GenomeNet

Database: RefSeq
Entry: NC_016457
LinkDB: NC_016457
Original site: NC_016457 
LOCUS       NC_016457           10101509 bp    DNA     linear   CON 29-NOV-2019
DEFINITION  Thermothielavioides terrestris NRRL 8126 chromosome 1, complete
            sequence.
ACCESSION   NC_016457
VERSION     NC_016457.1
DBLINK      BioProject: PRJNA79337
            BioSample: SAMN02744067
            Assembly: GCF_000226115.1
KEYWORDS    RefSeq.
SOURCE      Thermothielavioides terrestris NRRL 8126
  ORGANISM  Thermothielavioides terrestris NRRL 8126
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothielavioides; Thermothielavioides terrestris.
REFERENCE   1  (bases 1 to 10101509)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 10101509)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.-C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.H.,
            Baker,S.E., Magnuson,J., LaBoissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 10101509)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 10101509)
  AUTHORS   Otillar,R., Salamov,A., Grimwood,J., Reid,I., Ishmael,N., John,T.,
            Darmond,C., Moisan,M.-C., Henrissat,B., Coutinho,P.M., Lombard,V.,
            Natvig,D., Lindquist,E., Schmutz,J., Lucas,S., Harris,P.,
            Powlowski,J., Bellemare,A., Taylor,D., Butler,G., de Vries,R.P.,
            Allijn,I.E., van den Brink,J., Ushinsky,S., Storms,R., Powell,A.J.,
            Paulsen,I.T., Elbourne,L.D.H., Baker,S.E., Magnuson,J.,
            LaBoissiere,S., Clutterbuck,A.J., Martinez,D., Wogulis,M., de
            Leon,A.L., Rey,M.W., Tsang,A., Berka,R.M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003009.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043154
            The DNA was provided by Paul Harris (paha@novozymes.com)
            The strain is available from the Northern Regional Reaearch
            Labortories (USDA) in Peoria, IL under NRRL 8126 and from the
            American Type Culture Collection under ATCC 38088
            Contacts: Randy Berka (RAMB@novozymes.com)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Thielavia terrestris NRRL 8126
            GOLD Stamp ID         :: Gi01746
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Thielavia terrestris V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 10.15x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..10101509
                     /organism="Thermothielavioides terrestris NRRL 8126"
                     /mol_type="genomic DNA"
                     /strain="NRRL 8126"
                     /db_xref="taxon:578455"
                     /chromosome="1"
     gene            complement(783..2319)
                     /locus_tag="THITE_2106044"
                     /db_xref="GeneID:11523549"
     mRNA            complement(join(783..1131,1204..1212,1329..2319))
                     /locus_tag="THITE_2106044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648464.1"
                     /db_xref="GeneID:11523549"
     CDS             complement(1366..2067)
                     /locus_tag="THITE_2106044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648512.1"
                     /db_xref="GeneID:11523549"
                     /db_xref="JGIDB:Thite2_2106044"
                     /translation="MSRFVNDIEQRFGESDNQSSGYDNSQSDRSDNDYQQGDGYGRNQ
                     QGRNYGSNDDNNNYGGNRKDSSYGSNRDDSYGSNRDNNYGSNRDDSYSSSQGNKYSSN
                     RDNNYGSNRDDNYGGGRNDSYGSNQDDNYGSNRDDNYGSNRDDNYGSSQANSYCSNQD
                     DSYSSNWNNSYGRNDDDSSYNSSKNNDQQQSGRGFFRSNSSSGFGSTNEGNSSSSNNE
                     DQNDSGNSGSSSFFS"
     gene            complement(2953..5711)
                     /locus_tag="THITE_2106054"
                     /db_xref="GeneID:11523909"
     mRNA            complement(join(2953..4926,5008..5189,5251..5310,
                     5382..5413,5482..5511,5569..5711))
                     /locus_tag="THITE_2106054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648465.1"
                     /db_xref="GeneID:11523909"
     CDS             complement(join(3136..4926,5008..5037))
                     /locus_tag="THITE_2106054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648513.1"
                     /db_xref="GeneID:11523909"
                     /db_xref="JGIDB:Thite2_2106054"
                     /translation="MASPGQEQTVSAAPPAPIFRVARATPETAPLEDTAPSQIVVTSE
                     TGTTGSRKRSRAHFQASTPLTYSNLDPISTGLITLEDAESYFSTFFSGCDRYVPVFCP
                     LSDSFESVRSRSSVLLSAICSVGCRILTGSESHHSRALNLHTQRIINAAVAAAPIPGM
                     SWDCLETVQALLVRACYAPERSLLIALATRMALEIGLPEAYGDLCTRCLANPPTRSQG
                     GSKCSDGSATAPGEVDENDATLMRKTRTWLHLVMMGQILHVDAGGPPGFRLRGAAQRC
                     RVLINGPSSTGMDLYLISQVELNAIRARIYSTFSQYAQQRPREHDDDEIMEMLADARI
                     DINVWFEDWTRIYEKHQTQMPWLSPNLAVQRCWADSMAMCAALKATGIEDVSAMSSAG
                     KEILRMAKQALRQHLDIILEEPRLYLRDIRYAMDFVWAKNAFCYLLLLKLAVLLPEDG
                     LHSSSVFNDDLIEKGRMLVDELSKSEGGLGGSARNNTASAYLHLIRVSIDKFSKAVRS
                     WRQNNASHGLLGEPNALNDGEFSCPGPERANEPAKEGQHELESFVPEQFVFEWDFPGL
                     TWFSSLAHETSWLDNMLGGVFDGSETFDMWGYTSQDYYAS"
     gene            complement(12248..15399)
                     /locus_tag="THITE_2106057"
                     /db_xref="GeneID:11523916"
     mRNA            complement(12248..15399)
                     /locus_tag="THITE_2106057"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003648466.1"
                     /db_xref="GeneID:11523916"
     CDS             complement(12482..15049)
                     /locus_tag="THITE_2106057"
                     /note="CAZy_ID 269681"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003648514.1"
                     /db_xref="GeneID:11523916"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Thite2_2106057"
                     /translation="MPPQRERIPTGWWPSPQQHENSPSLRLSSSQPPPPFVFTFETVR
                     HNVFRTTFSSETHPVPPYPSVPRMETQLDGIQPVVTSTEKSKSIKIGYITASVHFAGE
                     TPLVSISIEGQPFPILQDLPNRSYVADGEGVSHYTRYNRKTLHVGLGEKAAPMNLSGR
                     RFELSATDSFGYDVYRTDPLYKNIPLLINATPDGCVATFSTSQGRGQYSIGAEMDGMH
                     GFFKVYRQDYGGLEEYIIVGKTLKEVVRTYADLAGYPLLVPRWAFGYISGGMKYSMLD
                     DPPAHEAMMQLARKLKELDIPCSAHQMSSGYTVSATPPRTRNVFTWNRHRFPDPEGWI
                     HEFHKQGIRLIANIKPYVIGSHPEYEKLRAAGALFTDPHTGKPAVTKLWSAGGGESAD
                     GGHIDFTSKAGFDWWYNGVKELARQGIDCMWNDNNEYTIPDDDWKCALDLPLLQIPPG
                     AEKRPQVGVWGRNVHTELHGKASHDALVDVNPDVRPFVLTRSATAGTMRYAASSWSGD
                     NVTSWEGMKGANALSLNAGMSLLQCYGHDIGGFEGEQPSPELLLRWVQLGIHSPRFAI
                     NCFKTASGDNSVGDVIEPWMYPAITHLVRKAIKRRYALIPYIYSLMLESNRTATPPQR
                     WTGWGYESDPEVWTSVELTNGETQYWFGDALLIGGVYEPGVSKSRMYLPKAADAERDE
                     GFMNTNAPFQYLASGQWVDIDAEWHGAGIPVLAKVGAAIPVGRDVQVLSPGEQDNVAN
                     LPLDDYRGVEIFPPKGRSLNGQWHTTTWYEDDGVSAAHKNRVSSYTFAYTATEAGASG
                     EIKVKFSKDESSGFEAPWKTLVVILPSGDERTVVSDDGRTVVQLGVDAQGRNRFELQ"
     gene            16661..18514
                     /locus_tag="THITE_2106058"
                     /db_xref="GeneID:11523921"
     mRNA            join(16661..16765,16828..16943,16998..17183,17250..17527,
                     17645..17746,17906..18514)
                     /locus_tag="THITE_2106058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648467.1"
                     /db_xref="GeneID:11523921"
     CDS             join(16745..16765,16828..16943,16998..17183,17250..17527,
                     17645..17746,17906..18228)
                     /locus_tag="THITE_2106058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648515.1"
                     /db_xref="GeneID:11523921"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2106058"
                     /translation="MLGIINIFGSLLTYGLGHASSSVLRPYQIIFLFAGCLTVAWSIV
                     TLIFMPDSPMTAKFLKGDDKLIAIERLRMNQQGIVAGVWKWSHVWEALLDVKTWLWFC
                     LMFIISIPSGGISTFGPLIIQSFGFDSFTTILFNIPFGAVQIIATLGGAWLSDKIKMK
                     FPVLILLCLGPIAGCSILLAVGRGVSDRGVLLFGYYIISIYPGISPLIYSWSGQNTAG
                     DTKRKVTTGFLFVGSNAGNVIGPLLFRPDEKPRYTRGLTANLVLFILLAVLVGLGALW
                     IKFLNAKHAKARVALGKPGKIVDLSMADAKDKGNEDVLNQAADHVGERAFEDLTDLQN
                     EDFIYVY"
     gene            complement(19059..>23448)
                     /locus_tag="THITE_2093483"
                     /db_xref="GeneID:11523904"
     mRNA            complement(join(19059..19809,21125..21155,21230..21310,
                     21740..22120,22194..22404,22538..22999,23137..23275,
                     23344..>23448))
                     /locus_tag="THITE_2093483"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648468.1"
                     /db_xref="GeneID:11523904"
     CDS             complement(join(19657..19809,21125..21155,21230..21310,
                     21740..22120,22194..22404,22538..22999,23137..23275,
                     23344..23448))
                     /locus_tag="THITE_2093483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648516.1"
                     /db_xref="GeneID:11523904"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="JGIDB:Thite2_2093483"
                     /translation="MRGILGFAVALLTTAVSLVSADDTSAALQALPKCALACLADGIT
                     HSACASNLTAACMCTDEPLQEQLTLCVTANCTVKETLVAKNITDTSCGVPVRDRGAAY
                     DTATIVLFVIAACTVVLRLGFKLLVTRSLSADDYAVFLLILVVVPSVVFTHYGTTPNG
                     VGRDIWTLTPQNITDFLYYFYLMAMFYFLQVMLLKLCLLLFYLRIFPSQSVRRLLWGT
                     IVLDVVFGVVFFFLAIFQCSPISYFWTNWDGEHEGKCLNSNAIAWANAAISIALDLWM
                     LAIPLAQLKTLNLHWKKKIGVGLMFCVGTFVTVVSILRLQALVTFGKSNNATWDNFPV
                     SLWSTVEISVGIMCTCMPTLRLLLVRLFPVLGGGTKMGNGYYFSGGGPAASGKVRSSR
                     NRGLRDSSSRSKHASTHPGSSVDTVPVKPTGIMRQQTFAVQFLSEDGRKSIRTRFAAN
                     NDFTRRERFTLSLYTASLFLRVSQIRWARRLRHFTFLASLHEVSPLLLRRASPPDKPT
                     AKDSGHLSRLDR"
     gene            <25899..>26426
                     /locus_tag="THITE_112038"
                     /db_xref="GeneID:11523905"
     mRNA            join(<25899..26114,26155..26256,26394..>26426)
                     /locus_tag="THITE_112038"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648469.1"
                     /db_xref="GeneID:11523905"
     CDS             join(25899..26114,26155..26256,26394..26426)
                     /locus_tag="THITE_112038"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648517.1"
                     /db_xref="GeneID:11523905"
                     /db_xref="JGIDB:Thite2_112038"
                     /translation="MTVRMHPGAMIGGATLQLSATFTSQDRFNQDASALHAMIPTMSD
                     SGADVICLAKNSMLWLNAATICNSTGDYLAELGIPFRVQYSTLLYFDYYNTYMGPCLS
                     FAAPITPQVDIMMA"
     gene            complement(26678..28209)
                     /locus_tag="THITE_2106060"
                     /db_xref="GeneID:11523896"
     mRNA            complement(join(26678..27085,27169..27370,27465..27671,
                     27748..28209))
                     /locus_tag="THITE_2106060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648470.1"
                     /db_xref="GeneID:11523896"
     CDS             complement(join(26756..27085,27169..27370,27465..27671,
                     27748..27914))
                     /locus_tag="THITE_2106060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648518.1"
                     /db_xref="GeneID:11523896"
                     /db_xref="JGIDB:Thite2_2106060"
                     /translation="MAAADVVNPALFDRHQAAISPAIANDGRAAPHNVRTVLNYYKDP
                     GDGTPPAPFYVGKSFEQQQALRPTVSVEVEVTDISGSEDKYTLDSHGFQIVRHESKEK
                     QFLDEEQIKSIYYPETEQLLKDVTGATRVLIFDHTIRRPPKPNGDENALLRGPVRNVH
                     IDQSYTAAVNRVRYHLPDEAEELLKKRFQIINVWRPIKTILKDPLGVADAHSVAESDL
                     VGAALIYPNRKGETFAVKPNPAHRWYFKYAQRPDEVTLIKCYDSVTTPGVARRIPHSA
                     FTDPAEEDKEPRESIEVRTLVFYDY"
     gene            complement(28311..30534)
                     /locus_tag="THITE_2106062"
                     /db_xref="GeneID:11523903"
     mRNA            complement(join(28311..28630,28689..29086,29155..29909,
                     29989..30534))
                     /locus_tag="THITE_2106062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648471.1"
                     /db_xref="GeneID:11523903"
     CDS             complement(join(28483..28630,28689..29086,29155..29909,
                     29989..30382))
                     /locus_tag="THITE_2106062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648519.1"
                     /db_xref="GeneID:11523903"
                     /db_xref="JGIDB:Thite2_2106062"
                     /translation="MDFVEPDAETPLLFDTSSSQAAGSPNYHSILKRRPGVADARIGS
                     VDNTPRSLEDDVVPETAVPGRNLGWSSAYIIIISRVIGSGIFAAPGAIVSSVGSVGLS
                     LLLWIAGALISWCGLVVSLEYGCMLPRSGGQKVYLEFTYRRPRFLASTLVAVHAVMLG
                     FTASNCIVFGEYLLFALGRAPAERPVHVRLLAVSLMTGITVLHGCFLRTGILVQNMLG
                     WVKIGLVIIITLASGAVVIARYTPGEAEKLDAGKIPVNLGFPATWDGIWEGSVWNWGV
                     ISAALFKVFYSYAGLQNVNNVLNEVRDPVRTLRSAAQTALATACLLYLLINVAYFLVV
                     PLDVIKESGELAAALFFERVFGQTLGRLLLPLAVAISAAGNVMVVTFALARLNQEIAR
                     QGLLPFAELLSSSRPFGAPLGGLILHYIPSVIVICIPYKDIYSFILEVEGYPGQFFSL
                     ATSIGLIWLRRSRPDLKRPYRAFLPAAWFMVLLSCALLLAPFVPRQREDWRAHLSRVS
                     YALVGISVLLFGVLYWAVLTILLPWLRGYRLEEETDILQDGTTITKLVHVHREDDH"
     gene            complement(30697..32621)
                     /locus_tag="THITE_2106066"
                     /db_xref="GeneID:11523899"
     mRNA            complement(join(30697..31201,31270..31596,31707..32621))
                     /locus_tag="THITE_2106066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648472.1"
                     /db_xref="GeneID:11523899"
     CDS             complement(join(30828..31201,31270..31596,31707..32424))
                     /locus_tag="THITE_2106066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648520.1"
                     /db_xref="GeneID:11523899"
                     /db_xref="JGIDB:Thite2_2106066"
                     /translation="MARFPDLGSWFMRSVRRDHFASTPVLAVERLNTLPRPIQDADKE
                     VLVGAVLTMSSSLHLALSMLRELLPHEKSQERLAEVVCPTLNHLLAALQNTLSSFERR
                     DSPSTPSVPASCSAKATQQSHARALHANTALKPAPEPKRPGIASDEQPVQVRRHGDDR
                     SCSSCGSANTERLLPLQDNDQSRQLHIEVSSHNRPETHLVKALQAEMRVQAAIHVAIE
                     SLEFAEGQLKVVKEVNQLHGGELDILQTHFYEGYNRLLFRALELQRRELGLLQDRDSL
                     ILDSALQQRHQQPTEDGVLQTSPKQHQSVSFQKPLPLCRSASTLRSTAAVQGASWERR
                     VPGRRNTIQGIRQEGARARDSRPPLRRRLSLAEELALAGDDSESGYQEETSERASSGS
                     EHSDAEESSNGARGLMINRNESEESDRNAESGGEESALDSSDDDGQGDDDGEETLIPA
                     IASLGGGSSYSKSRWPRLQQRR"
     gene            complement(<36216..>36920)
                     /locus_tag="THITE_2083705"
                     /db_xref="GeneID:11523892"
     mRNA            complement(join(<36216..36543,36698..36791,36842..>36920))
                     /locus_tag="THITE_2083705"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648473.1"
                     /db_xref="GeneID:11523892"
     CDS             complement(join(36216..36543,36698..36791,36842..36920))
                     /locus_tag="THITE_2083705"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648521.1"
                     /db_xref="GeneID:11523892"
                     /db_xref="JGIDB:Thite2_2083705"
                     /translation="MSATQRARPDRWPFSLHNSGSPDEQAPSPHDDQNHELVFLCPTA
                     DQLYDTMNNVGDSALHGARHELRRRSPRNSQFHLGHAVAFSISGEQSGINIIRHERSS
                     GGMVLGLASSMSPIATATASFPTPSTALSTAAAGTKLSSATSETLGSTGALSTPSTGT
                     DVDKAT"
     gene            40268..42264
                     /locus_tag="THITE_2106069"
                     /db_xref="GeneID:11523894"
     mRNA            join(40268..40920,41004..41541,41617..42264)
                     /locus_tag="THITE_2106069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648474.1"
                     /db_xref="GeneID:11523894"
     CDS             join(40457..40920,41004..41541,41617..42096)
                     /locus_tag="THITE_2106069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648522.1"
                     /db_xref="GeneID:11523894"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR012951"
                     /db_xref="JGIDB:Thite2_2106069"
                     /translation="MLVPFAFAVAAALAAADPLAKRAAIDDCLSAAKVPVDTPDSDEW
                     KTDANPFNQRLPYTPVAIAVPTTAEHIQAAVSCAAQVGVKVNPKAGGHSYASFGLGGE
                     DGHLVVELDRMDNVTLDSTTQIATVQPGARLGHVATVLYEQGKRAFSHGTCPGVGVAG
                     HSLHGGFGFSSHLHGLALDWIAGVTVVLANATVVNASETENPDLFWALRGAGSNFGIV
                     ASFQFKTFAAPSLVTTFQVDLPWKNASSIASGWAKLQDWVKTDMPKELNMRILGNSYQ
                     TQLQGLYYGNSSALQSAMQPILSKLGAKLSDTEESDWMDAFAHYAYSPTIDITGPYNA
                     AETFYSKSLVTSALPSSVLQNVSNYWVEKARSNSRAWYIIIDMFGGANSAVTNVPANA
                     TSFAFRDPNYLFLYEFYDRVYFGSYPSNGFSFLDDWVNIFTSGLNTTQWGMYINYADP
                     AMSRAQAEEVYYRQNLPRLKQLKKQLDPTQLFDYPQAIDPTTA"
     gene            complement(<42432..>44230)
                     /locus_tag="THITE_120212"
                     /db_xref="GeneID:11516732"
     mRNA            complement(join(<42432..42796,42865..43370,43445..43712,
                     43781..44061,44151..>44230))
                     /locus_tag="THITE_120212"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648475.1"
                     /db_xref="GeneID:11516732"
     CDS             complement(join(42432..42796,42865..43370,43445..43712,
                     43781..44061,44151..44230))
                     /locus_tag="THITE_120212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648523.1"
                     /db_xref="GeneID:11516732"
                     /db_xref="InterPro:IPR006045"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="JGIDB:Thite2_120212"
                     /translation="MHHSQSLLCLLTACWQSARVLALPAPQIGSYGETTGAVGGVTPP
                     IPTATAPSGSLRGDSSLLGGNAPLPDPDKSDSAVVSNPQLVTGQEADAKLGLYLDFDS
                     ANPPQPIRGANGNTDPGPRTFEYEKLNPDLFAPPGTDTGDMPNLMWPMGLSHNRPGTG
                     KNSGWARQQNTEVLPAAKAMAGVDMRLAPNAYRELHWHTAGEWALMLKGCVRVAAIDD
                     EGRSFVDDVCAGDVWFFPAGIPHSIQAFDEGAEFLLVFDNGDFSEDGTFLVTELFLRN
                     PVEVLSKDFRAPVDAFNNLPKDQLYIFNGTPAPKDISEQNTTSSAGAITGNGSLTYHW
                     SQQRPYTVPGGSVKILDPLTFPAAKMFSAALVVVQPGALREIHWHTTSDEWNFFLQGS
                     GRITVYGAPASSRTYDFTAGDVGYVPVACGHYIENTGTEDLIFLEVLQAPKFTDISVA
                     QWLALTPKQVVKDHLNLPDSVVDALPKEKPLILPGNTNSTALAGNGTAF"
     gene            45119..46981
                     /locus_tag="THITE_2106073"
                     /db_xref="GeneID:11515323"
     mRNA            join(45119..45331,45418..46981)
                     /locus_tag="THITE_2106073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648476.1"
                     /db_xref="GeneID:11515323"
     CDS             join(45205..45331,45418..46781)
                     /locus_tag="THITE_2106073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648524.1"
                     /db_xref="GeneID:11515323"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR015353"
                     /db_xref="JGIDB:Thite2_2106073"
                     /translation="MDSGFAEGTRRFTSWFQALPGATFHPDIVVEDLRGRGAGRGIIA
                     KADIPADTVLFTIPRSAILCAATSALRDKIPDVFDLEGDHGAGHSDSGDEDGAASSSS
                     QDSWTLLILVLIYEHLQGEASRWRPYLDVLPPTFDTPMFWSPTELSELQASALVAKVG
                     RAEADRMIEAKVLPVIRAHEEVFFPPGRAKLDDAQLFELAHRMGSTIMAYAFDLENDD
                     SDNDEADEDDEWVEDREGRTMLGMVPMADMLNADAEFNAHINHGDDALTATALRPIRA
                     GDEILNYYGPLPNGELLRRYGYVTPKHSRYDVVELPWELVEAELKGRVGTHWTASEWD
                     KVRELVRADDDFEGSFVLERSSADPDSTGQLSGDAVFAGLPDELGEQFKAFLKAAKKV
                     ANSEIAARAASDKEMRKELYLQAVLAALQARERQYATSLEDDRQLMDAGNLTGRQEMA
                     VCVRIGEKVLLREAQSWVRRELDELQSQASRTTREDDAPAVKRRRV"
     gene            complement(46981..49125)
                     /locus_tag="THITE_2106074"
                     /db_xref="GeneID:11515885"
     mRNA            complement(46981..49125)
                     /locus_tag="THITE_2106074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648477.1"
                     /db_xref="GeneID:11515885"
     CDS             complement(47181..49019)
                     /locus_tag="THITE_2106074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648525.1"
                     /db_xref="GeneID:11515885"
                     /db_xref="InterPro:IPR013178"
                     /db_xref="JGIDB:Thite2_2106074"
                     /translation="MSSSSAPLAPKRSSASAGPGSSTANNISSKNNSASSLRERLAAV
                     LPRGYKFGVHHISTPPTRAQPLCPAPPGHRPDKTYKESHFLAVSILTDPANAAVPVKR
                     ASPGAGQAKEAEARKRVLVFAIEVFIFTTAYQTTLFVSKADSTGYLHLLGLPTGSPSP
                     IRQVCAIFLAHLLDHRQRRHAQSVVNLFARAQAQYLFPGSVRNKGKHVLDDWGLVRWW
                     CKILNPLMEGLSKRSWGSTKGYLLVPGLEETEMRAFIPRTPASTRNWAIGHPLERISH
                     YTRELDWVPPRCLIPSYPDDPKARFRDELDEEVSKRKQGAGAWKSVRSLSQFWEMMAF
                     RQECSSGRLTGFIWLVFDPPVNKSESLGNSSPSATVAAPSLATPNASFDSSLTPPAPA
                     TPPRRRVDIATHTPQSSPLKTAPVSPAVSLPPPCKVSKKKARKKLSGRIVPRAPKIKT
                     QARNYLQDRPTTTAYYYWPQAGRGDRLASEAEYKRIVELLLHLDFSTLDKAAGSSQRW
                     LKEVGLGDAAEGEVVGKAAAPESLRVNEAAPTAAAGSNATNLTGLIRRKNAPQSTAPD
                     PGRSSDAALDIQGGPAADSSAAKQVNVLESGLVRKKKKDSSDDARR"
     gene            49317..50295
                     /locus_tag="THITE_2106075"
                     /db_xref="GeneID:11516611"
     mRNA            49317..50295
                     /locus_tag="THITE_2106075"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648478.1"
                     /db_xref="GeneID:11516611"
     CDS             49509..50072
                     /locus_tag="THITE_2106075"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648526.1"
                     /db_xref="GeneID:11516611"
                     /db_xref="JGIDB:Thite2_2106075"
                     /translation="MALRSTCAALSSGCSSALQRCSAPAHSIAQRLGPSAVAVRQLST
                     TSATRNSNAVDAALETQERPRWSYTPERMKGPGFSINIVKDPRRTVWHNNDDPAKLDA
                     MYNRLLGPKGDRMLPDEIKWLAITHKSFDQGRRGFNTRLAYFGAFAETCTLPFCHPRE
                     SPGWFRAGLRSRAANQTMLGRAADSCA"
     gene            complement(50357..51742)
                     /locus_tag="THITE_2106079"
                     /db_xref="GeneID:11516569"
     mRNA            complement(50357..51742)
                     /locus_tag="THITE_2106079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648479.1"
                     /db_xref="GeneID:11516569"
     CDS             complement(50898..51605)
                     /locus_tag="THITE_2106079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648527.1"
                     /db_xref="GeneID:11516569"
                     /db_xref="JGIDB:Thite2_2106079"
                     /translation="MSFLPRTVELHTRRSHYADDDRHGSTPKWQSLSRNPAALSVNTE
                     ARAAALECYTVALPLFALPSRTQASERPGELLQDSDRVLYLNLEQDTVVLLGDLQYAR
                     LTRLLGWFRKMDTLARGRGRGAAASSPLAAKGLRRLAMSVAPWAHEVGAATLKAFART
                     VFADLDEFVLFMYSERLPPPTWTGGLCVLEEAAPDTDHYRRFVIGRGRQFRVGDGWMV
                     VGQRPMKVADISFEERW"
     gene            complement(53099..55237)
                     /locus_tag="THITE_2106082"
                     /db_xref="GeneID:11515635"
     mRNA            complement(join(53099..54557,54638..54855,54949..55237))
                     /locus_tag="THITE_2106082"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648480.1"
                     /db_xref="GeneID:11515635"
     CDS             complement(join(53223..54557,54638..54855,54949..55132))
                     /locus_tag="THITE_2106082"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648528.1"
                     /db_xref="GeneID:11515635"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2106082"
                     /translation="MIATVVLLALPLVATYLVATIWHRRFRQYAGIPQLKPSFLWGHL
                     RAIHELTTLQSRPGLHPDHVFAEMARQLGHPPLMLLDLRPVRPPMIIVTSHEVAEQIT
                     RVSKLFPWSTPKSPTMSSLVRLTGAESILAKNGEDWKQLRRRYNPGFAPQHLMSLLPC
                     ILDKTDMFVEHLDRYAGSGEEFQLSKLAINLTFEIIGAVTMDVDFHAQHPESSGQGEF
                     IKLFDQLLHMYGPVDNRFPWWMYPRREWRRWRLSEQIDRLLEDMIRHKHAEHQQQAGK
                     AGRARDVLSLSLQDSKELTKSLLSETRDQLKTFLFAGHDTTGILLSWVFYELSRTPAA
                     LKAVRDELDDLFGPDPSPAAVRRKLLAPGGEELIHRMAYTTAVIKEVLRLHPPGATAR
                     MSPPGTGFRVRTSDGQSFCLDGAILYNCATIIQRDRTVFGDTANDFMPERWLGDKVGI
                     MSAGAGGGADEDAGRKLPAGAWRAFERGPRNCIGQDLATIEARVIVAVVARRFDFVKV
                     GLGELDLDAEGRPVLDEKGQFKTKSELYSVSSVMAGSGRASIPPPPPPPSPPPLRVTA
                     QSMLTVIDRRSR"
     gene            complement(55442..57217)
                     /locus_tag="THITE_2106084"
                     /db_xref="GeneID:11516730"
     mRNA            complement(join(55442..56721,56792..57217))
                     /locus_tag="THITE_2106084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648481.1"
                     /db_xref="GeneID:11516730"
     CDS             complement(join(56086..56721,56792..56824))
                     /locus_tag="THITE_2106084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648529.1"
                     /db_xref="GeneID:11516730"
                     /db_xref="JGIDB:Thite2_2106084"
                     /translation="MDDTWVDTQELRRRFTNKTNAVFSRSDWHDDREYPAVNYERVFD
                     FSGCKDIIFQRGREDDVLMLAHGSGHMTLPAGVRVRVLSGYARCAPAAPDSVGSGSTV
                     VGSGVRAPPPSRVSAYAHSSAGSGYARSSAGSAYAPSAASFHRGGARSSYMSACGVPL
                     PPSEAGSRSMAGSANDWVVVEEMEGYGFQDDRDNCSIAPSESISSVGSRAASRWPVSA
                     SLRH"
     gene            complement(57237..58799)
                     /locus_tag="THITE_2106085"
                     /db_xref="GeneID:11517068"
     mRNA            complement(join(57237..58332,58400..58799))
                     /locus_tag="THITE_2106085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648482.1"
                     /db_xref="GeneID:11517068"
     CDS             complement(join(57413..58332,58400..58514))
                     /locus_tag="THITE_2106085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648530.1"
                     /db_xref="GeneID:11517068"
