLGM
                     LLSMTMLMCNYVNAEWMIIGFMAMAFFGKGIGALGWAVMADTAPKEISGLSGGLFNMF
                     GNISGIVTPIAIGYIVGTTGSFNGALIYVGIHALVAVFSYLVLVGDIKRIELKPIAGR
                     "
     gene            419811..419960
                     /locus_tag="EAE_RS24995"
                     /old_locus_tag="EAE_02000"
                     /db_xref="GeneID:45323375"
     CDS             419811..419960
                     /locus_tag="EAE_RS24995"
                     /old_locus_tag="EAE_02000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015369958.1"
                     /db_xref="GeneID:45323375"
                     /translation="MENRRPLMGRWTTLPSECESALLTPGKRKEKSHIDKVVIRQMPE
                     AGRDG"
     gene            complement(420044..420487)
                     /locus_tag="EAE_RS02075"
                     /old_locus_tag="EAE_02005"
                     /db_xref="GeneID:45318800"
     CDS             complement(420044..420487)
                     /locus_tag="EAE_RS02075"
                     /old_locus_tag="EAE_02005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014226602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin"
                     /protein_id="WP_015369957.1"
                     /db_xref="GeneID:45318800"
                     /translation="MAEVGIFVGTMYGNSLLVAEEAEAILSGLGHKATVFEDPEVKDW
                     ESYTGKYVLVVTSTTGQGDLPDSIVPLYEGIKDMYQPHLRYGIIALGDSTYANFCGGG
                     KTFDALLQEQGARRIGEMLTIDASEDPEPESVSNPWVEAWAKLLD"
     gene            complement(420493..421287)
                     /gene="truC"
                     /locus_tag="EAE_RS02080"
                     /old_locus_tag="EAE_02010"
                     /db_xref="GeneID:45318801"
     CDS             complement(420493..421287)
                     /gene="truC"
                     /locus_tag="EAE_RS02080"
                     /old_locus_tag="EAE_02010"
                     /EC_number="5.4.99.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine(65) synthase TruC"
                     /protein_id="WP_015703313.1"
                     /db_xref="GeneID:45318801"
                     /translation="MLEIIYQDQWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIG
                     QHVFTAHRLDRPTSGVLLMGLSSEAGRLLAQQFEQHQMQKRYHAIVRGWLTEEAVLDY
                     PLVEELDKIADKFAREDKGPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGR
                     KHQLRRHLAHLRHPILGDSKHGDLRQNRSAAEHFGCNRLMLHASQLSLTHPFTGEPLT
                     IRAGLDDVWMRALSQFGWRGLLPLNERVEFADDSGQDESIADNPGR"
     gene            complement(421287..421616)
                     /locus_tag="EAE_RS02085"
                     /old_locus_tag="EAE_02015"
                     /db_xref="GeneID:45318802"
     CDS             complement(421287..421616)
                     /locus_tag="EAE_RS02085"
                     /old_locus_tag="EAE_02015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqcC family protein"
                     /protein_id="WP_015369955.1"
                     /db_xref="GeneID:45318802"
                     /translation="MTLHASVRDRLHAIEALLRETNHWQEQAPDSRAFASEQPFCLDT
                     LEPLEWLQWVLIPRMHQLIASGMPLPQNFAVAPYYEMALDKAHPAREAIVAELLLLDA
                     LFADEDA"
     gene            complement(422247..422792)
                     /gene="syd"
                     /locus_tag="EAE_RS02090"
                     /old_locus_tag="EAE_02020"
                     /db_xref="GeneID:45318803"
     CDS             complement(422247..422792)
                     /gene="syd"
                     /locus_tag="EAE_RS02090"
                     /old_locus_tag="EAE_02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SecY-interacting protein"
                     /protein_id="WP_015369954.1"
                     /db_xref="GeneID:45318803"
                     /translation="MDHQTIEALQSFTQRYCDAWQQRYASLPRSEDLYGIPSPCISAS
                     EDDAVFWQPQPFTLEHHLDGVERALEIVVQQPIHSYYTTQFAGDMHARFAEQNLTLLQ
                     AWSPDDFQRVQENLIGHLVVQKRLKLSPTLFIATLDSELEVISVCNLSGEVIKETLGT
                     RKRETLSHSLASFLNQLEPLL"
     gene            422861..423706
                     /gene="queF"
                     /locus_tag="EAE_RS02095"
                     /old_locus_tag="EAE_02025"
                     /db_xref="GeneID:45318804"
     CDS             422861..423706
                     /gene="queF"
                     /locus_tag="EAE_RS02095"
                     /old_locus_tag="EAE_02025"
                     /EC_number="1.7.1.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent 7-cyano-7-deazaguanine reductase
                     QueF"
                     /protein_id="WP_015703314.1"
                     /db_xref="GeneID:45318804"
                     /translation="MSSYDNHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGL
                     HADNLPFHGTDIWTLYELSWLNAKGLPQVAVGYVELSDTTINLVESKSFKLYLNSFNQ
                     TRFADWQEVQATLTRDLSACAQGEVKVSLYRLDELEGQPVAHLHGTCIDDQDIEIDNY
                     QFSADYLQDAASGKVVEETLVSHLLKSNCLITHQPDWGSVQIQYRGPKIDREKLLRYL
                     VSFRHHNEFHEQCVERIFNDVLRFCRPESLSVYARYTRRGGLDINPWRSNGEFVPATG
                     RLARQ"
     gene            423819..425186
                     /locus_tag="EAE_RS02100"
                     /old_locus_tag="EAE_02030"
                     /db_xref="GeneID:45318805"
     CDS             423819..425186
                     /locus_tag="EAE_RS02100"
                     /old_locus_tag="EAE_02030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LOG family protein"
                     /protein_id="WP_015369952.1"
                     /db_xref="GeneID:45318805"
                     /translation="MITHVSPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNS
                     GSLTDNSKELLSRFENFDINVLRRERGVKLELINPPEDAFVDGRIIRSLQANLFAVLR
                     DILFVYGQIHNTVRFPNLDLESSIHITNLVFSILRNARALHVGEAPNMIVCWGGHSIN
                     ENEYLYARRVGTQLGLRELNICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPS
                     IIAAEPPNPLVNELIIMPDIEKRLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMHPD
                     NKAQVLPLILTGPKESADYFRVLDEFIVHTLGESARRHYRIIIDDAAEVARQMKKAMP
                     LVKESRRETDDAYSFNWSIRISPDLQMPFDPTHDNMANLKLYPDQPVEVLAADLRRAF
                     SGIVAGNVKEVGIQAIEKYGPYKLHGDPEMMRRMDDLLQGFVAQHRMKLPGGSAYIPC
                     YEICS"
     gene            425680..426969
                     /locus_tag="EAE_RS02105"
                     /old_locus_tag="EAE_02035"
                     /db_xref="GeneID:45318806"
     CDS             425680..426969
                     /locus_tag="EAE_RS02105"
                     /old_locus_tag="EAE_02035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAAAP family serine/threonine permease"
                     /protein_id="WP_015369950.1"
                     /db_xref="GeneID:45318806"
                     /translation="METTQTSTIVSGESRSGWRKTDTMWMLGLYGTAIGAGVLFLPIN
                     AGVGGMIPLIIMAILAFPMTFFAHRGMTRFVLSGKNPGEDITEVVEEHFGVGAGKLIT
                     LLYFFAIYPILLVYSVAITNTVESFMAHQLHMTPPPRAILSLILIVGMMTIVRFGEQM
                     IVKAMSVLVFPFVIALMVLALYLIPQWNGAALETLSLSSASTTGNGLLMTLWLAIPVM
                     VFSFNHSPIISSFAVAKREEYGEGAEKKCSSILARAHIMMVLTVMFFVFSCVLSLSPA
                     DLAAAKEQNISILSYLANHFNAPVIAWMAPIIAMIAITKSFLGHYLGAREGFNGMVIK
                     SLRGKGKTIEINKLNKLTALFMLVTTWIVATLNPSILGMIETLGGPIIAMILFLMPMY
                     AIQKVPAMRKYSGHISNVFVVIMGLIAISAIFYSLFS"
     gene            427036..428403
                     /locus_tag="EAE_RS02110"
                     /old_locus_tag="EAE_02040"
                     /db_xref="GeneID:45318807"
     CDS             427036..428403
                     /locus_tag="EAE_RS02110"
                     /old_locus_tag="EAE_02040"
                     /EC_number="4.3.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine ammonia-lyase"
                     /protein_id="WP_015369949.1"
                     /db_xref="GeneID:45318807"
                     /translation="MISVFDIFKIGIGPSSSHTVGPMKAGKQFTDDLIARGLLADVSK
                     VVVDVYGSLSLTGKGHHTDIAIIMGLAGNLPDTVDIDAIPGFIQDVNTHGRLLLANGQ
                     HEVEFPVDQCMNFHADNLSLHENGMRITALGGDKVLYSQTYYSIGGGFIVDEEHFGLT
                     TEAPVAVPYPYKNAADLQKHCNETGLSLSGLMMQNELALHSKEELEQHFAAVWEVMSA
                     GIERGITTEGVLPGKLRVPRRAAALRRMLVSQDNTNSDPMAVVDWINMFALAVNEENA
                     AGGRVVTAPTNGACGIVPAVLAYYDKFIRKVNANSLARYMLVASAIGSLYKMNASISG
                     AEVGCQGEVGVACSMAAAGLAELLGASPAQVCIAAEIGMEHNLGLTCDPVAGQVQVPC
                     IERNAIAAVKAVNAARMALRRTSEPRVCLDKVIETMYETGKDMNAKYRETSRGGLAMK
                     IVACD"
     gene            428556..429314
                     /gene="xni"
                     /locus_tag="EAE_RS02115"
                     /old_locus_tag="EAE_02045"
                     /db_xref="GeneID:45318808"
     CDS             428556..429314
                     /gene="xni"
                     /locus_tag="EAE_RS02115"
                     /old_locus_tag="EAE_02045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flap endonuclease Xni"
                     /protein_id="WP_015703315.1"
                     /db_xref="GeneID:45318808"
                     /translation="MAVHLLIVDALNLIRRIHAVQGSPCADTCLHALEQLIVHSQPTH
                     AVAVFDDEDRAHGWRHQRLPDYKAGRAPMPETLEAEMPALRAAFEQRGIRCWALPGSE
                     ADDLAATLAVKVAQAGHQATIVSTDKGYCQLLSPTIRIRDYFQKRWLDAPFIANEFGV
                     TPEQLPDYWGLAGISSSKVPGVAGIGPKSAAQLLTDYQDLEGIYARLAEVPEKWRKKL
                     EEHKEMAFTCREIARLQTDLQLDGNLQQLRLPSA"
     gene            complement(429358..430458)
                     /gene="rlmM"
                     /locus_tag="EAE_RS02120"
                     /old_locus_tag="EAE_02050"
                     /db_xref="GeneID:45318809"
     CDS             complement(429358..430458)
                     /gene="rlmM"
                     /locus_tag="EAE_RS02120"
                     /old_locus_tag="EAE_02050"
                     /EC_number="2.1.1.186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010435097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA (cytidine(2498)-2'-O)-methyltransferase
                     RlmM"
                     /protein_id="WP_015369947.1"
                     /db_xref="GeneID:45318809"
                     /translation="MNKVVLYCRPGFEKECAAEITDKAARLEVFGFARVKDDSGYVIF
                     ECYQQGDGEKLVRDLPFSSLIFARQMFVVGELLRDLPPEDRITPIVGMLQGVVEKGGD
                     LRVEVADTNESKELMKFCRKFTVPLRAALREAGVLTNYETPKRPVVHVFFIAPGCCYT
                     GYSFSNNNSPFYMGIPRLKFPSDAPSRSTLKLEEAFHVFIPADEWDERLANGMYAVDL
                     GACPGGWTYQLVKRNMWVSSVDNGPMAQSLMDTGQVTWLREDGFRYRPNRNNISWMVC
                     DMVEKPAKVAALMAQWLVNGWCRETIFNLKLPMKKRYEEVSQNLAYIQAQLDEHGINA
                     QIQARQLYHDREEVTVHVRRLWAAVGGRRDER"
     gene            complement(430451..430846)
                     /locus_tag="EAE_RS02125"
                     /old_locus_tag="EAE_02055"
                     /db_xref="GeneID:45318810"
     CDS             complement(430451..430846)
                     /locus_tag="EAE_RS02125"
                     /old_locus_tag="EAE_02055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004105073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF423 domain-containing protein"
                     /protein_id="WP_015369946.1"
                     /db_xref="GeneID:45318810"
                     /translation="MTSRFMLIFAAISGFIFVALGAFGAHVLSKSLGAAEMAWIHTGL
                     EYQAFHTLAILGLSVAMQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVT
                     PVGGVCFLAGWVLMLIGAIRLKRKGVVHE"
     gene            complement(430890..431807)
                     /gene="gcvA"
                     /locus_tag="EAE_RS02130"
                     /old_locus_tag="EAE_02060"
                     /db_xref="GeneID:45318811"
     CDS             complement(430890..431807)
                     /gene="gcvA"
                     /locus_tag="EAE_RS02130"
                     /old_locus_tag="EAE_02060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005130970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system transcriptional
                     regulator GcvA"
                     /protein_id="WP_015369945.1"
                     /db_xref="GeneID:45318811"
                     /translation="MSKRLPPLNALRVFDAAARHLSFTRAADELFVTQAAVSHQIKSL
                     EDFLGLKLFRRRNRSLLLTEEGQSYFQDIKEIFSQLTEATRKLQARSAKGALTVSLLP
                     SFAIQWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKL
                     YAEYLLPVCSPLLLTGDKALKTPADLAQHTLLHDASRRDWQTYTRQLGLNHINVQQGP
                     IFSHSAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQA
                     ELGKIAAFRQWILAKAASEQEKFRFRYEQ"
     gene            432239..433444
                     /gene="csdA"
                     /locus_tag="EAE_RS02135"
                     /old_locus_tag="EAE_02065"
                     /db_xref="GeneID:45318812"
     CDS             432239..433444
                     /gene="csdA"
                     /locus_tag="EAE_RS02135"
                     /old_locus_tag="EAE_02065"
                     /EC_number="3.13.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase CsdA"
                     /protein_id="WP_015703316.1"
                     /db_xref="GeneID:45318812"
                     /translation="MNAFNPAHFRAQFPALADAGVYLDSAATALKPLAVIDASDQFYR
                     LSAGNVHRSQFAAAQRLTERYEAARERVASWLNASSGKDIVWTRGTTEAINMVAQSYA
                     RPRLHPGDEIIVSEAEHHANLVPWLMVAEQTGARVVKLPLGADRLPDIAQLPSLISPR
                     SRVLAIGQMSNVTGGCPDLRLAIDLAHQAGMIVMVDGAQGAVHFPADVQALDIDFYAF
                     SAHKLYGPTGIGALYGKSELLAEMSPWLGGGKMITEVSFDGFKTQPAPWRLEAGTPNV
                     AGVIGLSAALEWLQEIDLTQAESWSRSLATLAEDELAKRPGFRSFRCQDSSLLAFDFE
                     GVHHSDMVTLLAESGIALRAGQHCAQPLLAALGVSGTLRASFAPYNTQDDVYALVHAI
                     DRALEILVD"
     gene            433444..433875
                     /gene="csdE"
                     /locus_tag="EAE_RS02140"
                     /old_locus_tag="EAE_02070"
                     /db_xref="GeneID:45318813"
     CDS             433444..433875
                     /gene="csdE"
                     /locus_tag="EAE_RS02140"
                     /old_locus_tag="EAE_02070"
                     /EC_number="2.8.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase sulfur acceptor subunit
                     CsdE"
                     /protein_id="WP_015703317.1"
                     /db_xref="GeneID:45318813"
                     /translation="MMTSQPLSTALSEATLRQIFAPLTQWEDKYRQLILVGKKLPPLT
                     DDQRAQAKEIAGCENRVWLGYQVDAEGKMHFFGDSEGRIVRGLLAVLLAACEGKSAAE
                     ILANDPLALFDELGLRGQLSASRSQGLQALSDAVLAAAREN"
     gene            complement(434320..435129)
                     /gene="tcdA"
                     /locus_tag="EAE_RS02145"
                     /old_locus_tag="EAE_02075"
                     /db_xref="GeneID:45318814"
     CDS             complement(434320..435129)
                     /gene="tcdA"
                     /locus_tag="EAE_RS02145"
                     /old_locus_tag="EAE_02075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA cyclic N6-threonylcarbamoyladenosine(37)
                     synthase TcdA"
                     /protein_id="WP_015703318.1"
                     /db_xref="GeneID:45318814"
                     /translation="MSVVISDAWRQRFGGTARLYGEKALQCFAEAHVCVVGIGGVGSW
                     AAEALARTGIGAITLIDMDDVCVTNTNRQIHALGGNVGLAKAEVMAERIRLINPECRV
                     TVIDDFITPENVAEYLGAGFSYVIDAIDSVRPKAALIAWCRRYKVPLVTTGGAGGQID
                     PTQIQVADLAKTIQDPLAAKLRERLKSQFGVVKNSKGKLGIDCVFSTEALVYPQADGS
                     VCAMKSTAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKMLAKAQRQGE"
     gene            complement(435209..436306)
                     /gene="mltA"
                     /locus_tag="EAE_RS02150"
                     /old_locus_tag="EAE_02080"
                     /db_xref="GeneID:45318815"
     CDS             complement(435209..436306)
                     /gene="mltA"
                     /locus_tag="EAE_RS02150"
                     /old_locus_tag="EAE_02080"
                     /EC_number="4.2.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008785702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase A"
                     /protein_id="WP_015369941.1"
                     /db_xref="GeneID:45318815"
                     /translation="MKGRWAKYVATGAMLAMLAACTSKPTDRGQQYSDGKFTQPFSLV
                     NQPDAVGAPINAGDFSQQVGQIRSASPRLYNSQSSVYNAIQEWLRSGGDTRTLRQFGI
                     DAWQMQGADNYGNVQFTGYYTPVVQARHTRQGEFQYPIYRMPPKNGKLPSRASIYAGA
                     LSDNYVLAYSNSLMDNFIMDVQGSGYIDFGDGSPLNFFSYAGKNGWPYRSIGKVLIDR
                     GEVKREDMSMQAIREWGEKHSEAEVRELLEQNPSFVFFKPQSYAPVKGASAVPLIGRA
                     SVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIG
                     PDAGHRAGWYNHYGRVWVLKNAPGAGSVFSG"
     gene            436519..436595
                     /locus_tag="EAE_RS02155"
                     /old_locus_tag="EAE_t24826"
                     /db_xref="GeneID:45318816"
     tRNA            436519..436595
                     /locus_tag="EAE_RS02155"
                     /old_locus_tag="EAE_t24826"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:436553..436555,aa:Met,seq:cat)
                     /db_xref="GeneID:45318816"
     gene            436641..436717
                     /locus_tag="EAE_RS02160"
                     /old_locus_tag="EAE_t24828"
                     /db_xref="GeneID:45318817"
     tRNA            436641..436717
                     /locus_tag="EAE_RS02160"
                     /old_locus_tag="EAE_t24828"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:436675..436677,aa:Met,seq:cat)
                     /db_xref="GeneID:45318817"
     gene            436763..436839
                     /locus_tag="EAE_RS02165"
                     /old_locus_tag="EAE_t24830"
                     /db_xref="GeneID:45318818"
     tRNA            436763..436839
                     /locus_tag="EAE_RS02165"
                     /old_locus_tag="EAE_t24830"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:436797..436799,aa:Met,seq:cat)
                     /db_xref="GeneID:45318818"
     gene            complement(436927..438180)
                     /locus_tag="EAE_RS02170"
                     /old_locus_tag="EAE_02085"
                     /db_xref="GeneID:45318819"
     CDS             complement(436927..438180)
                     /locus_tag="EAE_RS02170"
                     /old_locus_tag="EAE_02085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_015703319.1"
                     /db_xref="GeneID:45318819"
                     /translation="MSGYKSGLSRRRFLQGAGAMWLMSVSPVGLAAAAQVVAVRIWPS
                     STYTRVTVESNHVLKYRQFALSNPERVVVDIEGVNLNSVLKGMGGQIRDDDPYIKSAR
                     VGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPSTATDVQDPLLALLED
                     YNKGDLERQVPPAESGPQPGKAGRDRPIVIMLDPGHGGEDSGAIGKYRTREKDVVLQI
                     ARRLRALIEREGNMKVFMTRNEDVFIPLKVRVAKAQKQRADLFVSIHADAFTSRQPSG
                     SSVFALSTKGATSTAAKYLAQTQNASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLK
                     FGKAVLQKMGNINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTAKFQ
                     QEVAESILAGIKAYFADGATLARRG"
     gene            438407..439738
                     /gene="argA"
                     /locus_tag="EAE_RS02175"
                     /old_locus_tag="EAE_02090"
                     /db_xref="GeneID:45318820"
     CDS             438407..439738
                     /gene="argA"
                     /locus_tag="EAE_RS02175"
                     /old_locus_tag="EAE_02090"
                     /EC_number="2.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino-acid N-acetyltransferase"
                     /protein_id="WP_015369939.1"
                     /db_xref="GeneID:45318820"
                     /translation="MVKERRTELVEGFRHSVPYINAHRGKTFVIMLGGEAIEHDNFSS
                     IVNDIGLLHSLGIRLVVVYGARPQIDANLAEHHHEPVYHKQTRVTDAKTLELVKQAAG
                     MLQLEITARLSMSLGNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEEA
                     IHRQLDSGAIVLMGPVAVSVTGESFNLTSEEIATQLAVKLKAEKMIGFCSSQGVYDQH
                     GEIVSELFPNEAQARVEELEAEEDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGAL
                     LQELFSRDGIGTQIVMESAEQIRRATINDIGGILDLISPLEQQGILVRRSREQLEMEI
                     DKFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLSRIAAQAKQM
                     GLSKLFVLTTRSIHWFQERGFTPVDIDLLPESKKQMYNYQRRSKVLMADLG"
     gene            complement(439836..441683)
                     /gene="recD"
                     /locus_tag="EAE_RS02180"
                     /old_locus_tag="EAE_02095"
                     /db_xref="GeneID:45318821"
     CDS             complement(439836..441683)
                     /gene="recD"
                     /locus_tag="EAE_RS02180"
                     /old_locus_tag="EAE_02095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit alpha"
                     /protein_id="WP_015703320.1"
                     /db_xref="GeneID:45318821"
                     /translation="MTMDELLLAAAEQRLLRPLDVQFALMVAQDAPPAVKLAAALLSR
                     DAGEGHVCLPLSRLNAEEALSGKAGEIRDQLLAMAGEPQDWPQLLLSSSAVSRGDEPT
                     PMILCGERLYLNRMWRNELTVARFFNETNRVLEVDEGRLTATLNELFPATDDIDWQKV
                     AAAVALTRRISVISGGPGTGKTTTVAKLLAALIQINDTSRCRIRLAAPTGKAAARLTE
                     SLGAALRKLPLSDEQKALVPADASTLHRLLGAQPGSQRMRYHAGNPLHLDVLVVDEAS
                     MIDLPMMSRLIDALPEHGRVIFLGDRDQLASVEAGAVLGDICAWATSGYTAARAQELS
                     RLTGATVPAGEGQMAGALRDSLCLLQKSYRFGSHSGIGSLARAVNAGARAEVKATLRQ
                     PFEDIVLQPLSTTEEYEAMLMAAQEGYGRYLQLRREQAAPEQMIAAFGEFQLLCALRE
                     GPYGVSGVNEQLEQMLHRKRAITLPRHSRWYDGRPVMISRNDSALGLFNGDIGIALER
                     DGELRVWFPMPDGSIKSVQPSRLPEHDTAWAMTVHKSQGSEFDHAALILPSRSVPLVT
                     RELVYTAITRAKRRLSLYADEQVLAQAIVTRTERRSGLAEIFAHGGKPG"
     gene            complement(441729..445225)
                     /gene="recB"
                     /locus_tag="EAE_RS02185"
                     /old_locus_tag="EAE_02100"
                     /pseudo
                     /db_xref="GeneID:45318822"
     CDS             complement(441729..445225)
                     /gene="recB"
                     /locus_tag="EAE_RS02185"
                     /old_locus_tag="EAE_02100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228592.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit beta"
                     /db_xref="GeneID:45318822"
     gene            complement(445222..448107)
                     /gene="ptrA"
                     /locus_tag="EAE_RS02190"
                     /old_locus_tag="EAE_02105"
                     /db_xref="GeneID:45318823"
     CDS             complement(445222..448107)
                     /gene="ptrA"
                     /locus_tag="EAE_RS02190"
                     /old_locus_tag="EAE_02105"
                     /EC_number="3.4.24.55"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_417298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pitrilysin"
                     /protein_id="WP_015703322.1"
                     /db_xref="GeneID:45318823"
                     /translation="MPRSLWFKVLVVVVALWAPLSQADTGWQPIQETIRKSEKDPRHY
                     QAIRLQNGMVVLLVSDPQAVKSLSALVVPVGSLQDPADHQGLAHYLEHMTLMGSQKYP
                     QPDSLAEFLKMHGGSHNASTAPYRTAFYLEVENDALNGAVDRLADAIAAPLLDKKYAE
                     RERNAVNAELTMARTRDGMRMAQVSAETINPAHPASQFSGGNLDTLSDKPGSPVLDAL
                     HAFRDRWYSANLMKAVIYSNKPLPELASIAAATYGRVPNHDISKPEITVPVVTDAQKG
                     IVIHYVPAMPRKVLRVEFRIDNNSAQFRSKTDELVTYMIGNRSPGTLSDWLQKQGLAE
                     GIRADSDPAVNGNSGVLAISATLTDKGLAHRDEVTAAIFSYLNLLRTQGIDKRYFDEL
                     AHVLELDFRYPSINRDMDYVEWLADTMIRVPVEHVLDVVNIADRYDAQAIKDRLAMMT
                     PQNARIWYISPNEPHNKTAYFVNAPYQVDKISARTFADWQQKSAAIKLQLPTLNPYIP
                     DDFTLIKSDKAYPHPELIVDEPTLRVVYAPSQYFASEPKADVSLVLRNPQAMDSARRQ
                     VMFALNDYLAGIALDQLSNQAAVGGISFSTGANNGLMVNANGYTQRLPQLFTALLDGY
                     FSYTPTEEQLEQAKSWYAQMMDSADKGKAYDQAIMPIQMLSQVPYFERKTRRDLLPSI
                     TLKEVINYRDNLKARGRPELLVIGNMSARQSTDLARQIQKQLGADGNEWCRNKDVLID
                     SKQLAMFEKAGSSTDSALAAVFAPPNVDEYSSMAASSLLGQIIQPWFYNQLRTEEQLG
                     YAVFAFSMNVGRQWGMGFLLQSSDKQPAFLWQRFQAFFPTAEAKLRAMKPEEFAQIQQ
                     AAISQMLQAPQTLSEEASKLSKDFDRGNMRFDSRDKVVAQMKLLTPQKLADFFHQTVV
                     DPQGMALLSQVSGSQNGKTEYAAPEGGKVWESVSALQKSLPLMRENE"
     gene            complement(448271..451642)
                     /gene="recC"
                     /locus_tag="EAE_RS02195"
                     /old_locus_tag="EAE_02110"
                     /db_xref="GeneID:45318824"
     CDS             complement(448271..451642)
                     /gene="recC"
                     /locus_tag="EAE_RS02195"
                     /old_locus_tag="EAE_02110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007370363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit gamma"
                     /protein_id="WP_015703323.1"
                     /db_xref="GeneID:45318824"
                     /translation="MLRVYHSNRLDVLEALMEFIVERQRLDDPFMPEMVLVQSTGMAQ
                     WLQMTLAKRFGIAANIEFPLPASFIWDMFVRVLDDIPGESAFSKQSMSWKLMTLLPQY
                     LDDDAFTLLRHYLSDDSDKRKLFQLAARVADLYDQYLVYRPEWLMRWEADERVDGLGD
                     AQQWQAPLWKALVEYTAELGQPLWHRANLYQRFISALENADQPPAGLPSRVFICGISA
                     LPPVYLQALQALGKHVDVYVLFTNPCRYYWGDIKDPAFLAKLMSRQRRHHREARELPL
                     FRDTEQAPGLFNDDGEQDVGNPLLASWGKLGRDYIYLLAGLERYEELDAFVDIAPDNL
                     LHNLQADILDLRNAAVAGRTAQEFASSKSKRPLATDDRSLAIHVCHSPQREVEVLHDR
                     LLAMLEEDPELTPRDIIVMVADIDSYSPYIQAVFGAARGERWLPWAISDRRARESHPA
                     LQAFITLLSLPDSRFASEDVLALLDVPVLAARFNINEEGLRYLRQWVNESGVRWGMDD
                     DNVREMDLPATGQHTWRFGLTRMLLGYAMDSSQGEWQSVLPYDESSGLIAELVGNLAS
                     LLMQLNLWRRGLAQDRPLTEWLPVCRDLLTDFFLPDSETEAALALIEQQWQAIIDGGL
                     DAQYGAAVPLSLLRDELAQRLDQQRISQRFLAGPVNICTLMPMRSIPFKVVCLLGMND
                     GVYPRTLAPLGFDLMSQKPQRGDRSRRDDDRYLFLEALMSAEQKLYISYIGRSIQDNS
                     ERYPSVLVQELADYIGQSHCLEGDEVLDCDASERRVKEHITHLHTRMPFDAANYLPDE
                     DQSYAREWLAAASQQGEAHSEFIQPLAPLDIDTLPFEQLLRFWQHPVRAFFQQRLRVN
                     FRSEESEIPEDEPFVLEGLSRYQLNQQLLNTLIEQQDASAMYRRFRAAGELPYGAFGE
                     LAWEAQRQEMQNLAERVIASRQPAQSMEIDLQCNGINLTGWLQQVQPDGLLRWRPSLL
                     SVSQGVQLWLEHLVYCASGGLGESRLFVRKEGEWRFPPLAAEQAQAYLNELVEGYLQG
                     MSKPLLLLPESGGAWLKACYDAEKDVMLMDDDTQQKARSKFLQAYEGNMVVSGEGADI
                     WYQRLWRTLEPAYYEEIIAQAQRYLLPIFRFHQSE"
     gene            complement(451655..451978)
                     /locus_tag="EAE_RS02200"
                     /old_locus_tag="EAE_02115"
                     /db_xref="GeneID:45318825"
     CDS             complement(451655..451978)
                     /locus_tag="EAE_RS02200"
                     /old_locus_tag="EAE_02115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type N-terminal cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_015703324.1"
                     /db_xref="GeneID:45318825"
                     /translation="MPDAVARQRGFSLAETLLAMALLIMTITALGGYHRGLASGAAQL
                     NAYRQQWREAWRFSQLIPPAQPSQGQISRLQTSRQSCVSITVTITMPAAKRVQMNRLH
                     CPANQ"
     gene            complement(451963..452370)
                     /locus_tag="EAE_RS02205"
                     /old_locus_tag="EAE_02120"
                     /db_xref="GeneID:45318826"
     CDS             complement(451963..452370)
                     /locus_tag="EAE_RS02205"
                     /old_locus_tag="EAE_02120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2509 family protein"
                     /protein_id="WP_015703325.1"
                     /db_xref="GeneID:45318826"
                     /translation="MKRQRGVSSLLMVLLLLALGSLLLQGLNQQQRSLLAQVSAETQA
                     IRDTAAAQSALQWGKGVNWPLQSAVACQQENSQRWRACLRLFNDDRALLIAGSGTIQL
                     WQSASIEQGKLRYLAHGWSDFCPLKESALCLMP"
     gene            complement(452367..452930)
                     /locus_tag="EAE_RS02210"
                     /old_locus_tag="EAE_02125"
                     /db_xref="GeneID:45318827"
     CDS             complement(452367..452930)
                     /locus_tag="EAE_RS02210"
                     /old_locus_tag="EAE_02125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase-dependent protein"
                     /protein_id="WP_015703326.1"
                     /db_xref="GeneID:45318827"
                     /translation="MPVAARGFSLIETLIAMAIGAVLLLGAARFLPALQRQVLRQTQQ
                     QALENELWQRVYALAKHLQRAGYCAGQCHGQALVIASGGQCVIVRWDGNSNGIWDLAP
                     EADADSTGFRLRDGALETRRGVTDCGGKNWEKMTNPAAITVTRFHVERQAVSGFSPEL
                     IVTLAAQAQSDSRISAEAQYQVTGFNL"
     gene            complement(452921..453385)
                     /locus_tag="EAE_RS02215"
                     /old_locus_tag="EAE_02130"
                     /db_xref="GeneID:45318828"
     CDS             complement(452921..453385)
                     /locus_tag="EAE_RS02215"
                     /old_locus_tag="EAE_02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase-dependent protein"
                     /protein_id="WP_015703327.1"
                     /db_xref="GeneID:45318828"
                     /translation="MNRQHGYTLIEMLITMMLVVILSASGMYGWQRWQQQQRLWQVAC
                     QVRDYLVLLRDDANWHNRERVIRVGQSPTGWCLSAIGVEADCHAKTPFTLQPLWPGIT
                     LRHLTAGIGFYGLRNSAWAGYILLQSDGGAWRIVVSNWGRIRLCREEEELCQ"
     gene            complement(453572..454366)
                     /gene="thyA"
                     /locus_tag="EAE_RS02220"
                     /old_locus_tag="EAE_02135"
                     /db_xref="GeneID:45318829"
     CDS             complement(453572..454366)
                     /gene="thyA"
                     /locus_tag="EAE_RS02220"
                     /old_locus_tag="EAE_02135"
                     /EC_number="2.1.1.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_015369929.1"
                     /db_xref="GeneID:45318829"
                     /translation="MKQYLDLMQKVLAEGTPKNDRTGTGTISIFGHQMRFNLQEGFPL
                     VTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRSWP
                     APDGRHIDQISTVMEQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLS
                     CQLYQRSCDVFLGLPFNIASYALLVHMVAQQCDLQVGDFVWTGGDTHLYSNHLEQTNL
                     QLSREPRPLPKLVIKRKPASIFDYRFEDFEIEGYDPHPGIKAPVAI"
     gene            complement(454373..455248)
                     /gene="lgt"
                     /locus_tag="EAE_RS02225"
                     /old_locus_tag="EAE_02140"
                     /db_xref="GeneID:45318830"
     CDS             complement(454373..455248)
                     /gene="lgt"
                     /locus_tag="EAE_RS02225"
                     /old_locus_tag="EAE_02140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_015369928.1"
                     /db_xref="GeneID:45318830"
                     /translation="MNSGYLHFPEFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLATRR
                     ANRPGSGWTKNEVENLLYAGFLGVFLGGRIGYVMFYNLPVFLSDPLYLFRVWDGGMSF
                     HGGLIGVILVMIIFAKRTKRTFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNF
                     HYAMIFPGSRAEDLALLPSHPEWQSLFDTYGALPRHASQLYELALEGVVLFLILNLFI
                     RKPRPTGSVSGLFLIGYGLFRIIVEFFRQPDAQFTGGWVQYISMGQILSIPMVLAGII
                     MMVWAYRHRPQQQNS"
     gene            complement(455654..457900)
                     /gene="ptsP"
                     /locus_tag="EAE_RS02230"
                     /old_locus_tag="EAE_02145"
                     /db_xref="GeneID:45318831"
     CDS             complement(455654..457900)
                     /gene="ptsP"
                     /locus_tag="EAE_RS02230"
                     /old_locus_tag="EAE_02145"
                     /EC_number="2.7.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate--protein phosphotransferase"
                     /protein_id="WP_015369927.1"
                     /db_xref="GeneID:45318831"
                     /translation="MLTRLREIVEKVASAPRLNEALDILVTDVCKAMETEVCSVYLAD
                     NDRRCYYLMATRGLKKPRGRTVALAFDEGLVGLVGRLAEPINLADAQKHPSFKYIPAV
                     KEERFRAFLGVPIIQRRQLLGVLVVQQRELRQFDESEESFLVTLATQMAAILSQSQLN
                     ALFGQYRQTRIRALPASSGVAIAEGWMDASLPLMEQVYEASTLDTASERERLTGALEE
                     AANEFRRYSKRYAAGAQKETAAIFDLYSHLLSDARLRRELFDEVDKGSVAEWAVKKVI
                     EKFAEQFAALSDGYLKERAGDLRTLGQRLLFHLDDTTQGPNTWPERIILVADELSATT
                     LAEVPQDRLVGVVVRDGAANSHAAIMVRALGIPTVMGADIQPSLLHGHMLIVDGYRGD
                     LLVDPEPVLLQEYQRLISEENELSRLAEDDLERASELKSGERVKVMLNAGLSPEHEEK
                     LGSFIDGIGLYRTEIPFMLQSGFPSEEEQVAQYQGMLQMFNSKPVTLRTLDIGADKQL
                     PYMPISEENPCLGWRGIRITLDQPEIFLIQVRAMLRANAATGNLSILLPMVTSLEEVD
                     EARRLIERASREVEEMIGYAIPRPRLGVMLEVPSMVFMLPQLANRIDFISVGTNDLTQ
                     YILAVDRNNTRVANMYDCLHPAVLRALAMIAHDAERFGIDLRLCGEMAGDPMCVTILV
                     GLGYRHLSMNGRSVARVKYLLRRIDIEEAQELSRRSLEAQMTTEVRHQVAAFMERRGL
                     GGLIRGGR"
     gene            complement(457913..458443)
                     /gene="rppH"
                     /locus_tag="EAE_RS02235"
                     /old_locus_tag="EAE_02150"
                     /db_xref="GeneID:45318832"
     CDS             complement(457913..458443)
                     /gene="rppH"
                     /locus_tag="EAE_RS02235"
                     /old_locus_tag="EAE_02150"