                     /db_xref="JGIDB:Thite2_2106085"
                     /translation="MDAQNTSSLVPFSEATRVERLDSHAYRVNLVDSFCIGTVPNGGY
                     VASCILRAAGMHLAQAGQKDVLNAHFQFLNRTETGPAVIVIEDVKIGRQLSTLHATLY
                     QRALLPQAPWITPGGPTRKEVAVYLTMTDLSKEQGISLPTSFSLQHPVAAPPRPDFAA
                     LRQDRDAHWWRLRQRGSTPASYTRNRQNLAYYEPRGGQRTKTVIDKWVRLASGEKFTA
                     ASLAYVADCWPYMVEVWRPSRAEAEEKRRRGESVPFAPNALFWYPTVVLNLEVKKALP
                     ADGVEWLQLRIQSKQIKDGRFDLEVLVLDEHGDLVALSNHVNLILDSERNLAERSRGA
                     SATGQKSSRI"
     gene            <58957..>59476
                     /locus_tag="THITE_2083715"
                     /db_xref="GeneID:11515848"
     mRNA            join(<58957..59019,59060..>59476)
                     /locus_tag="THITE_2083715"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648483.1"
                     /db_xref="GeneID:11515848"
     CDS             join(58957..59019,59060..59476)
                     /locus_tag="THITE_2083715"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648531.1"
                     /db_xref="GeneID:11515848"
                     /db_xref="JGIDB:Thite2_2083715"
                     /translation="MSKQAVEAVPLMFGFKKPSNQDPSHPTTIVIYGLANARPLLGVK
                     YVDGAIPTFPDRSHLLGHPQAALPNAGSPLARHGPRRDPLISLAIRRDPGAGRPCSGR
                     ACTVTGGWSGRPSAASFSTAIMNDAHLFGRARSERLYLYSKEDVIIHWEDIERKARG"
     gene            complement(<59892..>61924)
                     /locus_tag="THITE_2140511"
                     /db_xref="GeneID:11515711"
     mRNA            complement(join(<59892..59975,60030..60123,60187..60248,
                     60300..60361,60415..60524,60576..60629,60687..60707,
                     60764..60789,60847..60879,60946..61040,61205..61327,
                     61385..61533,61616..61745,61809..61839,61910..>61924))
                     /locus_tag="THITE_2140511"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648484.1"
                     /db_xref="GeneID:11515711"
     CDS             complement(join(59892..59975,60030..60123,60187..60248,
                     60300..60361,60415..60524,60576..60629,60687..60707,
                     60764..60789,60847..60879,60946..61040,61205..61327,
                     61385..61533,61616..61745,61809..61839,61910..61924))
                     /locus_tag="THITE_2140511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648532.1"
                     /db_xref="GeneID:11515711"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="JGIDB:Thite2_2140511"
                     /translation="MGLLEDLKLPVGVLYGDDVLKLFTYAREKGFAIPACNVTSSSTV
                     VAALEAARDAKSPIILQTSQGGAAYFAGKGIKNSAEKQEASVAGAIAAAHYIRSIAHL
                     YDVPVVLHTDHCAKKLLPWLDGMLDEDEKFFKQHGTPLFSSHMIDLVEEPVDENISTC
                     VSYLKRMAPMKQWLEMEIGITGGEEDGVDNSGVDNAALYTQPEDIWKIEQAFRPISPY
                     FSIAAGFGNVHGVYAPGNVRLHPELLGKHQAYVSEKLGGKDKKPVFFVFHGGSGSSKQ
                     EYLEAISHGVVKVNVDTDLQWAYLTGIRDYITKNIDYLKTQVGNPEGPNKPNKKKYDP
                     RVWIREGEKTMSARVAECLQDFKTAGTL"
     gene            complement(<63078..>63764)
                     /locus_tag="THITE_2140512"
                     /db_xref="GeneID:11515579"
     mRNA            complement(join(<63078..63092,63209..63495,63545..>63764))
                     /locus_tag="THITE_2140512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648485.1"
                     /db_xref="GeneID:11515579"
     CDS             complement(join(63078..63092,63209..63495,63545..63764))
                     /locus_tag="THITE_2140512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648533.1"
                     /db_xref="GeneID:11515579"
                     /db_xref="JGIDB:Thite2_2140512"
                     /translation="MKSAFLGSLYCVLMLVGLGLSTDNRMPPKAPGLSHLYTVNITGG
                     DAVPVGPGPRGTRLVVPILGGNFAGPKLKAHPPLGTVLPIGADWALTDANGVNGSLTA
                     NVRQTFKTDDGAFIQVFETGEVQPDGSAFVRLAYETGSEAYYWLNTVVAIGIIHNVDT
                     NHLTIDTWQMTAP"
     gene            complement(70544..71601)
                     /locus_tag="THITE_2106106"
                     /db_xref="GeneID:11516715"
     mRNA            complement(70544..71601)
                     /locus_tag="THITE_2106106"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648486.1"
                     /db_xref="GeneID:11516715"
     CDS             complement(71072..71443)
                     /locus_tag="THITE_2106106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648534.1"
                     /db_xref="GeneID:11516715"
                     /db_xref="JGIDB:Thite2_2106106"
                     /translation="MRGLFLAVLPLLGATALASADKRATPTTLATSKTTTSPAQPTYQ
                     SCGGFRANPVECPDGQICIDDPYRGGCGMACDMPGICVEPVFCGGIAGIACKDGKKCV
                     DDPRDDCDPENGGSDCGGICV"
     gene            72763..74863
                     /locus_tag="THITE_2072060"
                     /db_xref="GeneID:11516886"
     mRNA            join(72763..73112,73181..74863)
                     /locus_tag="THITE_2072060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648487.1"
                     /db_xref="GeneID:11516886"
     CDS             join(72842..73112,73181..73842)
                     /locus_tag="THITE_2072060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648535.1"
                     /db_xref="GeneID:11516886"
                     /db_xref="JGIDB:Thite2_2072060"
                     /translation="MASHGPLRVGYVPEHFSTPIHFAKKHYGLEAELIPFPSGTGHMI
                     TALRGGEIDVGIGLTEGWVAGLGRSQESGDRDGGFKLVGTYVETPLCWAISTGADRPE
                     IKSVDSLQGGKIGVSRIGSGSYVMGYVLADERGWLIPSAGAGTAAEQASPYSDFVVLD
                     TFEKLRKAVNSGEADFFMWEHFTSKRYYDNGEIRKVGEIYTPWSSWKIVASTRLIDGE
                     KLDPRVDDLLGKLNLGIRHFNENKEEAIKYISTELDYSEEDARQWLETVRFPERSQGV
                     DLNVIHNTVRVLCQAGVLSVGKGADAAAMVAKRR"
     gene            <77236..>77739
                     /locus_tag="THITE_2041120"
                     /db_xref="GeneID:11521209"
     mRNA            join(<77236..77289,77389..77507,77592..>77739)
                     /locus_tag="THITE_2041120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648488.1"
                     /db_xref="GeneID:11521209"
     CDS             join(77236..77289,77389..77507,77592..77739)
                     /locus_tag="THITE_2041120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648536.1"
                     /db_xref="GeneID:11521209"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="JGIDB:Thite2_2041120"
                     /translation="MPLNFIAMLYPKPDRVARVEEIARQVCESVHEKEPGVLKYQWFR
                     AGGTDKPLIVVWETYLDQAAVDAHTSSPVMAWLVENDKKEENMAAPITVMPLEQFAGW
                     ENRS"
     gene            78201..80114
                     /locus_tag="THITE_2106112"
                     /db_xref="GeneID:11515877"
     mRNA            join(78201..78401,78525..80114)
                     /locus_tag="THITE_2106112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648489.1"
                     /db_xref="GeneID:11515877"
     CDS             join(78324..78401,78525..80012)
                     /locus_tag="THITE_2106112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648537.1"
                     /db_xref="GeneID:11515877"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="JGIDB:Thite2_2106112"
                     /translation="MVLQDLGRRINAAVSDLTRAPNLDEKAFDSMLKQICSALLEADV
                     NVRLVGQLRKSIRATVNFKELPPAVNKKRLIQKAVFDELVRLVDPHAEPFKPKKGKAN
                     VIMFVGLQGAGKTTTCTKLARHYQSRGFRACLVCADTFRAGAFDQLKQNATKAKIPYY
                     GSLTETDPAVVARDGVEKFKKERFEVIIVDTSGRHRQESALFQEMVDIQAAIRPDETI
                     MVLDASIGQQAEAQAKAFKEAADFGAIIITKTDGHAAGGGAISAVAATHTPIVFIGTG
                     EHMLDLERFVPRNFISKLLGMGDMAGLVEHVQSLKLDQKETIKHISEGIFTIRDLRDQ
                     LQNIMKMGPLSKMAGMIPGMSNMMQGMDDEEGSLKLKRMIYICDSMTDKELDSDGKIF
                     IDQPTRMTRVARGSGTTVREVEDLLTQQRMMAGMAKKMGGNMKNMQRAQSALAGGNKA
                     QQLAAMQKRLQSMGGGAGAGGMPDMASLMKMFGGGGAGAGGLGGLGGMDMGAMMRQMS
                     GLMGGQGGRGGRR"
     gene            complement(<80578..>81411)
                     /locus_tag="THITE_2083723"
                     /db_xref="GeneID:11515476"
     mRNA            complement(<80578..>81411)
                     /locus_tag="THITE_2083723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648490.1"
                     /db_xref="GeneID:11515476"
     CDS             complement(80578..81411)
                     /locus_tag="THITE_2083723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648538.1"
                     /db_xref="GeneID:11515476"
                     /db_xref="JGIDB:Thite2_2083723"
                     /translation="MHSLSLLAFAAVGPLLAAAANCTREFLKGTADSLVAAQTAGDPS
                     QLKPVSESLVYRENYATAAFKSGILATALKIDHSRHDLDTTQCATFTELVSASGPKPY
                     VIGVQMYFTDGAVSKIDTLITSTGDWLFNATNTLKWTSQEDWGTIPEDKRDTRAVIQA
                     AADAYCDIFSNKSVVVPWGRPCARLEGGAYTGNGGPNDRCDVGIPSGVSLTDRRYVID
                     ETIGAVSVFLSFSGIPDSHEFRIESGKIRYVHTMTVMTAARGNGRGMRKVRGIVRPLA
                     N"
     gene            <84594..>85926
                     /locus_tag="THITE_2140518"
                     /db_xref="GeneID:11516923"
     mRNA            join(<84594..84641,84688..84998,85439..85614,
                     85766..>85926)
                     /locus_tag="THITE_2140518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648491.1"
                     /db_xref="GeneID:11516923"
     CDS             join(84594..84641,84688..84998,85439..85614,85766..85926)
                     /locus_tag="THITE_2140518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648539.1"
                     /db_xref="GeneID:11516923"
                     /db_xref="JGIDB:Thite2_2140518"
                     /translation="MFSSLVSPQTPPLPDKAGNKAHKHGSGHGNRQNASKHSKAPKTT
                     KIPRGLDPGTVPASFLFAVNEFQVDYEPQPGEDHPLTDQWFNMVPPQRAEAYTGEYPG
                     TVFRYRNGVVSPAPGYICVYRNTSPSAVPSRGLSGYLPIILALMGFHGRPGRASDVFS
                     AHGWHQHRWTLSNRASNYLPKSGESPRGLYVQVCTDNLVDGLADSVENNIPVEQCTEV
                     LQYLECCTILVQG"
     gene            complement(<86409..>87883)
                     /locus_tag="THITE_2040152"
                     /db_xref="GeneID:11521474"
     mRNA            complement(join(<86409..86489,86543..87640,87716..>87883))
                     /locus_tag="THITE_2040152"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648492.1"
                     /db_xref="GeneID:11521474"
     CDS             complement(join(86409..86489,86543..87640,87716..87883))
                     /locus_tag="THITE_2040152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648540.1"
                     /db_xref="GeneID:11521474"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="JGIDB:Thite2_2040152"
                     /translation="MASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESS
                     AVPPCFSHEGINYLYIRHNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEES
                     IRDNFVIIYELLDEMMDFGYPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRS
                     EGIRYRKNEVFLDVIESLNLLVSANGNVLRSEILGAIKMKCYLSGMPELRLGLNDKVM
                     FETTGRTTRGKAIEMEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTQVKPL
                     IWVECLVESHSGSRIEYMLKARAQFKRRSTANNVEIIVPVPDDADSPRFRTNVGSVHY
                     APEQSAIVWKIKQFGGGKEFLMRAELGLPSVRGDDEHGGGMTGGFGGSMGGIGGPGKG
                     AKRPIQVKFEIPYFTTSGIQVRYLKITEPKLQYPSLPWVRYITQSGDIAVRLPDVI"
     gene            90312..92968
                     /locus_tag="THITE_2106119"
                     /db_xref="GeneID:11521472"
     mRNA            join(90312..91069,91156..92968)
                     /locus_tag="THITE_2106119"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648493.1"
                     /db_xref="GeneID:11521472"
     CDS             join(90556..91069,91156..92447)
                     /locus_tag="THITE_2106119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648541.1"
                     /db_xref="GeneID:11521472"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="JGIDB:Thite2_2106119"
                     /translation="MQQPAGSAALAVSDASTDQTRLADGRPEHMPSAGFSPPAVAATP
                     PLQLPPLALAFPSDPTTELAPIQQPHEKPTGPSGQTLPPLSSVTGAQAHAPLPKPPEP
                     AHPAPYTKTTNYWPSLNPFTAYYTPSYLDPVESSPGTVVEQNAARRGPSVSLDDPDVR
                     MAAEALGQMRADFGSSPRHRSTSLASTHSDCKPSRDLSSVSPSPQTNGRSPPEPEPLL
                     TLITTSHPLLATTIEGAASAYNSGKNYSPRLRTSAEYVESYLKPVGKAVGNVGRKTGV
                     EGGVRWIFGRRSRKQQASADIETGERGSNKRLKSERDVEKKNPSDAPYADLDADADDR
                     RTSISTVETLPAYDDQRSPAYTEVAEDSTGSRPELGSSPQPWGQRFVVTTSGLGVAMK
                     QESLRSLRYCLQVLRDTHGYIDGVLVKLKSVIDEFDAAARTDGEDRAMVGGPDANPQT
                     AAQRKTLIQRMSELRDDLFRVIYRTVQTISKYAGGALPENAKNIVQRQLMSLPGLYQF
                     HYVRESEGRPEDPSPEMRARNSSHLALLFARESLQLMSQVADVLNRTLVSAEEWCETL
                     YGNREQTGPPATLTEPPPAPARPTVSADQNSRMSG"
     gene            complement(93116..94431)
                     /locus_tag="THITE_2106121"
                     /db_xref="GeneID:11521454"
     mRNA            complement(join(93116..93926,93990..94431))
                     /locus_tag="THITE_2106121"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648494.1"
                     /db_xref="GeneID:11521454"
     CDS             complement(join(93189..93926,93990..94217))
                     /locus_tag="THITE_2106121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648542.1"
                     /db_xref="GeneID:11521454"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2106121"
                     /translation="MARRNILLCFDAFGTLFKPKRPIQEQYASVARQCGLDGFSAEQV
                     QASFKAAFSGESKAHPNYGKDSGMGAEKWWTNVIHQTFRPLIGPDKKLPEDLAPRLLH
                     RFSSDEGYAPAPGVVSLLRSLKQQQQQQGRNRITVGVITNSDDRVPSILSSLGLRVSP
                     LRYGYGASTDLDLARASGHAYDIDLHCMSYDVGFAKPDRRIFDAAEHMANQLLAMQQQ
                     RGAETGSSGSAKGDSPWLKLYVGDDFEKDVVGAQGAGWNAVFVSPEEHSVSDQKKDMS
                     DLEQLEGKTLEDVFPQDGPSPTLIRAERTQSFLAWLMKRCAEGDQ"
     gene            complement(<95006..>95911)
                     /locus_tag="THITE_153704"
                     /db_xref="GeneID:11521435"
     mRNA            complement(<95006..>95911)
                     /locus_tag="THITE_153704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648495.1"
                     /db_xref="GeneID:11521435"
     CDS             complement(95006..95911)
                     /locus_tag="THITE_153704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648543.1"
                     /db_xref="GeneID:11521435"
                     /db_xref="JGIDB:Thite2_153704"
                     /translation="MPGGPAFHQPVHQPAIHPSQQPPQLMSSAQAGPWTVHPGAAPGV
                     VMPGQVPAAWHQPAAQQQQHPWAPPSIAMPAASQFTPAQQQPQPWPPSMPVAMDPNTS
                     ISVPFSRLAQPPVPVAYPGPPHPGVAAATIPPHAQGVPSFPQPQWPAQPSYAHGYVLQ
                     QPHQMQPAPQGNDDIQRPVGGVAESSQHQVASVTQEGFGAGNAPSTTGLSLSNELATA
                     PAPIMGQLTANDGSERKKARAAEPGEAAGRDIADPGGAGHPVQDGAGSSDADPGKTEL
                     AGDGKADGEAKTGDAQPEAAGPGGG"
     gene            <106269..>107045
                     /locus_tag="THITE_39363"
                     /db_xref="GeneID:11521431"
     mRNA            <106269..>107045
                     /locus_tag="THITE_39363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648496.1"
                     /db_xref="GeneID:11521431"
     CDS             106269..107045
                     /locus_tag="THITE_39363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648544.1"
                     /db_xref="GeneID:11521431"
                     /db_xref="JGIDB:Thite2_39363"
                     /translation="MSASTPFKILIFSRTTAYRHDSIPAGIRALHRLAAASCSAAAAG
                     AESFTADDSEDPSVFTAASLAAYRVIVLLQCSGEFLDGQQLDALKGFVRSGGGVVAVH
                     CASFAMQSSEWYGRLVGAVFDNHPEPQLGRLEITDPGHPIMTCRCAGSQQEERPIGER
                     TWLDEWYNFKTHPRAANDDLHVLLTVDEKSYHGGAHGDDHPVAWCHDFDGGRCFYTSL
                     GHFDEAYEDDWYMGQLLGGILWAAGRLASESGARQSRVNG"
     gene            <107455..>109032
                     /locus_tag="THITE_2041135"
                     /db_xref="GeneID:11521403"
     mRNA            <107455..>109032
                     /locus_tag="THITE_2041135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648497.1"
                     /db_xref="GeneID:11521403"
     CDS             107455..109032
                     /locus_tag="THITE_2041135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648545.1"
                     /db_xref="GeneID:11521403"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="JGIDB:Thite2_2041135"
                     /translation="MSDGTSYWPRFVDDFLGRLESDPGALSEGSRGLPAYRFDDASER
                     ALLATRCRPVSFRLGTGASLFTDCLIPAMVSARSEIILVTCFWAPSESLTALHDALTA
                     LAAHRRSLIRGALSRGDAAIRPLTVRICLSSRSLLQKLLHPQSRGGYMYPPSAWEKQL
                     GLPDPASLEAGGIQLQVKSLFFLPFSVMHPKFVIIDRQRAFVPSCNVSWEPWLEACVE
                     ITGEAVRSLLVFYSRTWGDPPGSWQQVEPAPEGAATATEGVSLDARHAGLVVIQSPAH
                     HRTALRCREPVPTLVLPSSHHANPRFRPFPWQKPAAPPSTPQNIALLQLFSRAQQSIY
                     IQTPNMTCRAVIAAVLDALARGVHVSIVTNRSMMLAEQLLTAGTTTSWCMWSLVRRFR
                     RLRATADARSAGDGGGGGDLEAGRPSIGRLQISYFRAKSRGGRELRETPQSLIRTPSR
                     GEEPVHSHLKLTLVDDTYAVLGSANMDRASWFTSQELSLLFHDRDLCTEIRSGIDSVL
                     DGRVDLVFDSDDDVRAM"
     gene            109576..111974
                     /locus_tag="THITE_126432"
                     /db_xref="GeneID:11521362"
     mRNA            join(109576..110216,110292..111382,111450..111491,
                     111573..111974)
                     /locus_tag="THITE_126432"
                     /product="glycoside hydrolase family 6 protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648498.1"
                     /db_xref="GeneID:11521362"
     CDS             join(110125..110216,110292..111382,111450..111491,
                     111573..111793)
                     /locus_tag="THITE_126432"
                     /EC_number="3.2.1.91"
                     /note="CAZy_ID 269834"
                     /codon_start=1
                     /product="glycoside hydrolase family 6 protein"
                     /protein_id="XP_003648546.1"
                     /db_xref="GeneID:11521362"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001524"
                     /db_xref="JGIDB:Thite2_126432"
                     /translation="MAQKLLLAAALAASALAAPVVEERQNCGSVWSQCGGIGWSGATC
                     CASGNTCVELNPYYSQCLPNSQVTTSTSKTTSTTTRSSTTSHSSGPTSTSTTTTSSPV
                     VTTPPSTSIPGGASSTASWSGNPFSGVQMWANDYYASEVSSLAIPSMTGAMATKAAEV
                     AKVPSFQWLDRNVTIDTLFAHTLSQIRAANQKGANPPYAGIFVVYDLPDRDCAAAASN
                     GEFSIANNGAANYKTYIDAIRSLVIQYSDIRIIFVIEPDSLANMVTNLNVAKCANAES
                     TYKELTVYALQQLNLPNVAMYLDAGHAGWLGWPANIQPAANLFAEIYTSAGKPAAVRG
                     LATNVANYNGWSLATPPSYTQGDPNYDESHYVQALAPLLTANGFPAHFITDTGRNGKQ
                     PTGQRQWGDWCNVIGTGFGVRPTTNTGLDIEDAFVWVKPGGECDGTSNTTSPRYDYHC
                     GLSDALQPAPEAGTWFQAYFEQLLTNANPPF"
     gene            112244..114575
                     /locus_tag="THITE_2106126"
                     /db_xref="GeneID:11521361"
     mRNA            join(112244..114248,114325..114575)
                     /locus_tag="THITE_2106126"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003648499.1"
                     /db_xref="GeneID:11521361"
     CDS             join(112554..114248,114325..114447)
                     /locus_tag="THITE_2106126"
                     /note="CAZy_ID 269900"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003648547.1"
                     /db_xref="GeneID:11521361"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Thite2_2106126"
                     /translation="MPRVSRLRRQLRPGGRLAASWVKTAVLVTAFCLTALYLFARHFG
                     ASESVRLERHMNSGPLLHPLKPVKSSVDWGAVQCHYPPRQEPKGVPRPPRGAALPRIQ
                     ARFGKEPAKVRKKREDRRKSVLRLARRSWDSYRIYAWKKDALQPLSRAGKDQFSGWAA
                     TLVDSLDTLWIMGLRDEFDEAVAAVAEIDFGSCTSHRVNIFETNIRYLGGLLSAYDLS
                     GRKVLLQKAVELGDLIYSGFDTANRMPVDNIDFAAAKAGSGLVVEDTVVSASPGTLTL
                     EMTRLSQLTGDPKYYDAIAPIVELFYRGQNQTALPGLFPMFVSMLREDVTTGGTFTLG
                     GGADSLYEYFPKMHALLSGADPKLETLTRGFMDAAKQHLFFRPMVPDNDDILISGNVN
                     VDADGAPRLDPETEHLTCFIGGTFALAGRLLRSEEDVEVGARLTRGCVYAYQAFATGI
                     MPERLNMVACERGAGAEPCRWDEDKWVAEREKRPEYKPHLPKGFTTAKDPRYILRPEA
                     IESVFYMYRITGDSRWQDVAWNMFRAVAKGTATELGSAALLDVTVSKWPPPLDDYMES
                     FWIAETLKYFYLVFSPPDLISLDEYVLNTEAHPFRRPAA"
     gene            131999..134841
                     /locus_tag="THITE_2106129"
                     /db_xref="GeneID:11521360"
     mRNA            join(131999..132399,132482..134261,134316..134841)
                     /locus_tag="THITE_2106129"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648500.1"
                     /db_xref="GeneID:11521360"
     CDS             join(132251..132399,132482..134261,134316..134741)
                     /locus_tag="THITE_2106129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648548.1"
                     /db_xref="GeneID:11521360"
                     /db_xref="JGIDB:Thite2_2106129"
                     /translation="MAKKKKSGAPKPAGSQAQPAGGSTSKVDAQAPAPAKPAPAKDVD
                     HRPETSPYGSAPCTIPFAKPLSVPLDLLKKYPKLHAAYENRLPELSTIPEAVGHVLIH
                     YIHTGKYEALKPKATDAMTKQICELKTSIQAYAAARSYDMPGLMRLAENQINKHGEGL
                     PLPALLEVARDAYPTLTEADGWFLDYLRSRIRPLLRPESLLSSELLDQISSILSPHKL
                     LLKTVLELFCERIAAPPEPAASLRTSTVASPVTSPESAQATSFSPASPLSLLEMRSRS
                     ILRDGNHAPRKNLKTTPWPSPDTMSEASRTRETSVEPVLRAQEPPARAATPMIERAPA
                     TAALPEAGTVIIDVAPPPEPSVEANADVRTGNADAAPEPGVVANGTSERDVDVKAEPE
                     VSAPVEPGPVADADVALQSAGEPETDRKPEHEELPEQSAPVAPRERKDSGKEIDLEPV
                     QRELGLARGAVPETELKPGSSLQVQRGTMREADSGFWEGPDVEPEKESPPALVELGPE
                     AASTPKPETAGEPESVAPSDGIPEVAACDFAASDGAIQTQTESKPDAEPEAPEDPGSV
                     ILPKAQAPAGETVPENSTRDEVDHGSDPKPEPLPIRSVADDGEQPANLAAAMSESVLV
                     PGPEDSQIEEVEAKPVSEKVQAEKPLQAEAATEPLQADAAAKPEPEPKTDSTTVVPVP
                     DNAQPAGASEPEAAQPGREPEPEPAGKAEEQRVNTDSAVHAAPASAGERPAVLSAKPA
                     PEQEGAKTEANGAGDQACSSPVRHRSWKRRFLSLRYPTLFGRDM"
     gene            135874..137524
                     /locus_tag="THITE_2106130"
                     /db_xref="GeneID:11521359"
     mRNA            join(135874..136386,136452..137524)
                     /locus_tag="THITE_2106130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648501.1"
                     /db_xref="GeneID:11521359"
     CDS             join(136187..136386,136452..137310)
                     /locus_tag="THITE_2106130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648549.1"
                     /db_xref="GeneID:11521359"
                     /db_xref="JGIDB:Thite2_2106130"
                     /translation="MEAVRDSAEQSEAAVFSVVRPEHMKPTSVPSTASHSRSGTSSSL
                     KIPAARKASFRVREWVKRSKSSRTIHGTSPAAPSTLAPLNTQLSGARVDKPGVDSSAS
                     NKQFLGLPAAKQGSDRRTNSMDSRITQWPDFYHSSHEAGRPQTRPTLGSPAGRDRQAS
                     RYHRPESNTDLRPAPLRVPSSERPGGDRTPPPTLERKDSRWKPLPNLPAQPVPPKADS
                     TVMAPRLGEVVPPPAMGVDTPPPSPDRSANGVGAAEPAPPSTDRGKGKARGEGSSREG
                     RCDDQPGAGPHKAVRHTREERLWLHKHYHGEAPFLKAWGLDISKLADRLEGLDILRDL
                     IQAEAEKGRAQCPQAVVG"
     gene            complement(139350..141469)
                     /locus_tag="THITE_2106132"
                     /db_xref="GeneID:11521358"
     mRNA            complement(join(139350..140914,141139..141469))
                     /locus_tag="THITE_2106132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648502.1"
                     /db_xref="GeneID:11521358"
     CDS             complement(join(139647..140914,141139..141223))
                     /locus_tag="THITE_2106132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648550.1"
                     /db_xref="GeneID:11521358"
                     /db_xref="JGIDB:Thite2_2106132"
                     /translation="MATLSRQPFAPLDGARLKSLASIKNRQNALSNSPVKRKASEVSD
                     DDNSENIAPVLFSKRSKGAETWSDLSDGFAKPAAAFTLTKAASSPAFKDVLSSPPSRP
                     SSARPRNILQPKSPAARLRVKSAAPSPLTAPAGRSPTRASKRVGILSRRRTQRPDPPP
                     FNLGAGVPFSLDTALKGTIPSYSGSFRGGRRSSSNNSSGKTSSAALDFSLPTPDLRSS
                     WCFNIHEDTPEQEMTNLLQHGTCTLDISSDEESETRAGRDRADGRDKENIPPPEDVSQ
                     TSSARGSPVAAADAADIDEDVLLLKGRGPLAEMNAADFYGEGCDSTSVFIVPGDEEDP
                     EAVVDEGVLETPSADELPRLPDAQDQQMPCETDGPGSGRQQQHDVSIADVEAADIDDL
                     MEGNDRAVDAAVLAPIEGATESFELWESNSAKDEGDVPASPAPVADEENPQPMAVALF
                     "
     gene            142850..144647
                     /locus_tag="THITE_2106135"
                     /db_xref="GeneID:11521357"
     mRNA            join(142850..142978,143051..143631,143780..143888,
                     143967..144647)
                     /locus_tag="THITE_2106135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648503.1"
                     /db_xref="GeneID:11521357"
     CDS             join(143361..143631,143780..143888,143967..144498)
                     /locus_tag="THITE_2106135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648551.1"
                     /db_xref="GeneID:11521357"
                     /db_xref="InterPro:IPR000062"
                     /db_xref="JGIDB:Thite2_2106135"
                     /translation="MASINDLATAAVSALVTPAPTTAAAPPSPLPLPDSARAGTEDGA
                     HGEPAVARGALVVLEGLDRSGKTTQVKLLEQRFVELGRKVKVMRFPDRTTPIGQMIDS
                     YLRSQVDMDDHVIHLLFSANRWEAAKTIASLLTAGVTVICDRYYHSGIVYSAAKQNPS
                     LTLSWARAPEVGLPRPDLVLFLDLDENQARARGGWGGEAYEKAEMQRRVRELFWGLSL
                     GKIETASVVAEQGAVGPKEEVAVGPPTAQRLTGTEYRFRQEEEDLHVIDASPSVEEVA
                     EEVWRVVKSRVEAVEKGEMGRGIRRVS"
     gene            complement(145070..146335)
                     /locus_tag="THITE_2106137"
                     /db_xref="GeneID:11521356"
     mRNA            complement(145070..146335)
                     /locus_tag="THITE_2106137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648504.1"
                     /db_xref="GeneID:11521356"