                     /EC_number="3.6.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017803569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pyrophosphohydrolase"
                     /protein_id="WP_015703328.1"
                     /db_xref="GeneID:45318832"
                     /translation="MIDDDGYRPNVGIVICNRQGQVMWARRYGQHSWQFPQGGINPGE
                     SAEQAMYRELFEEVGLSRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLL
                     QLVGSDTAINMQTSSTPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFAGVTMSLAE
                     TTPKPQSAPAYRRKRG"
     gene            459126..459821
                     /gene="mutH"
                     /locus_tag="EAE_RS02240"
                     /old_locus_tag="EAE_02155"
                     /db_xref="GeneID:45318833"
     CDS             459126..459821
                     /gene="mutH"
                     /locus_tag="EAE_RS02240"
                     /old_locus_tag="EAE_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair endonuclease MutH"
                     /protein_id="WP_015369924.1"
                     /db_xref="GeneID:45318833"
                     /translation="MPAIAPLTAPPQSQEQLLAQAQRLAGYSLGELAALAGVPIPRDL
                     KRDKGWIGILLEIWLGASAGSKPEQDFAALGVELKTIPIDRQGRPLETTFVCVAPLTG
                     NSGVTWESSHVRHKLQRVLWIPVEGEREIPLAQRRVGAPLLWTPDEEEDRQLRMDWEE
                     LMDLIVLGQVERITARHGEVLQLRPKAANSKALTEAIGAHGEPILTLPRGFYLKKNFT
                     AALLARHFLLGHE"
     gene            459884..460597
                     /locus_tag="EAE_RS02245"
                     /old_locus_tag="EAE_02160"
                     /db_xref="GeneID:45318834"
     CDS             459884..460597
                     /locus_tag="EAE_RS02245"
                     /old_locus_tag="EAE_02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TerC family protein"
                     /protein_id="WP_015369923.1"
                     /db_xref="GeneID:45318834"
                     /translation="MLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQ
                     RAHARRIGLMGAMLMRLGLLASIAWVVKLTNPLFTVFGQEISFRDLILLLGGLFLIWK
                     ASKEIHESIEGEEEGLKSNVHSFFGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAA
                     VVIAVGVMMFAARPIGDFVDRHPSVKMLALSFLILVGFTLMLESFDVHVPKGYIYFAM
                     FFSIAVETLNLMRNKKNPL"
     gene            460721..460939
                     /locus_tag="EAE_RS02250"
                     /old_locus_tag="EAE_02165"
                     /db_xref="GeneID:45318835"
     CDS             460721..460939
                     /locus_tag="EAE_RS02250"
                     /old_locus_tag="EAE_02165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YgdI/YgdR family lipoprotein"
                     /protein_id="WP_004867116.1"
                     /db_xref="GeneID:45318835"
                     /translation="MKKWAVLISAVGLAFSVSGCSSDYVMATKDGRMILTDGKPAVDD
                     DTGLISYEDQQGNKMQINRDDVSQIIKR"
     gene            461191..462231
                     /locus_tag="EAE_RS02255"
                     /old_locus_tag="EAE_02170"
                     /db_xref="GeneID:45318836"
     CDS             461191..462231
                     /locus_tag="EAE_RS02255"
                     /old_locus_tag="EAE_02170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001527995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP(H)-dependent aldo-keto reductase"
                     /protein_id="WP_015369921.1"
                     /db_xref="GeneID:45318836"
                     /translation="MQYHRIPHSSLEISTLGLGTMTFGEQNSEADAHEQLDYAVSQGI
                     NLIDVAEMYPVPPRPETQGLTETYVGNWLAKRGNREKLVIASKVSGPARNNDSSIRPN
                     HALDRKNIRDALHDSLKRLQTDYLDLYQVHWPQRQTNCFGKLGYTWSDSAPVVTLLDT
                     LEALTEFQRAGKIRYIGVSNETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSYEVG
                     LAEVSQYEGVELLAYSCLAFGTLTGKYLNGAQPAGARNTLFSRFTRYSGEQAQKAVAA
                     YVDIAKRHNLDPAQMALAFVRRQPFVASTLLGATTMEQLKTNVESLHLELSEEVLAEI
                     EAVHKVYTYPAP"
     gene            complement(462317..463510)
                     /gene="lplT"
                     /locus_tag="EAE_RS02260"
                     /old_locus_tag="EAE_02175"
                     /db_xref="GeneID:45318837"
     CDS             complement(462317..463510)
                     /gene="lplT"
                     /locus_tag="EAE_RS02260"
                     /old_locus_tag="EAE_02175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysophospholipid transporter LplT"
                     /protein_id="WP_015703329.1"
                     /db_xref="GeneID:45318837"
                     /translation="MSESVHTNASLYSKGMMAVICAQFLSAFGDNALLFATLALMKQL
                     YYPEWSQPVLQMLFVGAYILFAPFVGQFADSFAKGRVMMVANGLKLLGAGCICFGVNP
                     FIGYTLVGVGAAAYSPAKYGILGELTTGDKLVKANGLMESSTIAAILLGSMAGGILAD
                     WHVLAALIVCALVYGGAVVANLWIPKLPAARPGQSWRFRPMTHSFFSACTTLWRNSET
                     RFSLMGTSLFWGAGVTLRFLLVIWVPVALGITSNAMPTYLNAMVAVGIVVGAGAAAKL
                     VTLETVSRCMPAGILIGVAVIAFAVQQSLLPAFGLLLLLGVCGGFFIVPLNALLQERG
                     KHTVGAGNAIAVQNLGENVAMLLMLGLYSLAVSVGIPPVGVGIGFGAVFALAIAALWW
                     WGRRK"
     gene            complement(463503..465662)
                     /gene="aas"
                     /locus_tag="EAE_RS02265"
                     /old_locus_tag="EAE_02180"
                     /db_xref="GeneID:45318838"
     CDS             complement(463503..465662)
                     /gene="aas"
                     /locus_tag="EAE_RS02265"
                     /old_locus_tag="EAE_02180"
                     /EC_number="2.3.1.40"
                     /EC_number="6.2.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional acyl-ACP--phospholipid
                     O-acyltransferase/long-chain-fatty-acid--ACP ligase"
                     /protein_id="WP_015703330.1"
                     /db_xref="GeneID:45318838"
                     /translation="MLLGFFRLLFKGLYRVRLTGDTQALYQEKVLITPNHVSFLDGIL
                     LALFLPVRPVFAVYTSISQRWFMRALTPLIDFVPLDPTKPMSIKHLVRLIEQGRPVVI
                     FPEGRISVSGSLMKIYDGAAFVAAKSKATIVPLRIEGAELTPFSRLKGLVKRRLFPRI
                     QLHLLPPTHLPMPEAPRARDRRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQDRFG
                     ARKNCVEDINFQPDTYRKLLTKTLFVARILEKYSAQGEKIGLMLPNAGISAAVIFGAI
                     ARGRIPAMMNYTAGVKGLSSAITAAEIKTIFTSRTFLDKGKLWHLPEQLTQVRWVFLE
                     DLKGDVTTADKLWIFGHLLAPRLAQVKQQPEDAAMILFTSGSEGNPKGVVHSHKSLLA
                     NVEQIKTIADFTANDRFMSALPLFHSFGLTVGLLTPLFTGAEVFLYPSPLHYRVVPEL
                     VYDRNCTVLFGTSTFLANYARFANPYDFYRLRYVVAGAEKLQDSTKQLWQDKFGLRIL
                     EGYGVTECAPVVSINVPMAAKVGTVGRILPGMDARLLAMPGIEQGGRLQLKGPNIMKG
                     YLRVENPGVLEAPTAENQYGEVESGWYDTGDIVVFDEQGYVRIQGRAKRFAKIAGEMV
                     SLEMVEQVALAVSPDKMHATAIKQDASKGEALVLFTTDNELNREKLLRYAREHGVPEL
                     AVPRDIRWLKQLPVLGSGKPDFVTLKGMVEEAEHSNE"
     gene            466283..467299
                     /gene="galR"
                     /locus_tag="EAE_RS02270"
                     /old_locus_tag="EAE_02185"
                     /db_xref="GeneID:45318839"
     CDS             466283..467299
                     /gene="galR"
                     /locus_tag="EAE_RS02270"
                     /old_locus_tag="EAE_02185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator GalR"
                     /protein_id="WP_015703331.1"
                     /db_xref="GeneID:45318839"
                     /translation="MATIKDVARLAGVSVATVSRVINNSPKASEASRQSVTAAMETLN
                     YHPNANARALAQQSTETIGLVVGDVSDPFFGAMVKAVEQVAYSTGNFLLIGNGYHNVQ
                     KERQAIEQLIRHRCAALVVHAKMIPDDELAGLMKQIPGMVLINRIVPGFEQRSVALDD
                     RYGAWLATRHLIQQGHSRIGYICSNHAISDAEDRLQGYYDALKESGLAVNDRLVTFAE
                     PDESGGELAMTELLGRGRNFTAVACYNDSMAAGAMGVLNDNGIEVPQEISLIGFDDVL
                     ISRYVRPRLTTVRYPIVTMATQAAELALALAEQRPAPEITHLFSPTLVRRHSVITPAE
                     SDKS"
     gene            complement(467260..467739)
                     /locus_tag="EAE_RS02275"
                     /old_locus_tag="EAE_02190"
                     /db_xref="GeneID:45318840"
     CDS             complement(467260..467739)
                     /locus_tag="EAE_RS02275"
                     /old_locus_tag="EAE_02190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_015703332.1"
                     /db_xref="GeneID:45318840"
                     /translation="MQIQPLYAAPQHGPQVAEWLWQAFAGDALPQAFFSSIVEHSQTP
                     GALPLTFIATDGEALLGTVGLWRCDLISRQDLFPWMAALFVAETARGQGLAGKLQRHV
                     IDYARQCGYPQLYLYSACRDFYERFGWRYIGEGLDYPATAVSLYRYDLSLSAGVITE"
     gene            467936..468937
                     /locus_tag="EAE_RS02280"
                     /old_locus_tag="EAE_02195"
                     /db_xref="GeneID:45318841"
     CDS             467936..468937
                     /locus_tag="EAE_RS02280"
                     /old_locus_tag="EAE_02195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="substrate-binding domain-containing protein"
                     /protein_id="WP_161798777.1"
                     /db_xref="GeneID:45318841"
                     /translation="MLDVSIRAGVSKATVSRVLNGTGQVKESTRQQVFKAMEELGYRP
                     NFLARSLANRTSNSIGLVVSTFDGFYFGRLLQQASRQTEAWGKQLIVTDGHDAPEREE
                     EAVQMLADRQCDAIVLYTRHMSEQKIMSLIETIETPLVVINRDVSQARERCVFFEQQE
                     AAFQAVDYLISQGHRDIACLTVPMHTPTGKARLAGYRSALEKHGIAWEPARVKYGDST
                     MTRGYELCRELLEEKTPFSALFSCNDDMALGASKALHQAGLRIPQDVSLFGFDDAPSA
                     KWLEPGLSTVYLPIDNMITTAIDQAIKLANEQPIETIPPFTGTLVLRESVTTGPFFK"
     gene            complement(468930..470192)
                     /gene="lysA"
                     /locus_tag="EAE_RS02285"
                     /old_locus_tag="EAE_02200"
                     /db_xref="GeneID:45318842"
     CDS             complement(468930..470192)
                     /gene="lysA"
                     /locus_tag="EAE_RS02285"
                     /old_locus_tag="EAE_02200"
                     /EC_number="4.1.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="WP_015369915.1"
                     /db_xref="GeneID:45318842"
                     /translation="MPRSLNATDTDLTADNLLRLPAEFGCPVWVYDAQIIRRQIAQLS
                     QFDVVRFAQKACSNIHILRLMREQGVKVDSVSLGEIERALAAGYDPVQHPDDIVFTAD
                     LIDRATLERVKALQIPVNAGSVDMLSQLGEVSPGHRVWLRVNPGFGHGHSQKTNTGGE
                     NSKHGIWFSQLPQALEVIRRHSLQLVGIHMHIGSGVDYGHLEQVCGAMVRQVVEFGQD
                     LQAISAGGGLSIPYHEGEEAIDTDHYFGLWNAAREQIAKHLGHPVKLEIEPGRFLVAE
                     SGVLVSQVRSVKEMGSRHFVLIDAGFNDLMRPAMYGSYHHITALAADGRDLSGEPQLE
                     TVVAGPLCESGDVFTQQEGGKVETRLLPAVAPGDYLVLHDTGAYGASMSSNYNSRPLL
                     PEVLFDNGSARLIRRRQTIEELLALELI"
     gene            470329..471255
                     /locus_tag="EAE_RS02290"
                     /old_locus_tag="EAE_02205"
                     /db_xref="GeneID:45318843"
     CDS             470329..471255
                     /locus_tag="EAE_RS02290"
                     /old_locus_tag="EAE_02205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703333.1"
                     /db_xref="GeneID:45318843"
                     /translation="MPAVNLRHIEIFHAVMTTGNLTEAARMLHTSQPTVSRELARFEK
                     VLGLKLFERARGRLQPTVQGLRLFEEVQRSWYGLDRIVSAAESLREFRQGELSVACLP
                     VFSQSFLPLLLQPFLARYPDVSLQIVPQESPLLEEWLSAQRHDLGLTETLHTPAGTER
                     TPLLTLNEVCVLPQNHPLAVKTELTPADFHGENYISLSRTDSYRQLLDALFMEHQVKR
                     RMVVETHSAASICALVRAGAGISVVNPLTALDYAESGVVVRRFSVDVPFTVSLIRPLH
                     RPGSALVDAFVQHLQTSLPRIEQPLAAVLKRA"
     gene            complement(471242..471934)
                     /locus_tag="EAE_RS02295"
                     /old_locus_tag="EAE_02210"
                     /db_xref="GeneID:45318844"
     CDS             complement(471242..471934)
                     /locus_tag="EAE_RS02295"
                     /old_locus_tag="EAE_02210"
                     /EC_number="5.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate/glutamate racemase"
                     /protein_id="WP_015703334.1"
                     /db_xref="GeneID:45318844"
                     /translation="MKTIGLLGGMSWESTIPYYRLINEGIKARLGGLHSASLLLHSVD
                     FHEIEACQSAGEWDRAGEILAAAALGLQQAGAEGIVLCTNTMHKVADAIEARCEVPFL
                     HIADATGRAISAKGQRRVALLGTRYTMEQDFYRGRLQQQFAIETLIPQAEDRVRINQI
                     IFDELCLGTFSDASRDYYLQVIEALAAQGAQGVIFGCTEIGLLVPETSSPLPVFDTAA
                     IHAADAVEFMLS"
     gene            complement(472014..473369)
                     /locus_tag="EAE_RS02300"
                     /old_locus_tag="EAE_02215"
                     /db_xref="GeneID:45318845"
     CDS             complement(472014..473369)
                     /locus_tag="EAE_RS02300"
                     /old_locus_tag="EAE_02215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate porin"
                     /protein_id="WP_015703335.1"
                     /db_xref="GeneID:45318845"
                     /translation="MNKIWVGCLISSLFIPAAGAQQTLSLEERLAQMEQRLKATEQRA
                     QNAEAEIRELKHQERATAKSSAPAPATVAAPALAVNKDVDLKFYGDVEFNMDGASRTG
                     SLTSVKTSANKNWAPGDKERWDINGRILLGFDGLRKGANGKYSGFSVQPLADMTGKMN
                     LDDAVFFFGQENDWKIKIGRFEAYDMFPLNQDTFIEYSGNTANDLYSDGYGYIYMMKE
                     GRGRSSSGGNFLLSKYVDNWYFELNTLVEDGSSLFVDQNYHGNALENHKNVVYVRPVA
                     AWQSGPWSVAAAVESNLVNNAYGYQNQNGRWVDQSSRTGYGLTMSWNTLKTDAEDGMV
                     VNLSTAYLDAADEEDFSAGINALWHRVELGYIYAHNKIDQFNMAGVSGECDGDCAILT
                     PGRYDIHTIHASWQLPNIMDMPNFNIYLGAYASWLDSSAQRSGNDDERYGARVRFKYF
                     F"
     gene            complement(473479..474909)
                     /locus_tag="EAE_RS02305"
                     /old_locus_tag="EAE_02220"
                     /db_xref="GeneID:45318846"
     CDS             complement(473479..474909)
                     /locus_tag="EAE_RS02305"
                     /old_locus_tag="EAE_02220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014333827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 32 protein"
                     /protein_id="WP_047058941.1"
                     /db_xref="GeneID:45318846"
                     /translation="MIYSISNAERELQAKSVDLNPRWYPRYHLAARAGWINDPNGLVW
                     FDGWYHAFYQHHPYSNQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAV
                     VDGDTLALIYTGHKFHGDPADENNLYQVQCLATSRDGIHFERQGMVIDTPPEMHHFRD
                     PKVWREGESWYMVVGARVDDVGQVRLYRSDDLRHWQDAGILAQAETGMGYMWECPDFF
                     ELDGKRVLMFSPQGMAADGFARRNLFQSGYLLGDWQPGQTFVREEAFVELDSGHDFYA
                     PQSFLTPDGRRIVIGWLDMWESPLPEQQDGWAGMLSLPRELSLGADNRLLMRPAKEVE
                     VLRRDWFPWPVSSLKNQQLTMVEHCETMEVNLHWDMANSCAEQYGLSFGEGLKVYVDN
                     QMQRLVLERRYPQYGLCGTRSVPLPAGSALKLRLFFDSSSVEVFVNDGEACLSSRIYP
                     DARRRELALFSWSGSAALIDGGAWNL"
     gene            complement(474928..476169)
                     /locus_tag="EAE_RS02310"
                     /old_locus_tag="EAE_02225"
                     /db_xref="GeneID:45318847"
     CDS             complement(474928..476169)
                     /locus_tag="EAE_RS02310"
                     /old_locus_tag="EAE_02225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703337.1"
                     /db_xref="GeneID:45318847"
                     /translation="MMKMHHSHSYPLLSALLFFFFVTWSSSGSLLSIWLHQEVGLKAG
                     DTGIIYAVLSVSALFAQICYGFIQDKLGLRKNLLWYITVLLILSGPAYLLFGYLLKIN
                     VLLGSIFGGIYIGLTFNGGIGVLESYTERVARQSQFEFGKARMWGSLGWAVATFFAGL
                     LFNINPQLNFAVASCSGLVFFMLLARLKVSSAPHAMQEAVSGGKVTLEDALRLLTLPR
                     FWALVFFVVGTCIYGVYDQQFPVYFSSQFATLHEGNAMYGYLNSFQVFLEAAGMFCAP
                     WLVNRIGAKNGLIFAGMVMAMRMVASGLVEGPVLISITKLLHAVELPVLLVSIFKYNS
                     LNFDKRLSSTLYLVGFACTSSVIATVLSPLAGYSYEKYGFADSYLIMGLLVFCTTFIS
                     IFLLRSNKASSDSLMSQPSTI"
     gene            476393..477388
                     /locus_tag="EAE_RS02315"
                     /old_locus_tag="EAE_02230"
                     /db_xref="GeneID:45318848"
     CDS             476393..477388
                     /locus_tag="EAE_RS02315"
                     /old_locus_tag="EAE_02230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013574937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_015703338.1"
                     /db_xref="GeneID:45318848"
                     /translation="MASLKDVAKLANVSLMTVSRALNSPERLKAETLARVQAAIEQTN
                     YVPDLSAKKIRGARATPSTIGVLALDTVTTPFSVEITLSIEETARAHGWNSFVVNMFS
                     DDNPDAILDLLLSHRPDGIIYTTMGLRQVPLPAKLLTLPCVLANCESLNENVASYIPD
                     DEQGQYDAVKALLAAGYRRPLCLHLPARHLATIRRRQGMERACREAQVDPDTLDHGYM
                     TYGDEHYRDIPGQLLAHIDQGKPRFDSVVCGNDRIAFMVYQTLLAQGLRIPEDVAVVG
                     YDNMVGIGDLFLPPLSTVQLPHYEIGRLSALHIINGDSHRDTIKVPSPWLPRESV"
     gene            complement(477389..478807)
                     /locus_tag="EAE_RS02320"
                     /old_locus_tag="EAE_02235"
                     /db_xref="GeneID:45318849"
     CDS             complement(477389..478807)
                     /locus_tag="EAE_RS02320"
                     /old_locus_tag="EAE_02235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004149648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar porter family MFS transporter"
                     /protein_id="WP_015369908.1"
                     /db_xref="GeneID:45318849"
                     /translation="MTSLTTDPGLLPNAQRNTRRMNQFVSIAAAVAGLLFGLDIGVIA
                     GALPFITDHFVLSSRLQEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMVGAVLFVAG
                     SIGSAFATSVEMLLAARIVLGVAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLG
                     IVLAFLSDTAFSYSGNWRAMLGVLALPAVLLIILVVFLPNSPRWLAEKGRHIEAEEVL
                     RMLRDTSEKARDELNEIRESLKLKQGGWALFKVNRNVRRAVFLGMLLQAMQQFTGMNI
                     IMYYAPRIFKMAGFTTTEQQMIATLVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVM
                     ALGTLVLGYCLMQFDNGTAGSGLSWLSVGMTMMCIAGYAMSAAPVVWILCSEIQPLKC
                     RDFGITCSTTTNWVSNMIIGATFLTLLDAIGAAGTFWLYTALNVAFIGVTFWLIPETK
                     NVTLEHIERKLMSGEKLRNIGN"
     gene            complement(479102..479863)
                     /gene="kduD"
                     /locus_tag="EAE_RS02325"
                     /old_locus_tag="EAE_02240"
                     /db_xref="GeneID:45318850"
     CDS             complement(479102..479863)
                     /gene="kduD"
                     /locus_tag="EAE_RS02325"
                     /old_locus_tag="EAE_02240"
                     /EC_number="1.1.1.127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002434532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase
                     KduD"
                     /protein_id="WP_015703339.1"
                     /db_xref="GeneID:45318850"
                     /translation="MILDAFSLQGKVAVVTGCDTGLGQGMAVGLAEAGCDIVGINIVE
                     PTETIERVTALGRRFLSLTADLRQIDGIPQLLERAVAEFGHIDILVNNAGLIRRQDAI
                     EFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGGKIINIASMLSFQGGIRVPSYTA
                     SKSGVMGVTRLLANEWAKHNINVNAIAPGYMATNNTQQLRADEQRSAEILDRIPAGRW
                     GLPSDLMGPVVFLASSASDYINGYTVAVDGGWLAR"
     gene            complement(480230..481408)
                     /locus_tag="EAE_RS02330"
                     /old_locus_tag="EAE_02245"
                     /db_xref="GeneID:45318851"
     CDS             complement(480230..481408)
                     /locus_tag="EAE_RS02330"
                     /old_locus_tag="EAE_02245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA C-acetyltransferase"
                     /protein_id="WP_015369905.1"
                     /db_xref="GeneID:45318851"
                     /translation="MKDVVIVGALRTPIGCFQGTLARHSAVELGSVVVKALVERSGID
                     PQCIDEVILGQVLTAGTGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAI
                     QCGEADVVIAGGQENMSRAPHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVT
                     AENLAREYGISRELQDAWALSSQQKARRAIDSGRFRDEIVPVATEHNGSQRLVDTDEQ
                     PRMDASAEGLASLMPTFDQLGSVTAGNASSINDGAAAVMMMSESKAQELGLPILARIR
                     AFASVGVDPALMGIAPVHATRRCLERAGWQLDEVDLIEANEAFAAQAISVGRVLEWDE
                     RRVNVNGGAIALGHPIGASGCRILVSLVHEMIKRDARKGLATLCIGGGQGVALAVERA
                     "
     gene            complement(481520..482395)
                     /locus_tag="EAE_RS02335"
                     /old_locus_tag="EAE_02250"
                     /db_xref="GeneID:45318852"
     CDS             complement(481520..482395)
                     /locus_tag="EAE_RS02335"
                     /old_locus_tag="EAE_02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703340.1"
                     /db_xref="GeneID:45318852"
                     /translation="MHYSPEALTAFVEAAASGSFSAAARRMRKSQSTISTAISNLETD
                     LGLTLFDRSTRQPTLTAQGEQVLGYVKAILAASSRLDELASSLSGNTEPRLTFVLSDT
                     LHPDVLEYLLEQFDRRFPHTEFECLIGEDEDVVDLLQKERAQVGLIEARDSYPMEIGS
                     MRLPLQTAMGIYVAPGHPLAGQGRVFWDDLHGWRELRLSTYLESAPDPSRGQVWSAPN
                     YLLLLSMAVQGFGWCILPCALVEEFAGSGKLKALNIAGWPRSISVDLLWNKRTPLGEA
                     GSWLRQHLEGQGRES"
     gene            482498..482959
                     /locus_tag="EAE_RS02340"
                     /old_locus_tag="EAE_02255"
                     /db_xref="GeneID:45318853"
     CDS             482498..482959
                     /locus_tag="EAE_RS02340"
                     /old_locus_tag="EAE_02255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug/biocide efflux PACE transporter"
                     /protein_id="WP_015703341.1"
                     /db_xref="GeneID:45318853"
                     /translation="MKTNNLQHKTLLERVLHAVSFEGLATLILAPTAAWLMQRSVVEM
                     GGLAILLATMAMVWNLIYNAAFDRLWPVSRLARTLRVRALHAIGFECGFIIIGVTVVA
                     LVLGVSLVQAFMLEIGFMLFFLPYTMFFNWAWDTLRVRVLKYRQPQSLPNS"
     gene            483099..484328
                     /locus_tag="EAE_RS02345"
                     /old_locus_tag="EAE_02260"
                     /db_xref="GeneID:45318854"
     CDS             483099..484328
                     /locus_tag="EAE_RS02345"
                     /old_locus_tag="EAE_02260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_015369902.1"
                     /db_xref="GeneID:45318854"
                     /translation="MSKIWSKEETLWSFALYGTAVGAGTLFLPIQLGSAGAIVLFLTA
                     LVAWPLTYWPHKALCQFILSAKVAAGEGITGAVNHYYGKKVGNLITSLYFLAFFVVIL
                     IYAVAITNSLAEQLARHVAMTPGVRALLSLAVVLVLNLIFLMGRHMTIKVMGFLVFPL
                     IGCFLFLSIYLIGSWQPEHLTSQMQLNAKTWHQIWISIPVMVFAFSHTPIISTFAIDQ
                     QEKYGELAMGKCKKIMKVAYTIICASVLFFVFSCLLSIPLPYIEAARNEGVTILSALS
                     MAPGAPGWLAVTGIIVAVVAMSKSFLGTYFGVIEGASEIVKTSLGQLGIRKSRAFNRA
                     MSIMLVSALTFIVCFINPNAISMIYAISGPLIAMILFIMPTLSTYIIPALKPYRSLGN
                     LITLIVGLLCVSVMFFS"
     gene            484444..485310
                     /locus_tag="EAE_RS02350"
                     /old_locus_tag="EAE_02265"
                     /db_xref="GeneID:45318855"
     CDS             484444..485310
                     /locus_tag="EAE_RS02350"
                     /old_locus_tag="EAE_02265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldo/keto reductase family oxidoreductase"
                     /protein_id="WP_015369901.1"
                     /db_xref="GeneID:45318855"
                     /translation="MSSVTLSGVMTLGDRQVYRLGYGAMQLAGPGVFGPPKDPDAAIR
                     VLQEAVAAGVNHIDTSDFYGPHITNQLIRQALHPYSDDLCIVTKVSARRDEKGNWLPA
                     MSPAELTQAVEDNLRNLGLERLEVVNLRSMLGTHGPVEGSLEEPLTTLLELKARGLIR
                     HIGLSNVTARQVADAQKLTPIVCVQNQYNIANRGDDALIDALAQQNIAYVPFFPLGGF
                     TPLQAQELNEVAAMLDATPMQVALAWLLQRSPNILLIPGTSSVAHLRENLAAATLTLP
                     AGALAKLDSISG"
     gene            485711..486415
                     /locus_tag="EAE_RS02355"
                     /old_locus_tag="EAE_02270"
                     /db_xref="GeneID:45318856"
     CDS             485711..486415
                     /locus_tag="EAE_RS02355"
                     /old_locus_tag="EAE_02270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004124685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilZ"
                     /protein_id="WP_015703342.1"
                     /db_xref="GeneID:45318856"
                     /translation="MIEGTIKTSKYEIIAIFREEQRKQTEIEIFFNNKSISTQIARVD
                     FAEFHIQSDSKIPAGNKFKFILHSDSGKIEFTSQRQKNSAGGAENSNKVAFALPECIQ
                     VVQRRRDPRFRLRDENDFFCHGRHKNGENYAFDIKDISDGGCALIAPSPNLKFLANNS
                     TLKNAILSLAEYGEITVDLIIKNVAMVTLDSEEKSPENYYQISCQFKFRRSDDRKKIE
                     KTLIDLILEAKRKKRV"
     gene            486415..487005
                     /locus_tag="EAE_RS02360"
                     /old_locus_tag="EAE_02275"
                     /db_xref="GeneID:45318857"
     CDS             486415..487005
                     /locus_tag="EAE_RS02360"
                     /old_locus_tag="EAE_02275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_015703343.1"
                     /db_xref="GeneID:45318857"
                     /translation="MPLNNILLYTDDNIIGQSIHDYLSDIHQDITQASYQDIVQGGVA
                     PLAETVIFNMIHKDISAADTVVLLNKLRFHFSRCTLLVLMVKSDIANLCRELIDLENL
                     LILTEKSSLDAFSAITRTQDETPQTRYLRTQRKLTARELQVLELIIACNNNKRIASLL
                     NIDHKTVHSHRIHIMKKLGMNSSQVMHKQIVNMNHC"
     gene            complement(487027..487728)
                     /locus_tag="EAE_RS02365"
                     /old_locus_tag="EAE_02280"
                     /db_xref="GeneID:45318858"
     CDS             complement(487027..487728)
                     /locus_tag="EAE_RS02365"
                     /old_locus_tag="EAE_02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="winged helix-turn-helix transcriptional
                     regulator"
                     /protein_id="WP_015369898.1"
                     /db_xref="GeneID:45318858"
                     /translation="MLHPAVVIDDDEALAVAMAAVASAMADPSRVKILCALMDGRAWT
                     ATELSGAADISPSTASAHLSRLVNSRLLICLAQGRHRYYRLAGGDVAGLLENMMTMAG
                     KSAVPLTTRTPGTLRMARTCYDHLAGEVAVAIYDFLQQQAWLTANGTALTAAGEAHFA
                     RLGITCDSGSRRKVCCACLDWSERRFHLGGAAGAALLQWGVQKGWFMPVPGYREVTIS
                     EPGKRALRQHFGLAL"
     gene            complement(487750..488067)
                     /locus_tag="EAE_RS02370"
                     /old_locus_tag="EAE_02285"
                     /db_xref="GeneID:45318859"
     CDS             complement(487750..488067)
                     /locus_tag="EAE_RS02370"
                     /old_locus_tag="EAE_02285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_015703344.1"
                     /db_xref="GeneID:45318859"
                     /translation="MIAVLFEAQVTPAQQERYLALAAQLKPLLETIDGFIAIERFQSL
                     SAPGKILSLSWWRDEQSVAAWKHNICHQAAQREGRESIFADYQIRVAQVLREYQMQSS
                     HSA"
     gene            488437..488649
                     /locus_tag="EAE_RS02375"
                     /old_locus_tag="EAE_02290"
                     /db_xref="GeneID:45318860"
     CDS             488437..488649
                     /locus_tag="EAE_RS02375"
                     /old_locus_tag="EAE_02290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1471 domain-containing protein"
                     /protein_id="WP_015369896.1"
                     /db_xref="GeneID:45318860"
                     /translation="MKNVKLLAAAGMLSLVSFASFAAHPVSVTSDTLDNAEAKIAAIA
                     KDQGASYHITEAYTGNQVHMTAELSK"
     gene            complement(488762..489628)
                     /locus_tag="EAE_RS02380"
                     /old_locus_tag="EAE_02295"
                     /db_xref="GeneID:45318861"
     CDS             complement(488762..489628)
                     /locus_tag="EAE_RS02380"
                     /old_locus_tag="EAE_02295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_015703345.1"
                     /db_xref="GeneID:45318861"
                     /translation="MAFFTRHLAVDLLLTALAPAIWGTTYIVTSQFLPPDRPFIAALL
                     RVLPAGIALLLWSRQFPQRGEWWKLIITGILNIGAFQALLFIAAYRLPGGLAAVIGAI
                     QPLLVMLLAWCVDRQRSPWLAVVSACAGIIGMAMLLLSPRTVLDSLGIGAAFLGAVSM
                     ALGTWLSRRWALSLPVVAMTGWQLLIGGIVLLPIALLVDPPLHNITPLQAAGYVWLCV
                     AGAMLAYGLWFRGISRLSPVAVSAMSLLSPVTAVLLGWIFLGQKIEGMALAGLIVVLA
                     SVLSIQRALAKR"
     gene            489709..490215
                     /locus_tag="EAE_RS02385"
                     /old_locus_tag="EAE_02300"
                     /db_xref="GeneID:45318862"
     CDS             489709..490215
                     /locus_tag="EAE_RS02385"
                     /old_locus_tag="EAE_02300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014226703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_015369894.1"
                     /db_xref="GeneID:45318862"
                     /translation="MDKLPPTDAVDRILAQWQRERPDLDCSPMGPIGRLKRCAMLLEP
                     RVEAAFVKHGLVRWEFDMLATLRRAGEPFVLSPTQLFSTLMITSGTMTHRLKALEKRG
                     LITRLANPQDARSMLVALTPEGRALIDEAVATHVANEQQLLAGLSAPQLQQLDEALRV
                     FMRLLENE"
     gene            490378..490848
                     /locus_tag="EAE_RS02390"
                     /old_locus_tag="EAE_02305"
                     /db_xref="GeneID:45318863"
     CDS             490378..490848
                     /locus_tag="EAE_RS02390"
                     /old_locus_tag="EAE_02305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_015369893.1"
                     /db_xref="GeneID:45318863"
                     /translation="MDKTHSSTPPESHESRFHKEEFPFFWVVNVYARYTQLMEIELKK
                     IDIDLSRFRVLMLVHQYHRASISRITEYAVSKMPTVTKIVGRLRDDGLLTTHVSVSDG
                     RVTEAELTAAGEAKVAEARALAETVFAKAFKGVTPAQEKKMNQVLALILHNLDD"
     gene            491196..492341
                     /locus_tag="EAE_RS02395"
                     /old_locus_tag="EAE_02310"
                     /db_xref="GeneID:45318864"
     CDS             491196..492341
                     /locus_tag="EAE_RS02395"
                     /old_locus_tag="EAE_02310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_015703346.1"
                     /db_xref="GeneID:45318864"
                     /translation="MVTEHRTEAEKAESGFISRFTLGEGELTFAVKDSLDIAGFPTRA
                     GSPVLQDAPPAVRHAAVVEALLDNGCQLRGKTTLHELAFGVTGINPHSGTPRNPHYPQ
                     LIPGGSSSGSAAVVAAGEVDFAVGTDTGGSVRMPAACCGVAGLKPSFGRLSRAGVMPT
                     ESSLDCVGLFARDIATLRQALAKALGESAPPARRDAPAISYLAGTATPEIEQLIVSRL
                     QQAGLAWTRAELPGFNEAHQAGLTVISQENWLAFHSIINAPNLAPDVARRIHAGAEIG
                     PQQRQAAESVRQQFSAAVDAQLAKTPLIVLPTLPECPPTLEEAADPLKVVNLTRLVRP
                     FNLSGHPALSLPLGEINHRPVALQLVANKNKEFDLLNYAEYLLEKLK"
     gene            492381..493547
                     /locus_tag="EAE_RS02400"
                     /old_locus_tag="EAE_02315"
                     /db_xref="GeneID:45318865"
     CDS             492381..493547
                     /locus_tag="EAE_RS02400"
                     /old_locus_tag="EAE_02315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004867253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_015369891.1"
                     /db_xref="GeneID:45318865"
                     /translation="MLNPSATSRAEKTLHATTIEFAELLADIKKRSEEFEQQKYIPAD
                     IISRFKKIGVYRALVPKRYGGDEISPAEFCQLIETLSTADGSAGWVASFGMNPFYLGG
                     LPPSSLDELYRHGPDIVFAGGIFPPQKATTQDGGYRVSGRWSFASGCSGAELIGVGIL
                     TDDGSDRPLPRIAVLPAGEFTIDPVWNTVGLSGTGSHDVVLNNAFVPQEWTFIRGGEL
                     NLEGPLYRYPVLSLATQVLSVVALGIARAALSEIYAIAERQSSVTGAPCLADRQFAQM
                     EIAHCEADLRSARCWFYDAIDDVWQAILRGDEPGEERINAMRLSSTHITRVSASVTTR
                     ALKLAGMPGISMRSPLQRYARDSMVITQHAFMGELTYINAGNMFFGHSPQPGYL"
     gene            493565..494077
                     /locus_tag="EAE_RS02405"
                     /old_locus_tag="EAE_02320"
                     /db_xref="GeneID:45318866"
     CDS             493565..494077
                     /locus_tag="EAE_RS02405"
                     /old_locus_tag="EAE_02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclear transport factor 2 family protein"
                     /protein_id="WP_015369890.1"
                     /db_xref="GeneID:45318866"
                     /translation="MNEEMLQRLEKLEAVVQIRNAISQYMHLCDDLTHPDTARQIGAL
                     FSETAIWEGIGELYQHKLGRHCGRAAIVGMMNAYISEPSHFAINVHYLTAEHIRVDEN
                     NRAVGRWKMLQASTFRRGGSHLNSAELVIEFIKQDQQWLIHHFTTRNLFSRPVDDWHS
                     LADLPVPDDH"
     gene            494100..495404
                     /locus_tag="EAE_RS02410"
                     /old_locus_tag="EAE_02325"
                     /db_xref="GeneID:45318867"
     CDS             494100..495404
                     /locus_tag="EAE_RS02410"
                     /old_locus_tag="EAE_02325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic ring-hydroxylating dioxygenase subunit
                     alpha"
                     /protein_id="WP_015369889.1"
                     /db_xref="GeneID:45318867"
                     /translation="MSECIPVKNIDTSHTAETLAALVQSDRVHTCLYTSEEIFDLEID
                     NIFNRTWVWVAHESEIPDAGSYKSSMVGTQPVIVVRDRKGNINVLLNRCRHRAATVCE
                     HRSGKTNGFTCPYHGWGYGLDGALRGVPHPESYGDTLNKSELGMVRLRVESYAGMIFA
                     SFNHDIEPLTDFLGPAMKWMDLFMKQGAGYALQATTAHRFRFPGNWKIQLENTTDGYH
                     FPIVHKSFLSSVDKQTEEMLNFVDGKGFVEDLGNGHSVMVMIPELIDLEANLDAPIPE
                     RFSELAQALREEGHDEQQVRRIVRAVGGSGFNLNLFPNVACSMAFFRVLQPISVKETE
                     IHHMVLTMKDGPAIANQARLRLHEHFQGPMGFGTPDDSEAWERVQRGGGAGDDLWIML
                     NRGLPGEVRTADGLRSDVSAETGMRAAYQQWKKYMTADNRGQ"
     gene            495404..495883
                     /locus_tag="EAE_RS02415"
                     /old_locus_tag="EAE_02330"
                     /db_xref="GeneID:45318868"
     CDS             495404..495883
                     /locus_tag="EAE_RS02415"
                     /old_locus_tag="EAE_02330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003450939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic-ring-hydroxylating dioxygenase subunit
                     beta"
                     /protein_id="WP_015703347.1"
                     /db_xref="GeneID:45318868"
                     /translation="MNTSPILNAAIQFINLEADLLDQGEFREWLALWRAEGIYIIPID
                     QQTTDFANVLNYAYDNHEMREKRVQRLYSGESISTTPRARTIRMSGRYRLLSASDEVV
                     EVRCAQFLYEYRKGNEQHYAADVTWTLAPEGDSFRILQKVVRLINGDDYLHSIGYIL"
     gene            495891..496631
                     /locus_tag="EAE_RS02420"
                     /old_locus_tag="EAE_02335"
                     /db_xref="GeneID:45318869"
     CDS             495891..496631
                     /locus_tag="EAE_RS02420"
                     /old_locus_tag="EAE_02335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015963580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_015703348.1"
                     /db_xref="GeneID:45318869"
                     /translation="MTRSVLITGAANGLGLVISRHLWQQGYQVAMADLNLDTVTRSAQ
                     EIDPSQQRLLPLALDIRQPQQFSDALAQIRARFGELDVLVNNAALTLTTPIMEIDVEE
                     FDRVTSTNLRGTFVGCQAIGRYFSQRQQGSIINLASLAGQNGGTASGAHYAASKGGII
                     TLTKVFARALSNAGVSVNAIAPGPLDLPSVRAAVPEEKMPALLEMIPMKRLGDPLLVA
                     RAVELLAAPSATFITGATWDINGGIYMR"
     gene            496656..497624
                     /locus_tag="EAE_RS02425"
                     /old_locus_tag="EAE_02340"
                     /db_xref="GeneID:45318870"
     CDS             496656..497624
                     /locus_tag="EAE_RS02425"
                     /old_locus_tag="EAE_02340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_015703349.1"
                     /db_xref="GeneID:45318870"
                     /translation="MAETLTVRVTEREIQGAEVVVLTLASPDGAPLPSFSAGAHIDLH
                     LGDGIVRQYSLCGSAHHPQRYRLGILKDRASRGGSLAAHALQPGDEVQISPPRNLFAL
                     EMSAPHSILIGGGIGITPMLAMADTLFRAGKSFEVHYCGHSREVMAFLAELADCHFSA
                     QVQLHISDENGRIRPQELLTPHAAAGHLYVCGPEGFMAWINETAQGCGFSAEQLHQEY
                     FNREVETSGGSFEVAVPELNLSVTVGENETIVAALQKAGIKVKVSCQQGVCGTCLANV
                     CSGEPDHRDEYLTEEEREDNDQILLCCSRAKTPRLVIEGFEYVKLK"
     gene            497636..498130
                     /locus_tag="EAE_RS02430"
                     /old_locus_tag="EAE_02345"
                     /db_xref="GeneID:45318871"
     CDS             497636..498130
                     /locus_tag="EAE_RS02430"
                     /old_locus_tag="EAE_02345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase"
                     /protein_id="WP_015703350.1"
                     /db_xref="GeneID:45318871"
                     /translation="MNLTSDFRNAMAQLGSAITIITTDGPAGRFGFTASAVCSVTDSP
                     PTLLVCMNRSSFAHGKFQHNGVLCVNVLSGQHQQLSGIFANGQIRSEERFLHDEWLAL
                     ETGSPALASAVANCDCVIADSHEVGSHSVFYCEVKQIRFGNPSDGLVWFNRQFHTLSM
                     ASCR"
     gene            498262..499542
                     /locus_tag="EAE_RS02435"
                     /old_locus_tag="EAE_02350"
                     /db_xref="GeneID:45318872"
     CDS             498262..499542
                     /locus_tag="EAE_RS02435"
                     /old_locus_tag="EAE_02350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MHS family MFS transporter"
                     /protein_id="WP_015703351.1"
                     /db_xref="GeneID:45318872"
                     /translation="MRKLIIGSFLGNSLEWYDFFLYGTAAALVFGPLFFPTTNDPLLG
                     SFLAFSGFAIGFIARPLGGVIFGHLGDRYSRKMTLIITLTLMGASTFLIGLLPTYAHI
                     GVLAPIALITLRFVQGVASGGEWGGGVLMLSENAPESQKGYYTAWSQVGVCGGFVLSS
                     LAFYLVQLLPQEEVMSWAWRIPFLLSLFIFLVGVYIRRNIQENAEFVASKAENDSKNE
                     AHHLPVLSAFKNHPRAILQAIGLRLAENGAVYIFFTFSVVYCKHIGIDTRDLIAAVTI
                     AMTVEIATILGWGWLSDRIGRKRLYYIGVIGMALVAFPFFWLLNMHTFPAMLLAMLLA
                     LPLCHGAMIAAQPCLMVDLFPVEVRYTGLALGHEIGAVISGGISPMLAVAFLMMWDSY
                     IPIALMLLAFALLALVALISIRQQQLRPEPVATA"
     gene            complement(499586..500581)
                     /locus_tag="EAE_RS02440"
                     /old_locus_tag="EAE_02355"
                     /db_xref="GeneID:45318873"
     CDS             complement(499586..500581)
                     /locus_tag="EAE_RS02440"
                     /old_locus_tag="EAE_02355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703352.1"
                     /db_xref="GeneID:45318873"
                     /translation="MKWIILLVLSLCSFLARAGNCELTPSIPPASIEASGNYTFKPLA
                     ANGELNLRDSSLQANAFSFRCPSNSNITVSVSLQSPPQTSYYVEVGSKIYEINFSFDQ
                     TKMESLGNGKIVENQVYNLADMFNSLVGIRYEIKEGSANGQRVTPGVPFQMRYGIVLK
                     YCKNNECHNVNINYTFNVTLQVNIMTCGFNVPNRLINMGDYSYFDIKEDKAQYRLESV
                     DIDCNQDESAVFKLTPGKIDYYFVAASGFAGTSKILKNDDQDAATGAGEVGFHLLDSQ
                     GGELQYGSGFLYHSSEDARHGDSNPIYLQIKPMKYGENIRGGTIKSRVIIVINNN"
     gene            complement(500595..503078)
                     /locus_tag="EAE_RS02445"
                     /old_locus_tag="EAE_02360"
                     /db_xref="GeneID:45318874"
     CDS             complement(500595..503078)
                     /locus_tag="EAE_RS02445"
                     /old_locus_tag="EAE_02360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis outer membrane usher
                     protein"
                     /protein_id="WP_015703353.1"
                     /db_xref="GeneID:45318874"
                     /translation="MLRMTPLSSMILLVLLSGQLQAAEETFDTNFMIGGMKGEKSSSF
                     RFADNQPLPGEYELDIYVNKQWRGKYPIVVASNPDDTCLSSALLHQLGIKADSAPLAK
                     DNQCMTLKSAVRSGSYTFNINIFQLDLEIPQAYVLDLERGYVAPESWDRGVNALYTSY
                     YLSQYYSDYKDSGNNKSTYARFNSGLNLLSWQLHSDATYSKADSGGGDWKSNTLYLER
                     SFAPILGTLRAGDMYTSADIFDAVRFRGVRLFRDMQMLPNSKQNFTPIVQGIAQSNAL
                     VTIEQNGFTVYQKEVPPGPFAIADLQLAGGGADLDVTIREADGSVTTYLVPYSSVPNM
                     LQPGVSKYDIAAGRSHIEGASNQEDFMQASYQYGLNNLLTLYGGTMLGTDYQAFTMGT
                     GWNTHLGAVSVDGTWARSDQDNGTFEGQSYQIAYNKYLTQTKTRFGMAAYRYSTSDYR
                     TFNDHVWAKNRNSYHHDDNDVYNIDDYYRYDFGRKNSLSANISQSLPEGLGSFSLSAL
                     WRDYWGKSGSNKDYQLSYTNNWQRVSWTISASQTYDEDHHEDKRFNLFISIPLIWGES
                     DSVLARRLTLSNSTTFDNDGFASNNTGISGTGGQRDQFDYGVNLSRQQQNHETTAGGN
                     LTWNAPLATLSGSYSQSSKYTQASGSLSGGVVAWSGGVNFANQLSETFAIIQAPGLEN
                     AYVNGQKYRTTNAQGTVIFDHVLPYRESSLLLNTANTQSKTELIGNRKAVAPYRGAVV
                     LARFDTDQRQPWLIHAERPDGTPLKFGYEIEDNDGQNVGVVGQGSMLYIRTDNVPPSI
                     TIAVDKLQGHYCTITFKHTIDEGKTYVCR"
     gene            complement(503097..503780)
                     /locus_tag="EAE_RS02450"
                     /old_locus_tag="EAE_02365"
                     /db_xref="GeneID:45318875"
     CDS             complement(503097..503780)
                     /locus_tag="EAE_RS02450"
                     /old_locus_tag="EAE_02365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_015703354.1"
                     /db_xref="GeneID:45318875"
                     /translation="MKRILLAGLFIAMQPAHAGVVIFGTRVVYPAEKQEVVVQLMNHG
                     TRSSLVQSWIDDGNTSLPPEKINVPFLLSPPVARITGNSGQQLRIKKLANKLPANKES
                     LFYLNVLDIPPNTPGSEGANTLRFAMQNRIKLFYRPKGIAAVNKDTFKSISLSSRKNA
                     LHIANGSANWLTITEIKLSNVKVNERSVMLAPLSSQDVFLKNNLARQYSLTMIDDNGN
                     FISDRLNVK"
     gene            complement(503832..504398)
                     /locus_tag="EAE_RS02455"
                     /old_locus_tag="EAE_02370"
                     /db_xref="GeneID:45318876"
     CDS             complement(503832..504398)
                     /locus_tag="EAE_RS02455"
                     /old_locus_tag="EAE_02370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015703355.1"
                     /db_xref="GeneID:45318876"
                     /translation="MKRSIIAAAVFSTVLMSINAFAAAPSEEQGELVIIGNVINSSCR
                     FETDYSSTIQLADVDATRFAGMSAGEVLSGNFATSSDPLTIVCPEGTVLKSIDISGGT
                     YTTGGVLNPIATTTSANGVGFKLRLGSADINENTIYDVNNLPDAVTSLGNGVYQMNFS
                     AQYARINAATPVTAGEVRSVLTIAVSAE"
     gene            504749..504994
                     /locus_tag="EAE_RS02460"
                     /old_locus_tag="EAE_02375"
                     /db_xref="GeneID:45318877"
     CDS             504749..504994
                     /locus_tag="EAE_RS02460"
                     /old_locus_tag="EAE_02375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015369878.1"
                     /db_xref="GeneID:45318877"
                     /translation="MKKIILPLLTAALLLPTLTAHATYRAEKRQDARDIRQDARQSGR
                     EEKRECVRNDDKSNMRCREDKRENRREGRRDARDEKW"
     gene            complement(505028..505501)
                     /locus_tag="EAE_RS02465"
                     /old_locus_tag="EAE_02380"
                     /db_xref="GeneID:45318878"
     CDS             complement(505028..505501)
                     /locus_tag="EAE_RS02465"
                     /old_locus_tag="EAE_02380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004867276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_032706451.1"
                     /db_xref="GeneID:45318878"
                     /translation="MDSIDRKILAELQADGRLSITELAERVNLSLSPCHRRLRALEQE
                     GVITGYRANLDPGKMGFNFLAIVFATLKEGDKKAVSAFEEAVAEIPQVVLAQRLFGDP
                     DYLMHVVTRDLPAFQKLYDDKLSAMPGVQHLRSTLVMKTVVQDRPFPLETLNASR"
     gene            505640..506251
                     /locus_tag="EAE_RS02470"
                     /old_locus_tag="EAE_02385"
                     /db_xref="GeneID:45318879"
     CDS             505640..506251
                     /locus_tag="EAE_RS02470"
                     /old_locus_tag="EAE_02385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014226705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysE family translocator"
                     /protein_id="WP_015703356.1"
                     /db_xref="GeneID:45318879"
                     /translation="MEISLIASFWIVSFLLIITPGADWAYAISAGINGRRVVPAVMGL
                     MSGHLLATIIVVAGVGVLIAGHPLALSAITLAGAAYLLWLGVMILRHPAAPGAAQQSA
                     GSWNAWAVKGLCISGLNPKVFLLFLALLPQFTDPHGSWPLALQMSALGAMHLMTCTLI
                     YLLVGYGSRAVLAARPQAAKGVSMVSGLIMIAIAIILFYQQLR"
     gene            507086..507691
                     /locus_tag="EAE_RS02475"
                     /old_locus_tag="EAE_02395"
                     /db_xref="GeneID:45318880"
     CDS             507086..507691
                     /locus_tag="EAE_RS02475"
                     /old_locus_tag="EAE_02395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015875142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_015369873.1"
                     /db_xref="GeneID:45318880"
                     /translation="MKNNSDIKKRNFLTQNEIESLLNAANSGPHAARNYCLTLLCFIH
                     GFRASEICRLRISDIDLRSKCIYIHRLKKGFSTTHPLLNKEIQALKRWLDIRDEYPQS
                     TSEWLFLSRKGNPLSRQQFYQIISASGDQAGLPLEIHPHMLRHSCGFALANMGIDTRL
                     IQDYLGHRNIRHTVWYTASNAGRFYGIWDNSREKQRISLFQ"
     gene            508271..508867
                     /locus_tag="EAE_RS02480"
                     /old_locus_tag="EAE_02400"
                     /db_xref="GeneID:45318881"
     CDS             508271..508867
                     /locus_tag="EAE_RS02480"
                     /old_locus_tag="EAE_02400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_015703357.1"
                     /db_xref="GeneID:45318881"
                     /translation="MNRRRFLTAKEVQAMMQAAQHGPTGERDYCLILLAFRHGMRISE
                     LLDLHYRDLDLNEGRINVRRLKNGFSTVHPLRFDEREAIERWTQQRAGWKAAGKSDAL
                     FISRRGTPLSRQQAYRIIRAAGEEAGTVTHTHPHMLRHACGYELAERGADTRLIQDYL
                     GHRNIRHTVRYTASNAARFAGIWERNNLLEENLQARKK"
     gene            509363..509911
                     /locus_tag="EAE_RS02485"
                     /old_locus_tag="EAE_02410"
                     /db_xref="GeneID:45318882"
     CDS             509363..509911
                     /locus_tag="EAE_RS02485"
                     /old_locus_tag="EAE_02410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015369870.1"
                     /db_xref="GeneID:45318882"
                     /translation="MKIKTLAIVVLSALSLSSAAALADTTTVNGGTVHFKGEIVNAAC
                     AVDAGSIDQTVQLGQVRSAKLATAGSTSSAVGFNIQLDDCDTSVATKASVAFSGTAVD
                     STNTSVLALQSSAAGGATNVGVQILDKTGTPLGLDGATFSAATTLNDGTNIIPFQARY
                     YATGAATAGTANADATFKVQYE"
     gene            509984..510523
                     /locus_tag="EAE_RS02490"
                     /old_locus_tag="EAE_02415"
                     /db_xref="GeneID:45318883"
     CDS             509984..510523
                     /locus_tag="EAE_RS02490"
                     /old_locus_tag="EAE_02415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015369869.1"
                     /db_xref="GeneID:45318883"
                     /translation="MQGVKTGLLMFLFPPLALAGNHWNVTVAGGNMRFQGVIIAESCR
                     VEAGDQQMTVNMGQISSNRFHSAGEDANPVPFDIHLQDCSTAVSQHVGVSFRGVADGK
                     NPDVLSVGEGPGIATGVGIALFDNEDQLIPLNSPPGAWRRLYTGPTTLHFVAKYRATG
                     NQVTGGAANAQVWFSLTYQ"
     gene            510598..511284
                     /locus_tag="EAE_RS02495"
                     /old_locus_tag="EAE_02420"
                     /db_xref="GeneID:45318884"
     CDS             510598..511284
                     /locus_tag="EAE_RS02495"
                     /old_locus_tag="EAE_02420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016831764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_045368437.1"
                     /db_xref="GeneID:45318884"
                     /translation="MTRGLLAGLLMIAASGYSAWAQAGVALGATRVIYPAGQKQVQLG
                     VTNNDDSSTYLIQSWVENADGGKDGRFVITPPLFAMQGKKENTLRIIDATNKQLPQDR
                     ESLFWINVKAIPSMDKSKLSDNTLQLAIISRIKLYYRPAKLALPPDQAAEKLSFSRSG
                     SSLTLTNPTPYYLTVTELNAGTRVLENALVPPMGKTSVKLPPDAGSNITYRTINDYGA
                     LTPKMTGVLR"
     gene            511366..513999
                     /locus_tag="EAE_RS02500"
                     /old_locus_tag="EAE_02425"
                     /db_xref="GeneID:45318885"
     CDS             511366..513999
                     /locus_tag="EAE_RS02500"
                     /old_locus_tag="EAE_02425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial biogenesis usher protein"
                     /protein_id="WP_015703360.1"
                     /db_xref="GeneID:45318885"
                     /translation="MSHLKYGQDRFGSRSARLRPRAILAMAKFPVALCFVLQAGYAQA
                     ELYFNPRFLADDPAAVADLSGFENGQEVPPGTYRVDIYLNDGFMTTRDVTFNRGEKGH
                     GLSPCLTRGQLAGMGVNTAAVNGMSALAADACVPLTELITDATTRFDVGQQRLYLTVP
                     QAFMGNRARGYIPPEMWDDGINAGLLNYNFTGNNVHNDTGGSSNYAYLNLQSGLNLGA
                     WRLRDNTTWSYSSGGSSSSNENKWQHVNTWLERDITPLRSRLTLGDSYTNGDIFDGIN
                     FRGAQLASDDNMLPDSQKGFAPVIHGIARGTAQVSIKQNGYEIYQSTVPPGPFTINDL
                     YAAGNGGDLQVTIKENDGTSQVFSVPWSTVPVLQREGHTRYALTAGEYRSGNDQQEEP
                     KFFQSTVLHGLPAGWTLYGGTQLADRYRAFNLGVGKNMGDFGAVSLDVTQANATLPDD
                     SDHQGQSIRFLYNKSLSDVGTNIQLVGYRYSTKGYYSFADTTYRRMSGYDVETQDGVI
                     QVKPKFTDYYNLAYNKRGKVQLSVTQQLGRTATLYLSGSHQTYWSTGKADQQLQAGLN
                     AAVDDINWTLSYSLTKNAWQQGRDQMLAVNVNIPFSHWLRSDSKSVWRHASASYSMSH
                     DLDGRMTNLAGLYGTLLEDNNLSYSVQTGYASGGEGDSSGTGYAALNYRGGYGNANVG
                     YSRSDGFKQLYYGVSGGVLAHANGVTLSQPLNDTVVLVKAPGAGDVKVENQTGVRTDW
                     RGYAVLPYATEYRENRVALDTNTLADNVDLDDAVVSVVPTHGAIVRADFKAHVGVKLL
                     MTLTHNGKPVPFGAMVTSGSNQSGSIVADNGQVYLSGMPLAGSVQVKWGEGADASCMA
                     SYRLPEESQRQALSQLSAECR"
     gene            514010..514540
                     /locus_tag="EAE_RS02505"
                     /old_locus_tag="EAE_02430"
                     /db_xref="GeneID:45318886"
     CDS             514010..514540
                     /locus_tag="EAE_RS02505"
                     /old_locus_tag="EAE_02430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015369866.1"
                     /db_xref="GeneID:45318886"
                     /translation="MMKKPLNLFGAVLTLVCANAFAADSTITISGYVRDNACAVATES
                     KEFTVDLMDNAAKQFNAVGATTPLVPFRIVLSPCGSSVTAVKVGFNGTPDSDNNDLLK
                     IDGGASAAAGMAVQILNGQQTMLPVNAPSSSIAWTTLTPGQTNTLGFYARLMATRVPV
                     TAGHVYATATFTLEFQ"
     gene            514553..515056
                     /locus_tag="EAE_RS02510"
                     /old_locus_tag="EAE_02435"
                     /db_xref="GeneID:45318887"
     CDS             514553..515056
                     /locus_tag="EAE_RS02510"
                     /old_locus_tag="EAE_02435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004144028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015369865.1"
                     /db_xref="GeneID:45318887"
                     /translation="MKAHYAGWLLAGALALNIIPLHAADITITVNGKVVAKPCTVSTT
                     NASVDLGDLYTFSLVSAGSASAWHSTALDLSNCPVGTSRVVATFSGTADSTGYYKNQG
                     TAGNIQLELQDDSGTTLNNGAQKSVQVDESSQSARFPLQVRALSVNGGATQGTIQAVI
                     SVTYTYA"
     gene            515074..515976
                     /locus_tag="EAE_RS02515"
                     /old_locus_tag="EAE_02440"
                     /db_xref="GeneID:45318888"
     CDS             515074..515976
                     /locus_tag="EAE_RS02515"
                     /old_locus_tag="EAE_02440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000832247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015703361.1"
                     /db_xref="GeneID:45318888"
                     /translation="MKKIIALFTALLLMGWSLDVAAFTCKVADTGQTMTSGAANVYVN
                     LTPSIGVGQNLVVDLSSSIVCKNDSSGGSIIDYINLTSGSAFGGALEAFTGSIYWAGN
                     TYPLPMNSNSSVYIITHTDYRGLPLRMYLTATGAAGGVVINSGELIARLNMHKVASDG
                     NPRDFTWNIYANNNVVVPTGGCDVSARDVTVTLPDYPGSMAVPVTVHCAQNQNLAYYL
                     TGTTADSANSIFRNTASASPAQGIGVQLTRNGTAVPANSNVSLGTVGTSPVNLGLTAT
                     YARTSGQVTAGNVQSIIGVTFVYQ"
     gene            515963..517441
                     /locus_tag="EAE_RS02520"
                     /old_locus_tag="EAE_02445"
                     /db_xref="GeneID:45318889"
     CDS             515963..517441
                     /locus_tag="EAE_RS02520"
                     /old_locus_tag="EAE_02445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="WP_020078005.1"
                     /db_xref="GeneID:45318889"
                     /translation="MSTSKADIPQATTDYILSPCAMAAAGLARMVDDGCRHPVWLQPR
                     VQSMLSISAPADVRQIVVFLPDDPWWLLFVLREAAWLLNQAKRPLPMVILSRSPAPWL
                     WQTLLHQVGDRRLLAAVQAVSSDLPCRRLAALLQGGLVGYPGLQQLSAIEALARGKPP
                     SGLSKIELNATLALLYGHSITSQAQIRGVSQKTLYNQRTSGLNKMVEYHPHLASRFPG
                     SRSKRVTGQGMTALTPFEREFIHAIHSRQIFPVFQPIVDERLRLQGIEILSRWRKDGV
                     VLPPGEFLPHIHSEYAWLLLTAFVLQEAVQNINRYQGEFYFSVNIPPCIAYHDNLARM
                     METAWQQLQNPQWANRLVLEFAETVDLQQQGKAVENMSNIQQQGFRIFLDDCFSHSSV
                     MFPVRTARFSGYKLDMSIVNDFQRDPHALVLIKSLVYYCQLTQNRCIAEGVDSLEKFN
                     QLKALGVDRFQGYLFSPPVTREHLGEIISRFLPDHATCRLAG"
     gene            complement(517478..517753)
                     /locus_tag="EAE_RS02525"
                     /old_locus_tag="EAE_02450"
                     /db_xref="GeneID:45318890"
     CDS             complement(517478..517753)
                     /locus_tag="EAE_RS02525"
                     /old_locus_tag="EAE_02450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012134983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_071596052.1"
                     /db_xref="GeneID:45318890"
                     /translation="MMEILEGHNKFYVNDAEGNQVAEIVFVPTGEHLSIIEHTDVDPS
                     LKGQGVGKQLVAKVVEKMRQEQRKIIPLCPFAKHEFDNTREYDDIRA"
     gene            complement(517762..517992)
                     /locus_tag="EAE_RS02530"
                     /old_locus_tag="EAE_02455"
                     /db_xref="GeneID:45318891"
     CDS             complement(517762..517992)
                     /locus_tag="EAE_RS02530"
                     /old_locus_tag="EAE_02455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015369861.1"
                     /db_xref="GeneID:45318891"
                     /translation="MDKELLEAGYRAYTGEKIDVYFNTDICQHSGNCVRGSAKLFNLK
                     RKPWIIPDQVDVATVVKVIDTCPSGALKYRHK"
     gene            518415..518687
                     /locus_tag="EAE_RS02535"
                     /old_locus_tag="EAE_02460"
                     /db_xref="GeneID:45318892"
     CDS             518415..518687
                     /locus_tag="EAE_RS02535"
                     /old_locus_tag="EAE_02460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004124782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015369860.1"
                     /db_xref="GeneID:45318892"
                     /translation="MKQIVKRARPALLLLLLAVSGCSLSPAIPVLGAAFPGWFFCFLG
                     GALLLIPCHILIARKGWQARFSPLVLSYLALMFLFATILWFLLFAH"
     gene            518694..519722
                     /gene="mdtN"
                     /locus_tag="EAE_RS02540"
                     /old_locus_tag="EAE_02465"
                     /db_xref="GeneID:45318893"
     CDS             518694..519722
                     /gene="mdtN"
                     /locus_tag="EAE_RS02540"
                     /old_locus_tag="EAE_02465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004124783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter subunit MdtN"
                     /protein_id="WP_047058904.1"
                     /db_xref="GeneID:45318893"
                     /translation="MTQSSPSVLRKKWPLLALVLAAIVALIVVIWQLQTSPETNDAYV
                     YADTIDVVPEVSGRIVEMPIRDNQRVKKGDLLFRIDPRPYQAMLDDAKSRLAALDAQI
                     MLTQRTIKAQQYNAQSVSAAVERAKALVKQTTSTRIRLEPLVPQGFAAQEDLDQARTA
                     EKAARAELEATLLQAKQADAAVTGIDAMVAQRAGIVAQIALAELHLEFTEVRAPFNGV
                     VIALKTTVGQYASALKPVFTLLDNDHWYVIANFRETDLQNVRPGVPATVTVMTNHSRP
                     FDGVVDSVGSGVLPEGGSVIGGLPVIQKSINWVHVSQRFPVKIAVKNPDPELFRMGAS
                     ASAVLQAK"
     gene            519732..521663
                     /locus_tag="EAE_RS02545"
                     /old_locus_tag="EAE_02470"
                     /db_xref="GeneID:45318894"
     CDS             519732..521663
                     /locus_tag="EAE_RS02545"
                     /old_locus_tag="EAE_02470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter subunit MdtO"
                     /protein_id="WP_015703364.1"
                     /db_xref="GeneID:45318894"
                     /translation="MHNFWLFLQRELADVPGRANYTLRLTLSCAVLITLFMTLQIPFL
                     AVALIVVFYVSQPNILMIKLGSVLFFVTISVALGLVLLIIKWTYDFPLIRLVASVCLF
                     FGAMYLMRVLGKLGLAFFVVALAVIYAQTFPSMTSQSEVLVRLLLWLWVAINTATLVT
                     LLVNACFRQAFPGYQFRAQLVVMQRQVADVLRQNAAPPTFKEIAGRFNQLQGLFKQAR
                     FAAPEIAADPSRWQALMATTLHCYHLAALLQPGDDHAAARQQIAAALQALVPSMNEGT
                     SFSFSAPAIDDRGANTLILQEMADVLAKLACGETIDLPQGEAEKSPLLLPDAWRNPAY
                     LHFALKTLLATLLCYVFYTAADWQGIHTIMLSCVIVAQPGLGATMQKTWLRIGGALLA
                     TLLALLLIVFVQPWTESIVGLLAMVLPVMALSAWIAAGSERIAYAGIQIGFTFSLAFL
                     SWFGPLTNLTELRDRVIGILLGVLVSSIVHLYLWPDSEAPQLKSRLAQLYRQIADFLR
                     TKDDKPQMVPLFQALTTSETLMHRVAAEPLGTFAHPWPQAKSWPSKATWQQAQEIVRL
                     SEGYRLYAAPGDPFLSRCAEQLQTYADDIERQQPTAPVAPLVVDPANPFGEPLAALLT
                     TLPDWSDKPSEFTRQAEPS"
     gene            521660..523132
                     /locus_tag="EAE_RS02550"
                     /old_locus_tag="EAE_02475"
                     /db_xref="GeneID:45318895"
     CDS             521660..523132
                     /locus_tag="EAE_RS02550"
                     /old_locus_tag="EAE_02475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MdtP family multidrug efflux transporter outer
                     membrane subunit"
                     /protein_id="WP_015703365.1"
                     /db_xref="GeneID:45318895"
                     /translation="MIKMDAAARFLRYSPLAFVISLLTGCALIQDDPGEVPIVNPQQA
                     QLAQVIHLANSGWPAARWWEGYHDPQLNMLVNRALQNSPTMQAARLRISQSQSTVELA
                     QSAMGVQATAVAAQNRMRITDKSFSWPYSYSLPVDKNGPWYTLNTVGVGATLNIDLWG
                     ADRARVAAAIGEKNARQAETAGIELDLASSVAQLYFAMQATFQKIVLLQQLEEIARLS
                     VQAHEHRTQRGVEDSVDIANAQAELLGAQQQVITARGTLTQYRETLRALIGADAQSMP
                     EIHPVALPALQETLPDSLSFELLARRPDLQALRGYVTASMSQVDAAKAAFYPHFDIKA
                     FWGYNALSIGDLFKSSFQQINLLPGLYLPIFDGGRLNANLKSVRTASNILIKQYNQAV
                     LDAVRDVAISSSQLNDLNQQVALQELKVTATMATTRSASAHHQRGLLSRYAAEEARRP
                     AIAQQLLLLDIQAQRLSTDITLIKALGGDYRGPAVGSAKP"
     gene            complement(523373..524923)
                     /locus_tag="EAE_RS02555"
                     /old_locus_tag="EAE_02480"
                     /db_xref="GeneID:45318896"
     CDS             complement(523373..524923)
                     /locus_tag="EAE_RS02555"
                     /old_locus_tag="EAE_02480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide MFS transporter"
                     /protein_id="WP_015369856.1"
                     /db_xref="GeneID:45318896"
                     /translation="MHSSVNKNESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILF
                     MAATVYDGGMGLARENASAIVGIFAGAMYLAALPGGWLADNWLGQQKAVWYGSILIAL
                     GHLSIALSAFMGNNLFFIGLMFIVLGSGLFKTCISVMVGTLYKKGDSRRDGGFSLFYM
                     GINMGSFIAPLISGWLIKSHGWHWGFGIGGIGMLVALVIFRLFAVPAMKRYDSEVGLD
                     STWNSPVAKKNGVGAWLLALAVGVAVVITLIAQGVIVINPVAVASMLVYVIAASVVLY
                     FIYLFVFAGLNRKERARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTNRMIGDFE
                     IPAVWFQSINALFIILLAPVFSWAWPAMARKNVRPSSITKFVIGILCAAAGFGLMMLA
                     AQNVLSNGGAGVSPLWLVGSILMLTLGELCLSPIGLATMTLLAPERMRGQMMGLWFCA
                     SALGNLAAGLIGGHVKADQLDMLPDLFARCSTALLICAAVLCVLIVPVRRMLENSKSV
                     EQKPATNA"
     gene            525472..525576
                     /locus_tag="EAE_RS02560"
                     /db_xref="GeneID:45318897"
     CDS             525472..525576
                     /locus_tag="EAE_RS02560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001312672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2618 domain-containing protein"
                     /protein_id="WP_006819052.1"
                     /db_xref="GeneID:45318897"
                     /translation="MENNNRMMPHIRRTTHIMMFAHRNSFDFHFFNAR"
     gene            525840..528038
                     /gene="speF"
                     /locus_tag="EAE_RS02565"
                     /old_locus_tag="EAE_02485"
                     /db_xref="GeneID:45318898"
     CDS             525840..528038
                     /gene="speF"
                     /locus_tag="EAE_RS02565"
                     /old_locus_tag="EAE_02485"
                     /EC_number="4.1.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_308748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase SpeF"
                     /protein_id="WP_015369855.1"
                     /db_xref="GeneID:45318898"
                     /translation="MTDLKIAVSRTCPNCFSTQRNIVNTSETNFIDVAAVVLTLEDIE
                     CGKLDELKATGYNIPVFIAINKEEVVPAEYMASVQGVFEHDETRNDFYGRQLEAAAHK
                     YETELRPPFFSALVDYVKQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGETLFRSDLC
                     NADVAMGDLLIHEGAPCIAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLTPGDLVL
                     FDRNNHKSNHHGALLQAGATPVYLETARNPYGFIGGIDAHCFEERYLRELVGEVAPNR
                     KQDARPFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCS
                     PLLLELNENDPGILVTQSVHKQQAGFSQTSQIHKKDSHIKGQQRYVPHKRLNNAFMMH
                     ASTSPFYPLFAALDINAKMHEGESGRNMWMDCVMNGIKARKLILESCKHIRPFVPKMV
                     DGKPWQSYETAQIAVDLRFFEFGPGERWHAFDGYAEHQYFVDPCKLLLTTPGINTASG
                     EYDAFGVPATILANFLRENGVVPEKCDLNSILFLLTPAEDMAKLQQLVALLARFDKLL
                     DADAPLQEVLPSIYSQHKERYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKDHFPRV
                     VMNPQEANYAYLRGQVDLVPLPQAEGRVAAEGALPYPPGVLCVVPGEVWGGAVLQYFT
                     ALEEGINLLPGFAPELQGVYIQEHDGRKQVWCYVIAESEKQSALLKGETV"
     gene            528035..529351
                     /gene="potE"
                     /locus_tag="EAE_RS02570"
                     /old_locus_tag="EAE_02490"
                     /db_xref="GeneID:45318899"
     CDS             528035..529351
                     /gene="potE"
                     /locus_tag="EAE_RS02570"
                     /old_locus_tag="EAE_02490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016155987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine-ornithine antiporter"
                     /protein_id="WP_015369854.1"
                     /db_xref="GeneID:45318899"
                     /translation="MSKSSNKMGVVQLTILTMVNMMGSGIIMLPTKLAEVGTISIISW
                     LVTAVGSMALAWAFAKCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAI
                     AISAVGYGTELFGATLSPVQIGLATIGVLWICTVANFGGARITGQISSITVWGVIIPV
                     VGLCVIGWFWFSPTMYVESWNPHHVPFFGAVGSSIAMTLWAFLGLESACANTDVVENP
                     ERNVPIAVLGGTLGAAVIYIVSTNVIAGIVPNMDLANSTAPFGLAFAQMFTPGVGKVI
                     MGLMVMSCCGSLLGWQFTIAQVFKSSSDEGYFPKIFSRVSASGAPIQGMLTIVILQTG
                     LSLMTISPSLSNQFNVLVNLAVVTNIIPYILSMAALAIIQKMANVEPGKARSTNVIAF
                     IGAVYSFYALYSSGEEAMLYGAIVTFMGWTLYGLVSPRFEMKNKHS"
     gene            complement(529400..529672)
                     /gene="rcnR"
                     /locus_tag="EAE_RS02575"
                     /old_locus_tag="EAE_02495"
                     /db_xref="GeneID:45318900"
     CDS             complement(529400..529672)
                     /gene="rcnR"
                     /locus_tag="EAE_RS02575"
                     /old_locus_tag="EAE_02495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_310938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ni(II)/Co(II)-binding transcriptional repressor
                     RcnR"
                     /protein_id="WP_015369853.1"
                     /db_xref="GeneID:45318900"
                     /translation="MSHTIRDKKKLQARASKIEGQVSALKKMLDEPHECAAVLQQIAA
                     IRGAVNGLMREVIKGHLTEHIVHEGDEVKREEDLDVVLKVLDSYIK"
     gene            529791..530897
                     /locus_tag="EAE_RS02580"
                     /old_locus_tag="EAE_02500"
                     /db_xref="GeneID:45318901"
     CDS             529791..530897
                     /locus_tag="EAE_RS02580"
                     /old_locus_tag="EAE_02500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel/cobalt efflux protein RcnA"
                     /protein_id="WP_015703366.1"
                     /db_xref="GeneID:45318901"
                     /translation="MNEFLPLLQQGNAWFFIPSAILLGALHGLEPGHSKTMMAAFIIA
                     IKGTVRQAVMLGLAATLSHTAIVWLIAFGGMYFSQKFTAEAAEPWLQLVSAFIILGTA
                     IWMFWRTWRGERNWLQAMQDRDAHHHDDETQIVDTGHGQIALSIFEEGEPPRWRIRTL
                     SGNQWAAGDVSLATRRSGSSFAQMFSFVDKGDYLESAQTIPEPHDFNVRLTLGHQRHT
                     HDYDLAFHEHHHHELDGLEEGSQAYQDAHERAHANDIQRRFDGREVTNWQILLFGLTG
                     GLIPCPAAITVLLICIQLKALTLGATLVLSFSIGLALTLVTVGVGAAVSVRQVAKRWS
                     GFNTLARRAPYFSSVLIGAVGIYMAIHGYLGVRG"
     gene            531014..531670
                     /locus_tag="EAE_RS02585"
                     /old_locus_tag="EAE_02505"
                     /db_xref="GeneID:45318902"
     CDS             531014..531670
                     /locus_tag="EAE_RS02585"
                     /old_locus_tag="EAE_02505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epoxyqueuosine reductase QueH"
                     /protein_id="WP_015703367.1"
                     /db_xref="GeneID:45318902"
                     /translation="MSEFQRPQLTLPNGADKLLLHSCCAPCSGEVMEAIQASGIDYTI
                     FFYNPNIHPQKEYEIRKEENIRFAHKHGVPFIDADYDTDNWFARARGMEWEPERGVRC
                     TMCFDMRFERTALYAYEHGFSVISSSLGISRWKNMQQINDCGERAAGHYPGMVYWDYN
                     WRKQGGSSRMIDISKRERFYQQEYCGCVYSLRDSNRHRKSQGRPLIKIGKLYYGDEGE
                     "
     gene            complement(532164..532754)
                     /locus_tag="EAE_RS02590"
                     /old_locus_tag="EAE_02515"
                     /db_xref="GeneID:45318903"
     CDS             complement(532164..532754)
                     /locus_tag="EAE_RS02590"
                     /old_locus_tag="EAE_02515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020078000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703369.1"
                     /db_xref="GeneID:45318903"
                     /translation="MIEHIKNSLVLNIDVEKNLASMSPRQLEMVKQRLTEYVGAKVGG
                     HTLSIPMVGGILFAVFCFVMPQITVWEIIFRLNGWPDYAILAAAFPSGVLYSILICIP
                     AFLTARGRLIGLKSLLCVITGTGIIAIAFLLFAVITFIMGGGNDAGDLLGAILGVFFI
                     AIGIKCLNTVMFTKTIAFYLLNRVSRQQIKLKHSSG"
     gene            complement(532770..533738)
                     /locus_tag="EAE_RS02595"
                     /db_xref="GeneID:45318904"
     CDS             complement(532770..533738)