     CDS             complement(145101..146093)
                     /locus_tag="THITE_2106137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648552.1"
                     /db_xref="GeneID:11521356"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="JGIDB:Thite2_2106137"
                     /translation="MAQFDSPSGSESPAALANGDENNKRNKAKAKGNGNGNGRTRLRD
                     GDIKDLNTGGPNGTRAIGERRSSVSKPARDFRDKPEPEPKRKKRRTAVAPGAVREEAA
                     TPGDAGDSSTRSPSPVIDFDGLSRPSVGTRERLEEDDAQKENRLARMKGAVRTLLECI
                     GEDPDREGLLATPERYAKAMLFFTKGYQENVRDIVNGAIFQERHNEMVIVKDIEVFSM
                     CEHHLVPFNGKMHIGYIPANAVIGISKLPRIAEMFARRLQIQERLTKEVANAIMEVLK
                     PQGVAVVMESSHLCMVMRGVQKTSSTTITSCVLGCFERKEKTRNEFLSLIGVNR"
     gene            146628..148175
                     /locus_tag="THITE_2106139"
                     /db_xref="GeneID:11521355"
     mRNA            join(146628..147518,147614..148175)
                     /locus_tag="THITE_2106139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648505.1"
                     /db_xref="GeneID:11521355"
     CDS             join(146877..147518,147614..148012)
                     /locus_tag="THITE_2106139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648553.1"
                     /db_xref="GeneID:11521355"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="JGIDB:Thite2_2106139"
                     /translation="MSSPSARSPPYPPHTQLPGINTASTNKKRAADGPAPPPPPLKRR
                     KASAISTASGPGSAHPLRQTSFPPDDTAVPHEARSPSADVDTMSLVSGSQVSAAAPLK
                     KKRGRKSKAEKAREQTPSAVGGRAATAVSGASDGGGRGAAKSVAGGTAGGDEGEAEDD
                     GPTEVAATADIRTKEQKEEEHRMRGMLISALSEDQFLRYENWRAANLSKASVRRLVNA
                     TTSQSVTENVVIAMRAVAKVFVGDIIESARRVQGEWILKMGEKQTDLPSPPPSATKAD
                     TGVEASPPNKEPEVEDRRGPLRPDHLREAVRRYRTGFEGGGVGMQWVFHQQQQGGVER
                     FPTRTGGRIIFR"
     gene            complement(148218..148940)
                     /locus_tag="THITE_2169110"
                     /db_xref="GeneID:11521354"
     mRNA            complement(join(148218..148639,148697..148940))
                     /locus_tag="THITE_2169110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648506.1"
                     /db_xref="GeneID:11521354"
     CDS             complement(join(148338..148639,148697..148760))
                     /locus_tag="THITE_2169110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648554.1"
                     /db_xref="GeneID:11521354"
                     /db_xref="JGIDB:Thite2_2169110"
                     /translation="MMADWEIAPGRIQVGSGANAENVAFSSSFLAQGRTVPVVDGATF
                     QVLEIEPGASVRWAAEESKSRLCSVARGIIRVSLPDTEFPIGPNGMWKVKQGVSCTVV
                     NPFYLGAVVHVTTIGEEWS"
     gene            complement(152133..156132)
                     /locus_tag="THITE_2072080"
                     /db_xref="GeneID:11521353"
     mRNA            complement(join(152133..153258,153370..153656,
                     155039..155900,155984..156132))
                     /locus_tag="THITE_2072080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648507.1"
                     /db_xref="GeneID:11521353"
     CDS             complement(join(152363..153258,153370..153656,
                     155039..155900,155984..156050))
                     /locus_tag="THITE_2072080"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648555.1"
                     /db_xref="GeneID:11521353"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="JGIDB:Thite2_2072080"
                     /translation="MASGANPTPTHSPPGPNAPRPKGILKNSYRGSPPLSPTDGHGGS
                     HPAAHSMSPKAAKELTIANTQYNAGHRRPSSAAGSRPGGSRRQSSLPPHKPGNGEEEQ
                     GQRLKWDEANLYLTEQERTSTMKINEPKTPYARHYDPSEDPSDVDDEEEGVAEPLDPG
                     RADLDRVDGVPRRRGQAQQRRRAGAADDEIPRLSLGEPEEEVPEPEFPASSSSSRHRA
                     VHVDSNGSGHDTDGEEYMVGLSAEEREKHRRFEEMRKKHYEMKDVAALLGHPEQLEDE
                     DDDDDDDNDNDDNDGERRGIPPVPPLPGRVNGSSSIGAEDVCASNPMHLVRLQRPFQR
                     AAAAAVLRPTTTTTTATTSLEDRFALLRIRSPVAANAAVAGRRYATVKSQGAYKLKSK
                     KTIPKKMGAKKTGDQYVIPGNIIYKQRGTIWHPGENTIMGRDHTIHAAVAGYVKYYRD
                     PQRHPKRQYIGVAFNREDKLPYPPAAPRRRKLNMVAVPRKVEEPVEETTAPSGIPLSV
                     TRHEPVAETTTTAASTAAAAEQSTAKLERPIPLVDGNAVVASLVREKLRSRQMGQARA
                     EARMREQQKELEARKATRVFRLQSDYSYRETNWEIGRLVGDAGVIPGTEKTESRKAKF
                     RLRKRRRVFYYRGLKSRRLAKARRREEHARRVRANRERARQQAAAAAAAAAAADAAKA
                     AGAAAAGPAKVAQGDDGKVDA"
     gene            complement(156861..159812)
                     /locus_tag="THITE_2060441"
                     /db_xref="GeneID:11521352"
     mRNA            complement(join(156861..157704,157785..157875,
                     157949..158370,158441..158881,158975..159148,
                     159242..159333,159415..159812))
                     /locus_tag="THITE_2060441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648508.1"
                     /db_xref="GeneID:11521352"
     CDS             complement(join(157489..157704,157785..157875,
                     157949..158370,158441..158881,158975..159148,
                     159242..159333,159415..159694))
                     /locus_tag="THITE_2060441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648556.1"
                     /db_xref="GeneID:11521352"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2060441"
                     /translation="MASKESADGAPPLAHATVDGKERQHAQEKDQAQTARLEVKNRVI
                     QGAKAATEKEQSMSLLEGIRLYPKSLAWSALISTCIVMEGYDVCLINNFYAFPQFNRK
                     YGQRLSGDDWEVPAPWQAGLSNGANVGELIGLLINGWVSERFGYRWTVMVCLMLISAW
                     TALFFTAQNVQTLLAGEILCGIPWGVFQTLTITYASEVCPVAMRGYLTTYVNFCWGLG
                     QVIGIGVIMSMLDRQDEWAYRIPYALQWMWPLPLAIGIFFAPESPWWLVRKGKLDKAK
                     AALLRLTSLSRDPDFNLDETVDMMVHTTALEKKTTSGASYWDCFKGHDLRRTEIVCMV
                     WAIQNLSGNSFSNYSTYFLKQAGLPSRSAYGFALGQYGINIVGVFGAWFLMSRGIGRR
                     SLYLYGLCVLCAMLLVLGFLGLVPEAHRREASIATGSIMLGWALAYQLTVGTVCYSLV
                     GEISTRRLQLKTVALGRVLYIIVGIICGVLTPYMLNPGDWNWRNYAGFFWGGICFLCV
                     VYTYFRVPEPSGRSFAEMDMLFQKGVSARKFATTQVDVFEEDVDADVLDNYQQHTKVH
                     RVEDP"
     gene            161392..163528
                     /locus_tag="THITE_2106159"
                     /db_xref="GeneID:11521351"
     mRNA            join(161392..161758,161835..161856,161921..162181,
                     162341..162784,162849..162949,163013..163112,
                     163252..163528)
                     /locus_tag="THITE_2106159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648509.1"
                     /db_xref="GeneID:11521351"
     CDS             join(161597..161758,161835..161856,161921..162181,
                     162341..162784,162849..162949,163013..163112,
                     163252..163487)
                     /locus_tag="THITE_2106159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648557.1"
                     /db_xref="GeneID:11521351"
                     /db_xref="JGIDB:Thite2_2106159"
                     /translation="MPPFQPASPPTRLRLMMISSVLDPPPPLGPPKWPLEDEDEACLF
                     RHFVQKLAVWLDLCDPNHTFETVVPQRARDSPILLNAMFALSARHLSQTCNDDRKWHY
                     HELAGRYNYACIKMINSLLGDARYQSSWTEHLFAAAIILQVMEEMNAALPVDTANQAA
                     DQGHLPGMYRFVETEFLEPGTLGAASFWVALRQEIYSAVTKRQPVRLNLDHPDLVDRS
                     LEQTDEYTWANRAIVHCADVLNFCFNPERRPSLRRWEELFRWNQGWSERQPRSYREPL
                     FRQHRDSAVFPEIWYHRSCQVIGVQHHLLAKLFLLDHRIRSGSPVTAGESDEVQEVIR
                     KTVREICGIGYGNQWTPPGIFTACMAISAFGAYFRSVEDQDAMLAILEQTEKNHARPT
                     EGVILDLLQIWGRHDLLVRRTRAAHWTQRCACSFRLTGEDGETSQEDKR"
     gene            complement(<164688..170446)
                     /locus_tag="THITE_2072089"
                     /db_xref="GeneID:11521349"
     mRNA            complement(join(<164688..165188,165310..167025,
                     168029..168115,168178..169455,169511..170446))
                     /locus_tag="THITE_2072089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648510.1"
                     /db_xref="GeneID:11521349"
     CDS             complement(join(164688..165188,165310..167025,
                     168029..168115,168178..169455,169511..170293))
                     /locus_tag="THITE_2072089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648558.1"
                     /db_xref="GeneID:11521349"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004102"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR008893"
                     /db_xref="InterPro:IPR012317"
                     /db_xref="JGIDB:Thite2_2072089"
                     /translation="MPPKKAKGKKAAAATPALDGCKLALSGTFMGLSHVMIKAKAEKL
                     GAAVRSTVTDDTTHLVVTESDYKKPSPKVAQAQKLGIHIVSLEWLLRSEQNGAREPEK
                     DHVPGASAKKDAGPTDAGKPTSSQNGDTASTSSRTRKRTSRQVADNASDNEAEPKAKR
                     TRGRKTTAAKADDVVGANDAGADEASANDAEPEDEKKAKPKAERTVGDGQVAKRKDLQ
                     IPLDEGCVFVTSKVYIDDSGVIWDASLNQTNASHNSNKFYRIQLLVDPSGTYRTWTRW
                     GRVGERGQVACASVSSVDDAKRMFEKKFKEKSGLLWSQRGEPPKPGKYAFVEKNYDEE
                     DSDEEGEADGAEAEEKKASSREPAKCTLEPAVQRLMELIFNQQYFDATMSSLNYDANK
                     LPLGKLSKATIMRGFQALKDLSALIDDPSLAASYGMAHGAAVEHLSNTFYSLIPHAFG
                     RRRPPVINNQQMVKREIELLENLSDMKDAALIMKTDKSAEDDIHPLDKQYQGLKMQEM
                     TPLDPTSEEFKQLEAYLHESRGATHGHSYMIETIFRIERQGEHERFDNSVFGKMAQNR
                     RLLWHGSRCTNFGGILSAGLKIAPPEAPVSGYMFGKGIYLADMSSKSANYCCSYLSGG
                     TALLLLCEAELGDPMQELIDASYNAGEDAKKKGMVATWGQGRMGPKKWKDASCVHPSL
                     AGVKMPDTSVPPGDTNVPGAGLWYNEYICYDVAQKRTANTCVTCRVRKVRCDGKRGIC
                     TNCQRLGFACSYDGNVGVEVVPGESRGAAISVPRRRVRQACENCHARKARCNGAVVCD
                     RCRAQGLECVYRPGKRSLPLTVPRPAAPLADPIAAPAPAAAAPSPGGAMHDDVPMGYG
                     TSSSTASPVATGAEQLDPDDALALRAFDSFFRHIHHVAMFSFLHRPSLMERYHAGLLD
                     RALVLALVGITSLLTDLGPGMVEYGDRCIDEAVSLCLSALEKPTVPRLQALVLAIKHR
                     ILSKRFSGAFMLHAIASRFATALRLNHENTELCFLAREARRRVMWSIYMIDASISVGQ
                     PEFALWPDAEHQIHLQLPCNERNFDFDLPEPTEPLRPPGPDAGGVVPPLPDVLGLVAL
                     HIRLHWMRTRILHCTSRAAASPSADMLAMLPSQLAELAAELDVFEARLPVSFRGTEAN
                     FRLRSYSSRLGIFIMTHVWWRQCHLDLYRLFLPGLREALAPDALRRLDPRFVAHKRRS
                     CYEHARAMADMFSQLLSLSHGSSSTPVADLDLPACAFQCVRVLYHGLQTDAAESGLTP
                     ESVRELAAVCLRAARQSTRGPASASVQADIERLIENGLVLPEIPPPSLPGRPRGLGGG
                     LEAPYLAPHAPISASTDNMPLGVMAPAPSPAPSPGPQTARSGGGVPMTLPATTLSPMA
                     GLGLSMAETAMPAAAATAAATAGVAPSQASATTSASNAFEEVADEFNFGPELFGMESW
                     SAFSHGWMTEMGGSSSIS"
     gene            173948..175668
                     /locus_tag="THITE_2106168"
                     /db_xref="GeneID:11521348"
     mRNA            join(173948..174688,174749..174816,174891..175215,
                     175288..175668)
                     /locus_tag="THITE_2106168"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648511.1"
                     /db_xref="GeneID:11521348"
     CDS             join(174064..174688,174749..174816,174891..175215,
                     175288..175424)
                     /locus_tag="THITE_2106168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648559.1"
                     /db_xref="GeneID:11521348"
                     /db_xref="JGIDB:Thite2_2106168"
                     /translation="MSPQPRRTTTDGLESRTRTTGHFSDTESSLASVSTNQSQAARKE
                     HKITRLLSYLGSNNPLPAEIAADDVVWLMDNTAFRDAKGAWQAEFVAAAFDKQPSARV
                     LDIVGEIAHKVGLSKGAKEEETIERRIGPFVMEVLPGRRIRVNFGRRTQLKLGPGGRN
                     GISSDLVKLPDLRGGSVVRSTADVPIEVTGLLGMKTLFAEPEGWAVISDIDDTIKVTQ
                     TSDPVGILRSTFVSEPTPIDGMPELYGQIRELVTPSAPFFYLSASPYNLYPFLRSFRD
                     AYYPHGQLILRDASWMTVSGLLSSLTLGTEKYKVDRIRKIHGWLPRRKLICIGDSTQS
                     DPEAYGDAYRAFPGWIKLILIRKVTDIAAIGIREKNEPERFEKAFAGVPR"
     gene            <175856..>176718
                     /locus_tag="THITE_2083750"
                     /db_xref="GeneID:11521347"
     mRNA            join(<175856..176455,176524..>176718)
                     /locus_tag="THITE_2083750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648512.1"
                     /db_xref="GeneID:11521347"
     CDS             join(175856..176455,176524..176718)
                     /locus_tag="THITE_2083750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648560.1"
                     /db_xref="GeneID:11521347"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="JGIDB:Thite2_2083750"
                     /translation="MASEVPPKRQKSAKDVPYHLIYWPGIPGRGEHVRLALEEAGAEY
                     TDTAFTDGGVDEVLAYVQGKIPDDGLNPPPCAPPILKHGDLVISQTPNILLYLGNRLG
                     LVPDADQDPDAMYKINALALTALDGLSNEPHDCHHPIASGLYYEDQKEEAKRRSEDYV
                     KNRLPKFLSYFERVLESKASGDGPWLYGGALTYADLVLFQCVDGVKFMFPKAMAKLER
                     GGKHAKVFQLYQAVAERPKIKAYLQSDRRQKYSNGIYRYYEELDFA"
     gene            complement(177161..178870)
                     /locus_tag="THITE_2106174"
                     /db_xref="GeneID:11521346"
     mRNA            complement(join(177161..177316,177396..178365,
                     178457..178870))
                     /locus_tag="THITE_2106174"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648513.1"
                     /db_xref="GeneID:11521346"
     CDS             complement(join(177310..177316,177396..178365,
                     178457..178793))
                     /locus_tag="THITE_2106174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648561.1"
                     /db_xref="GeneID:11521346"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="JGIDB:Thite2_2106174"
                     /translation="MLSGILIFNQKGENLIFRAFRNDCRPRLADVFRIQVISNAQVRS
                     PILTLGSTTFSHVKHENIYLVAITKSNANAALVFEFLYRLIQLGRSYFGKFDEEAVKN
                     NFVLVYELLDEIIDFGYPQNTETDTLKMYITTEGVKSERAVEDSAKITMQATGALSWR
                     KADVKYRKNEAFVDVIEDVNLLMSATGAVLRADVTGQIIMRAYLSGTPECKFGLNDRL
                     LLDNDGLLSLPSGNRMGSKATKAAAGSVTLEDCQFHQCVKLGKFDSDRIISFIPPDGE
                     FELMRYRATENVNLPFKVHAIVNEVGKTKVEYSIGVRANFGSKLFATNVVVRIPTPLN
                     TARITERCTQGKAKYEPSENNIVWKIGRFTGQSEFVLTAEAELTSMTNQKAWSRPPLS
                     MNFSLLMFTSSGLLVRYLKVFEKSNYSSVKWVRYMTRAGSYEIRF"
     gene            complement(<179341..>181034)
                     /locus_tag="THITE_2039728"
                     /db_xref="GeneID:11521345"
     mRNA            complement(join(<179341..180485,180566..180713,
                     180783..>181034))
                     /locus_tag="THITE_2039728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648514.1"
                     /db_xref="GeneID:11521345"
     CDS             complement(join(179341..180485,180566..180713,
                     180783..181034))
                     /locus_tag="THITE_2039728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648562.1"
                     /db_xref="GeneID:11521345"
                     /db_xref="InterPro:IPR007913"
                     /db_xref="JGIDB:Thite2_2039728"
                     /translation="MADDGHANAEPPAASVHPAGGHGHNLRESLRETLPINVALNKPN
                     GHNVTASHVMDEIASPTSPRLFAANPFSRKNTSLDIDDYFTGPRDTQKHSKWPIFLRM
                     HGSILPKLILPLAAVAAWTTLFTCISKLVTPLIVDSVLLTVLGFVVGLGLSFRSSTAY
                     ERYAEGRRYWAQLILASQNLGRVFWLHAGERKDVPEEKRAEARKRELLEKLTALNLIV
                     AFAVALKHRLRFEPYTCYEDISSLVSHLDTYAQSATRDDQENAQRTLRKSGRVKSVAE
                     YLGISFAESNPRKAVKKAGRPLGNLPLEILSYLASYTDELALSGRLPVPMQQTLAYNN
                     IAALNDVLAGTERVLNTPLPIAYSIAIAQITWVYVLVLPFQMLQKLDWMTIPATVVAA
                     YIILGILFIGREIENPFGNDVNDLPLEAYCAQIAAEMDVIASRPKPQSRDWIESVDNR
                     VLWPLSSSGWPMWMTRPEEKIQEAVRHKVEATFASQKKKEAAAEGRPVSEAGRHLKEA
                     TIDGVV"
     gene            <184230..>191054
                     /locus_tag="THITE_153729"
                     /db_xref="GeneID:11521344"
     mRNA            join(<184230..184495,184563..184752,191028..>191054)
                     /locus_tag="THITE_153729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648515.1"
                     /db_xref="GeneID:11521344"
     CDS             join(184230..184495,184563..184752,191028..191054)
                     /locus_tag="THITE_153729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648563.1"
                     /db_xref="GeneID:11521344"
                     /db_xref="JGIDB:Thite2_153729"
                     /translation="MVSALSSSAGYIRHLAPRCQGTAKSSASELELSGNFHFAYLALS
                     NFGKCGTRCHGPGSSTHAAVTSLLAQPPTSPTQYRTCPLRPDLAPTPLAAAILILGRG
                     PLKAATISMSRVAKQSSGTKAFEDGTFNFLSTPDGHFGLNWRTRIEVSMVEEEEEEEA
                     "
     gene            complement(<225344..>230213)
                     /locus_tag="THITE_2043103"
                     /db_xref="GeneID:11521343"
     mRNA            complement(join(<225344..225445,228666..228791,
                     230136..>230213))
                     /locus_tag="THITE_2043103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648516.1"
                     /db_xref="GeneID:11521343"
     CDS             complement(join(225344..225445,228666..228791,
                     230136..>230213))
                     /locus_tag="THITE_2043103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648564.1"
                     /db_xref="GeneID:11521343"
                     /db_xref="JGIDB:Thite2_2043103"
                     /translation="TTQGILVQFSIYILIVFLFLLRLKVFAFIPYFKEDIVKLIIHLN
                     KLFNFLDRFYINFTKLCYIKNDFIYPIIFFLKTISKLESNYPIYNKELLTIIYTIEE"
     gene            complement(<249156..>249602)
                     /locus_tag="THITE_2041100"
                     /db_xref="GeneID:11521342"
     mRNA            complement(join(<249156..249238,249257..>249602))
                     /locus_tag="THITE_2041100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648517.1"
                     /db_xref="GeneID:11521342"
     CDS             complement(join(249156..249238,249257..>249602))
                     /locus_tag="THITE_2041100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648565.1"
                     /db_xref="GeneID:11521342"
                     /db_xref="InterPro:IPR013103"
                     /db_xref="JGIDB:Thite2_2041100"
                     /translation="LYKLGFVIFLYDDGAFINTKLEIAILYYINDLIIIGPNINDINN
                     ITNEASQYIKLQSLEEIDTFLSINIIIDRKKKEIHIHQIPYINSILEKYKKNNLYLSN
                     TLIDLNNKLYKNQDIKIYQQEIGSLLYLALKTRLDIAFAV"
     gene            <299292..>299528
                     /locus_tag="THITE_2042071"
                     /db_xref="GeneID:11521341"
     mRNA            join(<299292..299369,299397..>299528)
                     /locus_tag="THITE_2042071"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648518.1"
                     /db_xref="GeneID:11521341"
     CDS             join(<299292..299369,299397..299528)
                     /locus_tag="THITE_2042071"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648566.1"
                     /db_xref="GeneID:11521341"
                     /db_xref="JGIDB:Thite2_2042071"
                     /translation="LGDYITVYFNNVLVYLNKSRKDYIKKDVGLNLDLKKYIFVVKEV
                     KYLGYIVEVEVYIYFNPKKIKAIYK"
     gene            complement(314572..317580)
                     /locus_tag="THITE_2106178"
                     /db_xref="GeneID:11521340"
     mRNA            complement(314572..317580)
                     /locus_tag="THITE_2106178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648519.1"
                     /db_xref="GeneID:11521340"
     CDS             complement(314724..316979)
                     /locus_tag="THITE_2106178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648567.1"
                     /db_xref="GeneID:11521340"
                     /db_xref="InterPro:IPR004601"
                     /db_xref="JGIDB:Thite2_2106178"
                     /translation="MMTSITATLPLPSASAALNRWPIARCRFQRPHRVSASISATALW
                     YQCLQRFALRLCFVPRLTLLPVPTNCCLPASLATNLPAPHIYTAPACRTTRRFSSMAR
                     NPEKSTDFPPSLELATNDFETPLRPEVHLRRSSRRLSKTMQPGGNAPSIPENLLGIRQ
                     QRGESLGSEEMQDRKKMVKGDVQLAIEGLARMEHRLRSATKRQKLQIEEDTRLTETRV
                     TAGQQVTRSPSVRKASLKSTGLARLGLLPTVDEEDKDDFAGGLSGGKNQDLEARRIDV
                     PEEVPDVPERGASRPPPVNSDYLPLPWKGRLGYACLNTYLRSAKTPVFCSRTCRMSSI
                     IEHRYPLSDPSQPEHAVKNRPDRSKEPSRELGERFLQNLGLANARDIVKMLRWNDRYG
                     IKFMRLSSEMFPFASHPEHGYKLAPFASEVLAEAGRVAAELGHRLTMHPGQFTQLGSP
                     RQEVVTAAVRDLEYHDEVLSLLRLPEQQDRDAVMILHMGGIFGDKAATLDRFRKNYAE
                     LSPSIKARLVLENDDVGWSVHDLLPICEELNIPLVLDYHHHNIIFDETKCREGTLDIS
                     QPELQARIAATWTRKGIRQKMHYSEPCPGAVTPRDRRKHSPRVTTLPPCPPDMDLMIE
                     AKDKEQAVFELMRAFRLPGFGLIHDMIPHEREDESHPAPTVPKKRQKPAANLKRKRAP
                     DEDPIGLNDVGAGADDEYQVIGAREVSAEDYAMGGPDGRVYWPPGREDWLKPARKGAR
                     TLEVSDYEDEC"
     gene            complement(<320856..>322885)
                     /locus_tag="THITE_2039153"
                     /db_xref="GeneID:11521339"
     mRNA            complement(join(<320856..321659,321720..322040,
                     322181..322562,322671..>322885))
                     /locus_tag="THITE_2039153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648520.1"
                     /db_xref="GeneID:11521339"
     CDS             complement(join(320856..321659,321720..322040,
                     322181..322562,322671..>322885))
                     /locus_tag="THITE_2039153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648568.1"
                     /db_xref="GeneID:11521339"
                     /db_xref="JGIDB:Thite2_2039153"
                     /translation="DLKTVFLCAKIKQLRSAVLANATGIRQLSDAIDKEQQVVRDLVG
                     RIEVHKKRLRLEEAKKEYEERLERAAPWRDLTPWSVELPRAPIRRSPRPVRRELPELP
                     LHAAARAAREIQPIYPQVAPNFAPGPLFPPLQHWCPQEALVPAPAPAPETIPFQHAVL
                     APPAEPETVDIVMVDAPDWVEDEDEVMDVSMVDIEMADAPYEPLLCQGSPTPALSALP
                     PCFSPVSTDLADAAMEVEQEPPRLTFPTLPAADAAAFVPPPTPKDNAQLPVATSGSRP
                     SSSLVPPTEPRLSDDNCAMVEQPAPAPEPEASLPAAAFQFSAAAFSAPTPTSTDDGPA
                     PFIFGLTAPAHTQSTAPAAEPATISFSFEAREPLETRGAAKSKSRPGRRQQARSAAAA
                     SARAARLVAAQSVAPQSSQAPEAATASPQQPSSPRDKGKGKASTPPPEAEPTRVATPP
                     EAPSAFVDDLMPGEILRSVCEDLIVAGAAFMNASPAVQCGKLSPSWVKRWQQSALVHV
                     GEELGPNIDELEFEHDEAAATVKRLLHYSFLRFPDGPDTEDKNAVFRHMKELAAEEGL
                     DLGRIEV"
     gene            complement(326668..327419)
                     /locus_tag="THITE_2106179"
                     /db_xref="GeneID:11521338"
     mRNA            complement(326668..327419)
                     /locus_tag="THITE_2106179"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003648521.1"
                     /db_xref="GeneID:11521338"
     CDS             complement(326965..327135)
                     /locus_tag="THITE_2106179"
                     /note="CAZy_ID 270165"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003648569.1"
                     /db_xref="GeneID:11521338"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Thite2_2106179"
                     /translation="MTPYLDFGFQNCRCGYRDMFEVAEMVSNYGVAQIPLEVAFTDVD
                     YVDKRRVSDKAR"
     gene            complement(329398..332324)
                     /locus_tag="THITE_2106180"
                     /db_xref="GeneID:11521337"
     mRNA            complement(join(329398..331564,331623..332014,
                     332078..332324))
                     /locus_tag="THITE_2106180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648522.1"
                     /db_xref="GeneID:11521337"
     CDS             complement(join(329521..331564,331623..332014,
                     332078..332188))
                     /locus_tag="THITE_2106180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648570.1"
                     /db_xref="GeneID:11521337"
                     /db_xref="JGIDB:Thite2_2106180"
                     /translation="MEPSSKRRRLAPKVPDLPPTPQAQAQLPPPHAFPPDQVPPQHYP
                     HAEPAPRLPERDEFEAFARHLQDAAIHIQQQTLRPKHTSVSVLMLRWEEDTSVEQDLL
                     ALEKVFRERYHYHTVKWAIPTVPNPSTKLGIQIASFLDNARPDHLLIIYYAGHGYVGP
                     DNQLYWACNPRENAAKLKWDGVRCLLEDAQSEILLLIDSCAVRDAPLAGSHGAKQAIA
                     AYTPDQASLEPGPRSFTATLAETLQNLSAPCQPFSAQKLYDHLRQQKQQESAQAVGRL
                     ANGPAKPVAVAERSPAFFTLTPAKGHGIVLVPLDPKAAQLQSPPDSADDADAQNAWKL
                     KPEDRPFSPEEVLDLVLDEQRVLVCTTFVGDASPDMAFFNQWLHNMPPTASKITVEGM
                     FLGPPTMLLISMPLNVWNIVQHDKVCCFLGHISSHNMIHLYQRLVNTRGNGLPGAMKS
                     TEDARAVNHSSSAVRGAETPGRYPPSLHKETPRPQGNHIAHAAAANVPAPLSQASPGK
                     IPSVDPKDEAEDSVEMQEAAEQLKALSHVRHIGDSTPATLERQPTGVADSIAVRHAGD
                     FGSPSDAALYDAEFSTPSAKPRARKPLQKHTPRQEVRCDHCSHAPFKDSSSLRKHIAA
                     AHTRPFPCAFSFAGCTSTFGSKNEWKRHISSQHLCLQYYRCSSCPQSAADGKGNEFNR
                     KDLFTQHLRRMHAPFAIKKATAKGDSKLQAEWDAHVKDMQTSCLVTRRQPPQRSACPK
                     PDCQSVFEGPGSWDEWTEHVGRHMEKGEAGRMGVDPLLAEWALDEGIVEKVGEGEYRL
                     CPGNGPGGSERESNGLSKALSDGGKKPEEDDDPSITVAMPTPVADNMDVD"
     gene            complement(337562..340259)
                     /locus_tag="THITE_2106184"
                     /db_xref="GeneID:11521336"
     mRNA            complement(join(337562..338593,338671..338790,
                     338878..339163,339247..339794,339872..339948,
                     340106..340259))
                     /locus_tag="THITE_2106184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648523.1"
                     /db_xref="GeneID:11521336"
     CDS             complement(join(337666..338593,338671..338790,
                     338878..339163,339247..339421))
                     /locus_tag="THITE_2106184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648571.1"
                     /db_xref="GeneID:11521336"
                     /db_xref="JGIDB:Thite2_2106184"
                     /translation="MQSPWASAGLVPGHSAWTLVPMVPPGAGGISWPAASPAQELVPV
                     PVAQQMQDSEILSIYVKFLSQFTASLDGHPDASNPYLKYYVPFCVNSQLLVHVAIYSA
                     ACFLTDTGHVERTVAMAHKGRVIKLLNEHIRSQLSASDEAIAGVVQLVVDEWLWGDAN
                     DLRAHLRGLQEMIRFRGGFRTLGLHGLISKLAMTSDVAIALSFEVSPFLQGGSEFEFR