                     /locus_tag="EAE_RS02595"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071609852.1"
                     /db_xref="GeneID:45318904"
                     /translation="MVEYYFGHDGLHNISPFDRPATWGGPGPVDFNFHDLAKQLDCSR
                     NFNRVGIIYSNGVSQWLVRPSRRIANSVQSIASHVIVTKVCDISQESSTKAIVKTLQA
                     PSLATEITSTALSCGAAAITLALTLTGTAILPLTAGASVLVAGVIAASGVATVGQCFI
                     GAGRLWTISRGREERLAWLDSQDWYLTTTTILDIISLAGAGAGLAKSIEVWKTMKKIS
                     SAEALSWLRGLSRVERKRLTYEIIRNENPGISNSGIKAAIEMGHYPKRFPSEVLQRTL
                     QRELMQVIVNSSAFAGSGISGTVRNPHNLKKTGQYVIGIIQSFSLT"
     gene            complement(534204..535469)
                     /locus_tag="EAE_RS02600"
                     /old_locus_tag="EAE_02525"
                     /db_xref="GeneID:45318905"
     CDS             complement(534204..535469)
                     /locus_tag="EAE_RS02600"
                     /old_locus_tag="EAE_02525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005225765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine-type phosphatase"
                     /protein_id="WP_015703371.1"
                     /db_xref="GeneID:45318905"
                     /translation="MMPARHQGLLRLFIACALPLLAMQSAVAANWQLEKVVELSRHGI
                     RPPTPGNREAIEAATQRPWTEWTTHDGEMTGHGYAAVANKGRAEGQHYRQLGLLQGQC
                     PSAEDIYVRASPLQRTRATAQALVDGAFPGCGVAIHYVSGDADPLFQTDKFTATQTDP
                     VRQLAAVKAKAGDLAKRRQALAPTIQLLKAAVCQQDKPCPIFDKPWQVEQNQSGKTTI
                     SGLSVMANMVETLRLGWSENLPLSQLAWGKITHASQITAILPLLTANYDLSNDVLYTA
                     QKRGSVLLNAMLDGVKADATPHVRWLLLVAHDTNIAMVRTLMNFSWQLPGYSRGNIPP
                     GSSLVIERWRNSKNGERYLRVYFQAQSLDDLRRLQMPDQQHPMLQQEWRQPDCQQTSV
                     GTLCPYQSALEALSKQIDKSAVPPVNMVL"
     gene            complement(535495..536853)
                     /locus_tag="EAE_RS02605"
                     /old_locus_tag="EAE_02530"
                     /db_xref="GeneID:45318906"
     CDS             complement(535495..536853)
                     /locus_tag="EAE_RS02605"
                     /old_locus_tag="EAE_02530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005225766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703372.1"
                     /db_xref="GeneID:45318906"
                     /translation="MSGIIHFFRASPPQAGAAFDEKRFRRVRWQTFIAMTLAYVTFYV
                     CRLSFTVAKSALVELGITPTELGMIGSTLFFSYAIGKLVNGFIADHANVVRYMSLGLL
                     LSAGMNLLMGMTTNAMLLAIFWGINGWAQSMGVGPCAVSLARWYGFKERGTFYAIWST
                     AHNIGEAMTYMVIAAVIAGFGWQMGYLSTAALGAAGVVLLLLFMRDSPQSSGFPSINV
                     IRDEPQEETEARGSVFKNQLLALRNPALWTLALASAFMYIDRYAVNSWGIFFLEQDKA
                     YSTLEASGIIGVNAIAGIAGTIIAGMLSDRFFPRNRSVMAGFISLLNTAGFALMLWSP
                     HNYYTDILAMIVFGATIGALTCFLGGLIAVDISSRKAAGAALGTIGIASYAGAGLGEF
                     LTGIIIDKTAILENGKTLYDFSTLALFWIGTGLGSALLCFTTAAIVARRHAVERQTSF
                     SS"
     gene            complement(536965..537774)
                     /locus_tag="EAE_RS02610"
                     /old_locus_tag="EAE_02535"
                     /db_xref="GeneID:45318907"
     CDS             complement(536965..537774)
                     /locus_tag="EAE_RS02610"
                     /old_locus_tag="EAE_02535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005225767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol monophosphatase"
                     /protein_id="WP_015703373.1"
                     /db_xref="GeneID:45318907"
                     /translation="MTSLDSSALQARYRLACELAKAGAELAFEYYQQREALAVEHKGN
                     DLQDVVSVADKRVEAFVKQRITDAFAEDGFLGEESGTQMPDARVLWVVDPIDGTSCFL
                     NGLHTWCLSLAIVVDGEPVVGVVYDPNHRELFHALRGHGAWLNETPIRPHPAATVKEG
                     VMGVGTSHRVTPAQFLPFLDALLSDGGMFIRNGSGALMSAWAAAGRLIGYYEPHMNPW
                     DALPGLVLMREAGGVANDFLAQEGIRHGNPLLLASQTLYPQLKNMILQPLH"
     gene            complement(537891..538847)
                     /locus_tag="EAE_RS02615"
                     /old_locus_tag="EAE_02540"
                     /db_xref="GeneID:45318908"
     CDS             complement(537891..538847)
                     /locus_tag="EAE_RS02615"
                     /old_locus_tag="EAE_02540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005225768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="substrate-binding domain-containing protein"
                     /protein_id="WP_162198565.1"
                     /db_xref="GeneID:45318908"
                     /translation="MAKLAGVSRSAVSRAFTPGASVSPKTRAKVQAAAEALGYQVNII
                     ARTMNTGSSNFIGIITSGFDNPFRSKLLAPLIHQLALHGFMPLLMNADDPQQLAPSLK
                     HLLSYHVAGVIITSGAPPLELAEEYLARKIPVTLINRHAELPGCDRVSSDNALGGKLA
                     AELLHAGQCRDVGFIGENRDNFSTRQRYEGFIHHASGLAVTAHFCETGGYQSGFAAAR
                     RLAAERPGLQALFCATDMLAIGAMDGLRADNPAAVLPAIIGFDDIPQAEWQPYQLTTI
                     QQDTTLLAYHAVEMLVSRIAKFNQPSRHREVAVKLIIRNSAK"
     gene            539350..540423
                     /locus_tag="EAE_RS02620"
                     /old_locus_tag="EAE_02545"
                     /db_xref="GeneID:45318909"
     CDS             539350..540423
                     /locus_tag="EAE_RS02620"
                     /old_locus_tag="EAE_02545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase family peroxidase"
                     /protein_id="WP_015703375.1"
                     /db_xref="GeneID:45318909"
                     /translation="MSKLDFRSPNTWRALASIAVIVGATAAAFAWTSGWLGSRTTSQS
                     LVPDPDKPFPAGFRRAHGKGICFSGTFEPAAPAVSYSTARLFSQSETPVVGRFSIGAG
                     NPHAADNSTKTLSMALLLKTDDKQQWRMAMNNEPYFATRNPEGFLAMKKATAVDPATG
                     KPDPQRLAVFLQDYPEAGKYLQWAAQKPAPGGFAGATFYSINAFYLVNADRQRQPVRW
                     MMRPHDPFVSIADEQRQKADHNFLFEQLQQRLSQHPIYWDLVLQLAQAGDAVDDPSQP
                     WPNDRQQVIAGTLKVTQLVAQAEGACRDVNFDPSIVPAGVEVSNDPVLNARSGAYSHS
                     WSRREREIGYGKATEAVQKTEVK"
     gene            540420..541004
                     /locus_tag="EAE_RS02625"
                     /old_locus_tag="EAE_02550"
                     /db_xref="GeneID:45318910"
     CDS             540420..541004
                     /locus_tag="EAE_RS02625"
                     /old_locus_tag="EAE_02550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b"
                     /protein_id="WP_015703376.1"
                     /db_xref="GeneID:45318910"
                     /translation="MNSNHHKQARAPQHFNPLARYLHWLMAIMILTMLFIGAAMMTSL
                     HHRIWLVDVHRPLGIAILLLALIRLANRFYSGQPPLPAELSRLQVLAAKASHWALYAL
                     MLAMPLLGWAQLSAAGVPIVMFEGLNLPAITPTSPLLFAWFHDAHRLLAKLLFAVVLL
                     HLSAALVHAWIFRDGVFASMAKSTSRSSKPPVER"
     gene            541336..542682
                     /locus_tag="EAE_RS02630"
                     /old_locus_tag="EAE_02555"
                     /db_xref="GeneID:45318911"
     CDS             541336..542682
                     /locus_tag="EAE_RS02630"
                     /old_locus_tag="EAE_02555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine-histamine antiporter"
                     /protein_id="WP_015703377.1"
                     /db_xref="GeneID:45318911"
                     /translation="MGSVSAGTAQKMGLTALTLVTASNMMGSGVFMLPTNLAGVGYIS
                     LWGWLFTIIGVIALALVFAKTSLITPRAGGIVAYASDAFGPFIGFQTTICYWISAWIG
                     NVALLVAGVGYLSYFFPALHNPVYGCITAIAILWAFIALGSLGAKTAGRAQSFTASCM
                     LVVVLGVGIVGWFWFDPKMFSEVYNGTGNSDSSAIVSAASIALWGFLGVESAVVSSGQ
                     VENPERTVPRATVYGLLIASVCYVGSCTVIMGLVPHAELVKSAAPFADAARYMFGDMA
                     GNIASALSIIACFGSISGWLILQSEGPRAGAKQGLFPQIFAETNKNDVPMKGLIISGV
                     LMSLVLLLTASPDLAKQFQVVILMSVFASLLPYMYAIIALPIIMVSKKLNRGRGFMFY
                     CVLTVIGMIYSIFALLGSGTDSIFWGTIMMMVTIPLFSFVAAGRNKKGQDILYLQK"
     gene            542717..543853
                     /locus_tag="EAE_RS02635"
                     /old_locus_tag="EAE_02560"
                     /db_xref="GeneID:45318912"
     CDS             542717..543853
                     /locus_tag="EAE_RS02635"
                     /old_locus_tag="EAE_02560"
                     /EC_number="4.1.1.22"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine decarboxylase"
                     /protein_id="WP_015369839.1"
                     /db_xref="GeneID:45318912"
                     /translation="MSLSIADQNKLDAFWSYCVKNRYFNIGYPESADFDYTMLERFLR
                     FSINNCGDWGEYCNYLLNSFDFEKEVMEYFSGIFKIPFAESWGYVTNGGTESNMFGCY
                     LGRELFPEGTLYYSKDTHYSVAKIVKLLRIKSQLVESQPDGEMDYDDLINKIRTSGER
                     HPIIFANIGTTVRGAVDNIAEIQKRIAALGIPREDYYLHADAALSGMILPFVEDPQPF
                     TFADGIDSIGVSGHKMIGSPIPCGIVVAKKANVDRISVEIDYISAHDKTISGSRNGHT
                     PLMMWAAVRSHTDAEWHRRIGHSLNMAKYAVDRFKAAGIDALCHKNSITVVFPKPSEW
                     VWKKHCLATSGNVAHLITTAHHLDSSRIDALIDDVIADLAQRAA"
     gene            543970..545238
                     /gene="hisS"
                     /locus_tag="EAE_RS02640"
                     /old_locus_tag="EAE_02565"
                     /db_xref="GeneID:45318913"
     CDS             543970..545238
                     /gene="hisS"
                     /locus_tag="EAE_RS02640"
                     /old_locus_tag="EAE_02565"
                     /EC_number="6.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine--tRNA ligase"
                     /protein_id="WP_015703378.1"
                     /db_xref="GeneID:45318913"
                     /translation="MSAKLKAIRGMRDVLPAETPIWQWLENKFRRLTYRYGYQEIRLP
                     LLEPVALFERAVGEATDIVAKEMYNFTDKSGEQITLRPEGTSGCMRAVLENNLCYNKT
                     QRLWYQGPMFRYERPQKGRLRQFTQFGAEAFGMAGPDVDAEMIFMVRDLFQELGLTPH
                     VRLEINSLGTPDERRAHKAALVDWFNAHREQLDEDSLKRLETNPLRILDSKNPTMQPM
                     LEQAPRLLDYLSEESRHHFSLLCELLDKADIPYTINPRLVRGLDYYTRTVFEWVTDEL
                     GSQGTVCGGGRYDGLAELFNPKALPACGFAIGIERLLLLIQTVSQKDNPLWHFHPDVV
                     ITSECQDDGLRAQMLAELLRQRIEKLSVMVDCSGNKLKRQHQTALQSQCRAIITLNTD
                     NEIRLWDLASSRQMTLEEKALIDWLQQHCQ"
     gene            545351..547174
                     /locus_tag="EAE_RS02645"
                     /old_locus_tag="EAE_02570"
                     /db_xref="GeneID:45318914"
     CDS             545351..547174
                     /locus_tag="EAE_RS02645"
                     /old_locus_tag="EAE_02570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_047079498.1"
                     /db_xref="GeneID:45318914"
                     /translation="MPRKNRLFIPGMPHMAQLRGHNGEELFRHEEDYSAFERCMQDAA
                     QRYAVSIHSWSLAVPRILLLVSAPDKQALSRFIQHIGRSYVPYYNRRYQRHGALWDSR
                     YLCSPLEPETYFLAVKRFIECDEDGSPGCHSHGNQPSGLIVPHPVWLKLGENEQQRQA
                     HFQEFCRQPVNRALVTRIRHALAQNCLLASPALSQQLEAQMERPLRARHCGRPRKYES
                     SPSEQWTWLELQAEQFLRQHGYQQIRLPLLEHTSLFAPGGPVMADKGKLRGDGTTGCL
                     RLMADNPHTAVMSRIWYSGAMFRQRSLDGDIRQNHQIGVEAFGMPGVDIELEHLVMQA
                     VFFRRIGLGEMAELHINMLGDEASLAAFRRALRDYYQPISRLLNPEQQHWLEKHPEWL
                     IHHEDILLQRLAPAAPCLADFITVDSRHRFQRLQHALTQAGIAWQYDPALFPANDYCQ
                     LVFEWRSIAMERELIISRGGRYDACASRIAEKPVSACGFAFMMEPIVTLLGYRPQPAR
                     AHPPTDIVIIAGQPRVAAKAMLLGRSLRQQFPYLSIINDCSPQRISTRYKNSRRLGAR
                     FILEIEGDGETIILSDSRDHRFKICTLDNITDRLAQVVLSQ"
     gene            complement(547207..548874)
                     /locus_tag="EAE_RS02650"
                     /old_locus_tag="EAE_02575"
                     /db_xref="GeneID:45318915"
     CDS             complement(547207..548874)
                     /locus_tag="EAE_RS02650"
                     /old_locus_tag="EAE_02575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen ligase family protein"
                     /protein_id="WP_015703380.1"
                     /db_xref="GeneID:45318915"
                     /translation="MMNALHRIAPLPAQKLLLVVSLFFWGGAMHLYWPNNGGSGLSLP
                     LNITAWIYAVVLAASALMLVPRQRWRITIPAAGFTMGALILTLLCLLTPEIWRSEALL
                     VAGALSGGVLVYLATLQIPLTTNTLTLLLALLWGACVLECLAFTYQYWHWPGVNYWEF
                     AWRRGTRPYGIFQQVNLMASFTACGVLLSALLYLRLRGGYRIIIAIALVIMGFVLHES
                     QSQTGYLSVAVGEALLLAVFPAQRRTLLLLLLPLAIGMIAGALARHFLSVVTVNHLTT
                     SQVRWTVLKASLALFAERPWTGWGVGSFAAVFLERAGPLGLSSISHPHNELALWLVEG
                     GLVGLVGALCFMASGLWLWLYGNRWHRACLVAALPVVIHMLTEYPVRQSTPHWLLLIL
                     LLRCADCRRKGARLPFTLASLLRAVASIAVAVITPLLFLTLQTQQQLTLAERQSTQWR
                     LAESLPVGGWLLATRYRFDVQMGYLQRYQHTRDERWLAAVRRWAPDYVRVQPDPNVSF
                     TQILLALQQRDLAEAHRLATRFCLLYPNDRRIPWLQDARRPFNQIME"
     gene            complement(548876..549415)
                     /locus_tag="EAE_RS02655"
                     /old_locus_tag="EAE_02580"
                     /db_xref="GeneID:45318916"
     CDS             complement(548876..549415)
                     /locus_tag="EAE_RS02655"
                     /old_locus_tag="EAE_02580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003838876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015369835.1"
                     /db_xref="GeneID:45318916"
                     /translation="MRFTLLIATSALLLGGLAQADTKLVGGDMYFHGTIRALACSLAP
                     GGDKIEVDFGQIATQDLYLSGRSKPKKFSIELRDCNPEVFRGISVTFSGSEDAELADH
                     LALDSSEQGASGIGIGMSEEDGTAIRLDESTSVKEITEGSMTLNFLAWVAAEPSALKN
                     QTLEYGPFSASGTWTLNYQ"
     gene            complement(549425..550489)
                     /locus_tag="EAE_RS02660"
                     /old_locus_tag="EAE_02585"
                     /db_xref="GeneID:45318917"
     CDS             complement(549425..550489)
                     /locus_tag="EAE_RS02660"
                     /old_locus_tag="EAE_02585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003830813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015369834.1"
                     /db_xref="GeneID:45318917"
                     /translation="MSVLHKALLWVVLAGCPLAGQAFTLGEGEPQGGSPHQYDIELNS
                     LDVSKNHEGGRTDPFTWNLGSWYVVDFHCEQADISRQPIYYTTTTTMPPSNQGANRFR
                     LNDYLDVEVKVWVAGRYNDYVQAPFTNFSNRYNDHNCKKRKGYERATNIESGSKGKVT
                     FIVTKPIINGINITSQSLVEVAGRLGSAGPTPTTPISRVVIKSGLITVPDKCIFNRGD
                     KISIEFGDLPGSAARLNGTNYSKSIPIHVVCEGGSFDQGALNINLGVQTTTASGTAGF
                     NDHLLGTLSGGQKRDDLGIVIKDASGGTVVPNQFYNVKGFYQNQGDWNLTAAPVAKPG
                     VGSVKEGEFEASATVVAQFQ"
     gene            complement(550486..551091)
                     /locus_tag="EAE_RS02665"
                     /old_locus_tag="EAE_02590"
                     /db_xref="GeneID:45318918"
     CDS             complement(550486..551091)
                     /locus_tag="EAE_RS02665"
                     /old_locus_tag="EAE_02590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015703381.1"
                     /db_xref="GeneID:45318918"
                     /translation="MKKMLCALLMAGMACSVQATSGRHDMSNVSGEYGNVRFHGRVFV
                     SPCVLDMASRDQTIDLGDISASRFRQSGDRSDPVLVTLHLNGCLKGSGHTLKDFPGQT
                     SELPELSHSTVERGVSMTLMAESAPENSDLGRIRGDVRGAGIRLLTERNQLIHLNQPQ
                     RMWILKPGDNAIHFLAALESFGQEVTAGEFNGLVRLKLEYL"
     gene            complement(551103..551879)
                     /locus_tag="EAE_RS02670"
                     /old_locus_tag="EAE_02595"
                     /db_xref="GeneID:45318919"
     CDS             complement(551103..551879)
                     /locus_tag="EAE_RS02670"
                     /old_locus_tag="EAE_02595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004093254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_015703382.1"
                     /db_xref="GeneID:45318919"
                     /translation="MNNQSLKFARRWLKPVACGLFFIAQINASWAGIALDRTRMIITG
                     DARSVSANLTNTSPSIPFLAQSWVEDAHGTKITSPLMVLPPLQRINGGQKGIARVTKT
                     SGVNALPQDRESLFYLNVREIPPKPDKPNVLQLAMQSRIKLFYRPTAIVPETPGAVWQ
                     NQLIFHKQGQRWTVDNPTPYFVTLIGLSRKPEAQGGGRLTDFPGIMIPPKSSLDFKVS
                     DASVSQFSMMYVNDFGGHPELKFSCTGNVCKALPMEQQPR"
     gene            complement(551906..554377)
                     /locus_tag="EAE_RS02675"
                     /old_locus_tag="EAE_02600"
                     /db_xref="GeneID:45318920"
     CDS             complement(551906..554377)
                     /locus_tag="EAE_RS02675"
                     /old_locus_tag="EAE_02600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PapC/FimD family outer membrane usher protein"
                     /protein_id="WP_015703383.1"
                     /db_xref="GeneID:45318920"
                     /translation="MITLKTDKKRLALFIVLVCAASWAEADEAIEFNTDVLDASDRHN
                     VDLQRFSEGNFVAPGEYLLDVRINSQEIPQQTIRYIADPANSHKSIACLTAQQLELLA
                     LKEEALTHIHPISATCYDISHLPGVALNNSAGVLDITVPQAWMKYTDPDWTPPERWDN
                     GVAGLIFDYSISGQATHYEQGGDHYRSLSGYGQTGFNLGAWRFRGQYQANYTSDDNHG
                     RIDWDQIYAYRPLPMQAAKLTVGEIYLNSQVFDSVRFTGVNLASDERMLPPNLQGYAP
                     EVHGIARSNAKVTVSQQGRVIYQTTVPAGPFNIQDLHGSVRGTLDVRVEEQDGSVQTF
                     QVNTADIPYLTRPGYVRYNAAVGKPSRYNHDVQGPAFYSGDFSWGVSNAWSLYGGALL
                     TGERYNAWSMGIGRDLNWLGALSADATQSVSRVKHQAEQKGMSFKLSYAKTFDEYNSA
                     ITFAGYRFSQRTFRTFSQFLDEQYESNNSAGNEKEMYTVTGNKTFFADDPHLATTLYL
                     TYTHQNYWDRGSQDRYGLSMGHSFSFAGIQGISTNLAAYRSEYQGKRDDSLSLSISVP
                     WGDGRSMDYELQNSGNQTSQMVSYSDNRDRNNPWRLRAGVSGEGHTAFDGYYQHRSMM
                     AELESNVSWQQSRYFSVGGTVRGGFTATRHGAALHNSQASMNTARVMVDTDGVANVPL
                     NGEQAHSNRFGIAVVPDVVSYHSFDTRIDVDAMDEDISATKAIVTNTLTEGAIGYQRF
                     AVAQGQKMMALLRLKDGSVPPFGAEVFNANGVSVAMVMENGMAWIAGVNPSERLSVAW
                     AGRAQCHLQVPQQINPEGNVLLPCE"
     gene            complement(554418..554966)
                     /locus_tag="EAE_RS02680"
                     /old_locus_tag="EAE_02605"
                     /db_xref="GeneID:45318921"
     CDS             complement(554418..554966)
                     /locus_tag="EAE_RS02680"
                     /old_locus_tag="EAE_02605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015703384.1"
                     /db_xref="GeneID:45318921"
                     /translation="MPGWRILLLFIFISPAWVSADTFRLVSTPGKMRMRGNIIEAACY
                     VDPRDRSLLVEFDDLSARDISGKPEKVSAHNFSIHLLGCSLGDSQHPGNVFQRANITF
                     SGAPDRDNPDYLSVQSETENLAIEIYDSKGQQIHLGEPSPDYVLNPGKNTLKFTAYLI
                     SRDGRMTSGEFTAVTHFVVNYL"
     gene            complement(555036..555584)
                     /locus_tag="EAE_RS02685"
                     /old_locus_tag="EAE_02610"
                     /db_xref="GeneID:45318922"
     CDS             complement(555036..555584)
                     /locus_tag="EAE_RS02685"
                     /old_locus_tag="EAE_02610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003838888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 fimbrial protein"
                     /protein_id="WP_015369827.1"
                     /db_xref="GeneID:45318922"
                     /translation="MKMKNVAVACALMAGMTFTASSAFAAKNVEPTNGKIHFTGSLVN
                     SACGLAPESSPVQVNFGEIPTSQLKDNQRAGVKHAKIVLQGCDTTVAKTATVTYTPAT
                     IDADNNALAAFTSGTAKGAGIGMVDSGNQDVEWGKAASQVNITDGETDIDFVAYLQAN
                     NASAAVTPGDFESTVNFQIDYQ"
     gene            556228..557016
                     /locus_tag="EAE_RS02690"
                     /old_locus_tag="EAE_02615"
                     /db_xref="GeneID:45318923"
     CDS             556228..557016
                     /locus_tag="EAE_RS02690"
                     /old_locus_tag="EAE_02615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015369826.1"
                     /db_xref="GeneID:45318923"
                     /translation="MISHIPINKIKSVIIGDGLVFRPLKNTLKDVASGEIATLNNVAT
                     QLLLYLLQNGKEISSRDEILLNVFQHNGARATDANLNQHISFLRKAITSTGHPAELIV
                     TIPRIGFRMGDVNINIQLQEEAQTAARVAYVASTPRRKKPNRWPVAITALITSIAVLA
                     TAWLTWIPNHIAMTDAAILRTIDYEQCRVHILGNALTDTITEKKALDIFKSVGISPNC
                     SHPKDLYLNTWASNHNLVEWSFAAECGLNLGYYHCISQYRHHEE"
     gene            557018..557536
                     /locus_tag="EAE_RS02695"
                     /old_locus_tag="EAE_02620"
                     /db_xref="GeneID:45318924"
     CDS             557018..557536
                     /locus_tag="EAE_RS02695"
                     /old_locus_tag="EAE_02620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703385.1"
                     /db_xref="GeneID:45318924"
                     /translation="MKQESDHSFLLWSVVIVIIGLAAIAYLIITGNAKKQEISFSCSS
                     EFTSIIDIQNTKKELHGIMLITSYNSGHLSLSVQGKLKSDDGEFAVNRKLFFRYARPL
                     GHTAGVFMLTPEGREKSPDDNATDAVDYLFFDAYEHADKLYMLKRLNEETVLIGDNFS
                     PRFACVMNHFAD"
     gene            complement(557964..558665)
                     /gene="aphA"
                     /locus_tag="EAE_RS02700"
                     /old_locus_tag="EAE_02625"
                     /db_xref="GeneID:45318925"
     CDS             complement(557964..558665)
                     /gene="aphA"
                     /locus_tag="EAE_RS02700"
                     /old_locus_tag="EAE_02625"
                     /EC_number="3.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001620835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase AphA"
                     /protein_id="WP_165442603.1"
                     /db_xref="GeneID:45318925"
                     /translation="MIRSAAFVSALIFSVPAFCANPVSSDTGIGATLQQITEQYPIHF
                     ISIEQIVKELKNKPPMDVGFDIDDTIYYSTPAFIHGQRELSPKSNEFLKKSEFWDRLS
                     NGWDSFSVPKKSASELIKLHLERGDRIWFVTGRQKPTNGKETVTELLGRDFSIPHEKL
                     NKVIFAGEDKGAKVQYIRDRNIKLYYGDSDGDIKDAREAGAEPIRVMRALNSSNQPMP
                     RNGALEEKVLVNSDY"
     gene            complement(558709..559995)
                     /locus_tag="EAE_RS02705"
                     /old_locus_tag="EAE_02630"
                     /db_xref="GeneID:45318926"
     CDS             complement(558709..559995)
                     /locus_tag="EAE_RS02705"
                     /old_locus_tag="EAE_02630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin, OprD family"
                     /protein_id="WP_072056542.1"
                     /db_xref="GeneID:45318926"
                     /translation="MSPIYAAEESRSRPPNGVTNFITDSSADISLRNQFKNLNSSDYG
                     ERSVQTAWGQGVTLDFRSGYIADIIGFDTSYYQVFKLAASDDFAGRSVLYNDNGKAKG
                     FHKFGQLYAKLKLDGEDSYFRLYSGWQIINKWGALTNSSRAIPSTYQGWKMDSEFGRL
                     AFRGAWVDRYSDRDSPEQVHFQTADRKKNISYLATGELSYKQKDYSVLYFYGESHNYM
                     QRHGVEVGWQPQSLAKNQGRVLTMLYMNHGLKDFKAMSADYRPFNNDAWHAAFYLEWK
                     QHKWKNKFGASWTRANSSDDHLGYFERHMAKNSRGRFNSMADAWGNDYVGNNEKSVTW
                     TTEYNLTPEVNIGLQSAIGWGMKYHSQTIERGETILFSRWKPSWEKNLSFQLSGGPSW
                     NYQSKKNRPILTDDGRPKRAVNHSIEFQIDYAFNLF"
     gene            559889..560131
                     /locus_tag="EAE_RS02710"
                     /old_locus_tag="EAE_02635"
                     /db_xref="GeneID:45318927"
     CDS             559889..560131
                     /locus_tag="EAE_RS02710"
                     /old_locus_tag="EAE_02635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703388.1"
                     /db_xref="GeneID:45318927"
                     /translation="MNWFLKEISALLSVIKLVTPFGGLLLDSSAAYIGDIDADINKIV
                     ARGLLKKQQFNISIIPYIASLLLKLSKGPTFKNVEA"
     gene            complement(560166..561344)
                     /locus_tag="EAE_RS02715"
                     /old_locus_tag="EAE_02640"
                     /db_xref="GeneID:45318928"
     CDS             complement(560166..561344)
                     /locus_tag="EAE_RS02715"
                     /old_locus_tag="EAE_02640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003244143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrimidine nucleoside transporter NupC"
                     /protein_id="WP_015703389.1"
                     /db_xref="GeneID:45318928"
                     /translation="MKYLIGIMSFLVIFILAILASNNRGAIRYRPLVVMLFCQFTFAG
                     LLLKTSLGNQVIAVIAGAFAHLMAYASEGVNFVFGGLQNHGELSFFISVLLPIVFVSA
                     LIGILQHLKILGFLIRYIGLGLSKINGMGRLESYNAVASAVLGQSEVFISVKQQLGLL
                     PQHRLYTLCTSAMSTVSMAIVGAYMAMLEPRYVVTALVLNLFGGFIIASLLNPYQVEP
                     QEDILTVSEGHQSFFEMLSEYILDGFKVALIVGAMLIGFIALITMMNAIFTAIFGISF
                     QALLGYLFAPMAYLVGVPWHETVDAGSLMATKIVSNEFVAMLSLKSMAAEFSVRTMAV
                     LSVFLVSFANFSSIGIIVGAIKALNNEQGNSAARFGLKLLYGATLVSFLNATIVGLFF
                     "
     gene            complement(562026..562345)
                     /locus_tag="EAE_RS02720"
                     /old_locus_tag="EAE_02645"
                     /pseudo
                     /db_xref="GeneID:45318929"
     CDS             complement(562026..562345)
                     /locus_tag="EAE_RS02720"
                     /old_locus_tag="EAE_02645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006818667.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /db_xref="GeneID:45318929"
     gene            complement(562365..562697)
                     /locus_tag="EAE_RS02725"
                     /db_xref="GeneID:45318930"
     CDS             complement(562365..562697)
                     /locus_tag="EAE_RS02725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001562993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV toxin-antitoxin system YeeU family
                     antitoxin"
                     /protein_id="WP_072056541.1"
                     /db_xref="GeneID:45318930"
                     /translation="MTHRQPDAPWWGLKPTVTPCFGARLVQEGNRLHYLADRAGFNGA
                     FSDDDALRLDQAFPLILKQLELMLTSGEISPEHQHSVTLYHNGLTCEADTLGSCGYVY
                     IAIYPTQR"
     gene            complement(562728..562949)
                     /locus_tag="EAE_RS02730"
                     /old_locus_tag="EAE_02655"
                     /db_xref="GeneID:45318931"
     CDS             complement(562728..562949)
                     /locus_tag="EAE_RS02730"
                     /old_locus_tag="EAE_02655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_588435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF987 domain-containing protein"
                     /protein_id="WP_015703392.1"
                     /db_xref="GeneID:45318931"
                     /translation="MKIISKRQAMTIYRQHPHSRLFRFCTGRYQWSGSICHYAGREVQ
                     DISGVLAVFAERRQDRNGPYVVLPSVTLN"
     gene            complement(562961..563440)
                     /gene="radC"
                     /locus_tag="EAE_RS02735"
                     /old_locus_tag="EAE_02660"
                     /db_xref="GeneID:45318932"
     CDS             complement(562961..563440)
                     /gene="radC"
                     /locus_tag="EAE_RS02735"
                     /old_locus_tag="EAE_02660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004109365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="WP_015703393.1"
                     /db_xref="GeneID:45318932"
                     /translation="MEQQLPLFVRELAPTDQQTVRRALLLLERQLREPGASFTSSHTV
                     RDWLRLQLSTLEREEFIALFLDNQHRLIAHDTLFTGTINHTQVHPREVVKTALKHNAV
                     AILVAHCHPSGLAEPSDADRRITERLKQALDLVDIRLLDHLVVGGMDIVSFAERGWL"
     gene            complement(563451..563933)
                     /locus_tag="EAE_RS02740"
                     /old_locus_tag="EAE_02665"
                     /db_xref="GeneID:45318933"
     CDS             complement(563451..563933)
                     /locus_tag="EAE_RS02740"
                     /old_locus_tag="EAE_02665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008815314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="WP_015703394.1"
                     /db_xref="GeneID:45318933"
                     /translation="MNNKLTLTSTVTESLFSPHTDAGGIVCTPVPDEQRVAFWPGHFG
                     SIPQWIILEPTVFAWMDRFCKDYHGGIWNFYTLSNGGAFMAPEASGDDDGKWALFNNM
                     NGNGAEMSADATGIAVCLMTYSHHAMRTECDGMTEHYYQLRGYALNHAECNAIMHIID
                     "
     gene            complement(564191..565009)
                     /locus_tag="EAE_RS02745"
                     /old_locus_tag="EAE_02670"
                     /db_xref="GeneID:45318934"
     CDS             complement(564191..565009)
                     /locus_tag="EAE_RS02745"
                     /old_locus_tag="EAE_02670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001234406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF945 domain-containing protein"
                     /protein_id="WP_015703395.1"
                     /db_xref="GeneID:45318934"
                     /translation="MRLASRFGRINQIRRDRPLTHEELMSHVPSVFGSDKHESRSDRY
                     TYIPTITILESLQREGFEPFFACQTKVRDQSKREHTKHMLRLRRAGQLNGHQVPEIIL
                     LNSHDGSSSYQMLPGLFRGVCTNGLVCGQSFGEVRVPHKGNVVEKVIEGAYEVLGVFD
                     RVDEKRDAMQSLTLPVPVRHALANAALKYRFGEDHQPVTESQLLTPRRREDYSDDLWT
                     VYQRVQENLMKGGLSGRTAQGKSSRTRAVTGIDGDVKLNRALWVMAEELQQALS"
     gene            complement(565100..565441)
                     /locus_tag="EAE_RS02750"
                     /old_locus_tag="EAE_02675"
                     /db_xref="GeneID:45318935"
     CDS             complement(565100..565441)
                     /locus_tag="EAE_RS02750"
                     /old_locus_tag="EAE_02675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000720953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703396.1"
                     /db_xref="GeneID:45318935"
                     /translation="MKKIIMVAALCLLSFSSLAASSPVSVSVSPGSYSHYSSIRITSK
                     VDSIVIKQLIVNRGNCQDAEFASPWKPVRLGFGGTVSHEFTGKGLMVPCNVLEVVVQT
                     SEGAWQFDFDS"
     gene            complement(565476..565940)
                     /locus_tag="EAE_RS02755"
                     /old_locus_tag="EAE_02680"
                     /db_xref="GeneID:45318936"
     CDS             complement(565476..565940)
                     /locus_tag="EAE_RS02755"
                     /old_locus_tag="EAE_02680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000727137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703397.1"
                     /db_xref="GeneID:45318936"
                     /translation="MKNKLIISLLLASVLTPSVSHAFGNRDSWVSGYVQGTSEYTILG
                     KGQSQLYLACDSSGSQPATIIFTDVNGHQVRMDSGQTLTMRIDNAEEVNISESESHVG
                     SDNVMWAWNKLRTGKRVLVSGSGVKPATFTLAGAAAVLSAFGDNGCVPGFAL"
     gene            complement(566066..566224)
                     /locus_tag="EAE_RS25000"
                     /old_locus_tag="EAE_02690"
                     /db_xref="GeneID:45323376"
     CDS             complement(566066..566224)
                     /locus_tag="EAE_RS25000"
                     /old_locus_tag="EAE_02690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001128372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703399.1"
                     /db_xref="GeneID:45323376"
                     /translation="MPLILLWGGLALLLGIVASANGRSFWGWFILGLIIDPILAGLLY
                     WLIAKDRS"
     gene            complement(566437..567324)
                     /locus_tag="EAE_RS02760"
                     /old_locus_tag="EAE_02695"
                     /db_xref="GeneID:45318937"
     CDS             complement(566437..567324)
                     /locus_tag="EAE_RS02760"
                     /old_locus_tag="EAE_02695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000682561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HSR1-like GTP-binding protein"
                     /protein_id="WP_047079510.1"
                     /db_xref="GeneID:45318937"
                     /translation="MKHPSGYTLIRRHLRRYPHALRQHLLQELNRLVTYEPVIGIMGK
                     TGVGKSSLCNALFRSEVCTVNAVEACTRQPQRVRLRFGTHFLTLVDLPGVGESVTRDG
                     EYRELYRDIMPQLDMVLWVLKADDRAYAVEEQFYRDVFARFSEPQPPVLWVLNQVDKT
                     EPAEQWRWPSAQPSELQAERIAQKQHAVARQLGVAEQDILPVSVRGRYRLSRLVEAMI
                     TRLPKQARSPLVPHLQNGYHTEAIISTASSSFGDAVVEVIDKIIDLAPLPHVARSALQ
                     AVTHTVARAARSLWGFFFG"
     gene            complement(567421..568347)
                     /locus_tag="EAE_RS02765"
                     /old_locus_tag="EAE_02700"
                     /db_xref="GeneID:45318938"
     CDS             complement(567421..568347)
                     /locus_tag="EAE_RS02765"
                     /old_locus_tag="EAE_02700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020885364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703401.1"
                     /db_xref="GeneID:45318938"
                     /translation="MNRYVEVRSIREGVYILWRLGNTEKARQFASGGQRDLIRCNGAI
                     NRIIEQALTEKNNNPSIIRRVIRLQEKYEQQRINENIASWVNHDKNACIYFWLYLFTR
                     FTHSSISVEDIRRIIRNDNDRHNYRLYRDALPLQIPDTAEQCFMAGLYILDLLPLPPE
                     VIRNEVDKIRKGYYRVKDSLRDDFAWIADADQGNVEWVWEQLKKHRDFLKDTNLTEFS
                     QHLLSQLIPFLYYLWDERSDTKQLFLNTLRKRYANMKHRKKVADKAPVNIRISKNAKD
                     TLVKLEKRFNRNRADVIESLIERAWAEMNQKN"
     gene            complement(568951..569496)
                     /locus_tag="EAE_RS02770"
                     /old_locus_tag="EAE_02705"
                     /db_xref="GeneID:45318939"
     CDS             complement(568951..569496)
                     /locus_tag="EAE_RS02770"
                     /old_locus_tag="EAE_02705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020885365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703402.1"
                     /db_xref="GeneID:45318939"
                     /translation="MRHFLTTYRDSILALTGIIIAIISLGFAIWQGREEIRHNHISVE
                     PRINAYFSNDGRKNQWGIYAINNGMGTAFVNRMVVMVDGKPVEPVDNNIFLGAVLALG
                     LHAKCFVIGGPRPNDSFKVGEEIFLVEARGSEKNCAEDRLRLKWASQNPHQLDFVLGM
                     ESIYGDKFRYTYSLNRQDKLD"
     gene            569816..570412
                     /locus_tag="EAE_RS02775"
                     /old_locus_tag="EAE_02710"
                     /db_xref="GeneID:45318940"
     CDS             569816..570412
                     /locus_tag="EAE_RS02775"
                     /old_locus_tag="EAE_02710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020885366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inovirus-type Gp2 protein"
                     /protein_id="WP_015703403.1"
                     /db_xref="GeneID:45318940"
                     /translation="MAYHNITDTNLNYVQHRTLQRYQRHHLSELFARYSKLLMFRVDF
                     YYRVDSNAWCHADKHSTTADMILLLQRCNTMTGLVGFTWVLEYTEQHGYHIHAAFYLN
                     GQKHRKIWPTFKTLQALWVEITREEGCAYRCTPQKYYKVQGERVTSHSDMKGRKGMLY
                     ILSYLSKQDQKGEKVVCQLSDIPAPAVGGRRRRCAISE"
     gene            570501..570707
                     /locus_tag="EAE_RS02780"
                     /old_locus_tag="EAE_02715"
                     /db_xref="GeneID:45318941"
     CDS             570501..570707
                     /locus_tag="EAE_RS02780"
                     /old_locus_tag="EAE_02715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000211143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AlpA family transcriptional regulator"
                     /protein_id="WP_015703404.1"
                     /db_xref="GeneID:45318941"
                     /translation="MTTDYSVLKDQLVTMAFITQLTGLTDKWFYKLIQDGEFPKPIKL
                     GRSSRWLESEVEAWLQQRIAHSRQ"
     gene            570825..571217
                     /locus_tag="EAE_RS02785"
                     /old_locus_tag="EAE_02720"
                     /db_xref="GeneID:45318942"
     CDS             570825..571217
                     /locus_tag="EAE_RS02785"
                     /old_locus_tag="EAE_02720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012602075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703405.1"
                     /db_xref="GeneID:45318942"
                     /translation="MTIYAKSFIALDGNQRLTGAVTAQLHPDDRYTCHLCGSALVFHP
                     EWGTNRPWFEHTWEDLTENSRHYCPYVRPEPKESRRIRMLRRYVPDVLPIVRKAEFHC
                     SECDSHYHGERYCLNCRTGDHSVEVTAN"
     gene            571278..571706
                     /locus_tag="EAE_RS02790"
                     /old_locus_tag="EAE_02725"
                     /db_xref="GeneID:45318943"
     CDS             571278..571706
                     /locus_tag="EAE_RS02790"
                     /old_locus_tag="EAE_02725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019106746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703406.1"
                     /db_xref="GeneID:45318943"
                     /translation="MRILKCYLANNIRNQFVNAKEAAKAGDDTGYWTCASCGCELHLL
                     TGEAGEAPWFEHIRHSIPHQRLMKCAWVDPEEKARAREKKLRQVAYSVDKNVRPPQEW
                     HCVLCDTTYQGNKYCRICKSGLYSTEPILRDSRTRSEAEK"
     gene            complement(572023..>572342)
                     /locus_tag="EAE_RS02795"
                     /pseudo
                     /db_xref="GeneID:45318944"
     CDS             complement(572023..>572342)
                     /locus_tag="EAE_RS02795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858162.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing N-terminus; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /db_xref="GeneID:45318944"
     gene            complement(572561..572770)
                     /locus_tag="EAE_RS02800"
                     /old_locus_tag="EAE_02735"
                     /db_xref="GeneID:45318945"
     CDS             complement(572561..572770)
                     /locus_tag="EAE_RS02800"
                     /old_locus_tag="EAE_02735"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_015703408.1"
                     /db_xref="GeneID:45318945"
                     /translation="MKKRFSDATFYTWRKKYGGIEVREVIHLKSLEEENARIKKLLPK
                     PRFIRRHFSWLWGESTEDRPKAGSR"
     gene            573487..574068
                     /locus_tag="EAE_RS02805"
                     /old_locus_tag="EAE_02740"
                     /db_xref="GeneID:45318946"
     CDS             573487..574068
                     /locus_tag="EAE_RS02805"
                     /old_locus_tag="EAE_02740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006536338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015703409.1"
                     /db_xref="GeneID:45318946"
                     /translation="MKKLIISALVAASFAAVSTPTFAGAEENPPSENNDGKPQQVTVN
                     GGTIHFEASVVNAACAVDANSINQTVQLGQFKLSDFSKKGDETSRIPFSIKLNSCDPA
                     VASTAAITFVGTPSESEQDVFALQGAGAAKNIALKLVDSQNKQIAPGQVSTGVKLIDG
                     SNELNYSASLISTSDEVSAGNANAVTNFMVTYS"
     gene            574137..574811
                     /locus_tag="EAE_RS02810"
                     /old_locus_tag="EAE_02745"
                     /db_xref="GeneID:45318947"
     CDS             574137..574811
                     /locus_tag="EAE_RS02810"
                     /old_locus_tag="EAE_02745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017628494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus periplasmic chaperone"
                     /protein_id="WP_164926765.1"
                     /db_xref="GeneID:45318947"
                     /translation="MRKLFLGMLFILAATQQVYAGGVTLGATRVIYSSSAKQAELTVI
                     NTDSQNKFLVQSWIDDENGHKNKDFIVTPPLYVLEANKENTLRVVYTGNNLPQDRESM
                     FWVNVKVIPPLNDEGKTTNTLQIAIQNRIKLFYRPQSIAKYDEREHEKIRFVRHGNKL
                     EISNPTPYYLTLVNIKSNQRELASNLVVAPFSSDYLTTNVSGSVSYQTINDFGAQTPK
                     VTKQID"
     gene            574873..577386
                     /locus_tag="EAE_RS02815"
                     /old_locus_tag="EAE_02750"
                     /db_xref="GeneID:45318948"
     CDS             574873..577386
                     /locus_tag="EAE_RS02815"
                     /old_locus_tag="EAE_02750"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012786.1,HMM:NF025319.1,HMM:NF025320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbria/pilus outer membrane usher protein"
                     /protein_id="WP_164926739.1"
                     /db_xref="GeneID:45318948"
                     /translation="MNNSLSIIQKSFKLGFMFFIIPCLEVNADNNYNPAFLSDNPDAV
                     TDLDYFKSGNIIPPGLYTVKLYLNDVYFKTLELSFIDNKGTVKPCIRKNLVEELDINL
                     LSLKEEALSDDCLDIEQLIPNSSVSFDIKNQSVSIGIPQSALNFKARGYIPPEHWDNG
                     INAATVNYSFNGNNGFSEYNSNNYYLNLRSGLNVGAWRLRDYSTWSYGKNGSSWNHIN
                     TYLQRDVVPLKSRLLIGESYTNSDIFEPLSFRGFSLESNDNMLPDSMRGFAPVVRGIA
                     HGHAKVTIRQNSYVIYQTFVPAGPFEIRDLYPTSNSGDLHVSVEEDDGSLNNYTVPYS
                     AVPILQRDGNHKFNLSIGNTRGGYQQENTRFLQAGIILGLPYDFTIYGGTQYSDKYNS
                     YAFGVGNNLGDFGALSADIITSQSELPDGNKRRGYSTRFLYAKSLNSYGTNFQLLGYR
                     YSTSGFYTLSDTLNKRMNGYISDKEDSVAESYFDLRYKKKDSMQVNLSQQIGDIGSVF
                     FTSNFQNYWDTNEKNTLLQAGYSGNLGDISYNLIYSYNKGIQGMGDDKMVSLGISVPF
                     RFFTSSPIETSNTYLNYNLSNSQNYTNHNVSMSGTLLDDNTLNYNVQQGLTNNGTGAS
                     GGVSVGYQSRYGNGNVGYSYQKTNRQLDYNFSGGLLFHENGITLSQPINSNAVLVDVP
                     NSPDIRIENSTGIYTDRNGYAVIPYATAYHKNRIALDTNSFNDHVDIEENVHFSVPTE
                     GAITKVKFKPRIGNRVLFTLKKNGRPLPFGAIANDKNHKLSGIVGEEGVLYLSGVPDK
                     GKLNVAWGKEIGKSCTVDYSIPENLRKEKFAKLYLECYE"
     gene            577379..577906
                     /locus_tag="EAE_RS02820"
                     /old_locus_tag="EAE_02755"
                     /db_xref="GeneID:45318949"
     CDS             577379..577906
                     /locus_tag="EAE_RS02820"
                     /old_locus_tag="EAE_02755"
                     /inference="COORDINATES: protein motif:HMM:NF012635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_015703412.1"
                     /db_xref="GeneID:45318949"
                     /translation="MSNIYKTMIICFLCFQALLGHAADTRIYVNGNLIGNTCTVSSQS
                     KNMTIKMGNIGSKDFIRPSSDGLWAAELPFSIDLTDCQTESIGVKVHFLGTPDTNNKE
                     LLRTLDNGAKGLAIRLMDENKNPIAINQSSKVYVINPELDVNKLNFYARYVLTQDNLT
                     PGPANAVSTFMLEYL"
     gene            577936..578979
                     /locus_tag="EAE_RS02825"
                     /db_xref="GeneID:45318950"
     CDS             577936..578979
                     /locus_tag="EAE_RS02825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004249173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_150377942.1"
                     /db_xref="GeneID:45318950"
                     /translation="MIFSVISSNSAFARADPLELNPPPMSFSGSADGTHVGTPITANW
                     IGENYVKYGFECTRAGLGKCYVQRVRALALGEKVNGVYYSDGKHQYSVYRVPGVPGIG
                     YAFGLKDNNDSVDYNPVDGQGDPTAGTIVYPQKGSTVNKDVNRVSLKAKIVFVVTGEH
                     LVSGSYHIPPLVIAKTWSEYGGRHNGNEQSVVTLNSTELNIKARACTVNTKSLTFNMG
                     DVLIRDLDKIGATSKLISKQISLQCDKNIHLYAGMTDQTDQSNTSSVLSLTKESTGSG
                     VGIQFFFNNDPTPISFGPDISSKGQPNQRELYITTMDNEFYSLDLKSNYIRTGGLKPG
                     SANGIASVTFSYQ"
     gene            579612..580499
                     /locus_tag="EAE_RS02830"
                     /old_locus_tag="EAE_02760"
                     /db_xref="GeneID:45318951"
     CDS             579612..580499
                     /locus_tag="EAE_RS02830"
                     /old_locus_tag="EAE_02760"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012354.1,HMM:NF015431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703413.1"
                     /db_xref="GeneID:45318951"
                     /translation="MMRVSPELLQIFVACVDCGSFSAAAKKLQKAQSTVSMSISALED
                     DLNIILFERQGRKVKLTKEGEVIYSRALIVLNARQELINVAGELVDVQEVAITIALSG
                     FIPDQQREFLKKELDAHINSLQITILSAESYKIDSMISNGEVDIAVIPAINSRMNYPI
                     ELKSRRTWFKSRLHIYCSSTHPLSQLTELCEDDIKRFRRIRLVKGMINNQSPRNNIFT
                     DNIFSAYRLCAQGLGWCELPEWFVESQYRQGDTRLKKLSVSPIWETLEFDAIFRNSSK
                     GKFMDWFIGMVTRKEPLNV"
     gene            581338..582849
                     /locus_tag="EAE_RS02835"
                     /old_locus_tag="EAE_02770"
                     /db_xref="GeneID:45318952"
     CDS             581338..582849
                     /locus_tag="EAE_RS02835"
                     /old_locus_tag="EAE_02770"
                     /inference="COORDINATES: protein
                     motif:HMM:NF012772.1,HMM:NF024202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic diguanylate phosphodiesterase"
                     /protein_id="WP_047079493.1"
                     /db_xref="GeneID:45318952"
                     /translation="MKKKPLFYLPWLLCIFLAFVSVGTALCYLQMQNNLQKNMRTRLN
                     KAVTILDKVLTEASQVSRNAEKFMGRECTDEVLTVLRGIVAIHPYIRSVGIVKDHAFY
                     CSTIIGNRYFPLKLAAYTKQNLILLKGNQLTPYESLIVYNTQDTQGNAVRVTINGFYF
                     FRVLKNISMDTPLQLQIGELILDSNGKVTSASKGNSLIESTSSKFEYKVFAEFPVQPL
                     YITFVNYEWKSILIVLFISILSTYLISKHLYYRLTTEFMLKNGLKHKELKAFIQPIIN
                     GVNNNIIGGEILVRWEHPSLGFIPPDEFIPLAERSLLIKDITRLCFEQVIESLNQNKL
                     KLPGELYMCFNISALNFIDDDIVILCSRFLEKLRQLKISLVLEITERELIEDTLQIKC
                     IIEKLRMLGVKFSLDDFGTGHANYSYLKKFAPDFLKIDKMFTAEIEKKSVSIQVVKNM
                     IDLAASFNCKIIAEGIENTKQLQSLKMLGISLFQGYYFGKPESLEDYTQRFRY"
     gene            complement(583425..584591)
                     /locus_tag="EAE_RS02840"
                     /old_locus_tag="EAE_02780"
                     /db_xref="GeneID:45318953"
     CDS             complement(583425..584591)
                     /locus_tag="EAE_RS02840"
                     /old_locus_tag="EAE_02780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001546991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-type recombinase/integrase"
                     /protein_id="WP_015703417.1"
                     /db_xref="GeneID:45318953"
                     /translation="MKLTARQVETAKPKEKPYKLADGGGLYLLVNPNGKRYWRLKYRS
                     LGKEKLLAIGVYPDVSLSEARGKREDAKRTLAAGNDPSLERKIEKLSRQQNAENSFEA
                     ITREWYQRRYDRWSVSYREEMLRTFEKDVFPYIGHRPIKDIKPMELLAVLSKIEARGA
                     TEKVRKVRQRCGEVWKYAVVTGRAEYNPAPALASAVTPHEKEHYAFLTQDELPEFLRT
                     LNTYAGSVIVKIAMQLLILTGVRPGELRQAEWREFDFERKVWNVPAERMKMRRPHLVP
                     LSGQAIDLLNQLKPMTEAGTLLFPGRNNPKKPMSEMALTVLVRRIGYAGRVTGHGFRH
                     TMSTILHEQGFNSAWIELQLAHVDKNSIRGTYNHAQYLEGRREMMQWYSNYISQ"
     gene            complement(584755..584828)
                     /locus_tag="EAE_RS02845"
                     /old_locus_tag="EAE_t24832"
                     /db_xref="GeneID:45318954"
     tRNA            complement(584755..584828)
                     /locus_tag="EAE_RS02845"
                     /old_locus_tag="EAE_t24832"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:complement(584794..584796),aa:Gly,seq:ccc)
                     /db_xref="GeneID:45318954"
     gene            complement(584909..585628)
                     /locus_tag="EAE_RS02850"
                     /old_locus_tag="EAE_02785"
                     /db_xref="GeneID:45318955"
     CDS             complement(584909..585628)
                     /locus_tag="EAE_RS02850"
                     /old_locus_tag="EAE_02785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan DD-metalloendopeptidase family
                     protein"
                     /protein_id="WP_015369803.1"
                     /db_xref="GeneID:45318955"
                     /translation="MKTRFYIAIMLLASLTLAGCSSTSDSGSTYTVKRGDTLYAISRS
                     TGTSVRDLARLNNISPPYTIEVGQKLKLNGGSKAKSSTAGKKSSSTRTAAVTPSSAVP
                     QSSWPPVGQRCWRWPTSGKVVMPYSTRDGGNKGIDIAGTRGQPVYAAGAGKVVYVGNQ
                     LRGYGNLIMIKHNEDYITAYAHNDKMMVNNGQSVKIGQQIATMGSTDADSVRLHFQIR
                     YRATAIDPLRYLPPQGSKPKC"
     gene            585860..586414
                     /gene="idi"
                     /locus_tag="EAE_RS02855"
                     /old_locus_tag="EAE_02790"
                     /db_xref="GeneID:45318956"
     CDS             585860..586414
                     /gene="idi"
                     /locus_tag="EAE_RS02855"
                     /old_locus_tag="EAE_02790"
                     /EC_number="5.3.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl-diphosphate Delta-isomerase"
                     /protein_id="WP_015703418.1"
                     /db_xref="GeneID:45318956"
                     /translation="MAGEHVILLDEQDKPTGMLEKYAAHTLDTPLHLAFSCWLFNEQG
                     QFLVTRRSLSKKAWPGVWTNSVCGHPQQGETFEQAVTRRCRFELGVEIADIAPVHPAF
                     RYRAVAPNGIVENEVCPVFAARVVSELQPNDDEVMDYQWVELPEMLSALAATPWAFSP
                     WMVLEAKNKNARQALIDFVARLRA"
     gene            complement(586520..588037)
                     /gene="lysS"
                     /locus_tag="EAE_RS02860"
                     /old_locus_tag="EAE_02795"
                     /db_xref="GeneID:45318957"
     CDS             complement(586520..588037)
                     /gene="lysS"
                     /locus_tag="EAE_RS02860"
                     /old_locus_tag="EAE_02795"
                     /EC_number="6.1.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001740376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_015369798.1"
                     /db_xref="GeneID:45318957"
                     /translation="MSEQQAQGADAAIDLNNELKTRREKLAALREQGVAFPNDFRRDH
                     TSDQLHADFDAKENEELEALNVEVAVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARD
                     DLAEGVYNDQFKKWDLGDIIAARGKLFKTKTGELSIHCTELRLLTKALRPLPDKFHGL
                     QDQEARYRQRYLDLISNDESRNTFKVRSQILAGIRQFMVGRGFMEVETPMMQVIPGGA
                     SARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVRHNPEFT
                     MMELYMAYADYKDLIELTESLFRTLAQDILGNTAVPYGDQTFDFGKPFEKLTMREAIK
                     KYRPETEMADLDNFDSAKAIAESIGIKVEKSWGLGRIVTEIFEEVAEAHLIQPTFITE
                     YPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAQRFQDQVDAKAAG
                     DDEAMFYDEDYVTALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPQK"
     gene            complement(588047..589145)
                     /gene="prfB"
                     /locus_tag="EAE_RS02865"
                     /old_locus_tag="EAE_02800"
                     /db_xref="GeneID:45318958"
     CDS             complement(join(588047..589069,589071..589145))
                     /gene="prfB"
                     /locus_tag="EAE_RS02865"
                     /old_locus_tag="EAE_02800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311790.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_096335406.1"
                     /db_xref="GeneID:45318958"
                     /translation="MFEINPVKNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQP
                     DVWNEPERAQALGKERSSLEAIVETLDQMTQGLEDVAGLLELAVEAEDEETFNEAVAE
                     LDGLEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLMRMYLRWAEARG
                     FKTEIIEESEGEVAGIKSVTIKIIGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFS
                     SAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQHVNRTESAVRITHIPTGLVTQCQN
                     DRSQHKNKDQAMKQMKAKLYELEMQKKNAEKQVMEDNKSDIGWGSQIRSYVLDDSRIK
                     DLRTGVETRNTQAVLDGSLDQFIEASLKAGL"
     gene            complement(589231..590964)
                     /gene="recJ"
                     /locus_tag="EAE_RS02870"
                     /old_locus_tag="EAE_02805"
                     /db_xref="GeneID:45318959"
     CDS             complement(589231..590964)
                     /gene="recJ"
                     /locus_tag="EAE_RS02870"
                     /old_locus_tag="EAE_02805"
                     /EC_number="3.1.11.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="WP_015369796.1"
                     /db_xref="GeneID:45318959"
                     /translation="MKQQIQLRRREAVDGVDLPADLPPLLQRLYASRGVRSAQELERG
                     VKGMLPWTQLTGVEKAVEMLHDAFQKGLHIVVVGDFDADGATSTALSVLALRALGYGN
                     VSYLVPNRFEDGYGLSPEVVEQAHARGAQMIMTVDNGISSHAGVDHAHKLGIPVLVTD
                     HHLPGDTLPAAEAIVNPNLRDCDFPSKSLAGVGVAFYLMLALRTFLRDNGWFEARGIA
                     APNLAELLDLVALGTVADVVPLDANNRILTWQGLSRIRAGKCRPGIKALLEISNRDPQ
                     KLAASDLGFALGPRLNAAGRLDDMSVGVALLLCDNIGEARVLANELDALNQTRKEIEQ
                     GMQAEALTLCQQLERSSDTLPGGLAMYHPQWHQGVVGILASRIKERFHRPVIAFAPTG
                     DGTLKGSGRSIQGLHMRDALERLDTLYPGLILKFGGHAMAAGLSLEEARFEEFQQRFG
                     ELVTEWLDPALLQGEVVSDGPLAAAEMSMEVAQMLRDAGPWGQMFPEPLFDGRFRLLQ
                     QRLVGERHLKVMVEPVDGGPLLDGIAFNIDTSIWPDNGVREVQLAYKLDINEFRGNRS
                     LQLIIDHLWPN"
     gene            complement(590970..591683)
                     /gene="dsbC"
                     /locus_tag="EAE_RS02875"
                     /old_locus_tag="EAE_02810"
                     /db_xref="GeneID:45318960"
     CDS             complement(590970..591683)
                     /gene="dsbC"
                     /locus_tag="EAE_RS02875"
                     /old_locus_tag="EAE_02810"
                     /EC_number="5.3.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional protein-disulfide
                     isomerase/oxidoreductase DsbC"
                     /protein_id="WP_015369795.1"
                     /db_xref="GeneID:45318960"
                     /translation="MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSP
                     VSGMSTVLTDSGVLYVTDDGKHIIQGPMYDVSGAQPVNVTNQLLVGKLNALTKEMIVY
                     KAPKEQHVITVFTDITCGYCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAI
                     WCAKDRNKALDDAMNGKGVQPASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQ
                     GPKELKAFLDEHQKQTSGN"
     gene            complement(591706..592602)
                     /gene="xerD"
                     /locus_tag="EAE_RS02880"
                     /old_locus_tag="EAE_02815"
                     /db_xref="GeneID:45318961"
     CDS             complement(591706..592602)
                     /gene="xerD"
                     /locus_tag="EAE_RS02880"
                     /old_locus_tag="EAE_02815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific tyrosine recombinase XerD"
                     /protein_id="WP_015703420.1"
                     /db_xref="GeneID:45318961"
                     /translation="MKQDLAQIEQFLDALWLERNLAENTLSAYRRDLTMLVEWLHHRG
                     LSLASVGSDDLQALLAERQTGGYKATSTARLLSAVRRFFQHLYREKVRPDDPSALLAS
                     PKLPQRLPKDLSEAQVERLLQAPLVEQPLELRDKAMLEVLYATGLRVSELVGLTMSDI
                     SLRQGVLRVIGKGNKERLVPLGEEAVSWVENYLEYGRPWLLNGVASDVLFPSQRAQQM
                     TRQTFWHRIKHYAVLAGIDSAKLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTT
                     QIYTHVATERLRQLHQQHHPRA"
     gene            592703..593224
                     /gene="fldB"
                     /locus_tag="EAE_RS02885"
                     /old_locus_tag="EAE_02820"
                     /db_xref="GeneID:45318962"
     CDS             592703..593224
                     /gene="fldB"
                     /locus_tag="EAE_RS02885"
                     /old_locus_tag="EAE_02820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavodoxin FldB"
                     /protein_id="WP_015369793.1"
                     /db_xref="GeneID:45318962"
                     /translation="MNIGLFYGSSTCYTEMAAEKIRDIIGPELVTLHNLKDDSPALMS
                     QYDVLILGIPTWDFGEIQEDWEAVWEQLDALDLNGKIVALYGMGDQLGYGEWFLDALG
                     MLHDKLATKGVKFVGYWPTEGYEFTSPKPVIADGQLFVGLALDETNQYDLSDERIQNW
                     CEQILGEMAEHFA"
     gene            complement(593232..593642)
                     /locus_tag="EAE_RS02890"
                     /old_locus_tag="EAE_02825"
                     /db_xref="GeneID:45318963"
     CDS             complement(593232..593642)
                     /locus_tag="EAE_RS02890"
                     /old_locus_tag="EAE_02825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_015369792.1"
                     /db_xref="GeneID:45318963"
                     /translation="MVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLL
                     LLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKTEWDIVGTPWVISSGMLLRLKHA
                     ETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD"
     gene            complement(593623..593889)
                     /gene="sdhE"
                     /locus_tag="EAE_RS02895"
                     /old_locus_tag="EAE_02830"
                     /db_xref="GeneID:45318964"
     CDS             complement(593623..593889)
                     /gene="sdhE"
                     /locus_tag="EAE_RS02895"
                     /old_locus_tag="EAE_02830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000354044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD assembly factor SdhE"
                     /protein_id="WP_015369791.1"
                     /db_xref="GeneID:45318964"
                     /translation="MDINNKARIHWACRRGMRELDISIMPFFEYEYDTLSDDDKRLFI
                     RLLENDDPDLFNWLMNHGKPADAQLQRMINLIQTRNRERGPVAI"
     gene            594113..595096
                     /gene="ygfZ"
                     /locus_tag="EAE_RS02900"
                     /old_locus_tag="EAE_02835"
                     /db_xref="GeneID:45318965"
     CDS             594113..595096
                     /gene="ygfZ"
                     /locus_tag="EAE_RS02900"
                     /old_locus_tag="EAE_02835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-modifying protein YgfZ"
                     /protein_id="WP_015703421.1"
                     /db_xref="GeneID:45318965"
                     /translation="MAFTPFPPRQPSFSARLPLTLMTLDDWALATITGPDGEKYLQGQ
                     ITADVSHLTADQHLLAAHCDAKGKMWSNLRVFHRDGGFAWIERRSLREAQLTELKKYA
                     VFSKVTIAANDDLVLLGVAGFQARAALAPLFAALPDAGKPVVTEGVTSLLWFEHPAER
                     FLLVTDADTANRVTDALRGEAQLNNSQQWLALNIEAGLPVIDSVNSAQFIPQATNLQA
                     LGGISFKKGCYTGQEMVARAKFRGANKRALWTLAGTASRVPEAGEDLELKMGDNWRRT
                     GTVLAAVQLDDGSLMVQVVMNNDMEPDSVFRVRDDAGSLSIKPLPYSLEED"
     gene            complement(595195..595854)
                     /locus_tag="EAE_RS02905"
                     /old_locus_tag="EAE_02840"
                     /db_xref="GeneID:45318966"
     CDS             complement(595195..595854)
                     /locus_tag="EAE_RS02905"
                     /old_locus_tag="EAE_02840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003838267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin III family protein"
                     /protein_id="WP_008806429.1"
                     /db_xref="GeneID:45318966"
                     /translation="MVRKPLITQGYSLAEEVANSISHGIGLVFGIVGLVLLLVQAVDT
                     NASATAITSYSLYGGSMIMLFLASTLYHAIPHQRAKQWLKKFDHCAIYLLIAGTYTPF
                     LLVGLNSPLAKGLMIVIWSLALLGILFKLTIAHRFKILSLVTYLTMGWLSLIVVYQLA
                     VKLAVGGVTLLAVGGVVYSLGVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYVGQ
                     S"
     gene            complement(596019..596330)
                     /locus_tag="EAE_RS02910"
                     /old_locus_tag="EAE_02845"
                     /db_xref="GeneID:45318967"
     CDS             complement(596019..596330)
                     /locus_tag="EAE_RS02910"
                     /old_locus_tag="EAE_02845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ASCH domain-containing protein"
                     /protein_id="WP_015703422.1"
                     /db_xref="GeneID:45318967"
                     /translation="MQANDITFFQRFQDDILAGRKTITIRDAAESHFKAGDVLRVGRY
                     EDDGYFCTIAVTATSTVTLDTLTEQHAQQENMTLEQLRQVISEIYPAEDRFYVIEFKR
                     L"
     gene            596381..597115
                     /locus_tag="EAE_RS02915"
                     /old_locus_tag="EAE_02850"
                     /db_xref="GeneID:45318968"
     CDS             596381..597115
                     /locus_tag="EAE_RS02915"
                     /old_locus_tag="EAE_02850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="WP_015703423.1"
                     /db_xref="GeneID:45318968"
                     /translation="MFSHAAVASLNNLEMMVYHYVIKNRDKVMYMTIRELAEAAGVST
                     TTVLRFCRKLQCEGYSEFRVRFKLYLEQNEPQQANIGASEIMSFFKSVNNDEFDQLLE
                     QAVDIILSSERIIFVGAGTSGALAKYGARFFSNVGKFSNHIDDPYFPVTNDMARNALA
                     IVLSVSGETEEILRFASQFSLHHCKVMSITSHEHSRLAKLADFNLSWHVPQTRIGGVY
                     DITTQIPVIYILESLGRKLARKIGLK"
     gene            597229..598662
                     /gene="bglA"
                     /locus_tag="EAE_RS02920"
                     /old_locus_tag="EAE_02855"
                     /db_xref="GeneID:45318969"
     CDS             597229..598662
                     /gene="bglA"
                     /locus_tag="EAE_RS02920"
                     /old_locus_tag="EAE_02855"
                     /EC_number="3.2.1.86"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phospho-beta-glucosidase BglA"
                     /protein_id="WP_015369787.1"
                     /db_xref="GeneID:45318969"
                     /translation="MKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHG
                     VPREITQQVEAGKYYPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPQGDET
                     QPNEEGLKFYDDMFDELLKYNIEPVITLSHFEMPLHLVQQYGGWTNRKVVDFFVRFAE
                     VVFERYKHKVKYWMTFNEINNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFV
                     ASALAVKAAQRINPEMQVGCMLAMVALYPYSCKPEDVMFAQESMRERYVFTDVQLRGY
                     YPSYVLNEWERRGFNIKMEDGDAQILREGTCAYLGFSYYMTNAVKAEGGTGDAISGFE
                     GSVPNPHVKASDWGWQIDPVGLRYALCELYERYQKPLFIVENGFGAYDKVEADGSIND
                     DYRIDYLRAHVEEMIKAVTYDGVDLMGYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDD
                     GTGDMSRSRKKSFNWYKEVIASNGENL"
     gene            598787..599146
                     /locus_tag="EAE_RS02925"
                     /old_locus_tag="EAE_02860"
                     /db_xref="GeneID:45318970"
     CDS             598787..599146
                     /locus_tag="EAE_RS02925"
                     /old_locus_tag="EAE_02860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper resistance protein"
                     /protein_id="WP_015369786.1"
                     /db_xref="GeneID:45318970"
                     /translation="MIKRQRKAILLVLLACLVVLICTAQRMAGMHALVMNVTAASQSA
                     QPGPDNAEAPVSPCELSAKSLMAVPPMLFEGALLAIALLLAVLAAIPPRIERIWPPRV
                     ISPPRLRVHLRLCVFRE"
     gene            599196..601205
                     /locus_tag="EAE_RS02930"
                     /old_locus_tag="EAE_02865"
                     /db_xref="GeneID:45318971"
     CDS             599196..601205
                     /locus_tag="EAE_RS02930"
                     /old_locus_tag="EAE_02865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide reductase"
                     /protein_id="WP_015703424.1"
                     /db_xref="GeneID:45318971"
                     /translation="MFMVFRRLLVCLLWLWLPVSQAADSGWLRAADNQHASVRLRAQS
                     ESNGDTRLLLDVALEKGWKTYWRSPGEGGIAPAIAWHTPLEVNWRWPTPQRFDVAGIS
                     TQGYHGDVSFPMTLRGKIPPTLSGVLTLSTCSNVCILTDYPFSLDMTAPAGERFNYDF
                     TRAMGTLPLRDGLTSALSASYVSGKLTVTARRDAGWQQPALFIDSMEDVDFGKPSFTS
                     RGDTLTATVPVTDSWGEAAPDLSGKTLSLVLADSGQAQESHIAIAAGSAAPGLALGWV
                     LLMALAGGLILNVMPCVLPVLAMKLGSLVQTERRERGAVRRQFLASVCGIVVSFLALA
                     LMMTALRLGNQALGWGIQFQNPWFIGAMALVMVLFSASLLGLFEIRLSSSASTFLATR
                     GGNGLMGHFWQGAFATLLATPCTAPFLGTAVSVALVAPLPLLWGIFFAMGIGMSLPWL
                     LIVAWPGLAQRLPRPGRWMNHLRVVLGLMMLGSALWLVSLLKIHIGRTPVLTLLVILA
                     IVLLLATAWRYRWRTALRAGALAIVVAGVVAFVAQQDGQGPRRDRVNWQPLSEQAIAN
                     ALAEHKRVFIDVTADWCVTCKTNKYNVLLRDDVQQALSAPDVIALRGDWSRPSADISQ
                     FLTARGSAAVPFNQIYGPGLPQGQILPALLDREQLLATLSAAKGK"
     gene            601207..601818
                     /locus_tag="EAE_RS02935"
                     /old_locus_tag="EAE_02870"
                     /db_xref="GeneID:45318972"
     CDS             601207..601818
                     /locus_tag="EAE_RS02935"
                     /old_locus_tag="EAE_02870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin domain-containing protein"
                     /protein_id="WP_015703425.1"
                     /db_xref="GeneID:45318972"
                     /translation="MRAITALLLLCVSAFSFAAPAEEPQSNGNDQLAQLLFNDPNSPR
                     TGAKEPKLTIVSFTDYNCPYCKQFDPMLEKIVHDNPDIQLIVKLLPFKGQSSVNAAKA
                     ALSTWRQQPDKFWALHQRLMAKKGYHDDASIAAAQKKTATDSVNIDDKTMDSLKMNLI
                     LSQVLNIQGTPATIIGDQMVAGAIPAEELEGLVKEQLAKARGQ"
     gene            601808..602311
                     /locus_tag="EAE_RS02940"
                     /old_locus_tag="EAE_02875"
                     /db_xref="GeneID:45318973"
     CDS             601808..602311
                     /locus_tag="EAE_RS02940"
                     /old_locus_tag="EAE_02875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide oxidoreductase"
                     /protein_id="WP_015703426.1"
                     /db_xref="GeneID:45318973"
                     /translation="MASKIRRWLRELAVWLLIGAAVSLAVDYFRQPALPQNFSATSLQ
                     TLDGRTLDLNAMSQQKPLLLYVWATWCGVCRYTTPSVASLAADGGNVLTVALRSGNNA
                     ALEKWLTRKKMTLPTVNDPSGQLARQWDIQVTPTLVVISQGEVKSVTTGWTSSWGMRL
                     RLWLASW"
     gene            complement(602507..603250)
                     /locus_tag="EAE_RS02945"
                     /old_locus_tag="EAE_02880"
                     /db_xref="GeneID:45318974"
     CDS             complement(602507..603250)
                     /locus_tag="EAE_RS02945"
                     /old_locus_tag="EAE_02880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_015703427.1"
                     /db_xref="GeneID:45318974"
                     /translation="MAIALISGASRGIGRATALLLAQEGYTVAVNYHHNIKAATEVVN
                     TIVESGGKATALRADISDEAQVMAMFEAVDRMGEPLMALVNNAGILFTQCTVESLSAE
                     RINRVLATNVTGYFLCCREAVKRMSHRHGGKGGAIVNVSSAASRLGAPGEYVDYAASK
                     GAVDTLTTGLALEVAAQGIRVNGVRPGLIYTEMHASGGEPGRVDRVKNSLPMQRGGQP
                     EEVAQAIAWLLSDKASYVTGSFLELAGGK"
     gene            complement(603312..606185)
                     /gene="gcvP"
                     /locus_tag="EAE_RS02950"
                     /old_locus_tag="EAE_02885"
                     /db_xref="GeneID:45318975"
     CDS             complement(603312..606185)
                     /gene="gcvP"
                     /locus_tag="EAE_RS02950"
                     /old_locus_tag="EAE_02885"
                     /EC_number="1.4.4.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017457610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminomethyl-transferring glycine dehydrogenase"
                     /protein_id="WP_015369781.1"
                     /db_xref="GeneID:45318975"
                     /translation="MTQTLSQLENRDAFIERHIGSDAQQQQEMLKTVGADSLNALIGQ
                     IVPQDIQLATPPQVGDATTEFAALAELKAIAGRNKRFKSYIGMGYTAVQLPPVIQRNM
                     LENPGWYTAYTPYQPEVSQGRLESLLNFQQVTLDLTGLDIASASLLDEATAAAEAMAM
                     AKRVSKLKNANRFFVAADVHPQTLDVVRTRAETFGFDVIVDDADKVLDHQDVFGVLLQ
                     QVGTTGEIHDYSKLIAELKARKVIVSVAADFMALVLLTAPGKQGADIVFGSAQRFGVP
                     MGYGGPHAAFFAAKDEFKRSMPGRIIGVSKDAAGNTALRMAMQTREQHIRREKANSNI
                     CTSQVLLANIASLYAVFHGPAGLKRIAGRIHRLTDILADGLQKKGLKLRHAHYFDTLC
                     VEVADKAAVLARAEALQINLRSDIHGAVGITLDEATTREDVLNLFRAIVGDDHGLDID
                     TLDKDVALDSRSIPAAMLRDDAILTHPVFNRYHSETEMMRYMHALERKDLALNQAMIP