                     DNVQIPLRLALNTPFISTLVAFSSCDDALRIHPAVASILDDMRFLLATVLALPETPSA
                     KELHKVHTTSAWIHERISSLPEESPAARRPSAGSSTTPSRDSPVTDIREGQQQAGHGR
                     PRGLTPQQQSGWPPMPVPGQAGTDHLREGSPNPGRQASPNNNSQSPPPAAAEPPDHVY
                     QAVRLAALLYSRAIMRRRPFSEVVLPGEFLRLWTTAWRVPLSTWRSLLGVLAWILLPI
                     LPSGKAAQPHDRLVKAVMNITLFQIGMDNWEIGSAVMAAALSLQRWLAGGAR"
     gene            complement(348323..350542)
                     /locus_tag="THITE_2106186"
                     /db_xref="GeneID:11521335"
     mRNA            complement(join(348323..349635,349713..350274,
                     350351..350542))
                     /locus_tag="THITE_2106186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648524.1"
                     /db_xref="GeneID:11521335"
     CDS             complement(join(348375..349635,349713..350274,
                     350351..350417))
                     /locus_tag="THITE_2106186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648572.1"
                     /db_xref="GeneID:11521335"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="JGIDB:Thite2_2106186"
                     /translation="MDANGLKRKDTTKGPPLRILSLDGGGVRGYSMFLILQDLMYRTF
                     VEIEGRAPRRHEIPKPCDHFDLIVGTGTGGLIALMLGRLRLDIETCKELYVRLTRMVF
                     ETDKTIAGIPYRSTLFKATKLEEAIKECVREHTVYEKEGNDGSDAPSVSPLSPVSRSS
                     AASPRRHSSNASVVSFSARSPTAQAARPVFSRGGNPNARLYDEREDRTKTAVTAIYKG
                     TPKGGPPALLRSYDSRREPAPEFDCTIWQAGRATCAIGLAFKPIQIGQSVFHDDGAGN
                     FNPSVTALDEAVVNEWPGREVGVFVSVGTGKRPKGSDANSALWYEGFLGEFAEARRKL
                     IAKIEGCEKIHEQMKREHLPKRGVNIENYYRLNVEVGVGEFGMNEWNRLADISTNTKR
                     YLAREEERQMVQSASAKLAKIHFAKQRWERLSVSGTGAVQPVPDIVMPLAVELPGDMP
                     TSPPQSNPSPSRQSYDSGSDVLPVRASTPSPRSSVEPPRHSPQLNQLPFPAAPATGAP
                     PTPPDRPAKPPAVTSPTRNERTADESDRLVVSAPTPAQYRIAAGMDKIVVAGPDASPR
                     RFQDPLMQPAPPRPEPPPLPPKTPLPEHQAAYGRRSGPVAPYPLDDEAPPVVNMARKP
                     NYSGW"
     gene            351520..354272
                     /locus_tag="THITE_2106190"
                     /db_xref="GeneID:11521333"
     mRNA            join(351520..352256,352314..354272)
                     /locus_tag="THITE_2106190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648525.1"
                     /db_xref="GeneID:11521333"
     CDS             join(351827..352256,352314..354112)
                     /locus_tag="THITE_2106190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648573.1"
                     /db_xref="GeneID:11521333"
                     /db_xref="JGIDB:Thite2_2106190"
                     /translation="MFSSCFGSGRRRRSEEQEPLLPQYNHDTAIQRRLHQKLHTYQML
                     RALSKGFMPSNEQAIVSLRTLLAADLLNPDNTQLSDSGQALVHYTKQWIKQLIELLQH
                     KNAGDQIQDFIWYLSKAKVSVDMEHVAERASKAKTKADTAAVYRSLQTVGSLLLTNSN
                     FRLFLGDLNVVAREVFRDTAFSLSEASREAGKRLEPSAEEQDSARQPGGDSHTPPSQH
                     DLMDQAAEVSRVLSGTASTVVDEAESSITQKLGGPEKDTMIHRLKEAVLDLRRRKDYS
                     DSVSTLSLLLRRYATVYSRMARDTLQAADQDVNWNPETDRGLTNFWGFLKSFGEAREW
                     EELEKRAQAVMEHGREDPQFEELVSQLGDALQEMCMDPSFFDHAEQRFQELRAKSKAL
                     SARSSLRDDIDELMTQLQRTFHSILRDKDVCAIMNTTRTIGRILSPKHQYTNPDLVGD
                     ALNVFVPLLIQSIHYIPIPRLEVSTPEVDLLLENLILEPGITVNNSSFFPYKLRVETL
                     NDIEIRKARFRTTSAVKTLMRIRIDGLSIRGEEIGYWLRAHTGLLRLADEGIASFALD
                     ERGLDIQLDVEVGRDRLEKVLSLRGVRVRIHKLNWKLRRSKFSLLAWLFKPFLRPIIR
                     KTIEAKIASAIGEALHFANRELLYARERLRATRIADPDDLKTFFKAVLARLTPPEDPD
                     LYTRVGVSAPGYGVFEGVYAPGSIAKLWRDEAAQAPQRIRENERDGWRNSIFDVQAAT
                     PA"
     gene            <354879..>355529
                     /locus_tag="THITE_2040977"
                     /db_xref="GeneID:11521331"
     mRNA            join(<354879..355171,355260..355379,355451..>355529)
                     /locus_tag="THITE_2040977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648526.1"
                     /db_xref="GeneID:11521331"
     CDS             join(354879..355171,355260..355379,355451..355529)
                     /locus_tag="THITE_2040977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648574.1"
                     /db_xref="GeneID:11521331"
                     /db_xref="JGIDB:Thite2_2040977"
                     /translation="MILADLFSMILRLAELAFGAIVAGLNGDYLHAAQHADSWQLHRF
                     IYAEVVAGVSIFFAVVGLFPFSGCFIHWPVDFIISVAWFVAFGLLVDWLSGNCGYVFD
                     WDGLAFDGSASCAQWKATIGFSFLSAICWLVSAMLGIYWVHRHTAPVGGSYSRRPWYR
                     LRI"
     gene            356717..358171
                     /locus_tag="THITE_2106193"
                     /db_xref="GeneID:11521328"
     mRNA            join(356717..357769,357860..358171)
                     /locus_tag="THITE_2106193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648527.1"
                     /db_xref="GeneID:11521328"
     CDS             join(356925..357769,357860..358028)
                     /locus_tag="THITE_2106193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648575.1"
                     /db_xref="GeneID:11521328"
                     /db_xref="JGIDB:Thite2_2106193"
                     /translation="MSGIVHKIKEAVHSDKGQQGAPEGTYGPHSSRTANAADPRVDSD
                     RDNSTTLGTGRTAGQGEYGSTGYGTGTGYGTGTGTGTAEGTYGPHSSRVANAADPRVD
                     SDRDNSATIGTGRTAGQGEYGSTGYGTGTGYGTGTGTGTAEGTYGPHSSRVANAADPR
                     VDSDRDNSATIGTGYGSTGSTGTTGYGSGQYASGGAGSGVTGVTGTHGAAEGTYGPHS
                     SRIANAADPRVDSDRDGRGAIGTGPGPAPNTAGPHKSDVVNKMDPRVDSDLDGSRTVG
                     GNRTFQSGAASTYRDPTDAAQVPPSVLRRHIGDPSIEHGDVAHHRERRNSVKTYQETF
                     SGI"
     gene            complement(<358289..>359579)
                     /locus_tag="THITE_2037150"
                     /db_xref="GeneID:11521324"
     mRNA            complement(join(<358289..358539,358607..>359579))
                     /locus_tag="THITE_2037150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648528.1"
                     /db_xref="GeneID:11521324"
     CDS             complement(join(358289..358539,358607..359579))
                     /locus_tag="THITE_2037150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648576.1"
                     /db_xref="GeneID:11521324"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2037150"
                     /translation="MISGGSDAAIKLWDLEQCANPWKPHTYHPVAVVPRAPSGPGPGP
                     GSVGGHRFGITHLCFYPFDSAAFLSSSYDQTLKLWSTERASVSGSFDLGAKAYAHAIS
                     PIAAHLLVACGTQHPAVRLVDLRSSAAVQSLVSPGQLGGSAGATLAVAWSPAHEHVLA
                     AGSVDGRVRIWDVRKANGLVALLDQEDTVGIVDAETPRAPRLSAKAHAGPVNGLTWTD
                     DGAYLVSAGHDGRIRVWDAATGANTLANFGPSIRNSQMGTLTMFVSPVGLTPPGRELL
                     FFPNETEILVMDLHEGSTVTRLRGMGPAVAAVGTRRGGERTVRNRVTCIAWRGAGGGG
                     GSSGMVMGGSNAPGGVYSGHSDGQIRAWLPRLEGADDEAESKDEEDASAARAKKRKVL
                     DDAFRSLMGRQVTFS"
     gene            complement(359592..360075)
                     /locus_tag="THITE_2106195"
                     /db_xref="GeneID:11521322"
     mRNA            complement(359592..360075)
                     /locus_tag="THITE_2106195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648529.1"
                     /db_xref="GeneID:11521322"
     CDS             complement(359655..359930)
                     /locus_tag="THITE_2106195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648577.1"
                     /db_xref="GeneID:11521322"
                     /db_xref="JGIDB:Thite2_2106195"
                     /translation="MNALLFDRSSGILGPNAFARLQTAGLLASFSAAPRFRFDGGERP
                     VEDAAGQPAGSSSVLPSGQGPDVWRVSLWAHQAGVSALALERFEGRM"
     gene            360201..361517
                     /locus_tag="THITE_2106197"
                     /db_xref="GeneID:11521321"
     mRNA            join(360201..360508,360566..361284,361336..361517)
                     /locus_tag="THITE_2106197"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648530.1"
                     /db_xref="GeneID:11521321"
     CDS             join(360370..360508,360566..361161)
                     /locus_tag="THITE_2106197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648578.1"
                     /db_xref="GeneID:11521321"
                     /db_xref="JGIDB:Thite2_2106197"
                     /translation="MESSRNPKSPSPAETAPPSSVSSSTTSLDHVKRLRGRDANVYDA
                     VAGRITLNEALSDAETANGRGRRRLKSTAGRYSSRNPKLAPEEALFRRKNAPVRYAEQ
                     DIYWANEDLPDGGLGYLPDSGLLKSVHGYASRFYEAAAARLGPKCVVGTRIVDERSMD
                     ETALLAFGILLEEASRDALGKRDDLVFTEASMEPKAVTGVAAVQETPRMASAEAPGLV
                     GEASAAHQTRKVKRRKVAKEESLDDK"
     gene            <366281..>369831
                     /locus_tag="THITE_40970"
                     /db_xref="GeneID:11521320"
     mRNA            join(<366281..366559,366636..366745,366804..368282,
                     368348..368464,368556..369170,369291..>369831)
                     /locus_tag="THITE_40970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648531.1"
                     /db_xref="GeneID:11521320"
     CDS             join(366281..366559,366636..366745,366804..368282,
                     368348..368464,368556..369170,369291..369831)
                     /locus_tag="THITE_40970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648579.1"
                     /db_xref="GeneID:11521320"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_40970"
                     /translation="MTPVTPHSAVPPPPPPHPPHSQAYGEDRRHVSFDNGSQPGGMYS
                     RQPSYQPPTPLPHPQPYDYPPQYASHGELPYPIQVAAATGKRKAQRASQACDMCRQLK
                     AKCDELKPCKSCKEKNVECKYREAVPKQQDKMAADILDALLTLQSKFETFEQRMDRLE
                     HMVALNRPSAAPTAEPARDEDERPESAESAAPVAGDGDPGSPGEAAPTQAPIDIVQAR
                     AITRDMEEEKEVEPGPVVPPGVPSIPPNHTTLAAFLLKWRPIAVLVRDILEAENVKYV
                     GEFPIRQEEKRGLLRVWGRGEGLESSLRFDKADREAIRDAGAMEVVQDDVSDAGGAPS
                     PADCWGGISGSPAPIDGKPVIGLQTPDFSESLVWKYVKSYQDNIQNMHPLIIPFELNA
                     MVKLFLDTVQQSLGRQSRSSGIAKFAVTPSPQSETGSKRKRSPGPEGAGGESPSGSPK
                     SAKPVFQRSINNALVLLVLALGKICLHKDRIPDVVPVSEPPHGSPLARNGYPASPIQA
                     SSPSQSSNPHSAGFPSPKEGAERPGPGSRRSSFQGGGGSSLRGGTSLKRNMDVIPGLD
                     YFAYATDILGGQLAGTSLRHIHAYLLAGLYHGQLGRVLESYAYIKEAGFALQIKMRPS
                     LDRFRKLQESMHVNQNAVTQKTDNQLVFAFWTCLQLESDIIAELPLPQSHILAYEDMM
                     PYPNIQVAQTLGFDEHVLQSYLAQLYLRKSLNQIHGMLYNPEKPQPLQRGNIIEHIQE
                     SLDMRFVPPRFKFNHSDPPAGDILSARLRAKYWGAQVITYRPFVRQILEFNFQRTYPN
                     EAPMPESDFRTDVSIPVIGPDARSADDIPQEIIDYAVKGIQALIESTRAFHGLKEKRF
                     IVTNVFGTAHAQWGNLLTLSAVFRDPTLHRFVDEQTLKELFARTIAFFKVIAHPTSAL
                     HIDLRILEGLERELWGKNSNSTDASDHPTGSSFSSTGSGGAGHPPPAPPPPPPVAPMP
                     PVAGPVGMHSPVNHATGGGGGRLAMSPPLASPLPQAFSEGAMMAPAAPVSASDGGPGS
                     HAAMLPPTQHHPPPPL"
     gene            complement(<370808..372243)
                     /locus_tag="THITE_2093517"
                     /db_xref="GeneID:11521319"
     mRNA            complement(join(<370808..370998,371126..371296,
                     371426..372243))
                     /locus_tag="THITE_2093517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648532.1"
                     /db_xref="GeneID:11521319"
     CDS             complement(join(370808..370998,371126..371296,
                     371426..371969))
                     /locus_tag="THITE_2093517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648580.1"
                     /db_xref="GeneID:11521319"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="JGIDB:Thite2_2093517"
                     /translation="MASPSASPPLADSPAPGSSSLDRRRVSDSNSNSSSSTPHPFDGA
                     DPASPLPQILWRLQVPLYITHMSQPATTTPPFIVSVPRFSYLAFLLPRLTAYYGLPCS
                     SFHHEEIQLRNLPVGLLVDLYQPPSLPWHLVVGDGPEWDIADTFTNSAKEADFVRNGN
                     AKQIMSLSKEHSTSLWNAVKDNDFATFSRINNRLLNTPTPLKNVPMRLYIPSSPNDPN
                     DATPGSFRVVQTLVPARLPTRAPQTLGAALKNLLPSLFPSSRDPVLANVILHGGPVPF
                     GAPLEELMREAAYPDGWLCLCVVFL"
     gene            complement(395281..400019)
                     /locus_tag="THITE_2106203"
                     /db_xref="GeneID:11521318"
     mRNA            complement(join(395281..397147,397224..400019))
                     /locus_tag="THITE_2106203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648533.1"
                     /db_xref="GeneID:11521318"
     CDS             complement(join(395594..397147,397224..399842))
                     /locus_tag="THITE_2106203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648581.1"
                     /db_xref="GeneID:11521318"
                     /db_xref="JGIDB:Thite2_2106203"
                     /translation="MVPSPLDPAVSQPSSAVPSTPHRMPSRSRTQSISSDRPSTVAHS
                     LMSPPLSVSPEPAFIAASAASQIVTNDHDSHAETWYDQHGIEPSGETAAVSPAALQLV
                     NSFLDQLLFNFLSVSRSTSLHALRPAVSEVLKPKLAKDAINQADEELREYLGGDDEDA
                     TLAHARDPVPSNNWDLELAWKRTRLRCMVYSSLGDMEEEDEDYYMEQGHLDTGLDDRF
                     SEAVSPAVAIFLTSILEFMGEQALIVAGQAAYHRMRSKYEKDLKDGVRSPTGVAERIV
                     VEDLDMERVALDRTLGRLWRSWKKKIRSPAVGSADRLNRSYSRDSLRSATGHLRSPST
                     AAEPAVPATVPEPHAEIEQGESDAQKQIEDSREPLEEHLVAAAVPLPIGPNDIAEIEV
                     PGLALYNEGESADDGTADVNEPARPKSMMILPSSGMPELHATPAPSRPLVARKRSSSL
                     PAPTLSRYVTAAKTQHDERSTVGLAGDPAAEGPEGLGAAADAPAGTVVAYEAGEPGAR
                     AGPDEYATEDEEMKEDVDDEVSIEEPRIVRSSRVSILGHSPSTGSSEHGRPASINTNL
                     PVRTPSIHSARLIDVAGPRSPAVGSRRNSVAVAESIRQSSPPRTSRTVTPPAQEDRPV
                     QPPDSASGGRLSVSVPNRSGLAASASISEAEEAADKEYVVSPAIPVSPAAPPPVAKDR
                     HEPAGAALQDRIPERSIPAKPTTKVTVLPAMSSPVSTASSTNGTFFIESMPVLPEGRE
                     IPEPPRADSLRSRSSAAAQPPPPAVPDRSAGRQAVANTSALRQPATIGQVSVERSRPR
                     SPSQGSSSRPRDPSAGRSKQQHASGSPSSTKFKPVRTSEDGMQARIDMARNFEELIQS
                     DQTIQYTLTPENMRELDPQSQPSRSVAGGSPVVSVKTRKSEEARQNGSRSRSSSVHRN
                     DARPSTSATRSSGSPTHPVTDGHQSNKNFPAAAGKHGGVVPRSIPPMPSKPRAANGPQ
                     ARDARLGRESLAEFAEFIRSTGPAGGSAAATLNASPGVGRTRHPGSVSNVSIETGRTS
                     TTSNPNRPKLQARGAAVDYKDDNSDLIDFIRRGPPSAPGNHRIPRAVAPFRTTMDSDQ
                     MSNAVGGKAVDAQLRDVDMRSSQASTNATESSVPPSIQSSVNSHSALLTRNKPPTSYD
                     AAEVDMPMPKRKTRRVRDPYAIDISDEELEEDEEPVPVPVQNRRKRAQTQEESLIDFL
                     NNYAPPPEPTVQPFNTAQTRNMLKPKKKASAPSLMARFTRRDSGQLGNGGSTGPASPD
                     VPQPPAASRSLSSQASSGGKAGHIPIQVNIPGGDVYSPPLRTSSRSAASTMTGSSGAV
                     GGRVPMKKFVPREPVSVTNRGTSDLAEFLKHSGPPAGAASMGNQLPGLAERDEANGLS
                     KVFTRRKRPSIS"
     gene            complement(402827..404032)
                     /locus_tag="THITE_2106207"
                     /db_xref="GeneID:11521317"
     mRNA            complement(402827..404032)
                     /locus_tag="THITE_2106207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648534.1"
                     /db_xref="GeneID:11521317"
     CDS             complement(403012..403920)
                     /locus_tag="THITE_2106207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648582.1"
                     /db_xref="GeneID:11521317"
                     /db_xref="JGIDB:Thite2_2106207"
                     /translation="MKASSVALGAALAAVVSALPSPPLKRAEVVSAQPTTTVPLSAPI
                     IAVRSSSDDCDPSIESCDEEVKVAAISRKGEPDDEDDGYDDKGGKGSKGGKGGKGGHG
                     HHHGHHHGHHHGHHHGHHHGHHHGHHHGHHHGHHHGHHHHGHKHKSKPDHGHERKPEG
                     HAEGKGTAEIVGKSETIGQAAELPFAAVKSHDDGEDSDKGGGDSGKGSGCEKGGHGGH
                     DSGGKGGGKGEGGKGGGEGEGEGKGGGKGEGGGHKHGDDDCESEDKGEKGGKGWSKHG
                     SSEHRRHQSGGSSHKGEGKPKLRQVV"
     gene            complement(404660..405758)
                     /locus_tag="THITE_2152641"
                     /db_xref="GeneID:11521316"
     mRNA            complement(join(404660..404774,404833..405191,
                     405297..405758))
                     /locus_tag="THITE_2152641"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648535.1"
                     /db_xref="GeneID:11521316"
     CDS             complement(join(404727..404774,404833..405191,
                     405297..405432))
                     /locus_tag="THITE_2152641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648583.1"
                     /db_xref="GeneID:11521316"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="JGIDB:Thite2_2152641"
                     /translation="MTDKTGRRRRSSSILQVYHEPPEPIEQLSDQSALPNLNADWVNA
                     KGAWTIHLVLILCLKIFYDSIPGVSQETSWTLTNITYMFGSYIMFHYVRGVPFEFNGG
                     AYDNLNMWEQIDDGAQYTPAKKFLLSVPIVLFLLSTHYTHYDLAYFTINFLAVLAVII
                     PKLPFSHRMRVGLFSGGPED"
     gene            406505..>407227
                     /locus_tag="THITE_2169126"
                     /db_xref="GeneID:11521315"
     mRNA            406505..>407227
                     /locus_tag="THITE_2169126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648536.1"
                     /db_xref="GeneID:11521315"
     CDS             406607..>407181
                     /locus_tag="THITE_2169126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648584.1"
                     /db_xref="GeneID:11521315"
                     /db_xref="JGIDB:Thite2_2169126"
                     /translation="MEQQEDTASPLLTAPGRTAPLKKEAETSEPQSPGLEPSRGDPIA
                     AEPHPTAHAGWNQGVSSGLRTSFAASSKGMSRKPLSRRVSVSPPQPDAQLIEVGSLAM
                     PLGDPGFARPSRENGWQDKFQQWCVRLMALNKEQEGIKDAGLLREAWNLWLETRVTLS
                     RAARTSAMQSAKDMNLTSDKLQEMFSEALHA"
     gene            <410324..>412714
                     /locus_tag="THITE_38345"
                     /db_xref="GeneID:11521314"
     mRNA            <410324..>412714
                     /locus_tag="THITE_38345"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648537.1"
                     /db_xref="GeneID:11521314"
     CDS             410324..412714
                     /locus_tag="THITE_38345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648585.1"
                     /db_xref="GeneID:11521314"
                     /db_xref="JGIDB:Thite2_38345"
                     /translation="MATNPQAFYCLWQNENIRERLFELLSKQDICAVRLANSACCNLV
                     TKRLFLRTHLTFTANSFTKASRLDALSRIGHHIEHLTFYFPHSNATFLPPLIHPQSGE
                     EISFMYSPPTSAKAVLTRRKYGNSELGEILTQQYPPLFHAATHVPSFISAMEQMTNMR
                     HLTIKTPGQDPRERYRRSIVDYALISLRISLERAPLTKLSKLSLSGVHPSAFQYLRHV
                     PGMGASPSAALRWRQIRKLYISAESWDFYGPSPGLDQLRIIEDYIRAFAPQLDKFSFT
                     WLGRRGPCPIALSDDPLFAPPRSSKKLFNEVTSPMSPLPPRPSPRMLAMPRLRSMSVR
                     NATMNVQQLRVLVASHKHTVREFDFENVALIRGGSWDEALAPLTENGSSDAWSRHSVG
                     ASDSRPGTARSNSSGSAVVSSVDDEQLPASSAAAEAASRELFEVDLEGMVFGGANDVE
                     AFEAGVEEWARGVSAAAQQSSRPNSSGDKTEDDGGLASDIEAAKQASQGFTTKLKKRR
                     IRRKSRKHNGEEAVEEEGRRSRDDRVSERRSDTHSHHSHHSHHSRSHHKHSRSEDTSD
                     RLSSRDSHRRHGRHRRHHSEEMVEIPFMPEVIGTDDEAYQPPATPRPKMDISVPILNP
                     EPLPVMLQPTVYDPSARHGPLTRTPDASPSSDDGLSSAQRSIEADLLAEAEEAAARAS
                     ALKRAKEAVITKLSREFSKRKADGSDARNKESAAAAAVAAGLSALSFGMNLPAHHNHH
                     HHHHHPRGLSCASSSSVAYRLREGLFGRSMAHVAVAPDHRSLESQSALVPLILSRS"
     gene            413968..417867
                     /locus_tag="THITE_2106215"
                     /db_xref="GeneID:11521313"
     mRNA            join(413968..416804,416882..417867)
                     /locus_tag="THITE_2106215"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648538.1"
                     /db_xref="GeneID:11521313"
     CDS             join(414061..416804,416882..417689)
                     /locus_tag="THITE_2106215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648586.1"
                     /db_xref="GeneID:11521313"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="JGIDB:Thite2_2106215"
                     /translation="MRVAIREQLAVVAILTVGIALAVVSIPTWLFVNNFVAGVESDSL
                     SLTASLKAARIGSEISLIQTTCQTISTRLLLQDAFKKFYSSQVNNVSTGGDPWEAANA
                     DLASALSSTGFSGLLQARLYSRNTTGDPKGLLSITGTGATDPAPILLPYKAPNGSQVY
                     LGDPEYGFPPSLYPNITYIDLNRTLDGLPSVHAFSANVFPGVSLGNGSDSAGVLLGPL
                     VVNSTFALISITIPVRDIVENGYTLGYMTLVATARTLVDVELSREGLGQTGIVLFVGS
                     VNPWNHFGPPLAASNATWVPPLEEFKQEEVRFIFPPQPADGQPDRHTQRSFGSGHFSE
                     PFQLRQYPAVLDVLGKKNPNPNNATSMLSTKNEQGYSVAVGVARPQTSLVSWAVVVEQ
                     DRSEAYEPIKTLRSILLGCVFGTLGLALLLIFPFAHWIVMPIRRLKEATENSIAPPGY
                     EDDEDELFDEENPSSGGGTASGRSSEKGVLAKMRRKMRRRRRGRLRRQGTATEATRRQ
                     FKIPAKVEEGKRYVTDELTELTQTFNEMTDELLKQYTFLDEKVAERTRELEISKKAAE
                     AANESKTLFLANISHELKTPLNGIMGMCAVCMEDDDIHRIKQSLKTVYKSGDLLLHLL
                     EDLLSFSKNQIGQQVRLEEREFRLGDIRSQILAIFDKQVRESKIKFAASFIPTENLDS
                     SPSPDRQTSVDTKRLPALGPPGVGRLKDMCLWGDQHRILQVIINLVSNSLKFTPAGGK
                     IDLRMRCVGEVEQPNDESRSSSFSKTGSNRAGRTRQRIGSVSTPSASSKGGHASISPA
                     NGGTALAINPLDPKATSHIYVRERSPTPPPPNAKTFLFEFEVEDTGPGIPDHMQQKIF
                     EPFVQGDRGLSKRYGGTGLGLSICSQLATLMGGSISLRSTPGVGTTFTMQIPLKYVKD
                     HTSSTASSSIKSRPPSAGSADGEAMRNPAPRTSAELQRQPSPSGVLDQQPRLVGLSQP
                     FFAATPNCRLSMEDQMAAIDRAMAVKESGQGRLRVLVADDNSTNIEVFSRLLKLEDIY
                     DVTVAKDGQEAYDLVKANMENNQHFDLIFMDIQMPNLDGLQSTRLIRKMGYSAPIVAL
                     TAFSEESNVKECIASGMNEFLSKPIRRRALKQVLEKFAAIPEESETGSTSRKTTPNKT
                     PVGTPEKEPKDPIADGAVVPKINGAGRPALPAAVETQ"
     gene            417868..419512
                     /locus_tag="THITE_2106217"
                     /db_xref="GeneID:11521312"
     mRNA            join(417868..418249,418309..419031,419113..419158,
                     419219..419512)
                     /locus_tag="THITE_2106217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648539.1"
                     /db_xref="GeneID:11521312"
     CDS             join(418519..419031,419113..419158,419219..419259)
                     /locus_tag="THITE_2106217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648587.1"
                     /db_xref="GeneID:11521312"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="JGIDB:Thite2_2106217"
                     /translation="MRLPYVPDPPPTSTPEEAAIVERIRARRAPRPLQPLDLALLHAP
                     AVADGWNAFLGAVRTRTSLADDVREIVIARVAVANQAWYEWMHHAPLAERGGVSRKGM
                     DEVVRREGELRLFEEDGTLKPAPEGLTEKQWVVVCYADEMTRNVQVREETFARLRELF
                     DEKEVVEITATVACYNCVSRFLVALDVGEKNGLGPDAVH"
     gene            complement(419513..420641)
                     /locus_tag="THITE_2106220"
                     /db_xref="GeneID:11521311"
     mRNA            complement(419513..420641)
                     /locus_tag="THITE_2106220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648540.1"
                     /db_xref="GeneID:11521311"
     CDS             complement(419766..420491)
                     /locus_tag="THITE_2106220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648588.1"
                     /db_xref="GeneID:11521311"
                     /db_xref="JGIDB:Thite2_2106220"
                     /translation="MTDSSSGQWILVLSLTALLLSLAVLAQIVSRYALAYLDAPSEVS
                     AFLDAVDSSIAENESYDRDIGKVQRLEDKLRLGRLLREIQRGGDDLREELNALLLGDD
                     DPRLRVGARLCWASHRLRLEEKVRRLDLLRMRFLVVHMSIIAGVAAQQTAAKKDLGPR
                     DPEKTEDAPLTPRPGGLPAALADSIKAKPPLRRLTVQAIGHQENVEGNHRKGWVGVVQ
                     ELQRSPLLRERHASIELAMSRTP"
     gene            421319..422446
                     /locus_tag="THITE_2106221"
                     /db_xref="GeneID:11521310"
     mRNA            421319..422446
                     /locus_tag="THITE_2106221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648541.1"
                     /db_xref="GeneID:11521310"
     CDS             421493..422332
                     /locus_tag="THITE_2106221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648589.1"
                     /db_xref="GeneID:11521310"
                     /db_xref="JGIDB:Thite2_2106221"
                     /translation="MAAPAAAPADAQSQFPPPKVLTYPAAAPPSLITQGAEGRLYKTT
                     HLLPDRPCALKYRPPKPYRHPILDARLTKARLSAEAKVLDRCRREGVPVPAVYAMDPA
                     AGWMMMEWIEGIPVRAAINEWLGARRPPEEGAEPSAEAADDGAPLADLMRRIGIAMGA
                     LHRTGVVHGDLTTSNMMLRPRGEGQAVNGCVGGGDDKAKVLEGEVVLIDFGLATQSMS
                     DEDRAVDLYVLERAFASTHPRAERLFATVLESYKDTFKKAPSVLVKLEDVRMRGRKRS
                     MLG"
     gene            complement(422447..423943)
                     /locus_tag="THITE_2106222"
                     /db_xref="GeneID:11521309"
     mRNA            complement(join(422447..423509,423592..423943))
                     /locus_tag="THITE_2106222"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648542.1"
                     /db_xref="GeneID:11521309"
     CDS             complement(join(422561..423509,423592..423617))
                     /locus_tag="THITE_2106222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648590.1"
                     /db_xref="GeneID:11521309"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Thite2_2106222"
                     /translation="MTKLILSTGNIVAGGPSIIRKPGAFRSNLELTNSLRSNFLAAQE
                     DCAAESHVDGVANGNGSANGAGDLDSGIRGRAPAALWTGRDETGALYVPRIDWHHHHG
                     LQEERAQYDITAKLFFLPDAPVSERRQYAREALDHVRRELRVPEVDLLIVSFPGMSFE
                     GDCEWEADRKNAAQGNSEEELATWPAIEELHRQGFAKRLGLAEFGSEKLARFLARARV
                     RPVVNQINLKNCCNVPPPLAQLAKEQGIDLLVHSDCTDILPKGTLRELLGQGLGGAGI
                     LADPETGAGGLQGDLTPLWVVKYTVVVRDRGVIENKGYFAGAELTDTK"
     gene            424590..425663
                     /locus_tag="THITE_2106224"
                     /db_xref="GeneID:11521300"
     mRNA            join(424590..424715,424778..424811,424877..424994,
                     425064..425338,425470..425663)
                     /locus_tag="THITE_2106224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648543.1"
                     /db_xref="GeneID:11521300"
     CDS             join(424705..424715,424778..424811,424877..424994,
                     425064..425338,425470..425499)
                     /locus_tag="THITE_2106224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648591.1"
                     /db_xref="GeneID:11521300"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="JGIDB:Thite2_2106224"
                     /translation="MAINYLILLSRQGKVRLAKWFTTLSPKDKAKIVKDVSQLVLARR
                     TRMCNFLEYKDTKIVYRRYASLFFIAGCSSDDNELITLEIIHRYVEQMDKYYGNVCEL
                     DIIFSFTKAYYILDELLLAGELQESSKKNVLRCISQQDALEDMEVEDEVTKIM"
     gene            426643..428401
                     /locus_tag="THITE_2106227"
                     /db_xref="GeneID:11521299"
     mRNA            join(426643..426962,427032..428401)
                     /locus_tag="THITE_2106227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648544.1"
                     /db_xref="GeneID:11521299"
     CDS             join(426957..426962,427032..428171)
                     /locus_tag="THITE_2106227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648592.1"
                     /db_xref="GeneID:11521299"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="JGIDB:Thite2_2106227"
                     /translation="MKYLSLPAFDVVTSALNFDTPDCHVTGSCDLYTTKAAGSDKKLY
                     KNIQQSLESQHAALLKLGASLSPPQRDSMAASLNLSRSSPFGSLEEVSNRRTFAYLIA
                     TLNASHPDYDFSHVLRPADFKRERVLRRVMTQIDSTLSSVRPSSTLLDAAVPRSSPAK
                     ASEFSTGVSTAPAWGPQMWAMIDKEMMLKDCTVFSYQPADDPFDEEEGAIWALHYFFF
                     NKALKRVCYLYVRGVPVMSHSPRLLPHAALSRRARAAGLPGISAAAAADDDDADYLGA
                     GKRARYWLGDRFADRVTASDDDDMDDGLIWNRDADGDVNCQYGDYDDDDLEAEEMTDA
                     DEEEGEEEEEEEEEEQGPRPDGKHCRRSSSPVRGVSEDIASRMEIDV"
     gene            complement(429519..432048)
                     /locus_tag="THITE_2106230"
                     /db_xref="GeneID:11521296"
     mRNA            complement(join(429519..430015,430224..430484,
                     430550..430756,430837..430921,431016..431089,
                     431258..431567,431865..432048))
                     /locus_tag="THITE_2106230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648545.1"
                     /db_xref="GeneID:11521296"
     CDS             complement(join(429627..430015,430224..430484,
                     430550..430756,430837..430921,431016..431089,
                     431258..431567,431865..431900))
                     /locus_tag="THITE_2106230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648593.1"
                     /db_xref="GeneID:11521296"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="JGIDB:Thite2_2106230"
                     /translation="MGQTLSEPVVEKTSEHGGDERLLYGLSAMQGWRISMEDAHTAVL
                     NLLEDNPKAAKEHPSKISFFGVFDGHGGSNVALFAGDNIHRILAKQETFKAGNYEQAL
                     KDGFLATDRAILNDPKYEEEVSGCTACVGLITEDKIYIANAGDSRSVLGVKGRAKPLS
                     FDHKPQNEGEKARITAAGGFVDFGRVNGNLALSRAIGDFEFKKSAELAPEQQIVTAYP
                     DVVVHELGDDDEFLVIACDGIWDCQSSQAVIEFVRRGIAARQDLDKICENMMDNCLAS
                     NSETGGVGCDNMTMIIVGFLKGRTKEEWYDEIARRVANGDGPCAPPEYAEFRGPGVHH
                     NFDDSDTDYGDQKQGKSFGIAGYRGRIIFLGDGTEVLTDSDDTEMFDNSEEDKDLVSQ
                     VSRSTSQEGNSESAADKTAATDAGPPAAAPPVEQEGETKFAGENKVDEKTTEEGTELK
                     KDA"
     gene            complement(433266..436789)
                     /locus_tag="THITE_2106231"
                     /db_xref="GeneID:11521274"
     mRNA            complement(433266..436789)
                     /locus_tag="THITE_2106231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648546.1"
                     /db_xref="GeneID:11521274"
     CDS             complement(433299..436316)
                     /locus_tag="THITE_2106231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648594.1"
                     /db_xref="GeneID:11521274"
                     /db_xref="InterPro:IPR008009"
                     /db_xref="JGIDB:Thite2_2106231"
                     /translation="MPSLVVTWAMTALLLVSLSTANPTISFPLNSQVPPVARIGQLFS
                     FVFSPSTFTSSSAIAYSLSNPPRWLSLDSDARRLFGTPEEEDVAPGRVVAVPLNLVAT
                     DDSGSTTLSATLVVSRSPGPMVEIPFDKQAPDFGTFSAPSAILSPPGKAFSFRLDPNT
                     FSKPSDAPVSYYATMADNTPLPAWISFDPTSLSFMGQTPPSESLVQPPERFSFQVIAS
                     DVVGFAGSSLSFDIVVGNHQLTANKTTIVLNATPGIPVSYTGLRSAVSVDGKPATAQV
                     ALVATTPNIPAWLSLDNDTWRITGVPPGTAESTNFTVTICDTFSDELNLTVSVNVTRD
                     NAGLFRGTPPNFTVSPGAHFSFDLRPYLLSPLDTEISIKTDPSYSWIRFNSSTATLFG
                     DVPAGLTDSAVDVTVKAASRDSKRSASFSFDFLIRAVPGSRGSTLTTTGPAATKSPGG
                     RPSLAGDSLGDGRFNPLLLAVLLPVFLLLALAICALFWYFRQRRARQKPPLSTRDISG
                     PLPGSFVTRTASPSVSHSLPDLTKRFGKSFSADDVFGSEKKYYLESRSAFLTRPDLAR
                     HTGEVRILAPNSSPAADPGAVPEATTTPIASSMASGALLPETRRKVSSSLSSITEASL
                     GELVDSRGLESVGNASRQSFRDKIEINVPRLPQTPGSTHTCAPSPAEPVSTPWIGSPL
                     TASDTDAVPLRAESRLSYYPPAAAMRKVSWPWFKAFRGKHQGSKLIPRLKRLSEQPSV
                     LTTDSPVSEPTVLQDNGHGRSIPDSPPLPLTEVPTSASLSGPPTRSRSGSAASRYPEK
                     LDQVQPETSGTTADSATQGPSVLSVGEHAAPSFLDQGDTPADSLSIYDDIVNRNPFCP
                     SRTWSTVPMTDETVDETVGSPALSRSASQQQRNWTVLQESPVITGRDDPAPTSGMLPE
                     MVSSVRLPQAKEGEEVQEAGKEGAKEKDAEGEGGQDSLASRSLVPSSSRPQTATSQNK
                     GVRDPGWSGPPKSQSKGVSLHSEGSKSDYAVFI"
     gene            <437425..>438530
                     /locus_tag="THITE_2043056"
                     /db_xref="GeneID:11521264"
     mRNA            join(<437425..437672,437828..437998,438239..>438530)
                     /locus_tag="THITE_2043056"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648547.1"
                     /db_xref="GeneID:11521264"
     CDS             join(437425..437672,437828..437998,438239..438530)
                     /locus_tag="THITE_2043056"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648595.1"
                     /db_xref="GeneID:11521264"
                     /db_xref="JGIDB:Thite2_2043056"
                     /translation="MTNGDRSPSPEFDPLAFGDDLAPLPEYKAAGTTEVDFSGLLGEP
                     LKLHEDLRSGCGGQLWPAGLVLAKHMLRYHRDELQHARILELGAGGGVVGLTVARGCA
                     SLEHPLYITDMVEMESLMQHNIALNGLDDRVRARVLNWGEPLSEEVLGFKPDIILAAD
                     CVYFEPAFPLLLQTLQDLLTLVPDAVVFFCFKKRRRADMQFLKAARKAFTVTEIEDED
                     RPVFSREGLFLYTFTRKQ"
     gene            440328..441207
                     /locus_tag="THITE_2106235"
                     /db_xref="GeneID:11521239"
     mRNA            440328..441207
                     /locus_tag="THITE_2106235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648548.1"
                     /db_xref="GeneID:11521239"
     CDS             440383..440835
                     /locus_tag="THITE_2106235"
                     /note="CAZy_ID 269901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648596.1"
                     /db_xref="GeneID:11521239"
                     /db_xref="JGIDB:Thite2_2106235"
                     /translation="MASPVVSSLLPIQASPSPSTSSPPAATSSSSSSGSGSSGSGSGS
                     GGSTTYQGDITYYTLGLGSCGIDDTGKDNSANIVALSAALMGAVSNANPLCGKTITIK
                     ANGKTAQAVVHDKCPVCAFGDVDASQNLFLELFGSTDGGREKIEWWFN"
     gene            complement(441569..444304)
                     /locus_tag="THITE_2106236"
                     /db_xref="GeneID:11521219"
     mRNA            complement(join(441569..443780,443841..444304))
                     /locus_tag="THITE_2106236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648549.1"
                     /db_xref="GeneID:11521219"
     CDS             complement(join(441594..443780,443841..444206))
                     /locus_tag="THITE_2106236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648597.1"
                     /db_xref="GeneID:11521219"
                     /db_xref="JGIDB:Thite2_2106236"
                     /translation="MAAASGIVPAQPGFLAIYNPSLGTTDETVADQIVYYSSASSIQA
                     GSKRRRHHRGPHQRDPAESGSGDVSNEERNEQLRQIGLAQAMVEFGRNFSRGQPVDAI
                     DTERSRVVLHELEPGWWILASIDLTRLPLPRSKTSTTQPPPPPPALNAPSPPPTDPSS
                     PSQDQKYDYSTREVKPAVLLKQDLLRAHALFLLLLPPYHPSSPPSPSPTDASDSSPQP
                     PPRSLATLFATRPRAHCAALLARHWDAFLGSWSVLLHGNPACAVLGGLKVAASGELGV
                     GVGEEDRGSAERAVLEGLVGRVPGLVDLLVGRYGHVGKAEGEEVVLGRNRGKGRGQGK
                     GSAVAIAGGNGGGNDDEGWLGVGNEVGAEDGAVFLGVGALSRQSLRALVAWMEEIYAW
                     GENAYGLVGSAAATGSRARRRRAAGKKGGTGQASAAGADKADQGRGKSKSEANSGAGQ
                     SPPSAAKDAPNETGGMDKMLSYLKLGYGTYWSLGTASPAASSDADDETAQPTDTEGAA
                     SLPPARNLNTGYFLLGLGDQGANTPEQPEPPAGEGGKRFPTVTVELEDSEGSRRTARL
                     RPVVYIHRPFIYILLFDPQSNPPTPWAELSQSLPTELSALHKPLLSSTAYRPEKPLPT
                     TATSSSAQTNPLDPSSAIYDLVFDPATLTIHSTIPNIPDPPIPASSSSPFSVAASPWT
                     RVEALATHAQLLSMYAAARADPAARERTCKTARGWWVVWNRIGGGGGAFAGGTDSRDN
                     AGGGGGGGGADAPAGEEDDDDWGRETKGGGGGGGGAVGKEVFLVRRASDHGPGVSGLR
                     GVSGSYVGGGGGGGDGRGNGGGGGWADGASRLAQGIGVDTRRYIEALLSLNR"
     gene            complement(444576..448012)
                     /locus_tag="THITE_2106238"
                     /db_xref="GeneID:11521198"
     mRNA            complement(444576..448012)
                     /locus_tag="THITE_2106238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648550.1"
                     /db_xref="GeneID:11521198"
     CDS             complement(444910..447627)
                     /locus_tag="THITE_2106238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648598.1"
                     /db_xref="GeneID:11521198"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Thite2_2106238"
                     /translation="MTILSALSWRACLALCRVHALSAPALSARQRVFGSRSSLLRAHS
                     TETDASLPEATGESDAPAVTASELAATDQPDQPNQPASLIDRLRHVPVRAHGALESIV
                     IKPLTPYPHRREAHNERRKAFIARAQQARLRENLRRPTLGDWRVILRNLISWTPKYTW
                     PQNGIKVIIPQGSTKALLADHDGNVWNIKSRWRCRMTLFRPSVEAVGTEGESEGGDGD
                     GVTSKTNPGSKSDRGAADPYIILTGQPVDLAAAVDDILKVTREVIVVKLQNGTETVLH
                     GGQGEAARLSVSQFRFLLRPKPYVLTQRADEIPKPAEWTSESLQQYIAALTMGRVASG
                     LSRKLYPGKASHQDVVAFQLLSVFKDPKASAVMSNMALKLALRFLVGAGATRLKSAKL
                     IFLRAQKMGLRLDTDVYNIMAETAVKSKNMMAFQSILRLMVKRGQRPNLRTWLLFLRL
                     IEAEEVRRYIIHSMHAKNFFVTPTAVVAVSREMARNDAYRAIQLGQDMATFLAAQRKL
                     YGPAWWLPTVAANKVLDVFARYGKFDEAKQLVLLMLSRKRVYGKPDAVTLNTLLASCR
                     SQNKIDRAIEFIRMFDQHGVRVADHVSFRLLMESARALRKPHLAGAIFRYAHLQQRTS
                     FRLRRRGASLLKDDEEVERITDRIRRLWQEEPGESCKFQCRQSRKEFVTNLLLCDYQR
                     HLAAPTEHGDEAAAANRSPDDDDDSPGEPGEPPIVGQRSQDASPGTYSGFFSWALDQA
                     SRWEPAVPLGEFLEAALARDRELHALAHEPRIEGQPREPVPDPLESPPPLPLRPRLEG
                     RTTPARGGSEGKQDGEAGVGGEAKRENSIRIRRVSAPLRIRWLATQVEWKEKQQERLQ
                     EQANALPFGSGSESTTELLRWPPLRYRRKTAKSKGSKKAESESQGQQSG"
     gene            complement(448014..449510)
                     /locus_tag="THITE_2106239"
                     /db_xref="GeneID:11521182"
     mRNA            complement(448014..449510)
                     /locus_tag="THITE_2106239"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648551.1"
                     /db_xref="GeneID:11521182"
     CDS             complement(448160..449197)
                     /locus_tag="THITE_2106239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648599.1"
                     /db_xref="GeneID:11521182"
                     /db_xref="JGIDB:Thite2_2106239"
                     /translation="MPAGKSSRSRPQSPEPTIDILYENQRGCFLCGMALFSSRALGNL
                     DPPAWTNYAHKPSPTDIQTAQVPDPSWEWAWPEWRINHDEGVDEDGWEYSFAFSKKFS
                     WHKARWWNSFVRRRAWIRKRVKKNTGYLAQDPHMLTPEYFTVRPSSEAVRHRSPSRAS
                     SPRGSRLSTSTANGEGAEQPVIKQADELLRVLRLSRIDREKIEAVENYLENAQDDLEG
                     LQTIMHEIMALFVFQASRRVLLSRLTEVYDKEAAAEQGQVAAGDASRERRVRNLDAAV
                     KHADEEVRRLEYWSDVKGMAGEGESKGAVDLKQGWDDVAWQGVDKSGPSAPPAPAGQQ
                     GRQTSDQAGDG"
     gene            450099..451246
                     /locus_tag="THITE_2106241"
                     /db_xref="GeneID:11521169"
     mRNA            join(450099..450537,450633..450748,450880..451246)
                     /locus_tag="THITE_2106241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648552.1"
                     /db_xref="GeneID:11521169"
     CDS             join(450426..450537,450633..450748,450880..451047)
                     /locus_tag="THITE_2106241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648600.1"
                     /db_xref="GeneID:11521169"
                     /db_xref="JGIDB:Thite2_2106241"
                     /translation="MSKSRAPLAIGLAAAAGIGYYLYSAGGSPRAAEKKFEGDANHVA
                     GKIKGETPHRSNDVEEHGRKVGQEIGSKVDDAVATVNRDLSKAKNETESYAKAAKADT
                     LKKIDEFDRKVEEGTSKSKGYFSSWFGGK"
     gene            complement(451208..>455374)
                     /locus_tag="THITE_129437"
                     /db_xref="GeneID:11521167"
     mRNA            complement(join(451208..453854,454001..454462,
                     454816..454906,455133..455146,455214..>455374))
                     /locus_tag="THITE_129437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648553.1"
                     /db_xref="GeneID:11521167"
     CDS             complement(join(451445..453854,454001..454462,
                     454816..454906,455133..455146,455214..455374))
                     /locus_tag="THITE_129437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648601.1"
                     /db_xref="GeneID:11521167"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Thite2_129437"
                     /translation="MACNELDRRHPRLIGILLANVGILANAGILLASVGILANYYTRM
                     VLSDHLAVNVICHKSILGLRASSWVRGHLPGIVGILANAYIFLGSQLDAPLPRRFSLH
                     GWLTRDFANQNPNLRNQDPRHRSRPQHNMTSRRDFLSQPAPENYVAGLGRGATGFTTR
                     SDLGPAREGPSEDQIKAAVAKRSAQLGLTEPKDDDIDDDERYQDPDNEVGLFAGGIYE
                     KDDEEADRIWKDVDDKMARRRQKQREAREKAEREEYERKNPKIQQQFAGLKRALESVT
                     DEEWANLPDPKDLTGRTKRARQARMQRFYAVPDSVLAAARDQGQFGTTVADDGTATDA
                     NADGTVTDFAKIGAARDKVLRARLEQQSQSSGIATAGSATSIDPKGYLTSLANMQGAE
                     QSIGDIELFRKMLKSAVDSNPKQAASWIAAARLEIAAGKPGAARTLIAKGCQHCPKSE
                     DIWLENIHLNDNRNAKVIAAQAIQANPHSVKLWVEAMKLENDPRSRKKVIRRALDHNQ
                     ESEALWKEAVNLEEDPADARMLLAKATELIPESLDLWLALARLETPENARKVLNKAVK
                     KLPNSHELWIAAARLEEQLGEGNKKQVMKSAVRFLAGRNAMPKREEWIAEAEKCEEEG
                     AVITCSNIIEETLGWGLDEDDDRKEIWMDDAKGSISRDKFATARAIYAYALRVFPNSR
                     TLYLAAVDLERNHGTKDDLWRALEKAVEACPHVEAFWLMLAKEKAGEINEARRVLARA
                     FKQNPDNEDIWLAAVKLEADNGFIDQARDLLKTARQNAPTDRVWMRSVAFERQLGANE
                     AALDLVQDALQLFPAAPKLWMMKGQIYEDLGKVPQAREAYSTGVRAVPSSVPLWLLYS
                     RLEERSGNVVKARSVLDRARQAVPKSPELWTELIRVERRAGNTNQAKSLMASALQQMP
                     KSGLLWAERILHLEPRTQRKSLITEAIKKVEDDAVLQVTAARILWAERKLDRAQNWFE
                     RALLLDRDLGDTWAWYYRFLSQHGTDEKRAELVAKCVLNDPRHGEHWQAVAKDPKNAG
                     KSTEEILKLVAASLA"
     gene            complement(456089..460461)
                     /locus_tag="THITE_2106245"
                     /db_xref="GeneID:11521146"
     mRNA            complement(join(456089..458120,458179..460120,
                     460196..460461))
                     /locus_tag="THITE_2106245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648554.1"
                     /db_xref="GeneID:11521146"
     CDS             complement(join(456886..458120,458179..460120,
                     460196..460255))
                     /locus_tag="THITE_2106245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648602.1"
                     /db_xref="GeneID:11521146"
                     /db_xref="JGIDB:Thite2_2106245"
                     /translation="MNSSAASAPPWPPRRPSKRSKLRNGSVIIPSTGERSHRTFTLRP
                     SGLFPSSQPDGSDTPTAAAFLSRRTMADRIHSAAQIAREKGVQVLRWLDSPAGHGVLK
                     CTVAYTLGSLATFWSPLSDFLGRLDGKHVVATLTVYFHPARSVGSMIEAVLIAIVAVA
                     YAALVSILSMCTSVLFGAVLDMVPLAHGLVLVVFIGGGFGFMGWVKQRMGNPLVDVGS
                     TLASLAIIGVVTKETAVLTSVFSNQKIVQILKMLVMGVTITTFVNLLLWRTSAISALR
                     ESMTKASVSLGDMLAMITRSFLSGSEEDLKSPEFGAASAAYSSVYPQMAKNLREAKFE
                     RYFLGHEKIYQLDRAVVRSMETLAQSIGGLRSAANSQFALLKEPIATLPRVMSPSPQV
                     TSPISSPNLHKTISSTMRSGRERFLALSSIEEASEEGHEDERQPSEERPQSDTAAAGQ
                     PPFRHPSEIFELFIELLGPSMKSLAYTLSEVLRDPPFGAAPDYVITVNDHFRQSLTDA
                     LSLFNEARTHALQELYRTLELDRTRSESGQADFEEVAAACGHFAFSLQTFGEEMQKYL
                     DVLDDLKFANEHRKRSWHWLEWWRRGQQQGRKALALPYDNAERDPLIKPIKKSQMPKG
                     IADPLIRRRDTYNWEAAPEAKHKVVATVSQKILQAARKLARDDIRFGLKVGVGATLWA
                     SFAFFPRTHDLYRHWRGEWGLLSFMIVCSMTVGAANTTGWARFVGTVVGIAAAGLNWN
                     LSQHSALGLIPLGSLVAFWSFYVVIVKKKAPLGRITLLAYNVSTLYAYSLSQMVDDDD
                     DDEGGVNPIIWEILLHRFMAVTAGILWGLIVCRLIWPISARKKFKEGLSMLFLQMGLI
                     WKRGPLAILLRSDCTRSYLRSGEQAALQKYAARLDALRVSAASEFELRGPFPSEQSRR
                     LMSCAHRLLDAFYAMSLVTQRRGNLTEGERALLLCTADERALLCDRICHVFQVLASSL
                     MLEYPLTDALPGVASTRDRLLGKIFQFRKVHQQHDGGAEAGASGAAAAADYLGAGALT
                     RVNVEERDYALLYAYALVTGQVAEELKVVAKEIEGLFGVLDEETLLLQ"
     gene            461096..462440
                     /locus_tag="THITE_2106247"
                     /db_xref="GeneID:11521127"
     mRNA            join(461096..461423,461572..462440)
                     /locus_tag="THITE_2106247"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648555.1"
                     /db_xref="GeneID:11521127"
     CDS             join(461287..461423,461572..462313)
                     /locus_tag="THITE_2106247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648603.1"
                     /db_xref="GeneID:11521127"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2106247"
                     /translation="MRRFWAMMQSAPTASWRFAPLSRPYTPSPQTRKLEGIVFDVDGT
                     LCKPQTYMFAEMRAALGISKGTDILEHVYSLPTAEAQHRAMEQIRDIERRAMLEQVAQ
                     PGLQRLMAYLDARGVRKGICTRNFDTPVNNLLSKFLAGSVFAPIVTRDFRPPKPDPAG
                     ILHIARSWGLLRRSAGETGVPADAQEEEDRRRQRRRRRRSSSAGEEGSAGQDGEEADG
                     GDLLQTEAGEEVADASGLIMVGDSIDDITAGRRAGAKTVLLVNDANRHLADHEHTDLV
                     ISRLDELIDVLENGLL"
     gene            complement(462976..465180)
                     /locus_tag="THITE_2106250"
                     /db_xref="GeneID:11521119"
     mRNA            complement(join(462976..463176,463235..463418,
                     463485..464016,464082..464239,464305..465180))
                     /locus_tag="THITE_2106250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648556.1"
                     /db_xref="GeneID:11521119"
     CDS             complement(join(463085..463176,463235..463418,
                     463485..464016,464082..464239,464305..464583))
                     /locus_tag="THITE_2106250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648604.1"
                     /db_xref="GeneID:11521119"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106250"
                     /translation="MADAFAPRSMKRKNVKGLALKAPPPKPPSSVENARPGPAGKGDD
                     NAAQLEIGIEFNLDLRPEDLEVIRDLGAGNGGTVSKVRHIPTNTVMARKIIHVEAKKE
                     MRKRIVRELQIMHGCHSDYIVTFYGAFLNENNDVIMCMEYMDVGSLDRISRVFGPVRV
                     DVLGKIAVATLGGLTYLYAKHHIMHRDIKPSNILVNSRGSIKLCDFGVSGELINSVAD
                     TFVGTSTYMAPERIQGERYTVKSDVWSFGLTIMELAIGKFPFAASEQLSDAESAPAGI
                     LDLLQQIVHEPAPKLPKSDAFPQILEDMIQKCLYKEPERRPTPQELFDRDLFVQAAKR
                     TPVDLREWACGLMDRDNRKSHLAPQPSPATQDLLRSSDSPTYGTQQTPTSSYRIDRQA
                     ADHANLAAQVDRLYIREWDHEQ"
     gene            466317..471366
                     /locus_tag="THITE_2106254"
                     /db_xref="GeneID:11517703"
     mRNA            join(466317..466748,466817..467002,467062..470680,
                     470754..471366)
                     /locus_tag="THITE_2106254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648557.1"
                     /db_xref="GeneID:11517703"
     CDS             join(466575..466748,466817..467002,467062..470680,
                     470754..471025)
                     /locus_tag="THITE_2106254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648605.1"
                     /db_xref="GeneID:11517703"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="JGIDB:Thite2_2106254"
                     /translation="MSNDMRDLIDGEAELDEEEDDESFDEETGESRARDRNDILDDSS
                     EEDEDDDDEEEARRIREGFIVDEDEEEEADDSEERERRRKKKRRRAEREEEEQLDEED
                     LDLIGEANPEWERKSQPQTKFKRLKRGHRDEDRGNERRGLAEIFSDDEDDVVDERPYG
                     RASHRAQADEFDDFIEDDYPEDDEERIQRQVDREVARPRDKGLAVDATGLDKDALDDM
                     EAIFGNGEDYDWALEQEEVDEDLEREQQTIELKDVFEPSQLQEKLLTDEDNQIRIVDE
                     PERFQLDRKPFKEQQTSNEYFKEEARWITNLMWPKKQLPSDLHGPFNKAIYKVLEFFI
                     IDGVEVPYVFQHRRDYLIHAKKIRNQDGRDHPDAPEYTVDAEKLLTQDDLWRILELDI
                     KFRSLVEKRNALEKSFAGLKEAGVEDHILEEMIREAATLEELQDLQDYLNFQYSAQLK
                     DIAAMGNGASKEVKRPGAKTALFERIRRSKAYNFVRALGISPDRLAKNALREGKKVSS
                     DDDAKLPMDLADSLVDDDFPTGSQVVTAARQMYAEELFMSPRMRKHFRIQFYAMGCVS
                     CHRTEKGLRKIDEAHPYYEIKYLINHTIRDLAVRPEIFLKMMKAEDEGLVEVQLRLEN
                     EREFRRQLYNEFASDNFSESADAWNSERQKVLDIAFSKLEKVIAKGVKDSLRTACQEE
                     LLKTCREEYFKRLDQAPLKPKGMVLGTTPRVLTLSNGMGDPNRDPIYWTWVEEDGRVV
                     EHGKFINLARDESQRELFAELVRRRNPDVVGVSGFSADTHRLIKDIEGIISEKGLMGP
                     EYDDPEANEYRSDLLEVVVVNDEVARLYKDSPRAVAEHPTLNSLSRYCIALARYMQNP
                     MKEYAALGRDVTSLLIHPYQQYLPQDKLYKHLETAMVDIVNLCGVDLNEAIGDPYTAN
                     LLPYVAGLGPRKAQLLIKGVNANGGVVTSRDELVGDPERHKIPVLGPRVWNNAASFLY
                     IEHDSTNPDSDPLDNTRIHPEDYDLARKVAADALGLDEEDVKAEVDENGPGAIVRKLF
                     KEDEQEKVNELILEEYAEQLEREYQQRKRATLEAIRAELMGPYEELRKNFAVLSTDQI
                     FTMFTGETRDSLCEGMIVPVNVRVVKDDFAIVKLDCGIEGRVESHEVSYRHSIKDLLQ
                     VGQTAQAKLIDINRKDFVCKLTMREEELRRPFRRHYNYARDQWNYKLEEADREELREK
                     DKVTGRTQRVIKHPLFKPFNSTQAEEYLGGLPPGEVVIRPSSKGNDHLAVTWKVADGV
                     YQHIDVLELQKDNEFSVGKVLRVGNKYTYTDLDELIVEHVKAMAKKVEELMQHEKFQK
                     GSRADLEKWLTTYIDANPNRSTYAFCLDTKHPGYFYLCFKASRGSKVNAWMVRVIPHA
                     FELLKSQYPDMRALCNGFKLRYQSEMLKMHAGGGGRGH"
     gene            472045..475194
                     /locus_tag="THITE_2106257"
                     /db_xref="GeneID:11517652"
     mRNA            join(472045..472242,472312..475194)
                     /locus_tag="THITE_2106257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648558.1"
                     /db_xref="GeneID:11517652"
     CDS             472559..475150
                     /locus_tag="THITE_2106257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648606.1"
                     /db_xref="GeneID:11517652"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Thite2_2106257"
                     /translation="MFGLVFDNTFSKQTSKTATFVLLTYPTGAPPQTTRHLPNLQAGP
                     TASTSRSSLGKHTHSPRLGAVTSESVDSLHSHNTAGRALSVAGRSDAGVPSSYHVGVL
                     LKRRRKKGQGYARRFFSLDYTTCTLSYYHNRNSSALRGAIPLSLAAIAADERRREITI
                     DSGAEVWHLKASNAKEFVEWARALERASKIARGLESAVEEPAPETHGGATTQPVPAIR
                     HPQQEEEDREWKQVEALVSRIVGTRDALRRLVKDLAAQKEAPTNHGTHLSPNTPTVPE
                     DSEGSFAQQNDKKPFWKRKASGSSSPHAPQSMQSAASTSLAVPTPTSATPVPNGVMPQ
                     GAAPQGDTNTYDNCAALLKDLDSVVVEFSALLNSSKRRRISTQTPAVPRKSMESTAST
                     VEEFFDAEAGDSDRSQNQLMLIDHHSEEDTPASDAEEVSIHESSSISSVEDDEVPHTG
                     EGVGSLFPPKPKSLTPLPISDVIARRKTIPPARVAPPSLIAFVRKNVGKDLSTISMPV
                     SANEPISLLQRMAEQLEYAQLLDAAAKQSQPEQRLLRVAAFAVSQFSNGRAKERAVRK
                     PFNPLLGETFELVRSDAEVPGGFRLLVEKVSHRPVRLAMQADSALWSFAQAPAPTQKF
                     WGKSAELTTEGRVRVCLRLPDGSDEFYSWNTATVFLRNVVMGEKYVEPVGTMHVVNDG
                     TGAKAAVEFRSKGVFGGRGEEVQVEVFGADGAPAGLSLSGTWTGALRAAPGGEEIWRA
                     GSLVEKAGSTYGLTTFAASLNEITAVEKGRLPPTDSRLRPDQRLAERGDLDAAEEWKV
                     KLEEAQRQRRRAMEERGEEHRPRWFVRAATGPDGDEVWRLKGGRDGYWEERARGTWTG
                     VVDIFAA"
     gene            <476115..>480343
                     /locus_tag="THITE_2140577"
                     /db_xref="GeneID:11517642"
     mRNA            join(<476115..478390,478447..>480343)
                     /locus_tag="THITE_2140577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648559.1"
                     /db_xref="GeneID:11517642"
     CDS             join(476115..478390,478447..480343)
                     /locus_tag="THITE_2140577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648607.1"
                     /db_xref="GeneID:11517642"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="JGIDB:Thite2_2140577"
                     /translation="MTLASDPSAPPRGIRIAIDRGGTFTDCVGTYDGRDVVIKLLSED
                     PANYADAPLEGIRRIMAHFLGADLPRGAPLDTSRIESIRMGTTVATNALLQRKGEPIA
                     LVVTKGFGDCLVIGNQSRPRIFDLAIRKPDVLYSAVVEVDERVTLEDYAEDPERRVTR
                     VDVKVGSPEAASAELVMGLSGEAVRVLRRPDRDAVRAQLQRVFDSGIRSIAVCLMHAY
                     TFPDHEALVSEVASEIGFQHISLSHELMPMIKLVSRATSVCADAYLTPAIKRYIDGFQ
                     RGFEGGLGTKSVKEAAAGSKGARCEFMQSDGGLVDVDKFTGLRAILSGPAGGVVGYAI
                     TSYDERTKIPVIGFDMGGTSTDVSRYGEGRYEHTFETTTAGVTIQSPQLDINTVAAGG
                     GSRLFFRNGLFVVGPESAGAHPGPACYRKGGPATVTDANLFLGRLLPEFFPKIFGKNE
                     DEGLDPEASREVLQELADQIQRETGKEMDIDEVAFGFLTVANETMTRPIRSITEAKGH
                     DTSKHRLATFGGAGGQHAVAIAESLGIKQILIHRYSSVLSAYGMALADVVDERQEPDS
                     TIWTDDGDVVEQLKRKMAGLREKSRQALRDQGFEDGEIVFEEYLNMRYRGTESALMIV
                     KPEAGWDFGAAFVKHHRYEFGFTLDDREIIVDDVRVRGIGKSFRYDEKSVDEQLKTVT
                     RRDVTPDKKHGESKVYFEGGRLDTPIYKLGDLSVGDVVKGPAILADGTQTIVVTPSAS
                     ALMLETHVVIDLPENGKDRYSKASAEREVDPIMLSIFGHRFMAIAEQMGRALQKTSVS
                     TNVKERLDFSCAIFDASGGLVANAPHLPVHLGSMSTCVRRQAEIWKGKLKKGDVIVSN
                     HPSYGGTHLPDVTVLMPAFDEAGENILFYAASRAHHADIGGITAGSMPPHSRELHQEG
                     AAIKSEKLVSEGKFDEQRVIELFYDEPAKHPGCSGTRCLADNINDLRAQVSANQKGIS
                     LIEGLIAEYGEETVQFYMVAIQNNAEQQVRSLLRAVHERFEGADLSAEDFMDDGSPIR
                     LKIAIDPVKGEAVFDFAGTGPEVYGNINAPEAVSYSAIIYALRCMISEDIPLNQGCLK
                     PITVRIPPQSLLSPSENAAVVGGNVLTSQRVTDVIFKAFRACAASQGDCNNLTFGFGG