                     LGSCTMKLNAAAEMIPITWPEFAELHPFCPVEQAEGYHQMIAQLSDWLVKLTGYDAVC
                     MQPNSGAQGEYAGLLAIRHYHESRNEGHRDICLIPSSAHGTNPASAQMAGMQVVVVAC
                     DKNGNIDLADLREKAEQAGANLSCIMVTYPSTHGVYEETIREVCEIVHQFGGQVYLDG
                     ANMNAQVGITSPGFIGADVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFVPGHSVV
                     QIEGMLTRQGAVSAAPFGSASILPISWMYIRMMGAEGLKQASQNAILNANYIATRLKD
                     AYPVLYTGRDGRVAHECILDIRPLKEETGISELDIAKRLIDFGFHAPTMSFPVAGTLM
                     VEPTESESKVELDRFIDAMLAIRAEIDRVKAGEWPLEDNPLVNAPHTQGELVSEWNHP
                     YSRELAVFPAGLHNKYWPTVKRLDDVYGDRNLFCSCVPMSEYQ"
     gene            complement(606316..606705)
                     /gene="gcvH"
                     /locus_tag="EAE_RS02955"
                     /old_locus_tag="EAE_02890"
                     /db_xref="GeneID:45318976"
     CDS             complement(606316..606705)
                     /gene="gcvH"
                     /locus_tag="EAE_RS02955"
                     /old_locus_tag="EAE_02890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein GcvH"
                     /protein_id="WP_015703428.1"
                     /db_xref="GeneID:45318976"
                     /translation="MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVD
                     LPEVGATVEAGADCAVAESVKAASDIYAPISGEIVAVNEELNDSPELVNSDPYADGWI
                     FKIKASDEAQVAALLDATAYEALLEDE"
     gene            complement(606730..607824)
                     /gene="gcvT"
                     /locus_tag="EAE_RS02960"
                     /old_locus_tag="EAE_02895"
                     /db_xref="GeneID:45318977"
     CDS             complement(606730..607824)
                     /gene="gcvT"
                     /locus_tag="EAE_RS02960"
                     /old_locus_tag="EAE_02895"
                     /EC_number="2.1.2.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system aminomethyltransferase
                     GcvT"
                     /protein_id="WP_002916480.1"
                     /db_xref="GeneID:45318977"
                     /translation="MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRGDA
                     GMFDVSHMTIVDFHGSRIREFLRYLLANDVAKLTTPGKALYTGMLTASAGVIDDLIVY
                     FLSEDYFRLVVNSATREKDLAWISEQAEPYGLEITVRDDLSLIAVQGPQAKAKAATLF
                     TDAQRQAVEGMKPFFGVQAGDLFIATTGYTGEAGYEIAMPNEQAADFWRGLLDAGVKP
                     CGLGARDTLRLEAGMNLYGQEMDEGVSPLAANMGWTIAWEPADRNFIGREALEMQREK
                     GTEQLVGLVMTEKGVLRGGLPVRFTDSDGNQKEGIITSGTFSPTLGYSIALARVPAGI
                     GDTAVVQIRNREMPVKVTKPGFVRNGKAIV"
     gene            complement(608247..609449)
                     /gene="ubiI"
                     /locus_tag="EAE_RS02965"
                     /old_locus_tag="EAE_02900"
                     /gene_synonym="visC"
                     /db_xref="GeneID:45318978"
     CDS             complement(608247..609449)
                     /gene="ubiI"
                     /locus_tag="EAE_RS02965"
                     /old_locus_tag="EAE_02900"
                     /gene_synonym="visC"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent 2-octaprenylphenol hydroxylase"
                     /protein_id="WP_015703429.1"
                     /db_xref="GeneID:45318978"
                     /translation="MQSVDVAIVGGGMVGLAVACGLQGSGLRVAVLEQAAPQPLDADA
                     PPALRVSAINAASEKLLDKLGVWSEIIAQRASCYHGMEVWDKDSFGRISFDDQSMGFS
                     HLGHIIENAVVHHALWQKAQRCADVTLLAPAQLQQVAWGENEAFLSLQDGSMLTARLV
                     VGADGANSWLRNKADIPLTFWDYRHHALVATIRTTEPHQAVARQAFHGEGILAFLPLS
                     DPHLCSIVWSLSPEEAQRMQQADAAAFNQALNIAFDNRLGLCQLESDRQVFPLTGRYA
                     RQFAAHRLALVGDAAHTIHPLAGQGVNLGFMDAAELIDELKRLHAQGKDIGQHLYLRR
                     YERSRKHSAALMLAGMQGFREMFSGSHPAKKFLRDMGLKLADSLPGVKPQLIRQAMGL
                     NDLPAWLR"
     gene            complement(609460..610638)
                     /gene="ubiH"
                     /locus_tag="EAE_RS02970"
                     /old_locus_tag="EAE_02905"
                     /gene_synonym="visB"
                     /db_xref="GeneID:45318979"
     CDS             complement(609460..610638)
                     /gene="ubiH"
                     /locus_tag="EAE_RS02970"
                     /old_locus_tag="EAE_02905"
                     /gene_synonym="visB"
                     /EC_number="1.14.13.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
                     /protein_id="WP_015703430.1"
                     /db_xref="GeneID:45318979"
                     /translation="MSVLIVGGGMTGATLALAISRLTGGALPVHLIEAQDPASSRHPG
                     FDDRAIALAAGTCQQLARIGIWQNLAKRATPIQRVHVSDRGHAGFVNLAAADYGLSAL
                     GQVVELHDVGQRLFSLLREAPGVTLHCPAKVEAVNRSQDSVSLTLDSGETINGKLLVA
                     ADGSRSSLGARCGISWQQQPYEQLAIIANVSTALPHEGRAFERFTEHGPLAMLPMSQG
                     RCSLVWCHPQSRRDEVLSWSDERFCQQLQQAFGWRLGRITHAGKRSVYPLALTTAIRS
                     VSHRLALVGNAAQTLHPIAGQGFNLGLRDVMSLAEMLADAHALGEDVGNYSLLCRYQA
                     RRADDKAATIGVTDGLVHLFANRWAPLVAGRNVGLMAMELFTPARDALAQRTLGWVPR
                     "
     gene            complement(610635..611951)
                     /gene="pepP"
                     /locus_tag="EAE_RS02975"
                     /old_locus_tag="EAE_02910"
                     /db_xref="GeneID:45318980"
     CDS             complement(610635..611951)
                     /gene="pepP"
                     /locus_tag="EAE_RS02975"
                     /old_locus_tag="EAE_02910"
                     /EC_number="3.4.11.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="WP_015703431.1"
                     /db_xref="GeneID:45318980"
                     /translation="MTQQEFLSRRQALLAQMQPGSAALIFAAPEAVRSADSEYPYRQN
                     SDFWYFTGFNEPEALLVLIKSDETHNHSVLFNRVRDLTAEIWFGRRLGQDAAPGKLGV
                     DRALAFSEINQQLYQLLNGLDAIYFAQGEYAYADEIVFNALEKLRKGSRQNLQAPNSV
                     IDWRPVVHEMRLFKSAEELEVMRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFN
                     RHGARFPSYNTIVGGGENACILHYTENESELRDGDLVLIDAGCEYRGYAGDITRTFPV
                     NGKFSKPQREIYDIVLESLETALELYRPGTSIYEVNQEVVRIMINGLVRLGILKGEID
                     ELIANNAHRPYFMHGLSHWLGLDVHDVGNYDTDRSRVLEPGMVLTVEPGLYIATDADV
                     PAQYRGIGIRIEDDIVITEDGNENLTASVVKKADEIEALMAAARQS"
     gene            complement(611977..612555)
                     /locus_tag="EAE_RS02980"
                     /old_locus_tag="EAE_02915"
                     /db_xref="GeneID:45318981"
     CDS             complement(611977..612555)
                     /locus_tag="EAE_RS02980"
                     /old_locus_tag="EAE_02915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_708672.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YecA family protein"
                     /protein_id="WP_015703432.1"
                     /db_xref="GeneID:45318981"
                     /translation="MSIQNEMPGYNDVDQLLNQQGVGLTPAEMHGLISGILCGGNTDS
                     SWQPLVHDLTNEGLAFGHELAQALRSMHSATSDSLEDDGFLFQLYMPEGDNVSVFDRA
                     DALAGWVNHFLLGLGVTQPKLDKVKDETGEAIDDLRNIAQLGYDEDEDQEELEMSLEE
                     IIEYVRVAALLCHDTFARQQPTAPEVRKPTLH"
     gene            612722..613051
                     /gene="zapA"
                     /locus_tag="EAE_RS02985"
                     /old_locus_tag="EAE_02920"
                     /db_xref="GeneID:45318982"
     CDS             612722..613051
                     /gene="zapA"
                     /locus_tag="EAE_RS02985"
                     /old_locus_tag="EAE_02920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapA"
                     /protein_id="WP_004205298.1"
                     /db_xref="GeneID:45318982"
                     /translation="MSAQPVDLQIFGRSLRVNCPPEQRDALNQAAEDLNQRLQDLKER
                     TRVTNTEQLVFIAALNISYELTQEKAKTRDYASSMEQRIRMLQQTIEQALLEQGRISE
                     RPGSKFE"
     gene            613093..613276
                     /gene="ssrS"
                     /locus_tag="EAE_RS02990"
                     /db_xref="GeneID:45318983"
     ncRNA           613093..613276
                     /ncRNA_class="other"
                     /gene="ssrS"
                     /locus_tag="EAE_RS02990"
                     /product="6S RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00013"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00013"
                     /db_xref="GeneID:45318983"
     gene            613376..613972
                     /locus_tag="EAE_RS02995"
                     /old_locus_tag="EAE_02925"
                     /db_xref="GeneID:45318984"
     CDS             613376..613972
                     /locus_tag="EAE_RS02995"
                     /old_locus_tag="EAE_02925"
                     /EC_number="6.3.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_015703433.1"
                     /db_xref="GeneID:45318984"
                     /translation="MTIQPDIPLSRQQIRQQIRERRRALSAEQQQRFALQAAERMMAY
                     PPVVLAHTVALFLSFDGELDTQPLIEQLWRAGKRVYLPVLHPFSPGNLLFLHYHPQSQ
                     LIFNRLKIYEPRLDVRDVLPLAELDVLITPLVAFDASGQRLGMGGGFYDRTLQNWRQY
                     RLQPVGYAHDCQQVGTLPSEQWDIPLPAVITPGKTWRW"
     gene            complement(614060..615292)
                     /gene="serA"
                     /locus_tag="EAE_RS03000"
                     /old_locus_tag="EAE_02930"
                     /db_xref="GeneID:45318985"
     CDS             complement(614060..615292)
                     /gene="serA"
                     /locus_tag="EAE_RS03000"
                     /old_locus_tag="EAE_02930"
                     /EC_number="1.1.1.95"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate dehydrogenase"
                     /protein_id="WP_015703434.1"
                     /db_xref="GeneID:45318985"
                     /translation="MAKVSLEKDKIKFLLVEGVHQKAIDNLRAAGYTNIEFHKGALDT
                     EELKASIRDAHFIGLRSRTHLTEEIFAAAEKLVAVGCFCIGTNQVDLEAAAKRGIPVF
                     NAPFSNTRSVAELVIGELLLMLRGVPEANAKAHRGVWNKQAVGSFEARGKKLGIIGYG
                     HIGTQLGILAESLGMHVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENASTK
                     NMMGPEELALMKPGALLINASRGTVVDIPALCDALSRKHLAGAAIDVFPTEPATNSDP
                     FNSPLCEFDNVILTPHIGGSTQEAQENIGLEVAGKLAKYSDNGSTLSAVNFPEVSLPL
                     HGGRRLLHIHENRPGILTALNQIFAAQNINIAAQYLQTTPQMGYVVIDIEADGDVAQQ
                     ALLAMKAIPGTIRARLLY"
     gene            complement(615561..616223)
                     /gene="rpiA"
                     /locus_tag="EAE_RS03005"
                     /old_locus_tag="EAE_02935"
                     /db_xref="GeneID:45318986"
     CDS             complement(615561..616223)
                     /gene="rpiA"
                     /locus_tag="EAE_RS03005"
                     /old_locus_tag="EAE_02935"
                     /EC_number="5.3.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-5-phosphate isomerase RpiA"
                     /protein_id="WP_015369772.1"
                     /db_xref="GeneID:45318986"
                     /translation="MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKG
                     QIEGAVSSSDASTEKLKSLGIPVFDLNSVDRLGIYVDGADEINGHMQMIKGGGAALTR
                     EKIIASVADKFICIADASKQVDILGNFPLPVEVIPMARSAVARQLVKLGGRPEYRQGV
                     VTDNGNVILDVHGLEILDAIALENAINGIPGVVTVGLFANRGADVALIGTADGVKTIV
                     NK"
     gene            616391..617284
                     /gene="argP"
                     /locus_tag="EAE_RS03010"
                     /old_locus_tag="EAE_02940"
                     /db_xref="GeneID:45318987"
     CDS             616391..617284
                     /gene="argP"
                     /locus_tag="EAE_RS03010"
                     /old_locus_tag="EAE_02940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator ArgP"
                     /protein_id="WP_008806448.1"
                     /db_xref="GeneID:45318987"
                     /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLEN
                     MFGQPLLVRTVPPRPTEQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSL
                     ATWLLPALANVLSDSPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQALPSCLVDQLG
                     ALDYLFVASKEFAQRYFPNGVTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPC
                     HIVNSSEAFVQLARQGTTCCMIPHLQIEKELKSGELIDLTPGLFQRRMLYWHRFAPES
                     RMMRRVTDALIDYGHKVLRQD"
     gene            complement(617339..618106)
                     /locus_tag="EAE_RS03015"
                     /old_locus_tag="EAE_02945"
                     /db_xref="GeneID:45318988"
     CDS             complement(617339..618106)
                     /locus_tag="EAE_RS03015"
                     /old_locus_tag="EAE_02945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidative stress defense protein"
                     /protein_id="WP_015369771.1"
                     /db_xref="GeneID:45318988"
                     /translation="MKLKVLALAAALGFSTMAAQASELPDGPHIVTSGTASVAAVPDI
                     ATLAIEVNVAAKDAASAKKQADDRVAQYLSFLEKSGIAKKDISSANLRTQPDYDYQNG
                     KSILKGYRAVRTVEVTLRQLDKLNGLLDGALKAGLNEIRSVSLGVAQPDAYKDKARKA
                     AIDDAVHQAQELAAGFHSKLGPVYSVRYHVSNYQPSPMVRMMKAADAAPVSAQETYEQ
                     ATIQFDDQVDVVFELQPAQAAAPAAPAKPAEAPKPAQ"
     gene            complement(618192..618833)
                     /gene="argO"
                     /locus_tag="EAE_RS03020"
                     /old_locus_tag="EAE_02950"
                     /db_xref="GeneID:45318989"
     CDS             complement(618192..618833)
                     /gene="argO"
                     /locus_tag="EAE_RS03020"
                     /old_locus_tag="EAE_02950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine exporter ArgO"
                     /protein_id="WP_015703435.1"
                     /db_xref="GeneID:45318989"
                     /translation="MLSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCA
                     LSDLALICAGIFGGSALLMQSPWLLALVTWGGVAFLLWYGFGALKTAMSNNLELASAE
                     VMKQGRWKIIVTMLAVTWLNPHVYLDTFVVLGSLGGQLAVEPKRWFALGTISASFLWF
                     FGLALLAAWLAPRLRTARAQRIINVLVGLVMWFIALQLAKDGLQHIQMLINQA"
     gene            complement(618989..619846)
                     /locus_tag="EAE_RS03025"
                     /old_locus_tag="EAE_02955"
                     /db_xref="GeneID:45318990"
     CDS             complement(618989..619846)
                     /locus_tag="EAE_RS03025"
                     /old_locus_tag="EAE_02955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="small-conductance mechanosensitive channel MscS"
                     /protein_id="WP_015369769.1"
                     /db_xref="GeneID:45318990"
                     /translation="MEDLNVVDSINHAGTWLARNQELLLSYAVNIVAAIVILIIGMIV
                     ARIVSNTVNRLMLARKIDATVADFLSALVRYAIIAFTLIAALGRVGVQTASVIAVLGA
                     AGLAVGLALQGSLSNLAAGVLLVMFRPFRAGEYVDLGGIAGTVQNVQIFSTTLRTVDG
                     KIVVVPNGKIIAGNIINFSREPARRNEFIIGVSYDADIDKVKQLLTAIIESDDRILRD
                     REMTVRLNELGASSVNFVVRVWSKSSDLQNVYWDVLERIKRDFDANGISFPYPQMDVH
                     MVNQQEKAQ"
     gene            complement(620037..621116)
                     /gene="fbaA"
                     /locus_tag="EAE_RS03030"
                     /old_locus_tag="EAE_02960"
                     /db_xref="GeneID:45318991"
     CDS             complement(620037..621116)
                     /gene="fbaA"
                     /locus_tag="EAE_RS03030"
                     /old_locus_tag="EAE_02960"
                     /EC_number="4.1.2.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016505616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class II fructose-bisphosphate aldolase"
                     /protein_id="WP_004144748.1"
                     /db_xref="GeneID:45318991"
                     /translation="MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSIN
                     AVLEAAAKVRSPVIVQFSNGGAAFIAGKGVKTDVPQGAAILGAISGAHHVHQMAEHYG
                     VPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLHENIEICSK
                     YLARMAKMGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFT
                     IAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSSAQEIK
                     DSVSYGVVKMNIDTDTQWATWDGILQYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVW
                     LRAAQTSMVTRLEQAFKELNAIDVL"
     gene            complement(621227..622390)
                     /gene="pgk"
                     /locus_tag="EAE_RS03035"
                     /old_locus_tag="EAE_02965"
                     /db_xref="GeneID:45318992"
     CDS             complement(621227..622390)
                     /gene="pgk"
                     /locus_tag="EAE_RS03035"
                     /old_locus_tag="EAE_02965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_015369762.1"
                     /db_xref="GeneID:45318992"
                     /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTI
                     ELALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDGVDVA
                     AGELVVLENVRFNKGEKKDDEELSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADV
                     ACAGPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIA
                     NTFVAAQGHNVGKSLYEADLVDEAKRLLSTCDIPVPTDVRVATEFSETATATLKSVND
                     IKDDEQILDLGDVSAQKLAEILKNAKTILWNGPVGVFEFPNFRKGTEIVANAIADSEG
                     FSIAGGGDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLEERAKQ"
     gene            complement(622442..623461)
                     /gene="epd"
                     /locus_tag="EAE_RS03040"
                     /old_locus_tag="EAE_02970"
                     /db_xref="GeneID:45318993"
     CDS             complement(622442..623461)
                     /gene="epd"
                     /locus_tag="EAE_RS03040"
                     /old_locus_tag="EAE_02970"
                     /EC_number="1.2.1.72"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="erythrose-4-phosphate dehydrogenase"
                     /protein_id="WP_015369761.1"
                     /db_xref="GeneID:45318993"
                     /translation="MTIRIAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGI
                     AHLLKYDTSHGRFSWDVRQEREQLYVGDDVIRLLHEPSIAALPWQELAVDVVLDCTGV
                     YGSREHGEAHLQAGAKKVLFSHPGGNDLDATVVFGVNHDELRAEHRIVSNASCTTNCI
                     IPVIKLLDDAYGIESGTVTTIHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAG
                     ITRIFPQFNDRFEAIAVRVPTINVTAIDLSVTVKKPVKACEVNQLLQKAAQGAFHGIV
                     DYTELPLVSTDFNHDPHSAIVDGTQTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMA
                     AQGFR"
     gene            complement(623846..625837)
                     /gene="tkt"
                     /locus_tag="EAE_RS03045"
                     /old_locus_tag="EAE_02975"
                     /db_xref="GeneID:45318994"
     CDS             complement(623846..625837)
                     /gene="tkt"
                     /locus_tag="EAE_RS03045"
                     /old_locus_tag="EAE_02975"
                     /EC_number="2.2.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_015703436.1"
                     /db_xref="GeneID:45318994"
                     /translation="MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDF
                     LNHNPQNPSWADRDRFVLSNGHGSMLIYSLLHLTGYDLPIEELKNFRQLHSKTPGHPE
                     VGYTAGVETTTGPLGQGIANAVGMAIAEKTLAAQFNRPGHDIVDHFTYAFMGDGCMME
                     GISHEVCSLAGTLKLGKLVAFYDDNGISIDGHVEGWFTDDTAKRFEAYGWHVVRGVDG
                     HDADAIKRAVEEARAVTDKPSLLMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREA
                     LGWKYGPFEIPSDIYAQWDAKEAGQAKEAAWNEKFAAYAKAFPQEAAEFTRRMKGEMP
                     SDFDAKANEFIAKLQANPAKIASRKASQNAIEAFGPLLPEFLGGSADLAPSNLTLWSG
                     SKPINEDTAGNYIHYGVREFGMTAIANGISLHGGFLPYTSTFLMFVEYARNAVRMAAL
                     MKQRQVMVYTHDSIGLGEDGPTHQPVEQVASLRVTPNMSTWRPCDQVESAIAWKYGVE
                     RQDGPTALILSRQNLAQQERTEEQLANVARGGYVLKDCAGQPELIFIATGSEVELAVA
                     AWDKLTAEGVKARVVSMPSTDAFDKQDAAYRESVLPKAVSARVAVEAGIADYWFKYVG
                     LNGAIVGMTTFGESAPAEQLFEEFGFTVDNVVAKAKALL"
     gene            626117..626875
                     /locus_tag="EAE_RS03050"
                     /old_locus_tag="EAE_02980"
                     /db_xref="GeneID:45318995"
     CDS             626117..626875
                     /locus_tag="EAE_RS03050"
                     /old_locus_tag="EAE_02980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M48 family metallopeptidase"
                     /protein_id="WP_015703437.1"
                     /db_xref="GeneID:45318995"
                     /translation="MKIRSTLLAFGIAATLTGCQNMDSNALLSSGAEAFQAYSLSDEQ
                     VKTLSDQACKEMDAKATISPASSEYSKRLSKIAAALGDNINGQPVNYKVYETKDVNAF
                     AMANGCIRVYSGLMDLMNDNEVEAVIGHEMGHVALGHVKKGMQVALGTNAVRAAAASA
                     GGIVGSLSQSQLGDLGEKLVNSQFSQRQESEADDYSYDLLRKRGINPSGLATSFEKLA
                     KLEAGRQSSMFDDHPASEARAQHIRDRMKADGIK"
     gene            627253..628521
                     /locus_tag="EAE_RS03055"
                     /old_locus_tag="EAE_02985"
                     /db_xref="GeneID:45318996"
     CDS             627253..628521
                     /locus_tag="EAE_RS03055"
                     /old_locus_tag="EAE_02985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OprD family porin"
                     /protein_id="WP_015703438.1"
                     /db_xref="GeneID:45318996"
                     /translation="MKKELPLLALGIIAAAPAFASQQSTSQGFIEDSHLDLFLRNAYI
                     KRDYRDGLPDKAEWGQGIIATFESGFTQGPVGFGVDGIAQYAVRLDGGRGRSGAGGID
                     FFAQDDDGRAKSDLAKFGATAKMRFSNTVLSYGSQRPMLPIVYADDSRLLYESYTGTM
                     LTSREIDGLEINAGYLTDQQRKSDDSHNSGLKSLTFGGASYQFNDQLSGALYASHVED
                     VLNKQYLGLNYKQPFAADQQLIVDFNGYNSRLDQEYADANDTGRSNSIWSLAASYIWD
                     IHTFKVAYQQSSGSTGYHYGGYQNQGGVGDGGNTIWLANSYWSDFNGEDERSWQASYG
                     LDFAGLGVPGLSWTTAYVRGDNIKTAETSNGKEHEWFNQVQYQVQNGMAKDLKLRLRY
                     SVLRVSSNASDYNVSGNEVRFYVEYPFNVF"
     gene            complement(628658..630298)
                     /locus_tag="EAE_RS03060"
                     /old_locus_tag="EAE_02990"
                     /db_xref="GeneID:45318997"
     CDS             complement(628658..630298)
                     /locus_tag="EAE_RS03060"
                     /old_locus_tag="EAE_02990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate-binding protein"
                     /protein_id="WP_015703439.1"
                     /db_xref="GeneID:45318997"
                     /translation="MSEMITVGDAIARTLEQYHVEAIYGVISIHNLPIADAVGQREKI
                     RFVPARGEAGSVTMADAHGRFSGLGVALTSTGAGAGNAVGALVEAMNAGTPLLHLTGQ
                     VEKAWLDADTGFIHETRDQLTFLKASSKRAYRISNANQAVAILHKAIQEAQTPPCGPV
                     SVEIPIDIQSAKIPLSLLTAPLKRAPAVEPEASLVDALWAQLKQAKQPLLWLGGGALE
                     SGEAVKTLADAGVTVISSTHGRGILADSHRASLRAFHNSPSVEALISQCDFTLVAGSR
                     LRSNETRSWTLELPTPRVQIDIDPAAASRNYLMDNTVVADCRALLAALAARVQGRMWG
                     DARWDSQLKAAVEAAEQGLRDQCGAYAKLNDAIAQALPDDGILVRDITVSGSLWGSRL
                     FRAHGPLMNIHSLAGAIGMGLPMAVGTAIANPQRKVVGLVGDGGLSLNLGELATLAQE
                     KANVTLLIMNDGGYGVMRGIQDKYFGGRQYYNELHTPDFTLLAQAIGLQAWSVERAED
                     FQAVMTEALAMPGPSVVEVKMGQIGALRFAGPPQKTLY"
     gene            complement(630312..631781)
                     /locus_tag="EAE_RS03065"
                     /old_locus_tag="EAE_02995"
                     /db_xref="GeneID:45318998"
     CDS             complement(630312..631781)
                     /locus_tag="EAE_RS03065"
                     /old_locus_tag="EAE_02995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_015703440.1"
                     /db_xref="GeneID:45318998"
                     /translation="MDELDIFIGGQWRRGGGNLMHSQFPADGAINAALYAASLDDLQE
                     AIDCADRAWREPTWRAMLPHQRAKILHKVADLIEAQLDALTQKQSRDNGKPLAEARGL
                     VMSAAGTARYFAAACELLEGELPTPRQTDLLTLSRYEPLGVVAAITPWNSPIASEMQK
                     VAPAIAAGNAVILKPAEATPLMALELAKIFEQAGLPAGLLSVLPGKGSIIGDALARHP
                     KVRKISFTGGTTTGRHLAHVAAEKLIPASLELGGKSPTIVLEDADIEQAARGICYGIF
                     SSGGQACIAGSRLFVHDKVYPQLMARLLELTQGLRVGHPFSAGTHVGPLINDKHRQSV
                     LEYVELAKREGGSVLCGGEIPADPALAAGSYFLPTIIEGLNNQARVCQEEIFGPVLVA
                     MRFHDEAALIREANDSVFGLAAGIWTRDTGRALRLSEQLEAGTVWINTYKVFSISTPF
                     GGFKESGLGREKGIQGLKAWMQQKSIYLATGNSVNHWCD"
     gene            complement(631797..632561)
                     /locus_tag="EAE_RS03070"
                     /old_locus_tag="EAE_03000"
                     /db_xref="GeneID:45318999"
     CDS             complement(631797..632561)
                     /locus_tag="EAE_RS03070"
                     /old_locus_tag="EAE_03000"
                     /EC_number="1.4.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate dehydrogenase"
                     /protein_id="WP_015703441.1"
                     /db_xref="GeneID:45318999"
                     /translation="MKKVMLIGYGAMAQAVIERLPPQVTLGWIVARESHHAAIRQQFG
                     HTVTPLTDPLQCEETPDLVLECASQQAVAQYGEAVLARGWHLAVISTGALADSELEQR
                     LRQAGGKLTLLAGAVAGIDGLAAAKEGGLERVTYQSRKSPASWRGSYAEQLIDLSAVN
                     EAQIFFEGSAREAARLFPANANVAATIALGGIGLDATRVQLMVDPATQRNTHTLHAEG
                     LFGEFHLELSGLPLASNPKTSTLAALSAVRACRELA"
     gene            complement(632571..633365)
                     /locus_tag="EAE_RS03075"
                     /old_locus_tag="EAE_03005"
                     /db_xref="GeneID:45319000"
     CDS             complement(632571..633365)
                     /locus_tag="EAE_RS03075"
                     /old_locus_tag="EAE_03005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_015703442.1"
                     /db_xref="GeneID:45319000"
                     /translation="MNAQIEGRVAVVTGGSSGIGFETLRLLLGEGAKVAFCGRNPDRL
                     ASAHAALQNEYPEGEVFSWRCDVLNEAEVQAFADAVAARFGGADMLINNAGQGYVAHF
                     ADTPREAWLHEAELKLFGVINPVKAFQPQLEQSDIASITCVNSLLALQPEEHMIATSA
                     ARAALLNMTLTLSKELVEKGIRVNSILLGMVESGQWQRRFENRSDKSQSWPQWTADIA
                     RKRGIPMARLGKPQEPAQALLFLASPLASFTTGAALDVSGGFCRHL"
     gene            complement(633349..634119)
                     /locus_tag="EAE_RS03080"
                     /old_locus_tag="EAE_03010"
                     /db_xref="GeneID:45319001"
     CDS             complement(633349..634119)
                     /locus_tag="EAE_RS03080"
                     /old_locus_tag="EAE_03010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_015703443.1"
                     /db_xref="GeneID:45319001"
                     /translation="MTGFREQGSGIPLTLLHGISSGAASWHKQMTLPGYRVLAWDMPG
                     YGESPMLAATPAVAGDYADALARMLDRAGVEQTILVGHSLGALVAAAFAAKYPQRVLY
                     LVLADVAQGYGQAEAAQREKVWQGRQQQIALGGEAMAQGRAAKLLRPGAREADVATVA
                     AGMRRLRSEGYLAAAWMLAHDDIHRWLADYRGRLSVWCGEQDAITQPELVQGVALRYG
                     APYIAIPQAGHASYLDNETFFNQLLLRIGEEVRDECTN"
     gene            complement(634129..634659)
                     /locus_tag="EAE_RS03085"
                     /old_locus_tag="EAE_03015"
                     /db_xref="GeneID:45319002"
     CDS             complement(634129..634659)
                     /locus_tag="EAE_RS03085"
                     /old_locus_tag="EAE_03015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin domain-containing protein"
                     /protein_id="WP_004152888.1"
                     /db_xref="GeneID:45319002"
                     /translation="MTDSTVTAKQSLKPDHLTMEEWVESRIARFEGRKYDWNALKFQA
                     DFDPKYRRAQMRYIGTGATGVASDTNTVPAEHFTFSTMVLPSKCEGPLHLHDDVEEVF
                     FMLKGQITLMIQDGDNYTETVLRERDLISVPPGIYRGLFNHGEEEALMCVMLGTHKPH
                     IPTYPEDHPLAKVKRN"
     gene            complement(634670..635926)
                     /locus_tag="EAE_RS03090"
                     /old_locus_tag="EAE_03020"
                     /db_xref="GeneID:45319003"
     CDS             complement(634670..635926)
                     /locus_tag="EAE_RS03090"
                     /old_locus_tag="EAE_03020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703444.1"
                     /db_xref="GeneID:45319003"
                     /translation="MTTLETNAAPAEASGEGVRTPEKAVRWAIPLSLLACVLLAFFDK
                     ISIAALFSDSHFQQAMGIDFDTTRLGILMSAFLLSYGFSSVLLSGLGDRIAPLRLLTG
                     MMVVWCILMVIMGFTHNYALMVTLRILLGIAEGPLFPLAFAVVRHTFPQRLQARATML
                     WLLGTPVGAALGFPLSIWLLNTFGWQSTFFVMAMLTVPVLIFVRIGLRGVQLEAKVGS
                     DKTSQEARRSARRELFVSPHFWMICIFNIAFLAYLWGINGWLPGYLIKGKGIHLEHAG
                     WLSSMPFIAMLLGEIIGAWLSDRVDKRAAACFISLAGAGIGLAAVMHFSAPLPVIAAM
                     SFSTFMWGTGAPNIFALLAKATHPRVSATAGGIFNGLGNFAGALSPAVMGALIAFTHS
                     MDSGLIFLAVMAAVGCALLLPLLRRY"
     gene            complement(635953..637149)
                     /locus_tag="EAE_RS03095"
                     /old_locus_tag="EAE_03025"
                     /db_xref="GeneID:45319004"
     CDS             complement(635953..637149)
                     /locus_tag="EAE_RS03095"
                     /old_locus_tag="EAE_03025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_015703445.1"
                     /db_xref="GeneID:45319004"
                     /translation="MTARIVIIGGGQAGGWAAKTLRDEGFSGEICVVAEEQWDFYERP
                     PLSKAALLEAEPALPRLFSAEAQQALDLRWYRPLRAESIDRQNKTLALSNGETLAYDQ
                     LLIATGGRARLPSEAWAQHPQVYTLRHWQDAQRLKQRLASATRLAIVGGGWIGLEIAA
                     SARKSGVAVTLYEQQPALCMRSVSMEVSQALDELHRGQGVDIRRGCGALELEDDNGLP
                     TLHCDGQRETFDAVVVGIGVDLNLELARDAGLTVERGIVVDAQGRSSDPAIFAAGDVA
                     QHHQYGLCIQSWAFAQNQAIATAKAMLDPQASGYDEAPWLWSDQYDRNIQILGIPQAG
                     SRTIVRDEPQGALYFSLNADGRLTQLVAFNNARTVKLAKRWMAAGRDLSDVPLADPTF
                     SLMSLR"
     gene            complement(637146..638072)
                     /locus_tag="EAE_RS03100"
                     /old_locus_tag="EAE_03030"
                     /db_xref="GeneID:45319005"
     CDS             complement(637146..638072)
                     /locus_tag="EAE_RS03100"
                     /old_locus_tag="EAE_03030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_015703446.1"
                     /db_xref="GeneID:45319005"
                     /translation="MSITGIEKLEFGVDDLNHSAKFMRDFGLTGDASGRAFTTLSGAR
                     VELNPTDAADLPPAFEAGNTLRRMTWGVADRAALDALRPKLERQPAFREIDGALECRD
                     PNGMTLRVQVSQQTAVELNVEPINQWGDVRRIDTPSPVYNRAQPINVGHVVFFVEELA
                     AVESFYREVLGFQVSDRYINRAVFLRCGVRGGHHNLFLLQLPNRKRGLNHVAFTVRDI
                     HEVIGGGIAMNKNAWSTFIGPGRHPVSSAYFWYVNSPTGGAFEYYTNDDYLTENWQPR
                     ELEHSLVSFTEWAVEGGIDHDTRRQQKKPEAV"
     gene            complement(638161..638949)
                     /locus_tag="EAE_RS03105"
                     /old_locus_tag="EAE_03035"
                     /db_xref="GeneID:45319006"
     CDS             complement(638161..638949)
                     /locus_tag="EAE_RS03105"
                     /old_locus_tag="EAE_03035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_015703447.1"
                     /db_xref="GeneID:45319006"
                     /translation="MANDQEVKYLVPGLERGLQLLLAFGEQHRDLTFAELHRLVDMPK
                     ATAYRVVQTLEYMGFLERNARTNTFSLGMNVLRLGFEYIASLDVAQVGQPVIEQLRDI
                     SQCSSHLAIRDGRDIIYIARVSAAGSRINQVSVGTRLPVHCTSLGRMLLTDVSRSEFE
                     QLFPNERLPGNTPGQLYDREALWQMVQQDKARGYVIGESFYRHGISSIVYPVFDRSGR
                     VAAVVSILVPSDEIPQSDRERLQNDVSMAADKISGFLGYLSQAS"
     gene            complement(638963..639712)
                     /locus_tag="EAE_RS03110"
                     /old_locus_tag="EAE_03040"
                     /db_xref="GeneID:45319007"
     CDS             complement(638963..639712)
                     /locus_tag="EAE_RS03110"
                     /old_locus_tag="EAE_03040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SDR family oxidoreductase"
                     /protein_id="WP_015703448.1"
                     /db_xref="GeneID:45319007"
                     /translation="MNGLLNGKRIVVTGAARGLGYHFAESCAAQGATVVMCDILQGEL
                     AESAHRLQQKGYQIESHAIDLASQASIEQVFSAIGAQGPIDGLVNNAAMATGVGGKNM
                     IDYDPDLWDRVMTVNVKGTWLVTREAVPLLREGSAIVNVASDTALWGAPRLMAYVASK
                     GAVIAMTRSMARELGEKRIRINAIAPGLTRVEATEYVPAERHQLYENGRALSGAQQPE
                     DVTGSVVWLLSDLSRFITGQLIPVNGGFVFN"
     gene            complement(639712..640734)
                     /locus_tag="EAE_RS03115"
                     /old_locus_tag="EAE_03045"
                     /db_xref="GeneID:45319008"
     CDS             complement(639712..640734)
                     /locus_tag="EAE_RS03115"
                     /old_locus_tag="EAE_03045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic ring-hydroxylating dioxygenase subunit
                     alpha"
                     /protein_id="WP_015369746.1"
                     /db_xref="GeneID:45319008"
                     /translation="MTTTVQNYLDKGLRGLWYPVLASWEVQSAPVGITRLGEQIVVWR
                     NKDGQVQALEDRCPHRGARLSMGWNLGDRIACWYHGVEVAGNGEVKDVPAVDRCPLVG
                     QQCVRSYNVQEAHGAIFLWFGVTADQQPDELSFPEELANHEKYSNFLCTAAWKCNYQY
                     ALENVMDPMHGTYLHSSSHSMAEGDRKADMVLQPTKTGFIFEKKGQSGVNFDWVELGN
                     SGAYWMRLSIPYKKRFGPGGHFWIVGMVVPEDNDNCRVFFWRIRGVQGWQRDLWRFMY
                     RNRLEKLHWEVLEQDRVVLESLAPNARDHEYLYQHDVGLSRLRRMMQKAAKEQLALRE
                     AQQGAA"
     gene            complement(640745..641053)
                     /locus_tag="EAE_RS03120"
                     /old_locus_tag="EAE_03050"
                     /db_xref="GeneID:45319009"