                     NVAGQAAVRGFGYYETIAGGSGAGPTWEGTDGVHTHMTNTRITDAEVFERRYPVVLRA
                     FAVRRGSGGRGQHRGGDGVVRDIEFRIPVQVSILSERRVYRPYGMAGGEDGQCGLNLW
                     ARRVRKPSWERSLRRLQKQQQQRQFNNSNNNNQGEDQSKRQENNNNDDDDDEAEYEER
                     LINLGGKNSALMAAGDRIIVCTPGGGGWGPVGKEKALGRAKALGGGGGADPTRSWKKG
                     SHAAREETALQA"
     gene            complement(480671..483491)
                     /locus_tag="THITE_2106261"
                     /db_xref="GeneID:11517534"
     mRNA            complement(join(480671..481281,481372..482828,
                     482932..483491))
                     /locus_tag="THITE_2106261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648560.1"
                     /db_xref="GeneID:11517534"
     CDS             complement(join(480998..481281,481372..482828,
                     482932..483191))
                     /locus_tag="THITE_2106261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648608.1"
                     /db_xref="GeneID:11517534"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106261"
                     /translation="MSDPPPSNVPLREKMRTEQRIGAYNIVKTLGEGSFGKVKLAVHR
                     GTGQQVALKIISRKNLISRDMQGRVEREIEYLQLLRHPHIIKLYTVIKTPTEIIMVLE
                     YAGGELFDYIVQHGKMHEDEARRFFQQMLCAVEYCHRHKIVHRDLKPENLLLDDNLNV
                     KIADFGLSNIMTDGNFLKTSCGSPNYAAPEVIGGKLYAGPEVDVWSCGVILYVLLVGR
                     LPFDHEHIPTLFAKIAKGSYMVPTWMSPGAANLIKKMLVVNPVQRATIEEIRLDPWFL
                     KDLPPYLHPPVEEFLNTGVDPNKAIKVSDIAPHAPPQEQEKLHNEVTDKISKTMGYGK
                     RDVEEALEADEPSAIKDAYMIVRENKLMQSSQLAGLGAEDGTLSSARSVASASTGASA
                     RPPYVSKVGILPSSLPVYHQAYMEREKARAEGREVPDAPLTVPEPAPQPRSQAEQAET
                     LRRLKPHSRSFLRLDDASRPQGLTPVNPPKKTKPVRWQFGIRSRNAPWEALLCIYKAL
                     HKLGATWIVDEDYDPAQHGDDAGDDRYSRGRHSRSHSTASGAGPTEAYRLPADPWHMK
                     IRWNTNKLQKHSAASGLCDAGASATHVSSCRDGTAGDEQVVAMHMEIQIYEMERGVYL
                     VDFKVDGYETPDGKLLEDKEVASPFPFLDMAARLIMQLADAD"
     gene            complement(483655..485458)
                     /locus_tag="THITE_2106263"
                     /db_xref="GeneID:11517524"
     mRNA            complement(join(483655..484936,485008..485458))
                     /locus_tag="THITE_2106263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648561.1"
                     /db_xref="GeneID:11517524"
     CDS             complement(join(483920..484936,485008..485193))
                     /locus_tag="THITE_2106263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648609.1"
                     /db_xref="GeneID:11517524"
                     /db_xref="InterPro:IPR002794"
                     /db_xref="JGIDB:Thite2_2106263"
                     /translation="MKPIIAVPATLLLVYRAYSRKSLTPGGILAATLTAIAHAVHPWN
                     LPFVLLVVFFLAGTRATHVKENVKAGLTLKAGGTSGGEGPRTHVQVLANSLTASIFSL
                     LHAYQLRSREQSLLASAAAGSAGSAGSLCFSWGGDLLVVGIIANYACVAADTLSSELG
                     ILAKEQPRLITSLTLRKVPRGTNGGVTLTGLAAGLLGSIIIVTAAALFLPFCTDETAT
                     RLGGGAPWTTEQRRALILGLTLWGLLGSLVDSILGGLFQRSVRDVRSGKIVEGEGGVR
                     VLVSTAAERETDVAAGIKAALLHGEGESAVEETEPATGAGTAQGEPRADRYDALNKHR
                     RASFGDEKPSRVVESGWDLLDNNDVNFLMAFGMSVGAMAVASWYWQVPLSSVLPTAGG
                     MGAMAGRQ"
     gene            complement(491117..491747)
                     /locus_tag="THITE_2106268"
                     /db_xref="GeneID:11517476"
     mRNA            complement(491117..491747)
                     /locus_tag="THITE_2106268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648562.1"
                     /db_xref="GeneID:11517476"
     CDS             complement(491286..491615)
                     /locus_tag="THITE_2106268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648610.1"
                     /db_xref="GeneID:11517476"
                     /db_xref="JGIDB:Thite2_2106268"
                     /translation="MGRGLAQQNIPVRRNLAASGQQWLRLGRLERRWRQSCSTVASHM
                     TWAARRRATTRTQTQDSRRRTELKPAQQAWLVPWGNYFGFKKLPAVMRAAQPKPSRSP
                     KPYLFTA"
     gene            546247..549348
                     /locus_tag="THITE_2106273"
                     /db_xref="GeneID:11517235"
     mRNA            join(546247..547761,547832..547947,548013..549348)
                     /locus_tag="THITE_2106273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648563.1"
                     /db_xref="GeneID:11517235"
     CDS             join(546289..547761,547832..547947,548013..549123)
                     /locus_tag="THITE_2106273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648611.1"
                     /db_xref="GeneID:11517235"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2106273"
                     /translation="MEPLPGDPPTIAGRTPIACQNCANAKTGCDKRVPCGRCSEKNLP
                     CEARYARRSSKAAVRAAQASAAFQNALGQSTQQTQPTGAITVASMDANQSGVKAEGNS
                     SPTAIEVAIPGLSIAEGSPRKASPYHPQVSPGDFPSPHARIEGGLDDFMHVGHEFAPQ
                     DASYQDLMLWPEFSMNLDVYPNVVPLGRADIPMSIFPELNAVSPPSQPLTASSSSRGS
                     IQTPGTSIMSAGDLDHTLKPMELSPAAPMDNSIPEFEVVMVAEGAWNLARCNPGLSGN
                     CPRTAIVHLECLEQKSKQEGTWSSLERYLERLDWDPSDLASVVPLTSRTRDKMLAITQ
                     SFLHKALEIHRGGVNGYPKSGYSSPGDFNFIVLPSTKILEYFLRSYVRSLSVYYPLVT
                     AGCVDPNEMLQNNQASTLLVLLMIAQGAAAMPIAEARYLSAGLTETCRISLFDIVEKD
                     VELSSDPIALRCALLFIVLGAWSGDKWLMDIAMGQRGMYMSMLKHAGMLDPQPSMMPT
                     IHDSTGAELEWRAWVQRETRNRLVYNYVMLDQELSLFHDTAPLFAITDLRCPLPGPEI
                     LWMSPSSERWLSAMQSIYGSAANVNPQLLNTPSASPSLYDLFQDFLNDNLSMEQPGVS
                     PQQMRLILHPLQGLLCHLRQMLACFSDTPSTRRTGARLVTKNSTLHRLEEVQQLLQKW
                     YDLSANYTKANPDCPVARCNLVLYHLISLNAVSNFVEIERFARREGFEHWYWDIPKLN
                     KRCIFNREDAIFHCGQVFRLLRLMPKDRRPAWWSVAMYRPTLILWADSVSRVYSGAQA
                     SKGGEAAPPSTAPVIIDQVTPEDPAINAFVWNGNGVPMLTRTNGTTVTLDKPADILSY
                     AIQNIEAGFSSRLSDGIKRKLITLGNNWSVDAMETSQAGSGAG"
     gene            <555680..>558060
                     /locus_tag="THITE_112118"
                     /db_xref="GeneID:11516706"
     mRNA            join(<555680..555911,556002..556129,556316..556387,
                     556445..556494,557000..557288,557321..557407,
                     557561..557682,557769..>558060)
                     /locus_tag="THITE_112118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648564.1"
                     /db_xref="GeneID:11516706"
     CDS             join(555680..555911,556002..556129,556316..556387,
                     556445..556494,557000..557288,557321..557407,
                     557561..557682,557769..558060)
                     /locus_tag="THITE_112118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648612.1"
                     /db_xref="GeneID:11516706"
                     /db_xref="JGIDB:Thite2_112118"
                     /translation="MAERVSLLSSLLLLRLPFSALFDELSIHLPFPLPFSERIVDLRH
                     APSASISMSSTCWRGTRHLNPALTFDTGHPWGGCAAQIASIATFLASAVPWSAPVSAV
                     VAAALGRNRALFNPSALTTNVTPPRPAGARGETGFSSPGKSAAKGPVPWGIRAFCAVD
                     QEIPPARITAWVTQRWEQSLQQLATGHLRRPRGGSGYPFGLHSPDQGEQDPIPYGQAI
                     DDGKSVFAILRSTRAWLGNSRLLAWAQDDQLLQLAPRHKVQLLLHLPPRLAGKLPIPG
                     GLAVNNSENGVRRDTPVPTYFRRDCDPALPTRSAPASSGMATDSAAISPRTPVLCNLL
                     GSAGYSPNAWQRRAGQHSACHGLASHSATSDTATSIPGAAAVRQHDENRDRNLMNGLH
                     GSAGRRGRRKAEGSLSSQLKVPSGACYSLPG"
     gene            complement(<562854..>564212)
                     /locus_tag="THITE_2083808"
                     /db_xref="GeneID:11519191"
     mRNA            complement(<562854..>564212)
                     /locus_tag="THITE_2083808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648565.1"
                     /db_xref="GeneID:11519191"
     CDS             complement(562854..564212)
                     /locus_tag="THITE_2083808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648613.1"
                     /db_xref="GeneID:11519191"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2083808"
                     /translation="MSEQQNVLPQFRTVQGMSFPFTPMMEAQHPALQTIGSQGVLQRQ
                     LRAALARMESEAASARQEPQQHPRACAGCSKAKVQCSKDLPRCRRCIVYCTPCEYPAC
                     STKGGQKRKEPAEAGAAPPSKRGKTQHQASAPAVSAPPAVAAPPALQAPPAVPAPLAA
                     AAPPAVPAPPAVSALPAVVAPPTVPASPAVPAPPAVVTPPAVPAPPVVPAPPAVPASP
                     AVPASPAVAASPAVPAPAVDPDFGDLPLFGSLSGALDGDDYFDPAVLNRFFNGIVDSA
                     PPMTMTTTPTTCRCLEVCERQMTALHQMSGKAQPGSPYRKAFLGQCQRVMNAVSDALV
                     CQRCTPPARTNIASVLLLGLAFTTLMSAYLMQTTAMKTELPPGTSPKQLADQSALDDW
                     CTLAAQVYCVQRHLEKFRAWVDEAPAQAPLAAVALAEADWRVSVLAAMEEWEGLLPDF
                     LG"
     gene            complement(573335..580543)
                     /locus_tag="THITE_2106274"
                     /db_xref="GeneID:11519180"
     mRNA            complement(join(573335..573368,573456..573629,
                     573718..579609,579692..579986,580058..580543))
                     /locus_tag="THITE_2106274"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648566.1"
                     /db_xref="GeneID:11519180"
     CDS             complement(join(573582..573629,573718..579609,
                     579692..579986,580058..580374))
                     /locus_tag="THITE_2106274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648614.1"
                     /db_xref="GeneID:11519180"
                     /db_xref="InterPro:IPR001031"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="JGIDB:Thite2_2106274"
                     /translation="MGADQDNACANRPAYLLLGDQSLDTHGFLVRFFGQEQHGELAKA
                     FLRQAAYALKWEIQRLPAAEARRLPDFLTLKQLNERYNKSDYKHAAVDAALLTISQLA
                     HFLDHVEKHSEDIPHPEHTVAVGLCSGLWAGAAISVTPSLPDLVPVGVQTVILAFKLG
                     SYVQTIAQQFSHSAQDESESWTYLFPLLSHEETAVKLAEFQESTGIPPANRAYVSAVS
                     SSGIAVSGPPVTLSTLVNRGILSTKPVAIPVHGPYHAPHLHAGADVKKILDLDNPRVE
                     DAFYKSRPRLPVMSCSTGSFFSAADTKALMTSVASTILNETLMLDKVLASCVEHARQV
                     EAKSCLILPLGPTQLAGALKHALKAKTDLEVVVRTPYDAPPEATSSLSGKCKLAIVGM
                     AGRFPDAASHEKLWELLERGLDVHRLVPADRFDHRTHVDRSGKGTNKSHTPFGCWIEQ
                     PGLFDHRFFNMSPREALQTCPMQRMALTTAYEALEMSGYVPNRTPSTRLDRIGTFYGQ
                     TSDDWREINAAQDVDTYFITGGVRAFGPGRINYYFGFSGPSLNIDTACSSSAAAMQVA
                     CTALWARDCDTAIVGGLSCMTNPDIFAGLSKGQFLSKNGPCSTFDDAADGYCRGDGCA
                     SVVVKRLDDALADKDRILGVILGTATNHSADAISITHPHGPTQSALSTAILEEAGVDP
                     LDVDYVEMHGTGTQAGDGTEMLSVTNVFAPADRKRRADRPLYLGAVKANVGHGEAASG
                     VTALIKVLLMLEKNVIPPHVGIKPGSVMNRTFPDDLSARNVNIAFHATPFRRKDGRPR
                     RVFINNFSAAGGNTGLLLEDGPKPKPAAVDPRGHHIVTVTGKSKTSMIKNAQRLMDWI
                     ETHPDVPLSHVAYTMTARKIQHYWRMAVTGSDLAQVRNAIAARLQDHISPVPPQQPKV
                     VLMFTGQGSHYAGLGKDLYEHQSVFRQSIDEFVRLAWIHGLPSFLPLIDGSEPDVAKL
                     SPVVVQLGLVAFEMALGRLWVSWGVKPSLVVGHSLGEYAALEAAGVLSASDVIYLVGV
                     RAQMLVDKCTPGTHSMLAVQGSKEDVRPVLGANAGGIEVACMNGPRETVLSGKADEIS
                     EASRTLSAAGLKCTELRVPFAFHSAQVDAILDDFEAVAQGISFRAPKLPIISPFLGKE
                     IEGEPIDARYLREHARQPVNFLGALVSAQAAETIDHKTVWIEIGPHPVCANLVKGVFG
                     APTVAVPSLRRKEDCYKSISSTVATLHCEGVKIDFNEYHRDFQDSVRLLDLPSYAFDE
                     SNHWLQYTGDWCLTKHRVRDAANALHTRKLSTTSVQKIIAEEVKDDVATVEIESDLCQ
                     EQLRNAVSGHLVNGAPLCPSSLYGDMAMTVCEYAYKLLRPDAQRIGYNVAKLEVPKSL
                     IFDETAKSHILRLKVTANAKLGHADLVFYTGEGPKRTEHANCKVYFGNLDEWQAEFDR
                     VAYLIKSRIDALKQAEQQGIASKIGRGLAYKLFSALVDYAPRYRGMEEVILDSAACEA
                     TAKIRFQTTEQDGNFVFSPYHIDSVCHISGFIINGSDAIDSREQVFISHGWGSMRFTE
                     IPKADKEYRSYIRMQPVQGSKMMAGDAYVFDGDRIIGVTGNIKFQCVPRRVLNQLLPP
                     RSGGGAARAPPRPAPTKPPSAEKAAPPKKKKETVTPANIGKVNQKLRSLVHSVMDIIA
                     QEVHCSHDELADNIAFADLGVDSLMSLTVSGRLREELELNISSNAFVDYATIGEFKRY
                     LAQFEKTARKMSISSHDSELMSTAESPEGETESRITTPIGDSEASSVKGDDSKEEVRN
                     LVRKIIADEMAIEVDEIIAAPDLADLGMDSLMSLSILGRLREETGMDISPDLFVNNPS
                     LSQVEHALGITAPKKAAARKQQQPKQQSATPPARKQPSEKPPEPEDRGESSQTRVHPR
                     IGLEEPAPPKPPRPSELVDRFPHRRASSVLLSGVVRTASKHLFMVPDGSGSATSYTEM
                     AEIGGDWAVWGLFSPFMRTPEEYNCGVYGMAAKFIEEIKRRQPKGPYSVSGWSAGGVI
                     AYEIVYQLVQAGETVENLIIIDAPCPHTIEPLPQGLHAWFASIGLLGEGDDNRVPEWL
                     LPHFAASITALSNYDALPLPKEKCPKVMAIWCEDGVCKNPEDPRPEPYPKGHALFLLD
                     NRSDFGPNRWDELLDLEKMQFRHMPGNHFSMMHGALAKQLNGFVKDALGLQ"
     gene            complement(<586231..>588131)
                     /locus_tag="THITE_2038876"
                     /db_xref="GeneID:11519080"
     mRNA            complement(join(<586231..586861,586931..587494,
                     587586..587706,587762..>588131))
                     /locus_tag="THITE_2038876"
                     /product="multicopper oxidase like protein"
                     /transcript_id="XM_003648567.1"
                     /db_xref="GeneID:11519080"
     CDS             complement(join(586231..586861,586931..587494,
                     587586..587706,587762..588131))
                     /locus_tag="THITE_2038876"
                     /note="Extracellular Laccase-like multicopper oxidase-like
                     protein"
                     /codon_start=1
                     /product="multicopper oxidase like protein"
                     /protein_id="XP_003648615.1"
                     /db_xref="GeneID:11519080"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="JGIDB:Thite2_2038876"
                     /translation="MFWSRCLELFLSLPALVIVVRAGTVTYDWNVTWVWAKPDGFGRP
                     VIGINHKWPCPTLEATVGDTVIVNFLNKLGNQTAGLHFHGVSQLQTPEMDGPSGVTQC
                     PVPPDASVKYQFTADAPGTFWYHSHNMGQYPDGLRGPLIVHDPNDPYKSSYDEEVILS
                     VSDCLKAVQSMLSPYNTRFAPPIPDSLIVNEGLGSHINVTKGKTYRIRIINFAAFGSA
                     MIHFDSHTMNIIANDAAYVKKTDAYQLRIAPAQRYDVLIAPLDQDSGNYPFLISLDLN
                     RDWTNSSQQLKWAHNYTGYLVLDSSKKLDKKDVVNKWQPIDESLLEPYDGAAAYSSYD
                     QLIQLDFKFCLDQNGYPRSCFNNITYISQKVPTLYSVATTGDQNTNPVIYGQVNPFIV
                     NFNQTVQIVVNNIDTATHPFHLHGHHFQLLARPSSGVGTWPGHEGNYVSTPPMRDTVT
                     VMPNSYAVLRFRADNPGVWLFHCHIEWHVEMGLTATIIEAPDRLRNLTFPDDHIDVCK
                     KSNTPYQGNAAGNTKNVTDTSGFVTVPPTTYSGCVLILSSLPTPFPFPPRASP"
     gene            complement(590061..592780)
                     /locus_tag="THITE_2106279"
                     /db_xref="GeneID:11519078"
     mRNA            complement(join(590061..591870,591928..592780))
                     /locus_tag="THITE_2106279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648568.1"
                     /db_xref="GeneID:11519078"
     CDS             complement(join(590190..591870,591928..592700))
                     /locus_tag="THITE_2106279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648616.1"
                     /db_xref="GeneID:11519078"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="JGIDB:Thite2_2106279"
                     /translation="MMIIQSPKKSPRKNQAKSPEKVAKRAKPPPPPFFAPKNAGPSSA
                     IPSSSPAFATPAHPLRPFQPPAPAKAAVLPIILPPATLRPLAFRTFTKKHSLTLTSSA
                     LQELATFIGRHCGSGWREEGLAEKVLEEVARAWKNCNGGVIVEGTSPELKDILKTLEG
                     NMSGGKILTGPRGGLSRQNSLMLEPTDDADNSNTRLGLRPATTLTRDDSQASFGMSAM
                     DFDEEPDDEGVRDVRRWLKVISAFDQPRYTYNVAKKHFERITSKPSLLPSASHKTEAF
                     RNRYNVIHQRLLRNEAFQTSAVTSARSSALRRGASSMQSHKITPVANLLGRHGTNHML
                     LGMLVILPTGNLAISDLTGTIALDLSHAVAIPEDSAWFTPGMIVLVDGIYEEEEESVG
                     RGLSGSSGVGGTIGGRFQGFFIGQPPCEKRRVTLGISGLDGGADHTVGGGFGWVDFLG
                     VGSERAVGSRMRKLEQRLLRQPALANPDSPGRGRVVIVGELNLDQPRSLQALKKILSL
                     YATDPEGSTPMAFVLAGNFTTHAVMARGGSGGSIEYKEFFDALASTLADFPMLLTTAT
                     FVFVPGDNDGWVSAFSGGAAVPLPRKPVPDLFTSRIRRVFAAANAEAGLSSADGKGGE
                     AIWTSNPSRLSLFGPNHEIVLFRDDMSARLRRSSVRLKSKASTTATADTDADANANTN
                     ANRPPGEDAMDLDPPPSPPSPSDQNQKNQTSDEPPPPYDTLVARKLVKTILDQGHLAP
                     FRPAVRPLHWDHAAALHLYPLPTALALVDPSAPPFCLTYEGCHVVNPGAVLVAGRRGV
                     ARWVEYPVGRQGRVRECTF"
     gene            593304..594916
                     /locus_tag="THITE_2106284"
                     /db_xref="GeneID:11521095"
     mRNA            join(593304..593492,593557..593936,594033..594134,
                     594209..594916)
                     /locus_tag="THITE_2106284"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648569.1"
                     /db_xref="GeneID:11521095"
     CDS             join(593409..593492,593557..593936,594033..594134,
                     594209..594278)
                     /locus_tag="THITE_2106284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648617.1"
                     /db_xref="GeneID:11521095"
                     /db_xref="JGIDB:Thite2_2106284"
                     /translation="MLTTRLFSARQLCRLSRGLSTLSSNPSIKVFPHPETPNAYLLSY
                     LDTTPPNPALAIGSTTTVPPTPKSFQGNPRFLSILNDVLAQHAASDPGLKSQAQAFAS
                     PGGFSFIQARSQRGSGTGAGGASAEGGAGGAGVGGWVHLSDARNPPDFGRIAWPEDIL
                     GSVEVDGKGEIIGNFQPSGTYRIVTNQGILGLSPFLQEKLIARLREEEKKS"
     gene            complement(594918..595465)
                     /locus_tag="THITE_2106286"
                     /db_xref="GeneID:11517637"
     mRNA            complement(594918..595465)
                     /locus_tag="THITE_2106286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648570.1"
                     /db_xref="GeneID:11517637"
     CDS             complement(595084..595245)
                     /locus_tag="THITE_2106286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648618.1"
                     /db_xref="GeneID:11517637"
                     /db_xref="JGIDB:Thite2_2106286"
                     /translation="MPYHKKRRVEAESDTEPQVTKKQKGETAAQKDLSKGQDADGNAY
                     WEVGHPRLC"
     gene            595655..599440
                     /locus_tag="THITE_2106287"
                     /db_xref="GeneID:11521437"
     mRNA            595655..599440
                     /locus_tag="THITE_2106287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648571.1"
                     /db_xref="GeneID:11521437"
     CDS             595913..599149
                     /locus_tag="THITE_2106287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648619.1"
                     /db_xref="GeneID:11521437"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="JGIDB:Thite2_2106287"
                     /translation="MKQQDAPVTGAIPDKMDEKNKRDPDTVKPEPSPVPSPTSPDPSA
                     TVNTDDADESLTSRLFRFLATASPGTLGGVAVGLAATTYLVLGRLGLVLIGAFGGIVS
                     FIHWEQRNAEVARAVRGERGIDVLSRLLATKQEPESAPVKEQTADDALVRSFDDLQPE
                     TREALNELVDAVIDNYVKWWYSPIVPSDKFFPLACRKTLTNFLTSVSNCLRRKRPADA
                     FLEFVTNSSSILVVFMSELSNAFSELPPDSKANAPDAIYNYLASHPESNLANLLNQKQ
                     QAGKLRMASEDLLGFLDRSSYECEPVRVFLREILAGVVLETTLQSCSKPEWINSWIVY
                     LLESGEPDISQAIDVGMQTGPGADVAFADLDGNVGNIGLTKGNRNSFEQERARRKESM
                     AHKKKLSKAEEEMELAMEEMRRLNQMIAQESALKEGSQKQEAGPPGRSGSAAEATERL
                     PGALQRNVDNQGIKEEPNAKPGPPQPLDTSTHASKRTSSDGSSDRNEAIYTPATPMSG
                     TTPSSSQDSSPPANGGSRFTSFDQIVPPAQDEAESEAGEPRKPPPLTLHNATVTVLDE
                     PGDGRIRTKPTWDYLVQIEPATTVYPGWMIVRKYADFEMLHEVLRRIATISGATGFSE
                     QHSTLPAWKVHTRTSLRGELERYLRDACSYQSLAESEGLKKFFERDHGHMPNAPKSGF
                     QAFEKLGKNVLDVLTSAPLEGSKAVVGGVTGVLGNIGLGQRKTAAAAQQPPPPPPPSA
                     LQDVTAASRLSISALPRADSSMSLSGMRRTRDSMDSQRSSIVSQQPGKMPPMERRPSY
                     NSQGGDGEPDGARLPVTSARNSREHSRPSSRAPSRAPPTRSPSSLSLDGFRLPPPPDM
                     MPDDYDSPISPASGGRPQADFQHTRSLTMPTLGSSTSHQQQQQRLNGPPLKGVKQHAK
                     LSEQETRMTVELLFAVINELYTLSSAWNIRRTLLAAAKSFLLRPGNPSLLSIQALIQT
                     SVLDANTADAGVAALLRKLRANALPTDAERAAWPAEMSPADKDALRARARRLLIASGV
                     PAALMGVMGQAATSEALGRLFDCLQIEEVARGLVFGVVLQAVRTVTHC"
     gene            600298..>602535
                     /locus_tag="THITE_2148588"
                     /db_xref="GeneID:11517706"
     mRNA            join(600298..600674,600752..600847,600925..601000,
                     601089..601192,601262..601549,601648..601753,
                     601820..602125,602194..>602535)
                     /locus_tag="THITE_2148588"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648572.1"
                     /db_xref="GeneID:11517706"
     CDS             join(600400..600674,600752..600847,600925..601000,
                     601089..601192,601262..601549,601648..601753,
                     601820..602125,602194..602535)
                     /locus_tag="THITE_2148588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648620.1"
                     /db_xref="GeneID:11517706"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2148588"
                     /translation="MSDHPAEKLARSEHPAEKLARSEEGSGIAEEKVATANVEDPSSQ
                     GRRMQPPAFILGLTPEKRAELETRLKRKIDARLLPAIILMYIMNYIDRNNIAAARLAG
                     LEDDLGLTSTQFQTAVSILFVGYLLMQIPSNLFLNKFGKPAIYLPLCMVLWGIISALT
                     AACTNASGLLANRFFLGIVEAAYFPGCLYYLSCWYTRKELGFRTAVLYSGALISGAFS
                     GLISAGVTSGMDGARGLRAWRWLFIIEGSITVVVALACIIVLPNFPRTTSWLTDEERV
                     LAVWRLQEDIGEDDWVNREEQTFWKGARMMFADGKTYILLVLLFCIVASGTVTNFFPT
                     VVSTLQESSLSGASKKNNVISLLLTAPPYVLGVIATYLNATHADKTGERYWHITIPLW
                     VAVVAYIIAATTMKTAPRYLSMMLMVPSVYSGFVVALAWISNTMPRPPAKRAAALAFI
                     NAVSNCSSIYASYMYPTSASPQYTVAMCVNCATAFIAVCAATVMRIVLVRLNRRLARG
                     EYVEGAINAAPGEAVSSFRFKV"
     gene            complement(603199..606618)
                     /locus_tag="THITE_2106294"
                     /db_xref="GeneID:11521241"
     mRNA            complement(join(603199..606237,606328..606618))
                     /locus_tag="THITE_2106294"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648573.1"
                     /db_xref="GeneID:11521241"
     CDS             complement(join(603397..606237,606328..606510))
                     /locus_tag="THITE_2106294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648621.1"
                     /db_xref="GeneID:11521241"
                     /db_xref="JGIDB:Thite2_2106294"
                     /translation="MIESENLRTASLYINNQLLSRGLLRDGHNIDFAHPGDSEGEVAE
                     TMGRIMGVVNDLILRRDRDAEHRESLSATLRTLRAESLRQANDIQRLQEKHAEAQRKA
                     GLSEAAEAALRTHLKTAEATIHRLKEEAARTKTLVAQTRASCANEVRKRDRQIESLKK
                     AVTEAGRARGVGKSPAVTTITVTGDIGMGPETEQAAPPVSAGSAADQGYDLRSETNAF
                     LAELAKGLSEENEGLMQLVRRTIERLKEMSGWDVTNGGGPTGCAGDGHALALAANPAD
                     MSLEVDAVLEHLRTILTNPSFVPIEEVVVREDEIHRLRDGWEKMETRWKEAVHLIDGW
                     RKRMQASGRPVNVEELKMGLRLSPVRVRNVEETSQGLDLRLDAVLEDEEEADVVPHDG
                     DEGNLGLVQEPEFDDGYSDASSMFDHNVDDVDVCDLDVEEPNVEILQQSVMFASPPLP
                     PPPQLGPLRDSSTAGNRRERPDRGQRPVGFATITQEKTREVAGEDAPMPPPPPPPPSQ
                     GERPQQPPQKRPLLSLRTVPPEEAANVALPASAVVSTPDTSVENMPLSKATDEPATKP
                     PRAATKAEQRPAPTPKKKEAVRKETTARELTQKKDREETKAPASRPPAKARPTKPPIT
                     RGRTETRKDEKGSHPTKATPRARSAASTASAASASSSKSAGAAKNVITDNVKAPRPPK
                     APAPAQSPSRSPVRANSRLPMPRPGGNGVLPAPQQSPLNMATIAAKLAASEREADAAR
                     VRAKLKAARLGKGVVSLPPPGTGGGGGGSGTAGSAATCPAEADAGGGGSGGGGGGTST
                     RSESDSAAGSASTAASASDAAPSSATTAARDEELGADAGADADADADADELGLSPPGQ
                     QQKQPQPPQPQPQKQHLRAQPSRTELRKAAASATTTSSTRPPPSSTTAAARQKTSTRT
                     TAAAVTAPPTTATTTVATTGTAPTATAPTGTATTAPTAPPAPAAARKRDRRVSRTASR
                     RRSTLNPWELDALIQGGVSGVSNGGSSGKKLAAER"
     gene            complement(607412..608698)
                     /locus_tag="THITE_2106296"
                     /db_xref="GeneID:11521282"
     mRNA            complement(join(607412..607443,607513..608698))
                     /locus_tag="THITE_2106296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648574.1"
                     /db_xref="GeneID:11521282"
     CDS             complement(607609..608589)
                     /locus_tag="THITE_2106296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648622.1"
                     /db_xref="GeneID:11521282"
                     /db_xref="JGIDB:Thite2_2106296"
                     /translation="MASSPATIGDFSVLPVSIPPLPSFPKNAVHYLYVRRHTPKIPTP
                     TDSRSLFVTNVPVDSTEAHLRALFASLVGAGRFESATFEDESKEAHSQSQSQSLIDVA
                     QPAHAARLLQAHGRKRKREDDEAERAREEAAVRLPSTWTRPLRRSGSTAVVLLADEKS
                     VQQVLKAIGKAHKTKKYPAWPGSDDLPEGKVPPLGPAWLKAHNRLSYPDRQALQASVD
                     AFSALFARREQEAAEIAKRLRNEPDEDGFVTVTRGGRSAPASRTEAEEAKRRMLEKQE
                     KKKEELTNFYRFQLRERKKAEQAELLKRFDEDRRKLEAMREKKGKFVPEA"
     gene            complement(610162..612269)
                     /locus_tag="THITE_2106298"
                     /db_xref="GeneID:11521284"
     mRNA            complement(join(610162..611749,611829..612269))
                     /locus_tag="THITE_2106298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648575.1"
                     /db_xref="GeneID:11521284"
     CDS             complement(join(610191..611749,611829..612069))
                     /locus_tag="THITE_2106298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648623.1"
                     /db_xref="GeneID:11521284"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="JGIDB:Thite2_2106298"
                     /translation="MAYRVPNEPDHPEVDLYAPFTSDTILEVRTGTMKPLRGLTVQSG
                     IDKTVRHGPVRVTELGLEGDEHDPTFHGGLDKAIHGYCSSHYSTWRAEYPSAAAVFQP
                     GAFGENLVTAHLNERNLCIGDIVSISRSPAPTSATPAANGDPAKDDNDDKGGDDASSV
                     LLQVSLPRQPCFKLNHRFQLKNFAPQTWRTSRTGWYLRVLRPGTIQAGDTIRLVARPH
                     PAWTVARVQEYLHRNTADEAMNAELAGIAEFGAECRDAFRARVLRQRARRRKAAAAAA
                     AAQGKDGGEERQRWREFRVVERRRETGRIVAFVLEAVEPLVESEGEEVSLRAGAHAKI
                     RLGNGLVRAYSVVDGDRNRFRLGAALQEQSRGGSRYLHEKVHVGHTLQVGAITPPAPA
                     ASAASHHIFVAGGVGITAFLGMVEDFKKIHYSVELHYAVRSAEDVPFRERLAALGDAV
                     VIYDKAAGQRLDIRSILDKMLWNSRLYFCGPKRLMDEAAREVSARGIPETEVHFEAFE
                     ADVSGEPFEVVVANKGGRTIKVGEEETLLECLEREFGGVDSSCCVGNCGTCRVSLKEG