     CDS             complement(640745..641053)
                     /locus_tag="EAE_RS03120"
                     /old_locus_tag="EAE_03050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004144765.1"
                     /db_xref="GeneID:45319009"
                     /translation="MSESLDFNPALPESRQFTPPAEGGNGNIHKPGDYHNLIWQTRSR
                     VPENWELQLIATLETLFEQGAESLGELVNGLNGVRMHDQQGEPWSESSFQAFLQVNGY
                     "
     gene            complement(641050..641373)
                     /locus_tag="EAE_RS03125"
                     /old_locus_tag="EAE_03055"
                     /db_xref="GeneID:45319010"
     CDS             complement(641050..641373)
                     /locus_tag="EAE_RS03125"
                     /old_locus_tag="EAE_03055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="non-heme iron oxygenase ferredoxin subunit"
                     /protein_id="WP_004151769.1"
                     /db_xref="GeneID:45319010"
                     /translation="MSWIGVCDAEQVQEDFPYSGNIDGKEIGIYLIDGEYYALEDVCP
                     HAYALLSQGFVEDGKVECPLHEAVFDVKTGQCLHGPGGRNLNRYPVRVYDNQIQITFI
                     EENVA"
     gene            641801..643021
                     /locus_tag="EAE_RS03130"
                     /old_locus_tag="EAE_03065"
                     /db_xref="GeneID:45319011"
     CDS             641801..643021
                     /locus_tag="EAE_RS03130"
                     /old_locus_tag="EAE_03065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_032709126.1"
                     /db_xref="GeneID:45319011"
                     /translation="MAARWQGVIALLLLIIISYVDRVNISVMILNPEFAAHFQLNENR
                     MLQGMLMTCFLLGYGFSALLLTPVIESRWHYRQGLLSSIAIWALVCAISPLLGSLLGM
                     LIARIVLGVAEGPLFSLKTRFINDNFAADEIGKPNALTALGVSLGLAVGFPLVTWLMA
                     HVGWIGSFYVLALLNLLLGGGLIWRFLPAPQVTAQRAKPGFSQTFSLAWRTPLLGWIL
                     LVEIATLSYLWGSSAWLPAWLRDEHHFSLQATGLLAAVPFLLSLGSKFLGGVLLDKMR
                     PEQAPLLFIIGGLLTAGSVLALMLSQQPAMLALFMLAANVFWGLQGAAIPAVVQHHAP
                     REAVGSAYGIINGIGNICAAFIPLLMGVVMKSVGSVSSGFSVLVASQLITLCAGGVLL
                     LRMRRAAAVNTSIP"
     gene            complement(643142..644062)
                     /gene="speB"
                     /locus_tag="EAE_RS03135"
                     /old_locus_tag="EAE_03070"
                     /db_xref="GeneID:45319012"
     CDS             complement(643142..644062)
                     /gene="speB"
                     /locus_tag="EAE_RS03135"
                     /old_locus_tag="EAE_03070"
                     /EC_number="3.5.3.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008499737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatinase"
                     /protein_id="WP_015369744.1"
                     /db_xref="GeneID:45319012"
                     /translation="MSTLGHQYDNSLVSNAFGFLRLPMNFMPYESDADWVITGVPFDM
                     ATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMS
                     EKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCE
                     FDHGTMFYTAPNEGLIDPNHSVQIGIRTEFDKDNGFTVLDAGQVNDRSVDDIIAQVKQ
                     IVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVA
                     PAYDQSEITALAAATLALEMLYIQAAKKGD"
     gene            complement(644216..644944)
                     /locus_tag="EAE_RS03140"
                     /old_locus_tag="EAE_03075"
                     /db_xref="GeneID:45319013"
     CDS             complement(644216..644944)
                     /locus_tag="EAE_RS03140"
                     /old_locus_tag="EAE_03075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703450.1"
                     /db_xref="GeneID:45319013"
                     /translation="MKSIPRYGLIIGLLFLSGCAKQPEYNTRKALSTEVATRWGSDVH
                     STVKGVSAERVDSHPDEIVLINYSGQYQTGFDQRYSIRNSDLEYAVRDANFNSLPITR
                     RYNNSTGKWQYAIAARVGTQYQLYVRNYSHSVDYEIVATVDGLDVLSGKAGSLNNNGY
                     IVPAGGSLAIKGFRKNSRIEAAFEFSNVAQSYAAHSVQGDTRNVGVIGFAAFALRGKE
                     QASLPPCASQAFPADGFAPAPCQK"
     gene            complement(645097..647073)
                     /gene="speA"
                     /locus_tag="EAE_RS03145"
                     /old_locus_tag="EAE_03080"
                     /db_xref="GeneID:45319014"
     CDS             complement(645097..647073)
                     /gene="speA"
                     /locus_tag="EAE_RS03145"
                     /old_locus_tag="EAE_03080"
                     /EC_number="4.1.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_311841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biosynthetic arginine decarboxylase"
                     /protein_id="WP_015703451.1"
                     /db_xref="GeneID:45319014"
                     /translation="MSDDMSLGSLSSAGEHGVLRSMQEVAMSSQEASKMLRTYNIAWW
                     GNNYYDVNELGHISVCPDPDVPEARVDLAELVKAREAQGQRLPALFCFPQILQHRLRS
                     INAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLGLEAGSKAELMAVLA
                     HAGMTRSVIVCNGYKDREYIRLALVGEKMGHKVYLVIEKMSEIAIVLEEAARLNVVPR
                     LGVRARLASQGSGKWQSSGGEKSKFGLAATQVLQLVEILREAGHLESLQLLHFHLGSQ
                     MANIRDIATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNE
                     YANNIIWAIGDACEENGLPHPTVITESGRAVTAHHTVLVSNIIGVERNEYTEATPPAK
                     DAARPLQSMWETWLEMHETGNRRSLREWLHDSQMDLHDIHIGYSSGTFNLQERAWAEQ
                     LYLNMCHEVQKQLDPSNRAHRPIIDELQERMADKIYVNFSLFQSMPDAWGIDQLFPVM
                     PLEGLNKSPERRAVLLDITCDSDGAIDHYVDGDGIATTMPMPEYDPENPPMLGFFMVG
                     AYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELSDEGDTVADMLQYVQLDPNTLLTQF
                     RDQVKNTGLDAELQQQFLEEFEAGLYGYTYLEDE"
     gene            complement(647082..647198)
                     /gene="yqgB"
                     /locus_tag="EAE_RS03150"
                     /db_xref="GeneID:45319015"
     CDS             complement(647082..647198)
                     /gene="yqgB"
                     /locus_tag="EAE_RS03150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015585756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid stress response protein YqgB"
                     /protein_id="WP_015369741.1"
                     /db_xref="GeneID:45319015"
                     /translation="MNKKPVAQLQCQHYLLGLKAVHGLLSRLSTAIVVNITS"
     gene            647331..647597
                     /locus_tag="EAE_RS03155"
                     /db_xref="GeneID:45319016"
     CDS             647331..647597
                     /locus_tag="EAE_RS03155"
                     /inference="COORDINATES: protein motif:HMM:NF037550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_110916199.1"
                     /db_xref="GeneID:45319016"
                     /translation="MGRTSAGLHERDADCGIELRDRTTRRIRRKTLVHYLVSPPHCPE
                     TGQRQAKAIPVILQAADALAACVHPSHIVIYAPGNSRPCRLPAT"
     gene            complement(647603..647875)
                     /locus_tag="EAE_RS03160"
                     /old_locus_tag="EAE_03085"
                     /db_xref="GeneID:45319017"
     CDS             complement(647603..647875)
                     /locus_tag="EAE_RS03160"
                     /old_locus_tag="EAE_03085"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703452.1"
                     /db_xref="GeneID:45319017"
                     /translation="MAILGQNFIAFPHFFDITRINGKSVVEIFPDNPGKARIFILHFT
                     PLLGIKRRARLIKKAHEAPSRDATSSRVKHSVTQRRFRRLYDMYIP"
     gene            648012..649166
                     /gene="metK"
                     /locus_tag="EAE_RS03165"
                     /old_locus_tag="EAE_03090"
                     /db_xref="GeneID:45319018"
     CDS             648012..649166
                     /gene="metK"
                     /locus_tag="EAE_RS03165"
                     /old_locus_tag="EAE_03090"
                     /EC_number="2.5.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005123306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="WP_004149807.1"
                     /db_xref="GeneID:45319018"
                     /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACET
                     YVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPD
                     INQGVDRADPLEQGAGDQGLMFGYATNETDVLMPAPVTYAHRLVQRQAEVRKNGTLPW
                     LRPDAKSQVTFQYDDGKIVGIDAVVLSTQHAEDIDQKSLQEAVMEEIIKPILPTEWLN
                     ASTKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAA
                     YAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFF
                     DLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAALLREAAGLK"
     gene            649559..650953
                     /locus_tag="EAE_RS03170"
                     /old_locus_tag="EAE_03095"
                     /db_xref="GeneID:45319019"
     CDS             649559..650953
                     /locus_tag="EAE_RS03170"
                     /old_locus_tag="EAE_03095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar porter family MFS transporter"
                     /protein_id="WP_015369739.1"
                     /db_xref="GeneID:45319019"
                     /translation="MPDNKKQGRSNKTMTFFVCFLAALAGLLFGLDIGVIAGALPFIA
                     NEFQISAHTQEWVVSSMMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAA
                     PNVEILLISRVLLGLAVGVASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLS
                     DTAFSYSGAWRWMLGVIIIPAVLLLIGVIFLPDSPRWFAAKRRFVDAERVLLRLRDTS
                     AEAKRELDEIRESLKVKQSGWALFKENSNFRRAVFLGVLLQIMQQFTGMNVIMYYAPK
                     IFELAGYANTTEQMWGTVIVGLTNVLATFIAIGLVDRWGRKPTLILGFIVMAAGMGVL
                     GSMMHIGIHSATAQYFAVLMLLMFIVGFAMSAGPLIWVLCSEIQPLKGRDFGITCSTA
                     TNWIANMIVGATFLTMLNSLGSANTFWVYGGLNVLFILLTIWLIPETKNVSLEHIERN
                     LMQGRPLREIGARD"
     gene            651031..651531
                     /locus_tag="EAE_RS03175"
                     /old_locus_tag="EAE_03100"
                     /db_xref="GeneID:45319020"
     CDS             651031..651531
                     /locus_tag="EAE_RS03175"
                     /old_locus_tag="EAE_03100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SprT family zinc-dependent metalloprotease"
                     /protein_id="WP_015369738.1"
                     /db_xref="GeneID:45319020"
                     /translation="MKTPRIPIAIQQAVMRSLREHLATANLKLERRYAEPTLVYQQRG
                     TSAGTAWLEKNEIRLNPVLLLENQQAFIDEVVPHELAHLLVWKHFGRVAPHGKEWKWM
                     MEVVLGVPARRTHRFELDSVRQNTFPYRCQCQQHQLTVRRHNRVVRGEATYRCVRCGD
                     LLVAEK"
     gene            651626..652333
                     /gene="endA"
                     /locus_tag="EAE_RS03180"
                     /old_locus_tag="EAE_03105"
                     /db_xref="GeneID:45319021"
     CDS             651626..652333
                     /gene="endA"
                     /locus_tag="EAE_RS03180"
                     /old_locus_tag="EAE_03105"
                     /EC_number="3.1.21.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020883698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonuclease I"
                     /protein_id="WP_015369737.1"
                     /db_xref="GeneID:45319021"
                     /translation="MSRMYVFAVALFSVAASGPLAAAGIHSFSQAKAAGVKVNADVPG
                     DFYCGCKIDWQGKKGVIDLESCGYKVRKNENRASRVEWEHVVPAWQFGHQRQCWQDGG
                     RKNCAKDPEYRKMESDMHNLQPAVGEVNGDRGNFMYSQWNGGDGQYGQCAMKVDFKDK
                     VAEPPVRARGSIARTYFYMRDRYQLTLSRQQTQLFTAWDKQYPVTSWECERDERIAKV
                     QGNHNPYVQQACQAQKS"
     gene            652422..653153
                     /gene="rsmE"
                     /locus_tag="EAE_RS03185"
                     /old_locus_tag="EAE_03110"
                     /db_xref="GeneID:45319022"
     CDS             652422..653153
                     /gene="rsmE"
                     /locus_tag="EAE_RS03185"
                     /old_locus_tag="EAE_03110"
                     /EC_number="2.1.1.193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (uracil(1498)-N(3))-methyltransferase"
                     /protein_id="WP_015369736.1"
                     /db_xref="GeneID:45319022"
                     /translation="MRIPRIHHPERITPGSHIALSEDAANHVGRVLRMSKGQEIQLFD
                     GSNQVFDAVITEAGKKNVMVEVIRGQIDDRESPLHIHLGQVMSRGEKMEFTIQKSIEL
                     GVSLITPLFSERCGVKLDAERLQKKIQQWQKIAIAACEQSGRNIVPEIRPAMQLEAWC
                     AEEENGLKLNLHPRASASINTLPLPVERVRLLIGPEGGLSAEEIAMTARYQFTDILLG
                     PRVLRTETTALTAITALQVRFGDLG"
     gene            653202..654152
                     /gene="gshB"
                     /locus_tag="EAE_RS03190"
                     /old_locus_tag="EAE_03115"
                     /db_xref="GeneID:45319023"
     CDS             653202..654152
                     /gene="gshB"
                     /locus_tag="EAE_RS03190"
                     /old_locus_tag="EAE_03115"
                     /EC_number="6.3.2.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione synthase"
                     /protein_id="WP_015703453.1"
                     /db_xref="GeneID:45319023"
                     /translation="MIKLGIVMDPIASINIKKDTSFAMLLEAQRRGYELHYMEMNDLY
                     LINGESRARTRTLSVEQNYDKWYEFTGEQDLALADLDVILMRKDPPFDTEFIYATYIL
                     ERAEEKGTLIVNKPQSLRDCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHGDIILK
                     PLDGMGGASIFRVKAGDPNLGVISETLTELGSRYCMAQNYLPAIKDGDKRVLVVDGEP
                     VPYCLARIPQGGETRGNLAAGGRGEARPLTESDWEIARRVGPTLKAKGLIFVGLDIIG
                     DRLTEINVTSPTCVREIEAAFPDVSITGMLMDAIEKRINK"
     gene            654284..654847
                     /locus_tag="EAE_RS03195"
                     /old_locus_tag="EAE_03120"
                     /db_xref="GeneID:45319024"
     CDS             654284..654847
                     /locus_tag="EAE_RS03195"
                     /old_locus_tag="EAE_03120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqgE/AlgH family protein"
                     /protein_id="WP_015369734.1"
                     /db_xref="GeneID:45319024"
                     /translation="MNLQHHFLIAMPALQDPLFRRSVVYICEYNDDGAMGIIINKPLE
                     NLQVEGILEKLKIAPQPRNPDIRLDKPVMVGGPLAEDRGFILHTPPSDFSSSIRISDN
                     TVITTSRDVLETLGTDKQPSNVLVALGYASWEKGQLEQEILDNAWLTAPADQNILFKT
                     PIADRWREAAKLIGIDIVTMPADAGHA"
     gene            654847..655263
                     /gene="ruvX"
                     /locus_tag="EAE_RS03200"
                     /old_locus_tag="EAE_03125"
                     /db_xref="GeneID:45319025"
     CDS             654847..655263
                     /gene="ruvX"
                     /locus_tag="EAE_RS03200"
                     /old_locus_tag="EAE_03125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase RuvX"
                     /protein_id="WP_015369733.1"
                     /db_xref="GeneID:45319025"
                     /translation="MSGTFLSFDFGTKSIGVAVGQRITGTARPLPALKAQDGKPDWNI
                     IEKLLKEWQPEAVIVGLPLNMDGTEQPLTARARNFANKIHGRFGVKITLHDERLSTVE
                     ARAGLFEHGGFRALNKGSVDSASAVVILESYFEQGY"
     gene            complement(655511..656164)
                     /gene="csgD"
                     /locus_tag="EAE_RS03205"
                     /old_locus_tag="EAE_03130"
                     /db_xref="GeneID:45319026"
     CDS             complement(655511..656164)
                     /gene="csgD"
                     /locus_tag="EAE_RS03205"
                     /old_locus_tag="EAE_03130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator CsgD"
                     /protein_id="WP_015369732.1"
                     /db_xref="GeneID:45319026"
                     /translation="MINLSENLLHSRQVTFITHPSIQSNAFATWLTEKLSVNVTLHNI
                     NKPLTQRLAKDSVILFDIAVSNKKLNGVWRDIIRVQADNPRLLIINSAQKYELYEMAQ
                     WPALYGVFRHDDDQSRLIEGVKAVLNGEQTAELSVMHPALYSADQVTAPTENSPLTER
                     ECEILNELRCGATNMDIARALFISENTVRTHLYNVFRKLSVKNRTQAVSWANEHLRH"
     gene            complement(656515..657495)
                     /locus_tag="EAE_RS03210"
                     /old_locus_tag="EAE_03135"
                     /db_xref="GeneID:45319027"
     CDS             complement(656515..657495)
                     /locus_tag="EAE_RS03210"
                     /old_locus_tag="EAE_03135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016831640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus twitching motility protein PilT"
                     /protein_id="WP_015703454.1"
                     /db_xref="GeneID:45319027"
                     /translation="MELEEIVALSVKHNVSDLHLCSAYPPRWRRLGKLEPAPFTSPDV
                     EEILTRWLNDPQLAQWRADGQVDFALALSDGPRLRASAFAHARGLSLALRLLPQRCPQ
                     LGDLGAPAALSELLNEESGLILVTGATGSGKSTTLAAMVDYLNQYRHGHILTLEDPVE
                     FIHASRNCLIQQREIGRHCSSFAAALRVALRQDPDVILLGELRDSETIRLALTAAETG
                     HLVMATLHTRSAAQAVERLVDVFPAEEKEPVRSQLAGSLCAVAAQKLLPNASGGRVAL
                     YELLVNTPAVANLIREGKTHQLPGVMQTSQQAGMQTFAQSFQQRALAGEL"
     gene            657512..658216
                     /locus_tag="EAE_RS03215"
                     /old_locus_tag="EAE_03140"
                     /db_xref="GeneID:45319028"
     CDS             657512..658216
                     /locus_tag="EAE_RS03215"
                     /old_locus_tag="EAE_03140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_417426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggS family pyridoxal phosphate-dependent
                     enzyme"
                     /protein_id="WP_015703455.1"
                     /db_xref="GeneID:45319028"
                     /translation="MNDIAHNLAQVRDKISGAAARCGRASEEVTLLAVSKTKPASAIE
                     EAMAAGQRTFGENYVQEGVDKIRYFQQAGASGLQWHFIGPLQSNKSRLVAEHFDWCHT
                     VDRLKIATRLSEQRPADLPPLNVLIQINISDEQSKSGIPLAELDALAAGVAALPNLQL
                     RGLMAIPAPESEYERQFAVAQQMAVAFAQLKTLYPSVDTLSLGMSDDMEAAIAAGSTM
                     VRIGTAIFGARDYSKK"
     gene            658234..658800
                     /locus_tag="EAE_RS03220"
                     /old_locus_tag="EAE_03145"
                     /db_xref="GeneID:45319029"
     CDS             658234..658800
                     /locus_tag="EAE_RS03220"
                     /old_locus_tag="EAE_03145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012135068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggT family protein"
                     /protein_id="WP_015369729.1"
                     /db_xref="GeneID:45319029"
                     /translation="MKTLTFLLSTVIELYTMVMLLRVWMQWARCDFYNPFSQFVVKAT
                     QPIVGPLRRIIPAMGPLDSASLLVAFVLCVIKAIVLFMVVTFQPIIWIAAVLILLKTI
                     GSLIFWVLLLMAIMSWVSQGRSPVEYVLMQLADPLLRPIRNLLPSMGGIDFSPMVLVL
                     LLYVINMGIAELLQATGNVLLPGLWMAL"
     gene            658797..659087
                     /locus_tag="EAE_RS03225"
                     /old_locus_tag="EAE_03150"
                     /db_xref="GeneID:45319030"
     CDS             658797..659087
                     /locus_tag="EAE_RS03225"
                     /old_locus_tag="EAE_03150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggU family protein"
                     /protein_id="WP_015369728.1"
                     /db_xref="GeneID:45319030"
                     /translation="MSAVEVCADGLVLRLYIQPKASRDSLVGLHGDELKVAITAPPVD
                     GQANAHLVKYLAKQFRVAKSQVLIEKGELGRHKQVKIIHPQQIPPAVAALTD"
     gene            659100..659693
                     /locus_tag="EAE_RS03230"
                     /old_locus_tag="EAE_03155"
                     /db_xref="GeneID:45319031"
     CDS             659100..659693
                     /locus_tag="EAE_RS03230"
                     /old_locus_tag="EAE_03155"
                     /EC_number="3.6.1.66"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XTP/dITP diphosphatase"
                     /protein_id="WP_015369727.1"
                     /db_xref="GeneID:45319031"
                     /translation="MQKVVLATGNAGKVRELASLLEDFGLDVVAQTELGVDSAEETGL
                     TFIENAILKARHAAQVTGLPAIADDSGLAVDALGGAPGIYSARYSGENASDQQNLEKL
                     LDALQDVPDEQRQAQFHCVLVYLRHAEDPTPLVCHGSWPGVITRQAAGSGGFGYDPIF
                     FVPSEGKTAAELSREEKSAISHRGQALKLLLEALRNG"
     gene            659686..660825
                     /gene="hemW"
                     /locus_tag="EAE_RS03235"
                     /old_locus_tag="EAE_03160"
                     /db_xref="GeneID:45319032"
     CDS             659686..660825
                     /gene="hemW"
                     /locus_tag="EAE_RS03235"
                     /old_locus_tag="EAE_03160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM family heme chaperone HemW"
                     /protein_id="WP_015703456.1"
                     /db_xref="GeneID:45319032"
                     /translation="MANLPPLSLYIHIPWCVQKCPYCDFNSHALKGEVPHDDYVQHLL
                     ADLRHDAPYAQGREIKTIFIGGGTPSLLSGPAMQTLLDGVRACLPLAADAEITMEANP
                     GTVEADRFVEYQRAGVNRISIGVQSFSEPKLQRLGRIHGPEEAKRAARLASGLGLRSF
                     NLDLMHGLPDQSLDEALDDLRQAIALNPPHLSWYQLTIEPNTLFGSRPPVLPDDDALW
                     DIFEQGHQLLSAAGYQQYETSAYAKPGYQCQHNLNYWRFGDYLGIGCGAHGKVTFPDG
                     RILRTAKTRHPRGYMEGRYLERQHDVDAADKPFEFFMNRFRLLEAAPRAEFSLYTGLD
                     EQVIRPQIDAAIAEGYLLEDAQNWQITEHGKLFLNSLLELFLSEE"
     gene            661118..662164
                     /locus_tag="EAE_RS03240"
                     /old_locus_tag="EAE_03165"
                     /db_xref="GeneID:45319033"
     CDS             661118..662164
                     /locus_tag="EAE_RS03240"
                     /old_locus_tag="EAE_03165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004181270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_015369725.1"
                     /db_xref="GeneID:45319033"
                     /translation="MNYRNIFITLAALSGTVTASAWSAESATVAFLMPDQASTRYEQH
                     DFPGFKAEMSKLCAECKVIYQNANANASLQQQQFNSVIAQGAKVIVLDPVDSSAAAAL
                     VENAQAQGVKVIAYDRPVPNKPADFYVSFDNEGIGYAIAKSLTDHLKASGVPQDAGVL
                     QINGSPTDAAAGLIRDGIHRGLKESGYKTLAEFDTPEWAPPKAQEWTAGQVTRFGDKI
                     KGVVAANDGTGGGAIAAFKAAGVQPLPPVTGNDATIAALQLIIAGDQYNTISKPSEIV
                     AAAAAKVAVDFIQGKKPQASTTLYNTPSQLFTPEVVTAKNIKAEIFDKKIQTWDQVCS
                     GEYAAACQKLGISK"
     gene            662224..663033
                     /locus_tag="EAE_RS03245"
                     /old_locus_tag="EAE_03170"
                     /db_xref="GeneID:45319034"
     CDS             662224..663033
                     /locus_tag="EAE_RS03245"
                     /old_locus_tag="EAE_03170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004181271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_004181271.1"
                     /db_xref="GeneID:45319034"
                     /translation="MPQQQHNSAAGRPILQLRNVSKHFGAVSALTDIELEVHAGEVVA
                     LVGDNGAGKSTLVKILAGVHQPTSGTIEFDGNPVTLDSPGKALEYGIATVFQDLALCE
                     NLDVVANLFLGHEISPFQLDEVAMEVKAWTLLQELAARIPSVREPVASLSGGQRQTVA
                     IARSLLLNPKIIMLDEPTAALGVAQTAEVLNLIERVRERGLGVIIISHNMEDVRAVAD
                     RIVVLRLGRNKGIFTPDASNQDLVAAITGATENAVSRRVERKSQPTTSGAM"
     gene            663038..664285
                     /locus_tag="EAE_RS03250"
                     /old_locus_tag="EAE_03175"
                     /db_xref="GeneID:45319035"
     CDS             663038..664285
                     /locus_tag="EAE_RS03250"
                     /old_locus_tag="EAE_03175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004181281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_015369724.1"
                     /db_xref="GeneID:45319035"
                     /translation="MNSKTASHTALDRSDERVRHDEGLFGALRAQITRIKTGDLGTAP
                     VIAGLIVISLVFTFLNPVYIAPNNLVNLLFDCATVGFISLGIVCVLMLGEIDLSVGSM
                     SGLASAIVGVLWVNAGWPLAGAIAVALACGVAVGLVYALLYTRVGMPSFVATLAGLLA
                     LLGMQLYILGPSGSINLPYTSPLVRFGQLLVMPGWFSHLMALLPGLAIIVFGLKKRSR
                     RLAANLSAEGVSSLLARAIALTIIFEAAVLYLNQGRGIPWIFGLFVACVMILNYALKR
                     TKWGRSMFAVGGNREAARRSGINVRAIYVSAFVLCTTLATFGGILAASRLASASQQAG
                     TGDVNLNAIAAAVIGGTSLFGGRGSAWSALLGIIVIQSISNGLTLLNLPSSLRYIITG
                     AVLAIAVIIDSLARRSRVSHGRA"
     gene            complement(664332..665051)
                     /locus_tag="EAE_RS03255"
                     /old_locus_tag="EAE_03180"
                     /db_xref="GeneID:45319036"
     CDS             complement(664332..665051)
                     /locus_tag="EAE_RS03255"
                     /old_locus_tag="EAE_03180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2884 domain-containing protein"
                     /protein_id="WP_015703457.1"
                     /db_xref="GeneID:45319036"
                     /translation="MMRKTLLAVALSVTALSAHADYQCSVTPRDDVILSPQQVQVKGE
                     NGDLVIKPDGNLTFNGKAYALSAAQREQAQDYQAGLRSSLPWIDDGARSRVEKGRKAL
                     DKIITEQVGASSSMHSRLTKLDAQLKEQMNRIIERRSDGLTFHYKAIDQVRADGQQLV
                     NQAMGGILQDSINEMGAKAVLKGGGNPLQGILGSLGGLQTAIQDEWKNQEADFQQFGK
                     DVCGRVVSLEESRKALVGSLK"
     gene            complement(665102..665428)
                     /locus_tag="EAE_RS03260"
                     /old_locus_tag="EAE_03185"
                     /db_xref="GeneID:45319037"
     CDS             complement(665102..665428)
                     /locus_tag="EAE_RS03260"
                     /old_locus_tag="EAE_03185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggL family protein"
                     /protein_id="WP_015703458.1"
                     /db_xref="GeneID:45319037"
                     /translation="MAKNRSRRLRKKMHIDEFQELGFSVAWRFPEGASEEQIDQTVND
                     LIEEVIEPNKLAFDGSGYLSWEGLICMQEIGKCTEEHQAIVRKWLEDRKLADVRTSEL
                     FDVWWD"
     gene            complement(665428..666147)
                     /gene="trmB"
                     /locus_tag="EAE_RS03265"
                     /old_locus_tag="EAE_03190"
                     /db_xref="GeneID:45319038"
     CDS             complement(665428..666147)
                     /gene="trmB"
                     /locus_tag="EAE_RS03265"
                     /old_locus_tag="EAE_03190"
                     /EC_number="2.1.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine(46)-N7)-methyltransferase TrmB"
                     /protein_id="WP_015369721.1"
                     /db_xref="GeneID:45319038"
                     /translation="MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQQHALDNIWPV
                     MGVEFNDAPLDFAALFGREAPVTLEIGFGMGASLVAMAKAKPEQNFLGIEVHSPGVGA
                     CLASAEEEGVQNLRVMCHDAVEVLHTMIPDNSLNMVQLFFPDPWHKARHNKRRIVQPP
                     FAELVKSKLKLGGVFHMATDWEAYAEHMLEVMSSLEGYRNRSESNDYVPRPESRPVTK
                     FEQRGHRLGHGVWDLMFERVK"
     gene            666284..667342
                     /gene="mutY"
                     /locus_tag="EAE_RS03270"
                     /old_locus_tag="EAE_03195"
                     /db_xref="GeneID:45319039"
     CDS             666284..667342
                     /gene="mutY"
                     /locus_tag="EAE_RS03270"
                     /old_locus_tag="EAE_03195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="WP_015703459.1"
                     /db_xref="GeneID:45319039"
                     /translation="MTFLAAQFSAQVLDWYDKYGRKTLPWQIAKTPYKVWLSEVMLQQ
                     TQVTTVIPYFERFMARFPTVVDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATQH
                     GGEFPKTFEEVAALPGVGRSTAGAILSLSLGQHYPILDGNVKRVLARCYAVSGWPGKK
                     EVEKRLWEISEEVTPAQGVERFNQAMMDLGAMVCTRSKPKCELCPLSNGCVAYANHSW
                     AEYPGKKPKQTIPERTGYFLLMQHGDEVFLSQRPPVGLWGGLFCFPQFEDEAGLREWL
                     AQRQIKADNLTQLTAFRHTFSHFHLDIVPMWLTVHSSGACMDEGNALWYNLAQPPSVG
                     LAAPVERLLQQLKAGTPV"
     gene            667371..667646
                     /locus_tag="EAE_RS03275"
                     /old_locus_tag="EAE_03200"
                     /db_xref="GeneID:45319040"
     CDS             667371..667646
                     /locus_tag="EAE_RS03275"
                     /old_locus_tag="EAE_03200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidative damage protection protein"
                     /protein_id="WP_004105744.1"
                     /db_xref="GeneID:45319040"
                     /translation="MSRTIFCTFLQREADGQDFQLYPGELGKRIYNEISKEAWAQWQH
                     KQTMLINEKKLSMMNPEHRKLLEQEMVQFLFEGKDVHIEGYTPPEKQ"
     gene            667692..668777
                     /gene="mltC"
                     /locus_tag="EAE_RS03280"
                     /old_locus_tag="EAE_03205"
                     /db_xref="GeneID:45319041"
     CDS             667692..668777
                     /gene="mltC"
                     /locus_tag="EAE_RS03280"
                     /old_locus_tag="EAE_03205"
                     /EC_number="4.2.2.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013364819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane-bound lytic murein transglycosylase
                     MltC"
                     /protein_id="WP_020077945.1"
                     /db_xref="GeneID:45319041"
                     /translation="MMKKYLALALIAPLLVSCSSSNKKGAEYNEAWVKDTNGFDILMG
                     QFAHNIENIWGYNEVLLAGPKDYVKYTDQYQTRSHINFDAGTITVETIAGTDPQGRLR
                     QAIIKTLLMGDDPNSIDLYSDVDDIQISKEPFLYGQVVDNTGESIRWEWRAARYADYL
                     LQTRLKSRSNGLRVVYSITINLVPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQT
                     ESSFNPYAVSHADAMGLMQVVQHSAGKDVFRSQGKSGLPSRSYLFDPANNIDTGTAYL
                     AMLNNVYLAGIDNPTSRRYAVITAYNGGAGSVLRVFSSDKVQAANIINSMAPGDVYQT
                     LTTRHPSAESRRYLYKVNTAQKSYRRK"
     gene            668963..670216
                     /locus_tag="EAE_RS03285"
                     /old_locus_tag="EAE_03210"
                     /db_xref="GeneID:45319042"
     CDS             668963..670216
                     /locus_tag="EAE_RS03285"
                     /old_locus_tag="EAE_03210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017899764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside permease"
                     /protein_id="WP_015703460.1"
                     /db_xref="GeneID:45319042"
                     /translation="MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGAAIGAVY
                     SSLGIAAVLMPTLLGIVADKWISAKWVYAICHLVGALTLYLAAQVTTPGEMFLVILLN
                     SLAYMPTLGLINTISYYRLQSAGLDIVTDFPPIRIWGTIGFILAMWGVSFSGFELSHM
                     QLYIGATLSVLLALFTLTLPHIPVANAQRNQSWTEMLGLNAFALFKNKRMAIFFIFSM
                     MLGAELQITNMFGNTFLHSFDKDPLFSGSFIVEHASVLMSISQISETLFILTIPFFLS
                     RYGIKNVMLISIVAWMLRFGLFAFGDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVE
                     KEVRPEIRASAQGMFLMMTNGFGCILGGMVSGKVVEHFTIEGITNWQSVWLIFAAYSL
                     VLAFAFVALFKYQHVRQPAAARQNA"
     gene            complement(670260..672398)
                     /locus_tag="EAE_RS03290"
                     /old_locus_tag="EAE_03215"
                     /db_xref="GeneID:45319043"
     CDS             complement(670260..672398)
                     /locus_tag="EAE_RS03290"
                     /old_locus_tag="EAE_03215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine decarboxylase"
                     /protein_id="WP_015703461.1"
                     /db_xref="GeneID:45319043"
                     /translation="MKSMHIAASCELVSRLSTHRQVVALDSTDFTDAAAVVITAADSR
                     SGILALLKRSGFNLPVYLFSETQTDKPEGVVAVISGKEQEWLELEAAACGYEEKLLPP
                     FFNTLSQYVEMDNSTFACPGHQHGAFFKKHPAGRQFYEFFGENVFRADMCNADVKLGD
                     LLIHEGSAKHAQKFAAKVFNADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKS
                     NHHGALIQAGATPVYLEAARNPFGFIGGIDDHCFDETYLRELIREAAPEKADARRPFR
                     LAVIQLGTYDGTVYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCSPLLLDLNE
                     NDPGIFVTQSVHKQQAGFSQTSQIHKKDNHLRGQARFCPHKRLNNAFMLHASTSPFYP
                     LFASLDVNAKIHEGESGRRLWAECVELGIEARKAILAQCKLLRPFVPPLVGGKPWQEH
                     STATIASERRFFSFEPGASWHGFSGYADNQYFVDPCKLLLTTPGIDADSGDYTEFGIP
                     ATILAHYLRENGIVPEKCDLNSILFLLTPAESAEKLARLVAMLAQFEQHFEADSPLAE
                     VLPTIYNKYPVRYRDYTIRQLCQEMHDLYVSFDVKDLQKAMFRKQSFPPVVMNPQDAN
                     REFIRGNVELVRLSEAEGRIAAEGALPYPPGVLCVVPGELWGGAVLRYFLALEEGVNM
                     LPGFSPELQGVYSETDTDGIKRLYGYVLKK"
     gene            672818..673531
                     /locus_tag="EAE_RS03295"
                     /old_locus_tag="EAE_03220"
                     /db_xref="GeneID:45319044"
     CDS             672818..673531
                     /locus_tag="EAE_RS03295"
                     /old_locus_tag="EAE_03220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF554 domain-containing protein"
                     /protein_id="WP_015703462.1"
                     /db_xref="GeneID:45319044"
                     /translation="MVIGPFINASAVLVGGVLGALLSQRLPERIRTSMTSIFGLASLG
                     IGILLVIKCANLPVMVLATLVGALLGEVCNMEKGINTLVSKLQQLLSPKGRKKASAHE
                     SYIQSYVAIIVLFCASGTGVFGAMREGMTGDASILIAKAFLDFFTATIFACTLGLAVS
                     VICVPMLLIQLSLAACASLIMPLTTPMMMADFSAVGGMLLVATGLRICGIKMFAVVNM
                     LPALLLAMPISVAWTAFFA"
     gene            673637..673712
                     /locus_tag="EAE_RS03300"
                     /old_locus_tag="EAE_t24834"
                     /db_xref="GeneID:45319045"
     tRNA            673637..673712
                     /locus_tag="EAE_RS03300"
                     /old_locus_tag="EAE_t24834"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:2.0.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: tRNAscan-SE."