                     RIDHRGTALREEEKATSMLACVSRGIGRITIEI"
     gene            614307..617009
                     /locus_tag="THITE_2106301"
                     /db_xref="GeneID:11521286"
     mRNA            join(614307..614757,614841..617009)
                     /locus_tag="THITE_2106301"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648576.1"
                     /db_xref="GeneID:11521286"
     CDS             join(614614..614757,614841..616592)
                     /locus_tag="THITE_2106301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648624.1"
                     /db_xref="GeneID:11521286"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Thite2_2106301"
                     /translation="MSLLRLPYELLSIICEHLDLRDIYSLSFSCKRFQFLLYEPNITK
                     LLLESKAPHSTEARDARISKRYAAGLRRLIKRREAVASVSPYLVAIVAFAEEWLYSNG
                     VLCYLRGPQLRILDLHRSGSREMVVDTRKLFREALEGSRRRRTYQIQLLYQSHNIVSC
                     VYGPSRRRKTRSPSSNWLVAFDPLDGQIKTVHRLESVSNLFVRNNERFLYYGTTSAPG
                     HDGYERWVIGGFDLAAREWLGELTISAVIGTDIGSSVCFEILDGFLYVVSNQTSLELE
                     VVDWISYYPCFRLPLTRRGLKEVEAPPREQNWRRNHTEGPIDDRFTFLRLFKDEETGQ
                     LRVTESRREWLWGRISARQTYYTTPISFEGADRDLRGRYSLQLQQQRTVSATRTRDPH
                     LVHPADGNSATIPLSKSAVRSYHPSCQAFVDLVDDSNSCDTANQRIRIRGGSRRPRMP
                     GERVERECLPAAQDSKYQDVLLRQIDDLYISENGLLWPPELDPSAPDPALSDLYAILN
                     PPGYLGNLHGSWDERSMVYATGGTAGGLKALVFISWDPSISLAGTPPYPGKLSSGLLG
                     SSRDKTRQTTERCPISQPNATSCPVGSFKPMKAATGGVQGGSAVDWRVFEPAGYREIG
                     RGYHFAC"
     gene            complement(618975..620798)
                     /locus_tag="THITE_2106304"
                     /db_xref="GeneID:11521288"
     mRNA            complement(join(618975..620554,620656..620798))
                     /locus_tag="THITE_2106304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648577.1"
                     /db_xref="GeneID:11521288"
     CDS             complement(join(619037..620554,620656..620691))
                     /locus_tag="THITE_2106304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648625.1"
                     /db_xref="GeneID:11521288"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="JGIDB:Thite2_2106304"
                     /translation="MSLRGFQKGIARAPQQLKAKLNIGEHTKDPVYIDTERRFQDLEA
                     ETKHLHDESKKYFDAINGMLSHQIEFSKAMTEIYKPISGRMSDPESLKLQGNLEGIRA
                     CEEYEAVVKDLQETLAPELEMIESRVIRPATELLDVIKVIRKTATKREHKKLDYDRHR
                     ATLKKLQEKKDRSAKDEKALWKAENDVEQSTQEYNYYNDLLKDELPKLFALEREFIQP
                     LFQSFYYMQLNIFYTLHERMQRVDIGYFDLTLDVEEAFQKKRGDVQERVEALSIVRFK
                     TSGMKRPPKYGGPRPGAIEGPKTAGLLTPGTAATTPGANSTSAPATPALAAAPRSPSP
                     AAAASFSKSPSATASSLRPSWQPRQADVIDNPPPPYSPQPQQPHAGSVSPAASLSAVA
                     KAKPPPPPPPKPSRLSGAPKPETVTALYDYAAQAEGDLSFRAGDVIEVVTRTANENEW
                     WTGRLGGRQGQFPGGFLFFSFFFFFFFFFLIFFSPISEERKRSQDRKEKPEANRIPLL
                     FFSYKPNWA"
     gene            621315..623568
                     /locus_tag="THITE_2106307"
                     /db_xref="GeneID:11521290"
     mRNA            join(621315..621748,621814..622637,622857..623568)
                     /locus_tag="THITE_2106307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648578.1"
                     /db_xref="GeneID:11521290"
     CDS             join(621469..621748,621814..622637,622857..623279)
                     /locus_tag="THITE_2106307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648626.1"
                     /db_xref="GeneID:11521290"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="JGIDB:Thite2_2106307"
                     /translation="MANLAPSVFRQASRLASKQSISGAPRRAVVVLSRASTAPARGAG
                     HRRYVTQSKSDHAQVQVDTAIRLDRSELEKAGATLEVQSGSTTHVSPMADVLKQATKM
                     DEGQRPIYLDMQATTPVDPRVLDAMLPYLTGVFGNPHSRTHAYGWESEHAVEQAREHI
                     AKLIGADPKEIIFTSGATESNNMSIKGVARFFGRSGKKKHIITSQTEHKCVLDSCRHL
                     QDEGFEVTYLPVSSKGLINLEELKAAIRPDTALVSIMAVNNEIGVIQPIAEIGKICRE
                     NKVFFHTDAAQAVGKIPLDVNAMNVDLMSISSHKIYGPKGIGACYVRRRPRVRLEPII
                     SGGGQERGLRSGTLAPALVVGFGEACRIAKEELEYDSKRIKALSDRLLKGLLSMEHTN
                     QNGDPEHFYPGCVNVSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRALGNSD
                     ENAHSSIRFGIGRFTTEAEIDYVLKAVRERVGFLRELSPLWELVQEGVDLKTIEWTQH
                     "
     gene            624948..625997
                     /locus_tag="THITE_2106309"
                     /db_xref="GeneID:11521418"
     mRNA            join(624948..625204,625275..625463,625583..625997)
                     /locus_tag="THITE_2106309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648579.1"
                     /db_xref="GeneID:11521418"
     CDS             join(625082..625204,625275..625463,625583..625852)
                     /locus_tag="THITE_2106309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648627.1"
                     /db_xref="GeneID:11521418"
                     /db_xref="InterPro:IPR008462"
                     /db_xref="JGIDB:Thite2_2106309"
                     /translation="MSANNNNNNNNNPSTLRSYVDSAAGTVQNALGSIIGNPGDEAEG
                     KARQQKAQSEYDASHTAAKLPGMTATSNAVAKDHPDRSAGSWNQTVGAAKEFVGGLVG
                     NEGLKQSGRQQNVSGQEQEARGQISDFTSGLGDRASGAVGSAVAGLTGDRQKQAEYQN
                     RHDVGKTQQRGAELDIQKQAEARSQKEAEARRQ"
     gene            <629216..>630304
                     /locus_tag="THITE_2124977"
                     /db_xref="GeneID:11521292"
     mRNA            join(<629216..629341,629404..630022,630084..>630304)
                     /locus_tag="THITE_2124977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648580.1"
                     /db_xref="GeneID:11521292"
     CDS             join(629216..629341,629404..630022,630084..630304)
                     /locus_tag="THITE_2124977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648628.1"
                     /db_xref="GeneID:11521292"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Thite2_2124977"
                     /translation="MKHRANQLAIMRIAIAGGGGFAQILAQQISQTAHALLVLSRRPH
                     PELEDFCPGCQVAIVDYDDVENLRYTLQGVDLVISTIAGNEQLNLIDAARRARVRMFV
                     PSEFEGDLGHRPANDPLDRGSQSALQLLESWSQSRSHRLRYTVFSCGIFMERFGPGGL
                     QTYQIGAGCGIQGPDDYLINIQDGRAEIIPTNSAGRPAHVSLTSAYDVAQFVTAAIEM
                     GLDNWPKEFRMRGDTMTVQELVTTCSNTLGIPFSLVTRHYQEVEAQAESCLQRGDWAQ
                     WYYFQRLLQTANGRYHVRQPNLNEATQVQPMPFRTWLESVWPSGV"
     gene            633622..634771
                     /locus_tag="THITE_2106312"
                     /db_xref="GeneID:11521301"
     mRNA            join(633622..634642,634751..634771)
                     /locus_tag="THITE_2106312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648581.1"
                     /db_xref="GeneID:11521301"
     CDS             633929..634489
                     /locus_tag="THITE_2106312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648629.1"
                     /db_xref="GeneID:11521301"
                     /db_xref="JGIDB:Thite2_2106312"
                     /translation="MLVACDHASCSFPRRIPEPSSSRSAQTTPRDTKAGRGQRRILLP
                     GVELMWANLGEDALVPDSFDESSVFVQLRDVSDSPGSEKAGHGTSSRPPRQHGRGTRL
                     LAGSRLPACPRDRTACDTSRICEAVCQRFTEAIVTRKVIAGHQLRPHKLGRDAALPAF
                     STINSGSWLRIADHMMHNPKMSSLRQ"
     gene            complement(<637784..>639803)
                     /locus_tag="THITE_2039081"
                     /db_xref="GeneID:11521303"
     mRNA            complement(join(<637784..638933,639017..639135,
                     639249..639297,639428..639434,639515..>639803))
                     /locus_tag="THITE_2039081"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648582.1"
                     /db_xref="GeneID:11521303"
     CDS             complement(join(637784..638933,639017..639135,
                     639249..639297,639428..639434,639515..639803))
                     /locus_tag="THITE_2039081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648630.1"
                     /db_xref="GeneID:11521303"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2039081"
                     /translation="MTIRRLQTTNRPPSNIDPDPDPDTDANTLLHHPPAGLPSKNPTA
                     SYWLRDLSPALRGHRSSPHLPREADVVIVGSGVSGAFAGLFLLEGLGGGSGGDGWVVM
                     FEAREACSGATGRNGGHCQPLVYGSAPEVAAFELEVFEFLERFVKEEGVDCDWVSLTG
                     VHAFLSKDMFEVAAAEAEQLRQSHPELAAQLEVVRPVSSENGTTLASLRIPSAQGAIV
                     QRKAASLWPYKLVAAVLERLISKFPAPRFNLQTNTPVTSLARDDSGVGWVVSTPRGAI
                     AARQVLLATNGYTSHLLPAFADLIVPVRGQVGALLPPRSDQSAAPAKLTHSYVFAADP
                     EPGSTSPSSPRDDYLVQRPLPTGELIYGGGRRFARDLGVGEWRDDEVEEDLAAYLRSS
                     LSPPLDLTQDELQTKEGPQPPGGRGALKASFEWTGVMDYSRDHHPWVGPVPETLGGGG
                     PQGGLFVCAGYTGHGMPAAALSAREVVRQMVGGDVKARAGRFPAAFALTEERVARARE
                     LPPLTQGWEATNFAALMAGKGASGAGKAA"
     gene            complement(<640564..>641969)
                     /locus_tag="THITE_153800"
                     /db_xref="GeneID:11521305"
     mRNA            complement(join(<640564..640663,640722..640788,
                     640853..641687,641958..>641969))
                     /locus_tag="THITE_153800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648583.1"
                     /db_xref="GeneID:11521305"
     CDS             complement(join(640564..640663,640722..640788,
                     640853..641687,641958..641969))
                     /locus_tag="THITE_153800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648631.1"
                     /db_xref="GeneID:11521305"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="JGIDB:Thite2_153800"
                     /translation="MSSEEPNLQRRASSRKSVTFTDERVVVDADGSVTMVATPNDDTK
                     ETAMSHTPRTPPLSAALGAFTDASQAPANGAADGADTNPDGLDLSLMKKKKKKVKKED
                     GEGGDAADAAGGEEAIDLSMKKKKKKKVPKEDDEFSKKLEALNLEGGNGAEAAAEEDA
                     QEGDMDKGTGIWGHDETRIISYNPLLSRFFALLAQKNPDHASSGTRSYKIPPPQCLRE
                     GNKKTIFANLPEICKRMKRAEEHVTAYLLAELGTSGSVDANRRLAIKGRFQQKQIENV
                     LRTYIIEYVTCKTCRSPNTDLSKGENRLYFITCNSCGSRRSVQAIKTGFSAQVGKRKK
                     MQG"
     gene            642256..643445
                     /locus_tag="THITE_2106323"
                     /db_xref="GeneID:11517188"
     mRNA            join(642256..642881,642952..643445)
                     /locus_tag="THITE_2106323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648584.1"
                     /db_xref="GeneID:11517188"
     CDS             join(642590..642881,642952..643055)
                     /locus_tag="THITE_2106323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648632.1"
                     /db_xref="GeneID:11517188"
                     /db_xref="JGIDB:Thite2_2106323"
                     /translation="MSSTPSSDTASSLSASSSFVITDVPRSASSGRDGSDDDDEDVDS
                     LPSISSSILDSEADSSSDAQREWEASLEQLQLLLTMVIMPFAGKFLGRKFAYWSWARY
                     MEWMHNVEIRWTSKRTFNAAGAAEAASSL"
     gene            complement(643446..644631)
                     /locus_tag="THITE_2106324"
                     /db_xref="GeneID:11515451"
     mRNA            complement(643446..644631)
                     /locus_tag="THITE_2106324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648585.1"
                     /db_xref="GeneID:11515451"
     CDS             complement(643674..644183)
                     /locus_tag="THITE_2106324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648633.1"
                     /db_xref="GeneID:11515451"
                     /db_xref="JGIDB:Thite2_2106324"
                     /translation="MEKIQLLLRALQLLFIVILTGLVGNIIASNIAAASSATAAINFS
                     MFVVVLSWLAALLGLATAMIERVALAPLVLLGADALATLFTFIDAVVLAAKLRAVNCA
                     DTGGQPANWIAYGSADDGKRCREVQASTVFMWFLFATFAAVLALGFLGFRRGGGSIRS
                     GPTMSQVRV"
     gene            complement(645900..648800)
                     /locus_tag="THITE_2106325"
                     /db_xref="GeneID:11521468"
     mRNA            complement(join(645900..647541,647595..647723,
                     647802..647918,647991..648800))
                     /locus_tag="THITE_2106325"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648586.1"
                     /db_xref="GeneID:11521468"
     CDS             complement(join(646127..647541,647595..647723,
                     647802..647918,647991..648480))
                     /locus_tag="THITE_2106325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648634.1"
                     /db_xref="GeneID:11521468"
                     /db_xref="JGIDB:Thite2_2106325"
                     /translation="MALPDLEKRALPSLENGHGYEFDEEPPRRRALSWLGTFAVVLSL
                     LATVWWTSGQGLAATLSFTNHASLQAHTGYPGLASQAVISRSPTVDVGVDDDTGTGTT
                     SAAAPTRTVLKVFEVDQPVLMPGGPAESDGSTRAGEDYSPELCTVLLMRHDFAWSYNA
                     PFVGDYTPPDCEFNRVVLNFSVVSEGRQYDRLAIMYFGDTEVWRTSTAEPTVPPGISW
                     IYLKDMTHYMYFWKSPQKIIFDLGNLINDKYTGIYNTTLTAIFFNSPVETDQAPPSDL
                     IIPISARQGANNSVSQFTLPAQNATNTISFPRNVHRAVFSVSANGQANEEFWWNNVLQ
                     SDVYTFNSTAGALPGLSPFREVQVLIDGQLAGLQWPFPVIFTGGVVPSLHRPIVGIEA
                     FDLREHEIDITPFLPLLCDGQQHTFTIRVAGLNDTGTTASAHLTETVNESWYVTGKIF
                     VWLDDDPSSITTGDPPTIDEPPPVISISRSITTAANGTNETLTYSTTVSRSLQITARN
                     LRTQPNLTSSSSATWTQSLRYTNDGHLSAFGYNQRNTLSIQGADRADLPRGARYATTY
                     AYPLAANSSAAVSPQGNLTLWARLAQGKQLAVSGASVFPTGLEAFSGHSGSGSGSGSG
                     SGGAVVAVLRTSKEGTGSFYQSGDGKQSSGFGDARQVFWFGTADGDELYFRDVSAVNG
                     SVVADSKRVGGKEAGAGVEQGGEGVAAAVSYELW"
     gene            complement(649244..650631)
                     /locus_tag="THITE_2152666"
                     /db_xref="GeneID:11521304"
     mRNA            complement(join(649244..649586,649653..649841,
                     649912..650631))
                     /locus_tag="THITE_2152666"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648587.1"
                     /db_xref="GeneID:11521304"
     CDS             complement(join(649438..649586,649653..649841,
                     649912..650350))
                     /locus_tag="THITE_2152666"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648635.1"
                     /db_xref="GeneID:11521304"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="JGIDB:Thite2_2152666"
                     /translation="MLRSAFGVFDALLGGSAAPRIFSRGTAGRRIWMGRASARAPAAP
                     WHQRAMMSQLRTSRSVVARTQLRPLKTPLARPRRAFHTSRPRRADDTKNGNKAGEESL
                     SLSARLKKLSKEYGWTSVGVYLGLSVLDFPFCFLLVRTVGTEKIAHLEHIVVSNVQKV
                     IPERVQAWWREYRQALEEARRERAGETAELAVIYHGVEEAEQRSKQEGASLATQLALA
                     YAVHKSFIFLRVPLTAAVTPKVVKVLRSWGWQIGARKAKR"
     gene            651518..653431
                     /locus_tag="THITE_2106335"
                     /db_xref="GeneID:11521302"
     mRNA            join(651518..651633,651712..651744,651850..652452,
                     652569..652918,653026..653199,653279..653431)
                     /locus_tag="THITE_2106335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648588.1"
                     /db_xref="GeneID:11521302"
     CDS             join(651876..652452,652569..652918,653026..653199,
                     653279..653323)
                     /locus_tag="THITE_2106335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648636.1"
                     /db_xref="GeneID:11521302"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="JGIDB:Thite2_2106335"
                     /translation="MSAPPTQTTFSYPAPPSASQPKNYPPPPQAAPTPTPPPSTSTPS
                     YPPPPQQQQQQPQQRYPPPPQASPSPAPQGAIPQHLRSPSAASHSSSQAAPQFAPPPT
                     YPHEEDDGTYPAEKQQQQQQQQPGPAPVTDPAGAAGMLMGAPAAGHFTGASVIVDDVG
                     TFNGGSYRISHRDCNTILTIQLAIGCPIHAKPGVLIAMSPSIVLKGAYKFSVKKLVAG
                     GEMGRSTFTGPGELVLGPPMLGDITSLRLTGRETWSVSHDGYLASTENVVKDYKLQGL
                     SKAMFSGEGLWVYKITGTGLVWLTSFGAIIRKDLAEGEKYIVDNGHLVAWNTKYVLER
                     VASGGIISGLASAEGLVCKFTGPGTVFIQTRNAKSFTAFMSGQQATM"
     gene            <654775..>656850
                     /locus_tag="THITE_2083831"
                     /db_xref="GeneID:11521293"
     mRNA            <654775..>656850
                     /locus_tag="THITE_2083831"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648589.1"
                     /db_xref="GeneID:11521293"
     CDS             654775..656850
                     /locus_tag="THITE_2083831"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648637.1"
                     /db_xref="GeneID:11521293"
                     /db_xref="JGIDB:Thite2_2083831"
                     /translation="MAGYVKQTSSAGKAARTILCGLKINTSPLDTAQPDAKSPAMAST
                     DWRRRAAAVSAPETSAKKPLQRSKESCDGSYDQPSQFRLRLDKSFSGLDQYRHTKKRQ
                     APWEAALSAPAWPMSPSSPSVSADERHNVINIRLWSVNPITTSVNGEDIAIPNRFALD
                     IVPVHPDAPGFVVGELRPLNGSVTSFRTSSEDSEKLLAELRGLVGCPQCGCALANPTS
                     NEQHGFSPPARPRDVTDATISSAFGSSQSDTETHSRQERMEPPNDEERRFQTLLKRLQ
                     QPPSTRRIGGMASNSRPFVDPAIVAMKVKETAGNRQSNEATNNCEALHLDNRGGELQP
                     QSADSGYASNSSGNSSSDRSAALGASPLNGPISTPKEPLAGSDRVKTLNPTAAEFKST
                     RQDDVVRCLSPKKFSRPPLTNIFPNVIPSHPPLAQPVVHESALPLLSPAGGGSTVPGH
                     GSLGGVENWPTIGSAVFAESLRYVRPGAMNGIVPNGLASISTPPQHIIAPAQLGVASM
                     NGPALEANLPLTSVFHTFPPAPASSLPAYAHTQAAGLHSFLPGTVPLGRLPQQQAGHV
                     VNGKPSRPYFPVTTKPRDHDPVKQQLYEAYLEWRKANEPGYHLKCKMRQAQRVMRQYQ
                     LQQDKSASREPAGWKAVKEQAKAAVGAAAAAAAAEKRRQQESVREELRVKVKELSQNS
                     KKGSGEGKQ"
     gene            complement(658837..661887)
                     /locus_tag="THITE_2106338"
                     /db_xref="GeneID:11521291"
     mRNA            complement(join(658837..659820,659886..660405,
                     660482..660603,660675..660875,660944..661267,
                     661330..661887))
                     /locus_tag="THITE_2106338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648590.1"
                     /db_xref="GeneID:11521291"
     CDS             complement(join(658918..659820,659886..660405,
                     660482..660603,660675..660875,660944..661267,
                     661330..661482))
                     /locus_tag="THITE_2106338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648638.1"
                     /db_xref="GeneID:11521291"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="JGIDB:Thite2_2106338"
                     /translation="MAAPIRPVLAALWDATADYDERDVAMRDGITKAHGLMDSHEYSE
                     ALHVIFETVSLCPCMAPSDSAAATSNGMARHGKDKACHISQFIAALQSEDPEHPKALC
                     QLASQPCSCGYSWPSCPRILHAVALDALAECLNKADQHVNALSTALGTIRLDPACAVG
                     YCRAARIIHQLLIAPEHSPAARAMSGLLKVASLPSADALRELLRSLVRTGLYNTSRSR
                     TRPRGPYYFILQDIAHRLKIKEARRDPVEWFPAEVLTLIFSHLDITSLIKCLSVSKRW
                     NQLVRRDSVLWEDLRLNRPRNPGRFLAKFLQQHQEIRTFVVYESSSFSLNGSKISTIF
                     YGLPRLQRLYLTALPRPSELPGLDFQLRQAPGASLTQLTLVYFYNQRPVKKLLDLTCN
                     TLEVLDLVGTDFEVNNTLGSVFLPRLRKLRVTLGHLTKSHHQRGVIEMKPIVKATPRL
                     EQFFLDGFTIQWFAEDDDELLRLNEDDAAATCKDDLWPSLNTLVLGPRVLLSVNGIFA
                     AYKEFSALPPLTSNMRSIEILCHDPAVAHNVLFAVDSAPHPDNPDGPLPVTPMPNLEV
                     FRCTTQLLTRSGLRQILEPAAKSGALKVLELAAEPFLLFPDEEGGGHERVPFQPKVHL
                     DYVVSPNLHTLGLRDFNCLRYPDDPWNPPDLFDGQPFIDWLDSFPSLHTVAVYPGPWA
                     GVDEFIMKLIKHPRVQVIHQDVLRGVAWDRAVQLAETVEVQLNHTPRYMPAGWPLIED
                     "
     gene            complement(666261..666696)
                     /locus_tag="THITE_2106340"
                     /db_xref="GeneID:11521289"
     mRNA            complement(666261..666696)
                     /locus_tag="THITE_2106340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648591.1"
                     /db_xref="GeneID:11521289"
     CDS             complement(666304..666552)
                     /locus_tag="THITE_2106340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648639.1"
                     /db_xref="GeneID:11521289"
                     /db_xref="JGIDB:Thite2_2106340"
                     /translation="MCYQLIELYSACRCLYYQHAVDRCAAYGRPGHGIQRRTILVGYA
                     CSEHSSHHASGYDYSYSQYSDSGYYSGQSSKSSGGRYR"
     gene            complement(<668783..>669695)
                     /locus_tag="THITE_112145"
                     /db_xref="GeneID:11521287"
     mRNA            complement(join(<668783..668997,669181..669444,
                     669581..>669695))
                     /locus_tag="THITE_112145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648592.1"
                     /db_xref="GeneID:11521287"
     CDS             complement(join(668783..668997,669181..669444,
                     669581..669695))
                     /locus_tag="THITE_112145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648640.1"
                     /db_xref="GeneID:11521287"
                     /db_xref="JGIDB:Thite2_112145"
                     /translation="MSFPEHPQPGSLAAFPTSFESSAHARPPGLSAAESSSQDEFRVF
                     RPGCGAWRTDYRLIHHVPDRSGVSQSDGPGGKPPAIMSPPMVGNCGHIDHHWARYGES
                     LRFSTILLQFDKDMDRVNCTSLMSFVKNGFILPSSPRELNRCHPALLSAKAVVLSKLG
                     DAVLPPLAPNQDRHPSTVSSLGDASISIPGTQDLAGS"
     gene            complement(673316..678175)
                     /locus_tag="THITE_2106343"
                     /db_xref="GeneID:11521285"
     mRNA            complement(join(673316..674734,674809..677881,
                     678012..678175))
                     /locus_tag="THITE_2106343"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648593.1"
                     /db_xref="GeneID:11521285"
     CDS             complement(join(673448..674734,674809..677881,
                     678012..678070))
                     /locus_tag="THITE_2106343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648641.1"
                     /db_xref="GeneID:11521285"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106343"
                     /translation="MSRERQIPAGPRRENQSPTRRTVSGSPTKLGPGRWPTTDAPMLS
                     ASSSNNHSLFSFGGKHGLPDDVTDTATSFDFLPSVSFDDLQSSLESASADFKLTQFPS
                     PTGQGPILADRPLAAGNTMVERPDITRHTVASHAAAQQPPVTRSRTGSILRRPSTSSR
                     HASISSTAPSNPGVQNAPTAPAAMRSRRQSHYPPVSNANIVKPPRKSTGDVAIGGEFE
                     PRKRRPSVASLSDRNGLESTTRSSIDGGSRLAGDVLRAHTNSRTAKARSVQPPPRASQ
                     AMLSADTNTMSLDPGHTSTALPRSPRTSAKGPNPTGKRISVMPGAPQLPHATGLGART
                     ISPTDTRRMQRLSMHHTQGQPTAPVLPNPPQLTADGRSSSRSPSILPRKISTPSSSRT
                     TPDPNRKSYSSGLSITSNASVSTTVRTSTASVQQRNSQAASSRLPAPKVLGLHNSVSH
                     DEEEDVPPVPAIPKAYESPKETFITEAGPLDKRKSNLAYDASSIHSNSTGSVSGGVNE
                     APHAKTHRRASQRKSVHTSKLDMESKAVVSQTKKTLEPLRLPPITLGPLSTPTAARIA
                     ALQEQGSSDRNLSPPPARQIPKTPTTPMTASKSAFFRTRPEERTDVQHLRSSSSVYRF
                     RRESPPPPEPTSSSESVTAVNNGNQRSGPSPFLSSSLPKGGHMEAAFLKRSKTGGDFT
                     LPLDNTAAAESTTHLSKPSGPRAEKTATARPAKSPPPLSSPDEPPTPSSMSSLRRKLS
                     LSWKRSASKSGSSGQLQVEKSEHGTVKHDSMPPPRIPASVTLNSVNTGKPPSPTPSAK
                     SSGAGTYLESRRRKSSASSLNAIIAQEQRGRSDGLGTAKKESTLDTVAERTTLAHNSS
                     VVQKILKPRQSSAALRHHDVWTAELDKDDMIAEEEMMKLGLRRKDTELAARTLDALRK
                     RATPKERVSPQEAIRIAVLNIYERGEIVDYKDVYFCGTQNAAKVVGDPQSDSPNFGYD
                     DERGDYSIVPGDHLAYRYEIIDVLGKGSFGQVVRCIDHKTGALVAVKIIRNKKRFHQQ
                     ALVEVNILQKLREWDPHNKHSMVNFTHSFYFRGHLCISTELLDMNLYEFIKSNAFRGF
                     SLKMIRRFTKQMLSALNLLKQHKVIHCDLKPENILLRHPLHTEIKVIDFGSSCFENEK
                     VYTYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGVPIFPGENEQEQLACIME
                     VFGPPEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRRRPSSKTLQQVLKCDDEAFLDF
                     IARCLRWDPDRRMKPEEAIRHEFITGQKSSVPVPRSAIRDSSPSKRVASLNAGPRPLP
                     EPPAAAKSNPSSLRSRDAAAGFNAHHHNSPLKPGMAPSSTASTTRRTSGVVASSSSTT
                     ASASTAAPASTIPGLKRTSTGTGAGAGTASHSNGASAAPSGPLSGSHSNSSLPRASIR
                     SVSGSFAGVGGGAGAGGGVRQDLATAGASAAMGRRV"
     gene            680267..682310
                     /locus_tag="THITE_2106346"
                     /db_xref="GeneID:11521283"
     mRNA            join(680267..680781,680845..682310)
                     /locus_tag="THITE_2106346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648594.1"
                     /db_xref="GeneID:11521283"
     CDS             join(680606..680781,680845..682282)
                     /locus_tag="THITE_2106346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648642.1"
                     /db_xref="GeneID:11521283"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="JGIDB:Thite2_2106346"
                     /translation="MEELRSSFLDTVSGPAVTDPDDRHDEAQQSTDSDSVRTARGIRH
                     GVFRAATLQDKLLERLLSQVIPADDSNGRVPDLTADDMPAYAERPGFSLPLMAANFRR
                     FNARIGVVFKFQARALRVLSWRRPTQTLSLLAVYTFVCLDPYLLLALPLAIALFGILV
                     PSFVARHPAPSSEPDQVRNLGYSPRGPPLAPPRTVKPAKELSRAFLRNMGDLQNVMDD
                     FSVAHDKIVALVVPVTNFSDEALSSAVFVVLSGACLVMLIAAHLLPLRFIALVGGWAG
                     ILSGHPAVARWIRQAKAQYTAAATTTTTTNNNNSNNNNAKAASAPAKSTTPWYSPTAL
                     LQSLLSDIQLDSAPETREVEIFELQRRTFPSSSTIPASSHPPSPSPSSAGRDSAGEWQ
                     PWLFSPSPYDPLSAARLAGERPRGARFFEDVRPPDGWEWSEKKWALDLWSREWVEERI
                     ITGVEVETEGERWVYDMWTPGDDVAAAAGGGGGGEWEGAGEGQGRRSAPPRSGVSWEE
                     GEEEGMGRRGLWRRRRWVRTVKRKKVTDV"
     gene            complement(682587..684398)
                     /locus_tag="THITE_2106347"
                     /db_xref="GeneID:11521281"
     mRNA            complement(682587..684398)
                     /locus_tag="THITE_2106347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648595.1"
                     /db_xref="GeneID:11521281"
     CDS             complement(682704..683978)
                     /locus_tag="THITE_2106347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648643.1"
                     /db_xref="GeneID:11521281"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="JGIDB:Thite2_2106347"
                     /translation="MAAPPTATSSSSAPPTGPGSGSGSAPAPNNAFLQSPAAIPPRTS
                     STYSTAAAPPPGAAAALRSVPENDWPSAPTSAAANHHHKRQRSRKASGGATSFPSAAM