                     /anticodon=(pos:673670..673672,aa:Phe,seq:gaa)
                     /db_xref="GeneID:45319045"
     gene            complement(673973..674917)
                     /locus_tag="EAE_RS03305"
                     /old_locus_tag="EAE_03225"
                     /db_xref="GeneID:45319046"
     CDS             complement(673973..674917)
                     /locus_tag="EAE_RS03305"
                     /old_locus_tag="EAE_03225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703463.1"
                     /db_xref="GeneID:45319046"
                     /translation="MPDITSEINAVLSDHSRFDAEQLDIIISFVNELDKGTLSQFENA
                     PDRTIMDTYERLLSASKEPARRQRDEEYELESLTGASRRTATMSNHAAFFERFRTTPA
                     HMYGYGGNVYRDQTKSYYDVAGKILAGIGGLASFGAGTAAIAASQAGSSLSGIAARYA
                     LSSVGATGLAAGAMALLRNNFSDVQVATNKDFLETIKSIAKLRNKLNDFFQGLNNKVY
                     SDKTKAETALNNEMKSHPLRFGVGSGSQVVHANLAPIQRLVTQDFVTVNHEIRAKILP
                     KGTNSAWSVAVSSSEMGWDERVLDQANMGILQQVVHQL"
     gene            complement(674938..675420)
                     /locus_tag="EAE_RS03310"
                     /old_locus_tag="EAE_03230"
                     /db_xref="GeneID:45319047"
     CDS             complement(674938..675420)
                     /locus_tag="EAE_RS03310"
                     /old_locus_tag="EAE_03230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015962266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion system tube protein Hcp"
                     /protein_id="WP_015369713.1"
                     /db_xref="GeneID:45319047"
                     /translation="MAIDMYLKVDGVTGESNDSNHKNWIDVLSFSWAAEQPGNMSVGG
                     GGGAGKVNFQDLSVQALIDKATPAVLKFCASGKHVAKVELSICKAGGSQIEYSRVVLE
                     DVLVTKTSFSGVGHTDTIMVNYLFQASKVNLHYWEQSSQGTKGAETKSGWDIKQNKEI
                     "
     gene            complement(675536..676009)
                     /locus_tag="EAE_RS03315"
                     /old_locus_tag="EAE_03235"
                     /db_xref="GeneID:45319048"
     CDS             complement(675536..676009)
                     /locus_tag="EAE_RS03315"
                     /old_locus_tag="EAE_03235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YhcH/YjgK/YiaL family protein"
                     /protein_id="WP_015703464.1"
                     /db_xref="GeneID:45319048"
                     /translation="MIAGDIGTLTASGIHPVLAEALMLAVAACPQEKSPGRFNLRGDD
                     IFMNVMVFTTQPAESKKSEQHAQYIDIQLLLSGEERILWGMVNCAQQCEAIHVEEDYQ
                     LCNAIENQQAITLRPGNFVIFMPGEPHKPGCITTLPQEIKKVVVKVNVSLLQNEY"
     gene            complement(676006..676881)
                     /locus_tag="EAE_RS03320"
                     /old_locus_tag="EAE_03240"
                     /db_xref="GeneID:45319049"
     CDS             complement(676006..676881)
                     /locus_tag="EAE_RS03320"
                     /old_locus_tag="EAE_03240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmannosamine kinase"
                     /protein_id="WP_015703465.1"
                     /db_xref="GeneID:45319049"
                     /translation="MTTLAIDIGGTKLAAALVDDDLNLLKRRELPTPASKMPEALCSA
                     LQELIVPLFARAQRVAIASTGIISGGVLSAINPHNLGGLQHFPLTQTLEKITGLPTLA
                     VNDAQAAAWAEYHALGDECRDMVFITVSTGVGGGVVSNGRLITGYGGLAGHLGHTLAD
                     PNGPRCGCGRRGCAEAVASGRGMAAAAQGELSGCDAKTIFIRAGQDDEQAIGLIHRSA
                     QTLARLIADVKATTDCQRVVVGGSIGLAEGYLEMVRAYLAQEPSVYHVMLQPAHYRHD
                     AGLLGAVLLARENNS"
     gene            complement(676878..677567)
                     /locus_tag="EAE_RS03325"
                     /old_locus_tag="EAE_03245"
                     /db_xref="GeneID:45319050"
     CDS             complement(676878..677567)
                     /locus_tag="EAE_RS03325"
                     /old_locus_tag="EAE_03245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020077940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmannosamine-6-phosphate 2-epimerase"
                     /protein_id="WP_015703466.1"
                     /db_xref="GeneID:45319050"
                     /translation="MSLLEQLNQNIAQSGGLIVSCQPVPNSPLDKPEIVAAMALAAEQ
                     AGAVALRIEGIDNLRATRAVVSIPIIGIMKRDLDDSPVRITPFLEDVDALAQGGADII
                     AVDGTNRLRPVTVAALLARIHQHALLAMADCSTFEDGMACQQQGADIIGTTLSGYTTV
                     KTPEEPDFALVKTLSEAGCRVIAEGRYNTPAQAATAMRQGAWAVTVGSAITRLEHICQ
                     WYNSALKKAVS"
     gene            complement(677613..679103)
                     /locus_tag="EAE_RS03330"
                     /old_locus_tag="EAE_03250"
                     /db_xref="GeneID:45319051"
     CDS             complement(677613..679103)
                     /locus_tag="EAE_RS03330"
                     /old_locus_tag="EAE_03250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_417691.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_015703467.1"
                     /db_xref="GeneID:45319051"
                     /translation="MSTTTQNIPWYRHLNRAQWRAFSAAWLGYLLDGFDFVLIALVLT
                     EVQGEFGLTTVQAASLISAAFISRWFGGLMLGAMGDRYGRRLAMVTSIVLFSLGTLAC
                     GFAPGYTSLFIARLVIGMGMAGEYGSSATYVIESWPKHLRNKASGFLISGFSVGAVVA
                     AQVYSLVVPVWGWRALFFIGIVPIVFALWLRKNIPEAEDWKEKHEGKAPVRTMVDILY
                     RGQHRVLNIIMTFVAGASLWYCFAGEARIAGLVALLGLVCAIIFISFMVQSSGKRWPT
                     GVMLMVVVLFAFLYSWPIQALLPTYLKTELAYDPHTVANVLFFSGFGAAVGCCVGGFL
                     GDWLGTRKAYVCSLLASQLLIVPVFAIGGTNVWVLGLLLFFQQMLGQGISGILPKLIG
                     GYFETDQRAAGLGFTYNVGALGGALAPILGALIAQRLDLGTALGSLSFSLTFVVILLI
                     GLDMPTRVQRWIRPEAMRTHDAIDGKPFSGAVPFGRGKSTLAKSKN"
     gene            complement(679241..680134)
                     /gene="nanA"
                     /locus_tag="EAE_RS03335"
                     /old_locus_tag="EAE_03255"
                     /db_xref="GeneID:45319052"
     CDS             complement(679241..680134)
                     /gene="nanA"
                     /locus_tag="EAE_RS03335"
                     /old_locus_tag="EAE_03255"
                     /EC_number="4.1.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_312125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylneuraminate lyase"
                     /protein_id="WP_015703468.1"
                     /db_xref="GeneID:45319052"
                     /translation="MVSHLRGVMPALLTPFDAQQNIDRASLRRLVRFNIEQGVDGVYV
                     GGSTGEAFVQSLSEREEVLEIVAEEAKGKITLIAHVGCVSTAESQQLAVAAKRYGFDA
                     VSAVTPFYYPFSFEEHCDHYRAIIDSADGIPMVVYNIPALSGVKLTLEQINQLVTLPG
                     VGALKQTSGDLYQMEQIRRAHPELVLYNGYDEIFASGLLAGADGGIGSTYNIMAWRYL
                     GIVQALKEGDTAKAQQLQHECNKVIDLLVKVGVFRGLKTVLHYMDVLSVPLCRKPFAP
                     VEDKFQAELKALAQQLMQERG"
     gene            complement(680269..681051)
                     /gene="nanR"
                     /locus_tag="EAE_RS03340"
                     /old_locus_tag="EAE_03260"
                     /db_xref="GeneID:45319053"
     CDS             complement(680269..681051)
                     /gene="nanR"
                     /locus_tag="EAE_RS03340"
                     /old_locus_tag="EAE_03260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016151065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NanR"
                     /protein_id="WP_015369707.1"
                     /db_xref="GeneID:45319053"
                     /translation="MSAFDHSSDDTQETIGNSLRRRPLARKKLSEMVEEELEQMIRRG
                     EFGEGGQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGERARVSRPSADTIIS
                     ELSGLAKDFLSAPGGIAHFEQLRLFFESSLVRYAAENATDEQISLLSKALEINGQSLD
                     DNAQFIRSDVDFHRVLAEIPGNPIFMATHVALLDWLIAARPKVSEQELHHHNNVSFQE
                     HIAIFNAIRDRDPDEADRALQTHLKSVSATWRALGKSKKSAK"
     gene            681484..681729
                     /locus_tag="EAE_RS03345"
                     /db_xref="GeneID:45319054"
     CDS             681484..681729
                     /locus_tag="EAE_RS03345"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_064908766.1"
                     /db_xref="GeneID:45319054"
                     /translation="MTGLSPGKCGLTSRRGSAAARQAVHQDNDAQALMEVGTGNSRFV
                     SVRYGFTACDRVAGVAVRRAGETKKWRSARHSRVNDS"
     gene            681801..682916
                     /gene="iroB"
                     /locus_tag="EAE_RS03350"
                     /old_locus_tag="EAE_03270"
                     /db_xref="GeneID:45319055"
     CDS             681801..682916
                     /gene="iroB"
                     /locus_tag="EAE_RS03350"
                     /old_locus_tag="EAE_03270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_461700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="salmochelin biosynthesis C-glycosyltransferase
                     IroB"
                     /protein_id="WP_015703469.1"
                     /db_xref="GeneID:45319055"
                     /translation="MRILFVGPPLYGLLYPVLSLAQAFRVNGHEVLIASSGKFAQKAA
                     EAGLVVFDAAPGFDSEADYRRREAQRKESNIGTKMGNFSFFSEEMADQLVEFAGHWRP
                     DLIVYPPLGVVGPLIAAKYDIPVVMQTVGFGHTPWHIKGVTRSLADAYRRHGVEAPPQ
                     DMAWIDVTPPSMSILQNDGEPIIPMQYVPYNGGAVWEEWWERTPDRKRLLVSLGTVKP
                     MVDGLDLISWVMDSASEVDAEIILHLSANARSDLRALPSNVRLVDWIPMGAFLNGADG
                     FIHHGGAGNTLTALHAGIPQIVFGQGADRPVNARAVVDRGCGIIPGDGGLSSSMINAF
                     LDDRALRTASEEVAAEMAAQACPTEVAKELAAMAQKG"
     gene            682963..686631
                     /gene="iroC"
                     /locus_tag="EAE_RS03355"
                     /old_locus_tag="EAE_03275"
                     /db_xref="GeneID:45319056"
     CDS             682963..686631
                     /gene="iroC"
                     /locus_tag="EAE_RS03355"
                     /old_locus_tag="EAE_03275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001141250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="salmochelin/enterobactin export ABC transporter
                     IroC"
                     /protein_id="WP_015703470.1"
                     /db_xref="GeneID:45319056"
                     /translation="MPATHSPTPARSWIIRLARVCWERKKLSAIVVVASVSTILLAAL
                     TPLLTRQAVNDALAGNPTRLPWLACGLLLIAFFDFIGNYVRRGYAGELSLWVQHTLRG
                     RAFDSIQKLDGAGQDALRTGQVISRTNSDLQQMHTLLQMAPVPLAVFTYYIAGIAVML
                     WMSPAMTLIVVCVLACLAITALRARRRVFAQTGLASDRLANLTEHMREVLAQISVVKS
                     CVAELRETRWLDRQSRQMVRVRIGAAISQAMPGATMLALPVLGQIVLLCYGGWSVMHG
                     RIDLGTFVAFASFLAMLTGPTRVLASFLVIAQRTQASVERVFALIDTRSQMVDGSEAL
                     NGRVIGLQLEKVNFGYGGGNRILSDVSFSLQAGETLAVVGASGSGKSTLLMLLARFYD
                     PSAGDIWLNTSAGRQNLRDLKLEALRRQVGVVFEDAFLFAGTVAENIAYGHPQATTED
                     IRRAAAAAGASEFINALPKGFDTRLTERGTNLSGGQRQRIALARALITAPELLILDDT
                     TSAVDAGTEAEINAALGRYADDQHMLLVIARRRATLRLASRIVVLDKGQVVDIGSQAE
                     LESRCPAFRALMTGDGDFLEPAAGGCRDLWPTTPAMQNEEPQALPEVDGNGFVARMTR
                     VPEQAVQQALAGEGRRLTSLLRPVAWMFIIAALLIALDSAAGVGVLILLQRGIDSGVA
                     AGDMATIGICALLALCLVVISWCCYSLQTIFAARAAESVQHTVRLRSFGHMLRLALPW
                     HEKHVDSRLTRMTVDVDSLARFLQNGLAGAATSLVTMFAIAAAMFWLDPILALTALSA
                     VPIVALATWVYRRLSSPAYAQARLEIGKVNSTLQEKVSGLRVVQSHGQQEQEAARLRA
                     LSDRFRATRVRAQKYLAVYFPFLTFCTEASYAAVLLVGASRVAEGEMTAGVLAAFFLL
                     LGQFYGPVQQLSGIVDSFQQATASGKHIDELLATEETENVTPSSTQPATGALQLDEVT
                     YRYPGSAEPALDKLTLTIPEGSVVAVVGRSGAGKSTLIKLIAGLYSPTSGTIGIGERQ
                     MTATTLADYRRQIGLVDQDVALFSGDIAENIRYSRPSSSNAEVEIASRQAGLFELVRQ
                     LPQGFRTPVNNGGADLSAGQRQLIALARAQLANAHVLLLDEATSRLDRRAEERLMSSL
                     TEVARARKHLALIVAHRLTTAQRCDLIAVVDKGRLAECGTHEQLLAANGLYARLWRDS
                     VGPADARNQHDITGEIVG"
     gene            686735..687973
                     /locus_tag="EAE_RS03360"
                     /old_locus_tag="EAE_03280"
                     /db_xref="GeneID:45319057"
     CDS             686735..687973
                     /locus_tag="EAE_RS03360"
                     /old_locus_tag="EAE_03280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000933675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase family protein"
                     /protein_id="WP_015703471.1"
                     /db_xref="GeneID:45319057"
                     /translation="MFNINPHPPVSAAIAGLRRQLATGNITDLSHFWQQATSLPVPLV
                     TTVDGAADEREVTFLCRARHPLRGVYLRLNRVTDKEQVAKGLMTQIPATDIWTLTLRL
                     PASYCGSYSLVEIPPGTPEEVVNQLGSRFAALAGQADPLNKTPGIAIRDGVRESVLAL
                     DNAPAQSEWRGGRHAGTLLTSERIVAGQSRQVRLYLPAVDKSQPLGLVVLPDGETWFD
                     HLGVCAAIDAAIDSRRIVPVALLGIDNIDERERTTILGGRSELIRDVAEHLLPTIRRE
                     QPRQKWADRSRTVLAGQSLGGVSALMAARHAPETFGLVLSHSPSMWWTPDGGSRPHLF
                     SATDTSWVSEHVLSAPPRTVRIRLCVGSLEGSTVPHVQRLHQQLQASGVDSHCAIYTG
                     GHDYAWWRGALLDGLGLLQG"
     gene            688057..688989
                     /locus_tag="EAE_RS03365"
                     /old_locus_tag="EAE_03285"
                     /db_xref="GeneID:45319058"
     CDS             688057..688989
                     /locus_tag="EAE_RS03365"
                     /old_locus_tag="EAE_03285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_015703472.1"
                     /db_xref="GeneID:45319058"
                     /translation="MYARESRSTRPRKALFAVLSCLTLSYSASGLAKPDMQPLGPNIA
                     DKGSAFYHFSVNQFDSADGARHYRVWKAIPNKAAPPTGYPVLYMLDGNAVMDRLSDEL
                     LKQLAAQSPPVIVAVGYQTNLPFDLNGRAYDYTPAVRKNNETYVGRKSGGSEDFRQLL
                     ETRIAAKAEQGLKINPQRRGLWGHSYGGLFALDSWLSSSFFHSYYSASPSLGRDNFAL
                     LNRITAVEPASYCAKSLAIMEGSATPGDNRATHAAEVLTKVHAALATLKEKEVNAAFW
                     DFPGLGHGPMFNASFHSALLDMSREKASNQHSCP"
     gene            complement(689044..691218)
                     /gene="iroN"
                     /locus_tag="EAE_RS03370"
                     /old_locus_tag="EAE_03290"
                     /db_xref="GeneID:45319059"
     CDS             complement(689044..691218)
                     /gene="iroN"
                     /locus_tag="EAE_RS03370"
                     /old_locus_tag="EAE_03290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001222186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore salmochelin receptor IroN"
                     /protein_id="WP_015703473.1"
                     /db_xref="GeneID:45319059"
                     /translation="MRINKILWPLTALVVGLNSPLSAAKSSDDSDETLVVEATAEQVL
                     KQQPGVSIITSEDIKKDPPVNDLSDIIRKMPGVNLTGNSASGTRGNNRQIDIRGMGPE
                     NTLILIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPEQVERIEVIRGPAAARYGSGAA
                     GGVVNIITKRPTNDWHGSLSLYTNQPESSDEGATRRANFSLSGPLAGDALTMRLYGNL
                     NKTDADSWDINSSAGTKNAAGHEGVRNKDINGVVSWKVNPQQILDFEAGYSRQGNIYA
                     GDTQNSSSSAVTESLAKSGAETNRLYRQNYGITHNGVWDWGQSRFGVYYEKTNNTRMD
                     EGLSGGGEGRISADEKFTTNRLTSWRTSGELNIPLDLWVDQTLTVGAEWNRDELDDPS
                     STGLSVNDNNIGGIPGSAADRSSKNHSQISAIYFEDNIEPTPGTNIIPGLRFDYLNES
                     GGNFSPSLNLSQELGDYFKIKAGIARTFKAPNLYQSSEGYLLYSKGNGCPKDITSGGC
                     YLIGNKDLDPEISVNKEIGLEFALDDYHASVTYFRNDYQNKIVAGDDIIGQTASGAYI
                     LQWQNGGKALVDGIEASMAFPLVKDRLKWNTNATYMITSEQKDTGNPLSVIPKYTINN
                     SLDWTITQAFSASVNWTLYGRQKPRTHAESRSEDTGGLSGKELGAYSLVGTNFNYDIN
                     KNLRLNVGVSNIFDKQIYRSSEGANTYNEPGRAYYAGVTATF"
     gene            complement(691445..692002)
                     /locus_tag="EAE_RS03375"
                     /old_locus_tag="EAE_03295"
                     /db_xref="GeneID:45319060"
     CDS             complement(691445..692002)
                     /locus_tag="EAE_RS03375"
                     /old_locus_tag="EAE_03295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_460887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DJ-1/PfpI family protein"
                     /protein_id="WP_015369700.1"
                     /db_xref="GeneID:45319060"
                     /translation="MKSVAVLLAPGFEEGEAIVTIDILRRLNIAVQTIACGESREVVS
                     YHAIPMIADSTLKASFDQTFDAVVLPGGPEGSVNLAKSAEVIAFVRRHDEAGKYICPI
                     CSAAARVLGGNGLLKGRRYVCSGDLWQQVSDGVYVDADVVEDGNLLSGRGLGKVFDFA
                     FTLAARLQGDEAPAREQAEHIYYPW"
     gene            complement(692025..693215)
                     /locus_tag="EAE_RS03380"
                     /old_locus_tag="EAE_03300"
                     /db_xref="GeneID:45319061"
     CDS             complement(692025..693215)
                     /locus_tag="EAE_RS03380"
                     /old_locus_tag="EAE_03300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002443603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_015703474.1"
                     /db_xref="GeneID:45319061"
                     /translation="MTKSVITEALRPIELHQVDRLALSQKLEDALDRVTRKLDKNIVA
                     FGDKFPGEACENGIWPRTDNVEWTTSFWPGQLWLAWEMTGKAHYREAAERYLSSFARR
                     IEQRIDTATHDLGFLYSLSCISAWRLTGNEAARQSALLAAERLMERFNPTAKIIQAWG
                     DLNDPEQQGRMIIDCNMNLPLLYWASEQTGDPRYAQAATAHAGQAANYIVREDASTYH
                     TYYMDVQTGEPRFGNTHQGYSDTSCWSRGQAWGIYGFLLSYQHTGDKQMVELSRSLAH
                     YFLNRLPEDDVCHWDLALLGTDAVRDSSAAAIAACGLLELVKALPTLDANRAYYEEMA
                     LRIALSLTDNYLAHDDTPTEGLLQHSVYHMGSGKGVDQCCSWGDYFYLELLARLRQIW
                     YPYW"
     gene            complement(693229..694509)
                     /locus_tag="EAE_RS03385"
                     /old_locus_tag="EAE_03305"
                     /db_xref="GeneID:45319062"
     CDS             complement(693229..694509)
                     /locus_tag="EAE_RS03385"
                     /old_locus_tag="EAE_03305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014831344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligosaccharide MFS transporter"
                     /protein_id="WP_015369698.1"
                     /db_xref="GeneID:45319062"
                     /translation="MSTSSSVRAAQYKMSTFIFLYFFTWSSSFGLYALWLSQKVGLDS
                     ITIGSVFAINGVFAVVLKPVYGYIMDKIGMSKWLLYFVCAISALMAPFFALVYQPLLQ
                     SHATLGIIIGALYLSLGWYAGVAASESYADRFSRLYGLEFGRIRMWGSLGWAMAASVS
                     GLLFNFTPLANFLLSSGTSVLMLLVLISLKIGDEQLRNNNVISANKIVFADVLMLLKN
                     RKFWMFSLYVAGVAWMMFIAEQQFPRYFVSFFATKEQGNAWYGYLSTVQSGMEFVMMM
                     FIPWLVNHYGAKRGLLFCGCVVGARLIASGLTNDPIVISIIKPFYGVEIALLLISVFK
                     YIAEHFHRRVNATMYLLGYQAMIYVGSIVVAPPAGYLYDKIGFEHTYLLMGCCALTFT
                     LISAFTLSRCQSKRDASRPFTPALDTASVEPAKH"
     gene            complement(694506..696344)
                     /locus_tag="EAE_RS03390"
                     /old_locus_tag="EAE_03310"
                     /db_xref="GeneID:45319063"
     CDS             complement(694506..696344)
                     /locus_tag="EAE_RS03390"
                     /old_locus_tag="EAE_03310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014831343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2264 domain-containing protein"
                     /protein_id="WP_015703475.1"
                     /db_xref="GeneID:45319063"
                     /translation="MQPENIHLDNPLTSREEVLRLVNEMLNAVAPYFKNDASRIDLAN
                     FTAHYGQQVASMETFSRLLWGVTPLLAGGSEPQHFSFYLQAIKNGTNPQHADYWGEVA
                     PYDQRIVEMAAYGLLLALAGETVLAHFTAAEKENLWRWLKQCETQDIPDNNWHFFPIL
                     VQVGFHYCGMPTNPQAREDHFAAMERYYLGDGWYSDGPGRPRDYYISMGFHFYGLIYA
                     KLMADVDPQRCAELRQRAAHFSSDFIHFFADDGAAIPFGRSLTYRFAEAAFWSAAAFA
                     GLEVFSPGVMKGIVLRHLRWWLKQPMFDRDGVLSVGYSYPNLAMAEDYNAPGSPYWGL
                     KTMLVLALGEGDAFWQAAELPLPPLPAQHTIAHADQVLVHQADHLWMLTSGQLELNNF
                     VNTEAKYCKFAYSTRFGFTIERGRYGLNHAAPDSMLLLAEKDNYWRGRRECQQVVTAD
                     GVIYSRWLPWRDVVIDSWLLALGDWQLRVHRITTHRALDCAEGGFSLANRPLPQAQER
                     DGASCLRNARDISAIFCLHPHTRRGETVLTPPNSNLLFAERAAVPVLRGELDAGTHCL
                     VSAVWAGNAADFEPQHCPQAFISDDAVRFVTARQETTLVLAPEASL"
     gene            696574..697428
                     /locus_tag="EAE_RS03395"
                     /old_locus_tag="EAE_03315"
                     /db_xref="GeneID:45319064"
     CDS             696574..697428
                     /locus_tag="EAE_RS03395"
                     /old_locus_tag="EAE_03315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_015369696.1"
                     /db_xref="GeneID:45319064"
                     /translation="MGEAQLLERITLDRQAISFNRMYTTSVLYYHWHQCVELLYISSG
                     YGIVVVDNQHYTARPGRLFIFPPFRLHKVQVDHSDKNPYHRTTMHIEQSVVESALSAF
                     PRHQAQFAALAASNLPAQIYDLSEHAAFIERILEQFQRLEDNEQTTACEVAFLMMQLM
                     TFLPEQPQRYPPRQQTVASRIMNWIEAHYASKFSLDQLACDLGLSRSYTSRVFRQQTG
                     GNIHEYLLTRRIKRSCDLLRNSDESIDAIALAVGFGEVTYFITCFKKMMRQTPLQYRK
                     ASQRRSAL"
     gene            complement(697430..698839)
                     /locus_tag="EAE_RS03400"
                     /old_locus_tag="EAE_03320"
                     /db_xref="GeneID:45319065"
     CDS             complement(697430..698839)
                     /locus_tag="EAE_RS03400"
                     /old_locus_tag="EAE_03320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine permease"
                     /protein_id="WP_015703476.1"
                     /db_xref="GeneID:45319065"
                     /translation="MPTKESSPPLIEKHTIGYIPPEDRHGKTRDLFTLWFGGNIAPLP
                     IVTGALGVQIFHLNLLWGIVAILVGHLVGGALMALHSAQGPQMGIPQMIQSRAQFGSF
                     GSLLVVAIAGVMYVGFFASNIVLAGQSLHGIAPAVPLPVGIVIGAVGSCVIGIIGYRC
                     IHILNRIGTWVLGIGIMVGFGYIFTHLHTADFLTRGGFSFSGWLATVSLAALWQIAFA
                     PYVSDYSRYLPADVPVAATFWTTYLGSTLGSSLSFIFGAVAVLATPVGLETMDAVKLA
                     TGAIGPLMLVLFLLSVISHNALNLYGAVMSVITLVQTFLWRWIPGSRSRALLSVIVLI
                     CCVAAAIFASADFISHFIDLVLALLVVLVPWTAINLIDFYAIHKGNYDINSIFQVDGG
                     IYGRYNPHALLAYAIGILVQIPFMNTPLYVGPVSAWFNGADLSWLVGLLVTSPLYYWL
                     ASRDSAWRRRQVGLKQAMD"
     gene            complement(699184..699609)
                     /locus_tag="EAE_RS03405"
                     /old_locus_tag="EAE_03325"
                     /db_xref="GeneID:45319066"
     CDS             complement(699184..699609)
                     /locus_tag="EAE_RS03405"
                     /old_locus_tag="EAE_03325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014168984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF937 domain-containing protein"
                     /protein_id="WP_071647658.1"
                     /db_xref="GeneID:45319066"
                     /translation="MNSNVLMETVMGLLDQIGGVLGGQAGKAEQLQAIMTWIEQQGGI
                     QGILEKFRNGGLGEIVESWLSQQSNMSVNSDQITSVFGSPALQDLGAKLGVDSQTASS
                     LIAEYLPKIVDGLSPQGEAPAQGDLVSAGLNLLKGKLFS"
     gene            complement(699624..700073)
                     /gene="lysM"
                     /locus_tag="EAE_RS03410"
                     /old_locus_tag="EAE_03330"
                     /db_xref="GeneID:45319067"
     CDS             complement(699624..700073)
                     /gene="lysM"
                     /locus_tag="EAE_RS03410"
                     /old_locus_tag="EAE_03330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005226969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_015369692.1"
                     /db_xref="GeneID:45319067"
                     /translation="MGLLSFVKEAGEKIWDAVSGSSKEDQADKLKKHIDSLNLPGAEK
                     VNIAVADDGTATVTGDVGSQEDKEKILVAVGNVTGIGQVNDSVTVTQSGAESRYYTVK
                     SGDTLSAISKAMYGSANDYQRIFEANKPMLKHPDKIYPGQVLIIPAK"
     gene            complement(700128..701024)
                     /locus_tag="EAE_RS03415"
                     /old_locus_tag="EAE_03335"
                     /db_xref="GeneID:45319068"
     CDS             complement(700128..701024)
                     /locus_tag="EAE_RS03415"
                     /old_locus_tag="EAE_03335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703477.1"
                     /db_xref="GeneID:45319068"
                     /translation="MDKLRGMETFVAVVECGSFTGAAARLEMSAVMVGKYIALLEGQL
                     GTRLLERNTRRQSLTDAGRVYFDEARRVLEQVANAERSVERLRLAPAGTLRVSAPVSF
                     GASIIAPLTASFLQAWPEVRVELDLTNRMVDLVDEGIDLAIRIGDIQRTDLVAKYLAP
                     YRMAICAAPDYLVRHGTPQTPADLAGHQCLSHTVWTARNEWRLPGAAEEVRWKRDAVL
                     RCNDGYALRMAAVAGAGLLLQPEVLLAEDLANGRLVRILQNYTPEPRPIHLLWRQDLR
                     PLPKLTRFVEHLLKEVNGIYKL"
     gene            701123..701725
                     /locus_tag="EAE_RS03420"
                     /old_locus_tag="EAE_03340"
                     /db_xref="GeneID:45319069"
     CDS             701123..701725
                     /locus_tag="EAE_RS03420"
                     /old_locus_tag="EAE_03340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_005228839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="WP_015703478.1"
                     /db_xref="GeneID:45319069"
                     /translation="MKIIVIGASGTVGRVVAEELSRQHEVIRVGRTHGDEQVDITSQH
                     SVQALFEKIGPVDAIVSAAGSLYFGPLSTMTDRDFDQGLQDKLLGQIRLALTGQHYLN
                     DGGSITLISGIVADEPIAQGVNATTVNVGLAGFVRAAACELPRGIRINLISPTVLSES
                     VEAYDGFFPGFSSVPAAAVAQAYRRSVEGIQSGRVYKVGY"
     gene            complement(702022..702276)
                     /locus_tag="EAE_RS03425"
                     /db_xref="GeneID:45319070"
     CDS             complement(702022..702276)
                     /locus_tag="EAE_RS03425"
                     /inference="COORDINATES: ab initio
                     prediction:GeneMarkS-2+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS-2+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_126337396.1"
                     /db_xref="GeneID:45319070"
                     /translation="MVLSHYFGLHQRKSDISMRSTANLLITTFHSPFLQLRIICEMTK
                     NIGAGYKKNALPGAGKTPHLCVALFLEFYALCLIFYWQSS"
     gene            702275..703678
                     /locus_tag="EAE_RS03430"
                     /old_locus_tag="EAE_03345"
                     /db_xref="GeneID:45319071"
     CDS             702275..703678
                     /locus_tag="EAE_RS03430"
                     /old_locus_tag="EAE_03345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004867649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoin permease"
                     /protein_id="WP_015703479.1"
                     /db_xref="GeneID:45319071"
                     /translation="MTKHQSVNVENLESNTIRPIPLNMRHGKPGDLFTIWFGSNIMLL
                     TVITGAMSVTIFHLSFLWSVIALFIGSLVGGLFMALHSAQGPKLGVPQMVQTKGQFGS
                     YGSVLVVSIVVLMYIGFTASSLVLGGQSMHAIYQPMNSDIGIIVVGALSLFATIFGYK
                     IIHSYARIMSWISGIVLAATFVWIVFIHGLPGDFADRGGFNIVGFLGAVSIAALWQLA
                     YAPYVSDYSRYMPYSTNDKSVFYASYFGCILGSYLPMVLGVLVAICIGNDDIIQGIMD
                     LTGSMGAIVIIVLALGIAATNSMMLYCGVLCTLTLGQTFIDGWSPMARARIITAILTM
                     LLEIFLAIYGQENFLLIYTNFITVLLYVLVPWTAINLVDYYLVAHGEYHVESFFKRDG
                     GIYGYFNATAISCYILGILVEVPFMSTSIYTGPIALTFGGADLSWIIGLLVVSPVYYY
                     FSKAKSVKSMAFAKEKV"
     gene            complement(703720..704868)
                     /gene="argE"
                     /locus_tag="EAE_RS03435"
                     /old_locus_tag="EAE_03350"
                     /db_xref="GeneID:45319072"
     CDS             complement(703720..704868)
                     /gene="argE"
                     /locus_tag="EAE_RS03435"
                     /old_locus_tag="EAE_03350"
                     /EC_number="3.5.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="WP_015703480.1"
                     /db_xref="GeneID:45319072"
                     /translation="MNSRLQDILARLLAFDTTSRESNLAMIDDIADYLHGFAIETQLF
                     YDAEGRKANLYARLGPAGPGGVMLSGHTDVVPVDGQPWTVPPFALTQRDGRCYGRGSA
                     DMKGFLACVLAAIPDFLAQPLRMPLHLAFSYDEEVGCLGVRSLVAHLQASAEKPAMCI
                     IGEPTEMRPVYGHKGKLAMRCDVHGHACHSAYAPDGVNAIAWAAKLIGRLDELGEQLA
                     LRQDTRFDPPFSTLQVGVIKGGAALNIVPQHCQFDFEIRHLPDVSLDDTLASLQAYAE
                     GELLPKMRATAAGSAITFQPLSQYPGLLSDPQSAFAGWLAQWAECEDFSTVAFGTEGG
                     LFDEAGVATLVCGPGSMEQGHKADEFVSEAQLEKCAQMLKNLCRWMSA"
     gene            complement(704861..705535)
                     /locus_tag="EAE_RS03440"
                     /old_locus_tag="EAE_03355"
                     /db_xref="GeneID:45319073"
     CDS             complement(704861..705535)
                     /locus_tag="EAE_RS03440"
                     /old_locus_tag="EAE_03355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013024743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1028 domain-containing protein"
                     /protein_id="WP_015703481.1"
                     /db_xref="GeneID:45319073"
                     /translation="MTFSIAARCPESGQFGIAISSSSIAVGARCPWLQAGVGAVSSQN
                     ITLPALGQLTLAQMEQGLTAEKAMRRALAEDDFSRYRQIIAIDASGQTAWFSGDKTLG
                     TWHVVQGDNCIAGGNMLASEAVIAAMAATFSQTEGELATRLVAALQAGVAEGGEAGPV
                     HSAAVKVVDDYSWPLVDLRVDWSETDPIGELAALWQAYEPQMQAYVTRALDPREAPSY
                     GVPGDE"
     gene            complement(705545..705967)
                     /locus_tag="EAE_RS03445"
                     /old_locus_tag="EAE_03360"
                     /db_xref="GeneID:45319074"
     CDS             complement(705545..705967)
                     /locus_tag="EAE_RS03445"
                     /old_locus_tag="EAE_03360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_254079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA family protein"
                     /protein_id="WP_015369686.1"
                     /db_xref="GeneID:45319074"
                     /translation="MPTHTRIRMFNTKETYPNQTLDNDLCQAVRAGNTVYVRGQVGTD
                     FAGNLVGLGDPRAQAEQAMKNVKQLLEEAGSDLSHIVKTTTYIIDPRYREPVYQEVGK
                     WLKGVFPISTGLVISALAQPQWLMEIDVIAVIPDDAAK"
     gene            complement(705996..707261)
                     /locus_tag="EAE_RS03450"
                     /old_locus_tag="EAE_03365"
                     /db_xref="GeneID:45319075"
     CDS             complement(705996..707261)
                     /locus_tag="EAE_RS03450"
                     /old_locus_tag="EAE_03365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007969212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-binding domain-containing protein"
                     /protein_id="WP_015703482.1"
                     /db_xref="GeneID:45319075"
                     /translation="MTVEKIQIETLVVGGGQAGIAMSEHLSKQGISHLVVEKNRIAEA
                     WRTGRWDSLVANGPAWHDRFPGMEFKGGDPDAFIAKDDVAQYFVDYVREFNLPVRTGV
                     EVKSAVRNHGRPGFTIETTDGVIEALNIVAATGPFQKPVIPPIAPRDSAIHQIHSAKY
                     YNPQQLPEGAVLVVGAGSSGVQIADELQRAGRKVYLSVGAHDRPPRAYRNRDFCWWLG
                     VLGLWDAPASEPGKEHVTIAVSGAHGGHTVDFRELAHRGITLVGLTESFAGGTVSFKN
                     NLVENIRLGDENYLALLDAADAYIAANGLDLPEEPAARQFLADPDCMTSPILSLDLAQ
                     AGINTIIWATGYAVDYSWLNVNAFNEQGRPQHQRGVSSEPGVYFLGLPWLSRRGSTFI
                     WGVWHDAKHIADHIATRRKYSQYKDASQR"
     gene            complement(707573..708502)
                     /locus_tag="EAE_RS03455"
                     /old_locus_tag="EAE_03375"
                     /db_xref="GeneID:45319076"
     CDS             complement(707573..708502)
                     /locus_tag="EAE_RS03455"
                     /old_locus_tag="EAE_03375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_015703484.1"
                     /db_xref="GeneID:45319076"
                     /translation="MPHFTLKQLKYFVAVVEAESIAEASRQLHIAQPSISIAVKTLED
                     MFEQQFFIRHHAQGVSMTPSGQRFYEKAKELLRLSYQFEQNSKADNELVSGIISIGCF
                     ETAAPLYMPSLMAGFKKIYPEITIKIYDGEQHEIAHGLHRGRFDLAFLYDLELDTSIY
                     TESLNAPQKPYALLPADHPLAQRHAVRLSELSNLPMILLDVVPSKNYFISIFKDKGYN
                     PQVAYSSPSIEMVRCMVGQGLGFSVLVTRPVNDMTYDGQQVRCVEIQDEMANSALVMA
                     HLRSSEPTKPTKLFMEYCRNAVLSPPQQEVKVA"
     gene            709134..710642
                     /locus_tag="EAE_RS03460"
                     /old_locus_tag="EAE_03385"
                     /db_xref="GeneID:45319077"
     CDS             709134..710642
                     /locus_tag="EAE_RS03460"
                     /old_locus_tag="EAE_03385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015369681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_015369681.1"
                     /db_xref="GeneID:45319077"
                     /translation="MSDRNFWQRKLQEQRFISHAIIDGQPYVAKSRKTCPAINPASNT
                     LLAEVTSLQTEDIDIAVASARRAFTSGVWSGLAPQERKRALLRLSALILQHREELALL
                     ESVSMGKPVNDALNIDVPGAAHILSWYAESVDKLYDEVAPARPGALATITRQPIGVVA
                     AIVPWNFPLDLASWKLGPALAAGNSVILKPSENSPFSALRLGELALEAGIPPGVLNVV
                     TGLGTETGSALGLHHDIDVIAFTGSTAVGKAFMAYSAQSNLKQVWLECGGKSANIIFA
                     DCQDLDLAAEKAAFGICFNQGEVCSANSRLLVERPIYAAFIAKLQEKMQAWAPAHPLE
                     PQSRMGAMVSAAHAEKVMAAIRRAQDEGATLLTGGRTVEIDGVANYVQPTLLTDVNEE
                     MALWKEEIFGPVLAVCAFDSEQEAVHLANNHIYALAASLWTDNLHRAHRVAAQLTAGT
                     ISVNTVDALDVTVPFGGNKQSGFGRDLSLHAFDKFTSLKTTWFQFQQTGETK"
     gene            710639..712021
                     /locus_tag="EAE_RS03465"
                     /old_locus_tag="EAE_03390"
                     /db_xref="GeneID:45319078"
     CDS             710639..712021
                     /locus_tag="EAE_RS03465"
                     /old_locus_tag="EAE_03390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015479637.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_015369680.1"
                     /db_xref="GeneID:45319078"
                     /translation="MTNPSNQNRSTSDYQHSDAAHHIHAFLDQKALNAEGARVMVRGE
                     GLYLWDNDGNKYLDGMSGLWCTQLGYSRQDLADAAAAQFAKLPYYNMFFHTTHPAVIE
                     LSELLFSLLPPHYSHAIYTNSGSESNEVLIRTVRRYWQILGKPEKKVMIGRWNGYHGS
                     TLAASGLGGMKFMHEMGGVIPDVAHIDEPYWFMHGGDLTPQEFGLRCARQLEEKILEL
                     GAENVAGFIAEPFQGAGGMIFPPESYWPEIQRICRQYDVLLCADEVIGGFGRTGEWFA
                     HQYFGFEPDTLSIAKGLTSGYVPMGGLVLSKRMADVLVEKGGVFPHGLTYSGHPVAAA
                     VAIANLKALRDENHVTRVRTDSGPYLQKTLREVFENHPLIGEVQGAGLVAALQFAEDK
                     ATRKRFANENELAWRCRTIGFEEGVIIRSTLGRMIMAPALIAGHSELDELVEKTKRAV
                     DRTAKEIGLL"
     gene            712200..713000
                     /locus_tag="EAE_RS03470"
                     /old_locus_tag="EAE_03395"
                     /db_xref="GeneID:45319079"
     CDS             712200..713000
                     /locus_tag="EAE_RS03470"
                     /old_locus_tag="EAE_03395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015703486.1"
                     /db_xref="GeneID:45319079"
                     /translation="MLIKYLPVCALCIGLLPGALFAQTGEVKTNAEKSADDPTKVTTK
                     VGVTWSDNYDLDDSNLAFSGSLAFDEARKLNVRINSDATEWRVGGSWLFPIGIFNFNF
                     GKNVYPDDSSQTNYSIGTFLPLSYFGFEPAGFQIFPMAGYTYNTGDHMACNKDQHSAC
                     SQSGFNGMPSPENGFESTNISGSSGYLGAFVLKPLSADLRLLGFAGGSYGSKNDDGDN
                     YKGYFAGVGVGYNLTEHNSVKFMTYVQDNNTYLDEAEKRFLFSWQYQL"
     gene            complement(713035..714447)
                     /locus_tag="EAE_RS03475"
                     /old_locus_tag="EAE_03400"
                     /db_xref="GeneID:45319080"
     CDS             complement(713035..714447)
                     /locus_tag="EAE_RS03475"
                     /old_locus_tag="EAE_03400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoin permease"
                     /protein_id="WP_015703487.1"
                     /db_xref="GeneID:45319080"
                     /translation="MSRSHVIENKTVDYVPANERHGQARSLFTLWFCTNIAPLAVVTG
                     AISTQTFHLNILSAISAIIAGHMFGGLFLALTSAQGPRVGIPQMVQSRAQFGRYGSLL
                     VVAFTTMIYLGFFISNVTLSGKVINNVIPTIPLTSATVIGAIAATLIGIIGYRFIHRI
                     NKIGAWVMGSALLVGLVMMLTQPLPAGFWQQGSFSLNGWFATFCICAVWQMSFSPYTS
                     DYSRYLPENIGVFKPFICTWAGACCGTILAFLVGVVAINVVGGEGDAMAAVRQATGVL
                     GPVLMVLFLLNIICHNSMNLYGSVLSLITAMQTFRPQWRPDARVRMLFSAVVLVGGVL
                     VSVAAAANFVAFFLNLIWALIGVLIPWCVINLLDFYVINKQHYDIDAIFSADGGRYGL
                     VNRRALLVYFGGVLVQVPFVENAFYTGPWAHLIPGADISWMISLVVTSLAYMRFHQRG
                     AVGHYGREKARITGLMDNGS"
     gene            complement(714650..716116)
                     /locus_tag="EAE_RS03480"
                     /old_locus_tag="EAE_03405"
                     /db_xref="GeneID:45319081"
     CDS             complement(714650..716116)
                     /locus_tag="EAE_RS03480"
                     /old_locus_tag="EAE_03405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_015703488.1"
                     /db_xref="GeneID:45319081"
                     /translation="MESFDLYIDGVFERGAARFSSLNPATAQPWAEIAEAREEEVDRA
                     VAAAKRAFYDPAWRGLTASARGKLLMKLADLVEQNADELARLETLDSGKIIRETRSQI
                     AYVAEYYRYYAGLADKLEGRTLAIDKADTETWTRREAVGVVAAIIPWNSQLFLSAVKI
                     GPALAAGCTIVVKAAESAPTPLLAFARLIADAGFPAGVCNVITGFAGTCGTRLTTHPD
                     VDHIAFTGGPETARHIVRNSAENLSKTTLELGGKSPFIVFEDADLDSAANAQVAAIFA
                     ASGQSCVAGSRLLVAESVKEQLLEKLVERVKRIVIGSPDDAATQFGPLCTERQKRLIE
                     QVVSRSLEQGARLVSGHYAIDSPGYYYPPTILDCSATPQAESVVRELFGPVLSLVTFR
                     DEAEAIRLANATDYGLAAGVFTRNLARAHRVTRDLRCGIVWINTYRMVSPLAPFGGYG
                     LSGHGREGGMEAALEFTTTKTVWLRTSDEPIDDPFIMR"
     gene            complement(716128..717165)
                     /locus_tag="EAE_RS03485"
                     /old_locus_tag="EAE_03410"
                     /db_xref="GeneID:45319082"
     CDS             complement(716128..717165)
                     /locus_tag="EAE_RS03485"
                     /old_locus_tag="EAE_03410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006414450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_015703489.1"
                     /db_xref="GeneID:45319082"
                     /translation="MKLSLFIHMERISPDEPQDKLYNEMMTLCEMADEAGMHAIWTGE
                     HHGMNFTIAPNPFINLADLANRTKRVRLGTGTIIAPFNHPLRLAGEAAMTDIITGGRL
                     ELGIARGAYNYEYQRLMPGLDAWEAGQRMRELVPAVKKLWEGDYTHQGEYWQFPASTS
                     SPQPKQQPHPPIWIAARDPNSHEFAVSNGCNVQVTPLHQGEEEIVRLAECFHETRQRL
                     APEKPLKIMLLQHGFVAEDENDAQQAAEELNRFYNYFGAWFKNERPVSQGLIQPLSDE
                     EIAANTYYSAAAMRKNLAIGTPNEIITRLKKYEALGYDEFALWIDSGMPFERKKASLT
                     RFIQQVMPEFR"
     gene            complement(717184..718110)
                     /locus_tag="EAE_RS03490"
                     /old_locus_tag="EAE_03415"
                     /db_xref="GeneID:45319083"
     CDS             complement(717184..718110)
                     /locus_tag="EAE_RS03490"
                     /old_locus_tag="EAE_03415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin reductase family protein"
                     /protein_id="WP_015703490.1"
                     /db_xref="GeneID:45319083"
                     /translation="MQIDKRRQLRDAFGAFMTGVTVVTSRDKNGEPIGFTANSFSSVS
                     LDPALLLVSIDKRSANFSNFTECDYFAVNILAEQQKETSNIFAQKVEDRFALIDWRAS
                     ENGTPLIDNSSAWFDCALHQVIDAGDHAILLGRVEGFDSVGTAGLGYYRGAYFTPYHN
                     AEVLMNRLSVEVSALIEFNGQAVMMPHGDGYRLPTRSVAKGSVDDTLKALMAELGINA
                     SPGFVYSVYEDRQNNKQHIVLLCALPTEPESERPALRQAQWYDLEKLSALPIGDSALK
                     SLMNRFVRESAVGNYSIYYGDELSGSIKQFAS"
     gene            complement(718097..718942)
                     /locus_tag="EAE_RS03495"
                     /old_locus_tag="EAE_03420"
                     /db_xref="GeneID:45319084"
     CDS             complement(718097..718942)
                     /locus_tag="EAE_RS03495"
                     /old_locus_tag="EAE_03420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004963030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_015703491.1"
                     /db_xref="GeneID:45319084"
                     /translation="MMRKTQLLSERQMRVSYLEAGAGEPLVLIHGVGMNAASWYPQIE
                     ALSRYFRVIAVDMPGHGDSDAFQQPVILTDYVAWLNDFLRTQPERRFAVAGHSMGALI
                     ASGLAIDYPQRVSHAVVMSGVYRRNEQARRAVLQRARELAAGEAQLDSPLARWFSNDA
                     KEAILREQVGGWLAEVNLQGYAAAYQAFAGGDRVYADRWQEIRCPVLVLTGELDANSS
                     PQMAREMAAAAPLGQAIIIDGARHMVSLTDAPRVNHEMLSFLQCGSARQSNNANTAGL
                     THANR"
     gene            complement(718914..719516)
                     /locus_tag="EAE_RS03500"
                     /old_locus_tag="EAE_03425"
                     /db_xref="GeneID:45319085"
     CDS             complement(718914..719516)
                     /locus_tag="EAE_RS03500"
                     /old_locus_tag="EAE_03425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid synthesis family protein"
                     /protein_id="WP_015703492.1"
                     /db_xref="GeneID:45319085"
                     /translation="MHPAIRKTLVTTETLYVDGGKAAEKPLVMIAAAAVIRNPWAGLG
                     YVDDLAPQIREFAPILGELLTGLILKEAGSGEKVEAFGKSAIVGLDGELEHASALIHT
                     LHFGNHYRSAVQSKSYLAFNNTRGPANSPVLIPMMNKNDEGSREHYLTMQFNICDAPR
                     YDEIVIALGAALGGRPHHRIGNRYSDLKELGHDAQNPAAV"
     gene            720009..720686
                     /locus_tag="EAE_RS03505"
                     /old_locus_tag="EAE_03430"
                     /db_xref="GeneID:45319086"
     CDS             720009..720686
                     /locus_tag="EAE_RS03505"
                     /old_locus_tag="EAE_03430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_015703493.1"
                     /db_xref="GeneID:45319086"
                     /translation="MVDNHSLKIDAVPVTLRELALTKVRQAIIAGYFKAGDRLVERQL
                     TEQLGVSRSVVREVIRYLEAEGLIETLPKKGPIVAVLNWESAEQIYKIRMLLEQEAAS
                     DCARLANDDDKHQLYQQLQLIAQASREQDDIKRVEASQAFYETLFRVAKHTIAWEIVQ
                     RLNSRISRLRALTLASPERQVAGFERMSRIYDAIENNDPQQARQAVLEHLTEAAQLAK
                     QILSSQE"
     gene            720689..720979
                     /locus_tag="EAE_RS03510"
                     /old_locus_tag="EAE_03435"
                     /db_xref="GeneID:45319087"
     CDS             720689..720979
                     /locus_tag="EAE_RS03510"
                     /old_locus_tag="EAE_03435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015703494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1330 domain-containing protein"
                     /protein_id="WP_015703494.1"
                     /db_xref="GeneID:45319087"
                     /translation="MAAYWIAHVNIHDPEQYQHYMDLAPAAFKRYHARFVARGGRAQT
                     LEGQSFAKHVLIEFDDMESALACYHSEEYQQARAARADVADAMITIVEGLPA"
     gene            721228..721416
                     /locus_tag="EAE_RS03515"
                     /old_locus_tag="EAE_03440"
                     /db_xref="GeneID:45319088"
     CDS             721228..721416
                     /locus_tag="EAE_RS03515"
                     /old_locus_tag="EAE_03440"
                     /inference="COORDINATES: similar to AA