                     SGTSQTPPDPNRFATEDFFLNSARRPWSEEKDRVLRAPFDYLNQHPGKDFRTALVKAF
                     DAWLEVPPESLEVITRVVSMLHTASLLVDDVEDNSQLRRGFPVAHNIFGIPQTINSSN
                     YVYFCALQELQKLRNPKAVSIFAEELINLHRGQGMDLFWRDTLTCPTEDDYLEMVSNK
                     TGGLFRLGIKLMQAESRSLVDCVPLVNAIGLIFQIADDYHNLFNRQYAANKGMCEDLT
                     EGKFSFPVIHSIRSRPGDLQLLNILRQKTENEEVKRYAVAYMESTGSFEYTRRVLDVL
                     IARARRMADEVDDGRGKAQGVHEILDRMVIKE"
     gene            685443..686887
                     /locus_tag="THITE_2106348"
                     /db_xref="GeneID:11521457"
     mRNA            join(685443..685578,685699..686246,686311..686887)
                     /locus_tag="THITE_2106348"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648596.1"
                     /db_xref="GeneID:11521457"
     CDS             join(685845..686246,686311..686841)
                     /locus_tag="THITE_2106348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648644.1"
                     /db_xref="GeneID:11521457"
                     /db_xref="InterPro:IPR012535"
                     /db_xref="JGIDB:Thite2_2106348"
                     /translation="MESLLSLAFDNLASFDGGKIKKGLKQVEGLLAQICLSGPSSPRK
                     QERERGREQAPRKVLADLSADPAFREFFKLQEGFEWNIAQRLLTTLDWLVVRGGDGQY
                     DLLIVNALDLIQGALLLHPPSKALFSRSVHMNLLLDLLEPVNCPAIQSAAVATLVVAL
                     VDMPQNTRVFEQLDGLLTVTSLFKSRETGRDVKFRLTEFLYFYLTPETPSIPRAESRV
                     NPAAPGLLQRSPSKLAKVFGGGVGGGGAAAARSSAAGANNASKGHERPGSSENGATLS
                     VEAKKLLVDRYLPGVVDELLKDLDTYKPFGGVLS"
     gene            complement(688372..690312)
                     /locus_tag="THITE_2060551"
                     /db_xref="GeneID:11517702"
     mRNA            complement(join(688372..688900,688937..689342,
                     689547..689797,689962..690013,690077..690312))
                     /locus_tag="THITE_2060551"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648597.1"
                     /db_xref="GeneID:11517702"
     CDS             complement(join(688468..688900,688937..689342,
                     689547..689797,689962..690013,690077..690290))
                     /locus_tag="THITE_2060551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648645.1"
                     /db_xref="GeneID:11517702"
                     /db_xref="JGIDB:Thite2_2060551"
                     /translation="MVVAFARALAVGWLLAAAAAAANADAATADVHEHFATVETDVLL
                     SPRQFPVFPAQPLRKRQGGVCNPGYHPCNDIGPPGDGLCCRNDQYCIVNPATTTIGAC
                     CHLGSTCGSPCNATEYACKSTQTLTTSGTTTTTVIPACCGRRCTVSTMFACASSFGTG
                     CCPFGAVCGSSNHCLTTLAPSQSTSLPIAPPGCTTSQISCPASLGGGCCAATQSCTFV
                     AGAGARCAETPPAAPTGTGGVTVVEADGDGSGLGAGAKAGIAVGVVVGAGLVLGAATW
                     VCVRRRRGSRSGDVGESAGSGSRRTAGLVGRVAGGGGGGAGTGREMSEENSDMASRSG
                     RLAGLAQDYFGPTPAVGPYSDTHGTSAVTTPGMDRGGVPLQPHEPGDIAAPVEIDSRL
                     REAQRAPAAAGGYYPHAGEDGLERYELHGSDLGQISPSSLPSPFAGGMPSPPDERPRR
                     G"
     gene            complement(690946..692457)
                     /locus_tag="THITE_2106351"
                     /db_xref="GeneID:11517662"
     mRNA            complement(join(690946..692291,692355..692457))
                     /locus_tag="THITE_2106351"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648598.1"
                     /db_xref="GeneID:11517662"
     CDS             complement(join(691070..692291,692355..692443))
                     /locus_tag="THITE_2106351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648646.1"
                     /db_xref="GeneID:11517662"
                     /db_xref="InterPro:IPR008717"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2106351"
                     /translation="MSKDLNVSPSVINLTISFYMLSMSIFPLWWSSFSESLGRRTIYI
                     ISFSLFVVFSVLTAVSVNVGMLVVMRILGGGASASAQAIGAGTIADIWEPAERGLAMG
                     IFYLGPLVGPLCSPIIGGALAQGFGWRATMWFLAIYGAVMLLLLFFCLPETLAVRAPP
                     NPAPPTAGEQADALQRVSTAQSIRRHSRRGAAMLKRFLVDPLSVLVHLRQPPVLVAVY
                     CASAAFFSLFVLNISIQSTFSKPPYSFRPIPLGLCYLAPSLGYILASSFGGRWIDYIM
                     AREARRAERYDENGKLLYLPEDRMRENMWLAATLYPGAMIWYGWTADRGVHFMVPEVA
                     NFFFGCGSMLVFGVTTTMLTEFMPRRSSSGVAVNNFVRNIFSCVGSVIAQPLIDAMGN
                     GWMCTMVGLFAWVTGNAAIWALTRYGARWREEMNRKLNQGGNRG"
     gene            694036..695591
                     /locus_tag="THITE_2106352"
                     /db_xref="GeneID:11517348"
     mRNA            694036..695591
                     /locus_tag="THITE_2106352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648599.1"
                     /db_xref="GeneID:11517348"
     CDS             694174..695514
                     /locus_tag="THITE_2106352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648647.1"
                     /db_xref="GeneID:11517348"
                     /db_xref="JGIDB:Thite2_2106352"
                     /translation="MSLTNASPADAAQAAKSASHVLATLSADARNEALTAIHAGLAAA
                     RDDILAANARDLELARQAAADGKLSQSLVARLDLGKKGKWEDMLKGILDVRDLDDPVG
                     RVTLRTRLDDGLELERVTCPIGVLLIIFEARPEVIANIAALAIKSGNAAILKGGKEST
                     ESFVAISRVISAALERTQVPNDAIQLVTTRDVIPELLALDQHIDLVIPRGSNDLVRYI
                     KNTTRIPVLGHADGLCAIYLEQSADPAMAAEVIVDSKTNYPAACNSLETLVVQEAALP
                     TLLPAVAAALAAKGVELRCDTASKAALQHVPGLNLVDAVEADYDTEFLSLTLAVKTVA
                     SLTEAVAHINAHGSHHTDCILTASREQAEQFMAAVDSAGVYWNASTRFADGTRYGFGT
                     EVGISTNKIHSRGPVGLEGLMIYKYKLRGSGQVAAVYGEGDGKKRFLHQRLPLE"
     gene            complement(696495..699335)
                     /locus_tag="THITE_2106353"
                     /db_xref="GeneID:11515822"
     mRNA            complement(696495..699335)
                     /locus_tag="THITE_2106353"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648600.1"
                     /db_xref="GeneID:11515822"
     CDS             complement(696557..699154)
                     /locus_tag="THITE_2106353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648648.1"
                     /db_xref="GeneID:11515822"
                     /db_xref="JGIDB:Thite2_2106353"
                     /translation="MAAPLSPAPSAALNLSTPTANLRREACDDRRKPAGNTENHTSND
                     DISLDGDSSPFLSHVKDEVTSPTARGPSPPKARAGSRIISGSELSPLKILQQQQQSQI
                     QAQTQAQAQAQSQPQGQNQTQQSPQSAHDETSSPAKSMPPPPLPQSPRKVGPIKRFPV
                     KVSQPGSSARESPRRSLEERRSSGERQSSLQEVVLENEGLKHAIEIFEDEVNAMHDGA
                     DDADHEDGHTLLVSHGAAPGQGHLGEEEHSVLDDSMVSTFSAFSGVPNLTMLAQMRSD
                     SPSKFSVMGASTPRAPRMEPPEASRTPRVNGSYDAGNNTTNLMDFTEQLRYGAYGAYP
                     TPSRRGGAMPPSSSTAEANVAATPQRPNGSNNLVSLLDFDLPPAPTPRSIPSITPREL
                     ESLKSGFLSEISSLKASLSGKEAEVQSLKTAVGDAEKRVGECMEQLREVQGAQEALQA
                     EKDSWERRGREMEAVLRKVKEEIVISQREREELEFKLDESEKRREAAEMMAQEAESKM
                     AGMRAGKASAEAAAAAAGGAENKPPVAPPSHKEVEIAVERVARELHALYKSKHENKVA
                     ALKKSYEHRWEKRVHQLQAQVDELRRENEELRQLASRDSAAAHRGLDPARLAEMEEER
                     RAERARDAAQIRELEATVEKVEAVLKTVQADNAELRVLLERERVEKGELVMLAEEMMN
                     IQQSFIAAADEEPSDQQQQQQQPPHHQPQYQPQQQQQRSPPHHQQHQPQQQQQQQATK
                     TPSKRQSYAGPSTSRTPGNSFRLSTSANNNNSSLANGFRASGLRAPGSVSGIPAPGVR
                     ASHERTKSAATMIGVGAAGGGSGSGSGSGLPRPGSGQGLRGVGASGIMSSIERMGAGG
                     SHGSRGRFV"
     gene            701288..703067
                     /locus_tag="THITE_2106359"
                     /db_xref="GeneID:11516891"
     mRNA            join(701288..701627,701697..702031,702085..702288,
                     702362..702646,702731..703067)
                     /locus_tag="THITE_2106359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648601.1"
                     /db_xref="GeneID:11516891"
     CDS             join(701389..701627,701697..702031,702085..702288,
                     702362..702646,702731..702912)
                     /locus_tag="THITE_2106359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648649.1"
                     /db_xref="GeneID:11516891"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106359"
                     /translation="MVLADMLSTCVNRLKSVLGLSSKPLAQPARFFSEESISRYCYGG
                     YHPVRIGDVFDNGKYKIVSKLGYGVYSTVWLACHLETRRHVALKILTADCYGQQQDTF
                     ELDILRQIKAQTTPHPGSNHILPLLDQFEHQGPNGKHVCLVFKAMGPDIQRYRRLFPR
                     LRIPVPLVKEISRQLLLALAYLHDVCRVIHTDIKPQNILVETTAINTMFEQAPSEAFR
                     SERPPLEAPNDFYMESRQVSSAEEDLTQPTDLSVRLADFGTSSYFGRHLTEWIQPQML
                     RAPEVILGAEWDHKVDIWNLGVIVWELAEGKVLFDGAWTANAPYTAEAHLAQMTAIMG
                     RMPEALLARSKNRNQYFDDEGKLLKPSTFPPCSLEQFSSIPGLSDAEKKAYLDFVLSM
                     IRLDPQQRPDAKSLLESEWLRQ"
     gene            complement(<704440..>706692)
                     /locus_tag="THITE_129457"
                     /db_xref="GeneID:11516717"
     mRNA            complement(join(<704440..704463,704531..704627,
                     704682..705983,706047..706179,706236..>706692))
                     /locus_tag="THITE_129457"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648602.1"
                     /db_xref="GeneID:11516717"
     CDS             complement(join(704440..704463,704531..704627,
                     704682..705983,706047..706179,706236..706692))
                     /locus_tag="THITE_129457"
                     /note="Contains conserved domain KilA-N[pfam04383]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648650.1"
                     /db_xref="GeneID:11516717"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="JGIDB:Thite2_129457"
                     /translation="MNSGPEMYYPSHMSTGQGPPPQTVTSPYAHPHSQQHQQQHPHQH
                     PTPPLLQPGPGQYPPPQYGGQYSYPNALSPPTGPPAVSTPMGPGQPVLPLPGVNQASM
                     APSSYSPGFDTTGQIQPPGMKPRVTATLWEDEGSLCFQVEARGICVARREDNHMINGT
                     KLLNVAGMTRGRRDGILKSEKIRHVVKIGPMHLKGVWIPFERALDFANKEKITELLYP
                     LFVHNIGGLLCHPTSQTRPSQALTAGARKQDLRTPAPLPALQPPQHHPLALPGPQPLP
                     SHPPPMTRPPLDRALTFPTPPASATSVMGSMSSSDSFSWNQQGVTNGHPSSQISIDTS
                     LSNNARSLPNTPAQTPPATSIQNMQSYPPASQPYESSRQMYQPPPPQSSTYGTSSSAA
                     HERPMYGQGGYVKNEMGPPSSRGAAQNTEPVDSKPANGILHAGQSEAVASTGAEEEAD
                     HEHDGEYTHDSGAYDSNRTTYNYNAPPVGSLSHDHSHLSPADLSGSPHQSGSGRATPR
                     TATAASSYYAPQGYNTPPRVGQPSGNVYSVMSNERGPANGTSGNDVYASQNDMGSSVQ
                     NGYATQPPVLNGTSSMKRGRDDEDDRQSDMKRRKAMLDGSGSMPSPTFNPQMPQPPPA
                     ISAQRRRHAATRRLRLVDPIGYQMRVEQPVIANDGDLGLPTGPIDI"
     gene            717577..718695
                     /locus_tag="THITE_2106365"
                     /db_xref="GeneID:11521152"
     mRNA            717577..718695
                     /locus_tag="THITE_2106365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648603.1"
                     /db_xref="GeneID:11521152"
     CDS             717835..718650
                     /locus_tag="THITE_2106365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648651.1"
                     /db_xref="GeneID:11521152"
                     /db_xref="JGIDB:Thite2_2106365"
                     /translation="MPAHSNPKLPPPAEPRYSRNFDPWHSVAAGHQRPETRGPQGWRE
                     SRNMKMNSQFRAGNSGGPRISDTVGLGSEDFDERLGMLVPKQVRARAGHSVADMLRNP
                     GSMRPASRAASRAAEGAATAASSNTARPHGPVPVLGAEEGRENRRSHERAAEEQLALA
                     RQAEDEAREPREADKADKAQKAQERRIFDGLVVYVNGSTHPLVSDHKLKHLLSEHGAR
                     MSLHLGRRQVTHVILGKPSGPNGGAGGGLAGGKLEKEIRRVGGSGIRFVGVEW"
     gene            complement(722471..725241)
                     /locus_tag="THITE_2106367"
                     /db_xref="GeneID:11519073"
     mRNA            complement(join(722471..723252,723315..723829,
                     723887..724145,724212..724455,724519..725241))
                     /locus_tag="THITE_2106367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648604.1"
                     /db_xref="GeneID:11519073"
     CDS             complement(join(722499..723252,723315..723829,
                     723887..724145,724212..724455,724519..724894))
                     /locus_tag="THITE_2106367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648652.1"
                     /db_xref="GeneID:11519073"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2106367"
                     /translation="MDLTQDEVHRQSLADPEGFWGRQAEHLHWHKKPAAALTRTTKRL
                     RTGETHAHWEWFPGGEISTCYNCVDRHVLAGHGDLPAILYDSPVTNTKQRITYQQLLD
                     EVEVFAAVLREEGVKKGDVVLVYMPMVPAALIGILAINRLGAIHAVVFGGFAANALAQ
                     RIEASRPVAILTASCGIDGNKPPIPYRVFVEEAIRISSWKPPKTIVWQRDELPWRPIR
                     KLEGQRKWQNLVKSARARGMRAACVPVKSTDPVYIIYTSGTTGLPKGVVREAGGHAVG
                     LHLSISYLFGIHGPGDVMGCFSDIGWVVSHSYTLYGPLLAGATTVLYEGKPVGTPDAS
                     AFWRLVEEYKINSMFTAPTALRAIRKDDPDNSHIALIGQRGGLRSLRALFLAGERSEP
                     AIITMYQDLLNKYAADNALVVDNWWSSESGSPISGIALAPHAAKNRRVGLEGHRPLGI
                     KPGSAGKAMPGFDVRVVDDDGREVARGKMGNIVLAPPLAPTAFRTLWEDEDRFYRGYL
                     KRFGGRWIDTGDAGWIDDSGYIHIMARSDDIINVAAHRLSTGALEQAITSHPLVTEAC
                     VVGLPDPLKGHLPFAFVITTTTPTTPNSSSPSPSSAAAAPPDDAQLFAELQTLVRTQV
                     GPIATLGGMIRGTTSTTMSTTSTMMIPKTRSGKTLRRVLRELVENAVRGEVDKEVAVP
                     STVEDAGVVEVAREMVRRYFEGRKREGGVKARL"
     gene            complement(725853..727303)
                     /locus_tag="THITE_2169147"
                     /db_xref="GeneID:11515909"
     mRNA            complement(join(725853..726598,726650..726741,
                     726823..726911,727110..727303))
                     /locus_tag="THITE_2169147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648605.1"
                     /db_xref="GeneID:11515909"
     CDS             complement(join(726516..726598,726650..726741,
                     726823..726911,727110..727268))
                     /locus_tag="THITE_2169147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648653.1"
                     /db_xref="GeneID:11515909"
                     /db_xref="JGIDB:Thite2_2169147"
                     /translation="MKFTAAVLALAAGAMAHRNQTVVYTTEVVTAFTTFCPAATSFTY
                     GSQTYTVTEATTLTITDCPNGCTIKRPVTTISSVICNNCAPVYSNSSSSAAAVPPATT
                     TPAGTGSLPTPSTAGAPRALALSGAGLAGLLGIAAFVL"
     gene            731959..734157
                     /locus_tag="THITE_2106371"
                     /db_xref="GeneID:11517181"
     mRNA            731959..734157
                     /locus_tag="THITE_2106371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648606.1"
                     /db_xref="GeneID:11517181"
     CDS             732071..733999
                     /locus_tag="THITE_2106371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648654.1"
                     /db_xref="GeneID:11517181"
                     /db_xref="JGIDB:Thite2_2106371"
                     /translation="MADAVRLSAEKFREIYEQSFRAWSGIGHDAAEQPGLPHSYLDLQ
                     SAFRHYPSFPRNLRLKHVKYARHSQVYATGRSAWGSTKSDCAPGLPSFCQQVEISVVS
                     RSPIPVSVRAASEEEIQWGSWFARGDENYLAVLSLAWAYILSARWVETMPEDVSLVYT
                     SSTADVFTPNAHAAASPDQLNVLVDIGDAGPGEARWWAAILAPGQGWRATMSMGGDAF
                     LAPWSIQLQPACRFLLSTTTDSKNIGTHSAVPPSSSEALRFLGDFCARHNIADQSQAA
                     LAAVLLFPSMRTGQGLQLPAPAISGLGDSMGVASPSVLQPKPHGWAQQADDLDRLLTL
                     SCHTRGIRPMLLSSFYDPNIECNAVTPWLQGALAAIAVVARDDPLILARMLMDRQPKV
                     APLWLGVAVLGLQKDLLKDVGFGYIPVDLHSAAWSGTVQSFIQLPVSDPVVADGRVAR
                     ADQCRLLYLSRSGSHDRVPICQWRPFGETPLEHTDIEIRNHAECQGHGLRYQGFTWDC
                     VDGGTATQQPLDGDDAWACPSPLLASQPQRSKQAQVIDYGKLDIKKDFVSENATRSIF
                     SWLRVDGFASDEKDIWTHEWFEACESDEEVEMQSKGSSVDMARLSSCVETWVSELPCD
                     GSRSHNRESIPDSGNQIK"
     gene            734158..735798
                     /locus_tag="THITE_2106372"
                     /db_xref="GeneID:11517066"
     mRNA            join(734158..734376,734481..735798)
                     /locus_tag="THITE_2106372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648607.1"
                     /db_xref="GeneID:11517066"
     CDS             join(734352..734376,734481..735565)
                     /locus_tag="THITE_2106372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648655.1"
                     /db_xref="GeneID:11517066"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2106372"
                     /translation="MANLMKAVDIKNGKGPAEALFLNPATPIPQPPPGHALVKVRAFG
                     LNRMDLSQREGRYPLPPQAPATLGVEFSGTIVAVTPSSSSSDAAASADGSSSSSSGGG
                     GGGNNPPAAFAPGDEVFGLAYGGAYAEYIAVSTRMLLRKPAHLTFEQAAGIPETWLTA
                     TQALHFVLGGVEGGGGSSSGKKSILWHAGASGVSIAGIQLSRLAGAAQVFATAGSADK
                     CAFVERELGATAAFNYKEQDWVEEVLKRTEGKGVDLVVDFVGASYFQKNLDVVARDGR
                     ICMLGLLGGAVAEQVNIGKLLYKRARIEGSTLRSRDEDYQGRLRDRLEEYLPKFESGE
                     LKVWIDTVLPWEDIVKAHKLLEENKTMGKIICTIS"
     gene            complement(<735799..736489)
                     /locus_tag="THITE_2106374"
                     /db_xref="GeneID:11515627"
     mRNA            complement(<735799..736489)
                     /locus_tag="THITE_2106374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648608.1"
                     /db_xref="GeneID:11515627"
     CDS             complement(<735834..736444)
                     /locus_tag="THITE_2106374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648656.1"
                     /db_xref="GeneID:11515627"
                     /db_xref="JGIDB:Thite2_2106374"
                     /translation="MPDLFAGDAAPNSRAAATAVAGSNPASSAFSSGSSLLDTFKTKA
                     AEAAKSFLIDMWLARHTEAKVLPILERVLDACADEFADAVAHGGGVYAVGYCFGARYV
                     LLLAAERPAQGRRGGAAGGSAGADEEANRPATVGPRIKAGALAHATLVSKDDFIGLKA
                     PLSVVCVEDDPLFPDEVRIAGEEYMTHNGVEHEVQVYPGVPHG"
     gene            737187..739367
                     /locus_tag="THITE_2106375"
                     /db_xref="GeneID:11515690"
     mRNA            737187..739367
                     /locus_tag="THITE_2106375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648609.1"
                     /db_xref="GeneID:11515690"
     CDS             737521..739020
                     /locus_tag="THITE_2106375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648657.1"
                     /db_xref="GeneID:11515690"
                     /db_xref="JGIDB:Thite2_2106375"
                     /translation="MPGVISRNMRTPRGKLASSTSPASPAAVLSSFGKAAKPQSTGKQ
                     NSEKVTPFTPRSSNIEVVLSSRKRKARDDTESTPKKARRESEAQSAAPATPVSSRKQK
                     AVSFAEPEDAPRTPSTPSRALATPSTRKRRLESDETSQTEALLERLNLQSSPVHKRSK
                     TTVHRRAPPNDFDLPRELIDLLDLHVAFLKTLNMHYAHAGTTSPIDLRTLYPSVTRAW
                     GKRYVTLDDIQRCVGVLSWTPVKSEADQSKAPYFLSDYGRGKICLEFHADAERGPLRE
                     PKLNMDFEANLRTLWLSSDEQPATIFIGTLPKAPIKPCPSLAKSVTNNQTTLDAFKKD
                     IAQRKQQEQEAKSAARATTTALHAQDGSSSANPKPLSLLDRIRLKEQQSASHPSGPSA
                     AEIQRRAALRRAADVAAVIGMLCKATAAAGQARVSFTMAALLARLRDSLRTPVAPDDA
                     AACVRLLAAEVAPGWLRIVTVAGKENVVCAVGLQPSKAQVEERVRVLLG"
     gene            complement(<739684..>740267)
                     /locus_tag="THITE_2027442"
                     /db_xref="GeneID:11515648"
     mRNA            complement(join(<739684..740004,740106..>740267))
                     /locus_tag="THITE_2027442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648610.1"
                     /db_xref="GeneID:11515648"
     CDS             complement(join(<739684..740004,740106..740267))
                     /locus_tag="THITE_2027442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648658.1"
                     /db_xref="GeneID:11515648"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR013729"
                     /db_xref="JGIDB:Thite2_2027442"
                     /translation="MSAWDIAEVKIGKNVSRGGGAPRETVVRGQSALNAARRSGATIT
                     TEKKFSTGNAASKPAVEGQRLTMVDRADDIVKPKTVGAEVGKAIQKARNEYAQANGGK
                     GLTQKELATKCNTTPSVVAAFERGDAAPDQKVLAAMERVLNVKLRGSDIGKPKFEKKE
                     K"
     gene            740861..743719
                     /locus_tag="THITE_2106378"
                     /db_xref="GeneID:11519136"
     mRNA            join(740861..741703,741810..743719)
                     /locus_tag="THITE_2106378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648611.1"
                     /db_xref="GeneID:11519136"
     CDS             join(741158..741703,741810..743357)
                     /locus_tag="THITE_2106378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648659.1"
                     /db_xref="GeneID:11519136"
                     /db_xref="InterPro:IPR010775"
                     /db_xref="JGIDB:Thite2_2106378"
                     /translation="MAIWFSLLTVGFAAGISDIFPNLVDVLLFVFFSAVRRQQALEAI
                     LALLRRLVETTVIMGTTALLVFLPSRLSSLLSAHPQVGTEEPRWNGPGKVLLLPCRTS
                     HSRLFPQKHSFSYSCLTVGVPVGFEGNAGGMVSVGRRSRQNLFSWLSSEAWLTVDAGD
                     YLERGKSELGLRGKLDEYLRTQGVDPAAYPHAYLVTAARFLGYHFNPVSFWYLYDGEK
                     RLAAMILEVNNTFDERRMYFLTLDNGDDSARKNGRPAEAPTKTEEQGKGDIHLQHTLF
                     FNRTWSKDFHVSPFNSRDGSYTLAARDPFRPYSLPNATTSSSTPTPTATAATATGITI
                     SNTITLLSATTRRPILRATLTSHPSHPAVDPCALTAAQRLRFLASWAWTGLLTYPRIL
                     LEAGVLWLWRGGLRVWTRPEPLRGTIGRRADGAESALEPVVGRFLRDWVERRVRAPVV
                     VRYFAPGREGVVMRSRAAAARVSGEEGEGERTKMGQGEDEDGFELRVLSPVFYKRLVY
                     YVDPLEGLVAEAEEGGTIWVSRPDLLRRLVSESNNKINNEKTAQARESVGYWEHAQFR
                     MIQYLRTRSMRVGRPLESSNNAKAPRQPRPEDLATKDCSKPSHSCMDAYVWSHESPQD
                     RATYRRWVLKLLLADRIALGDLPLLELQLFVGRACLAWLLSSAVKGIGDPWAGVSWLG
                     RYWLNELGGPPKGSA"
     gene            744115..746153
                     /locus_tag="THITE_2106380"
                     /db_xref="GeneID:11521395"
     mRNA            join(744115..744745,745000..745208,745427..745678,
                     745744..746153)
                     /locus_tag="THITE_2106380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648612.1"
                     /db_xref="GeneID:11521395"
     CDS             join(744625..744745,745000..745208,745427..745507)
                     /locus_tag="THITE_2106380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648660.1"
                     /db_xref="GeneID:11521395"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Thite2_2106380"
                     /translation="MPLSGHCLCKAVTYTVDVEAPILTGYDHCDDCQRQSGSTYSLVA
                     VVPKDKLTVQGPLKKWEGKGSSGHSVWRWFCSECGSPIAHDPDAAPEIIALKGGSLDV
                     EIKKTLKPDTEIWTVSKLPFCQEHLAKPFEHMPQ"
     gene            749875..751270
                     /locus_tag="THITE_2106383"
                     /db_xref="GeneID:11515698"
     mRNA            join(749875..750407,750536..751270)
                     /locus_tag="THITE_2106383"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648613.1"
                     /db_xref="GeneID:11515698"
     CDS             join(749986..750407,750536..750929)
                     /locus_tag="THITE_2106383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648661.1"
                     /db_xref="GeneID:11515698"
                     /db_xref="InterPro:IPR013175"
                     /db_xref="JGIDB:Thite2_2106383"
                     /translation="MAPSSKNAAAAKDRRKSNNTAAAATTANAAARATSPKTSLIVTL
                     KVTPEKLRAIIDPDFVKEDSPAKQSTTAAPNSNAENASDSTPNSPSAGTPAAQSASMG
                     PPTEGPKKKGVKRSAGAAAIGNGEPKARGKPGPKKKQRLEDGTVEGGRGTLAPHKLGP
                     KANQGAINAGLRALDRSGKPCRKWTRGGFKLKSFTGVVWEIPRWKAPPKSQPESSADG
                     STPASVDSSNKENKEDASQVKSEASHNGEDIEMQSAPSLADGHSPAPVPAAAA"
     gene            752533..755929
                     /locus_tag="THITE_2106386"
                     /db_xref="GeneID:11515534"
     mRNA            join(752533..753652,753723..753949,754098..754237,
                     754617..754709,754769..755519,755657..755929)
                     /locus_tag="THITE_2106386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648614.1"
                     /db_xref="GeneID:11515534"
     CDS             join(752694..753652,753723..753949,754098..754237,
                     754617..754709,754769..755519,755657..755808)
                     /locus_tag="THITE_2106386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648662.1"
                     /db_xref="GeneID:11515534"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="JGIDB:Thite2_2106386"
                     /translation="MTNPYHHPLGSTTLAGGEASAGLPPVNVRRPSYASVVSGGSSSL
                     ARPGRSSFSHLLNPTPDSEQQPHASNHFASAQAPQFEPGGAYAQNGASGEDDSARYQF
                     NQTLDRALRPSRLGSSFPYFSRAFDLYMGKDPLPPTHSTAPDDLRFPSDPTMPNVSST
                     GFLSPSYLRGTIYLQKLEEKHRAKLLAEREGGLSAGAQPGPSASVASSRIVSNGSSSH
                     LPMLGTKVTGSAHRGVAYDVVEKPMLESEADDEFSPLPSKWNKDDKEAALEVLGDGYE
                     VRHTGRVLSDHEASSIRADHYISPSCGVYYFEITVLHKRKDQAKMPPIAIGFASKEAS
                     VTRAPGWEPDSWGYHGDDGNSFASQNVGKPYAAQFGTGDTVGCLLNFRLNHALFTKNG
                     QELPIAFKDIPFKDIKGKLYPIVGLKRKDDHIMANFGQRPFMFDIDGYMRTQQEIIEE
                     EIRLADTSRLVPGLSETDLIQQLVLQFLQHDGYVETARAFAEELQAEKTALRLDPSEP
                     VKGINIRDDEDAHNRQRIRRAILEGDIDRAMRDTNTYYPSVLRDNEQVYFRLRCRKFI
                     EMIRQEAELNLHLESLRRAAAPQQQQMPDRRDKDEEMLEPGEAGDDDRQEGDRPDLHH
                     HYHDNDMEMEDGLAAGEAAAIDAVAAALSRLSQEALAYGQELRAEFGASDHPRRETPK
                     QLDEIFALMAYPNPLKVKEVAHLLDGSGRVAVAEELNSAILTSLGKSSRAALENVYAQ
                     TCVLLEDLRRDGGDGAFVTVQSVIDKIPRPRLR"
     gene            complement(757682..>759072)
                     /locus_tag="THITE_133645"
                     /db_xref="GeneID:11515865"
     mRNA            complement(join(757682..758810,758884..>759072))
                     /locus_tag="THITE_133645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648615.1"
                     /db_xref="GeneID:11515865"
     CDS             complement(join(758049..758810,758884..759072))
                     /locus_tag="THITE_133645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648663.1"
                     /db_xref="GeneID:11515865"
                     /db_xref="JGIDB:Thite2_133645"
                     /translation="MQIPRPLQRLFDRFPLHTYDANDLPERSQHLTSGHLPTLYVFSS
                     EEDARLGAPSFNPTCLKWQTLLRLANLQFRVLPSTNHASPTGSLPFLLPPRTSPTASP
                     LPIPADKLLAYARQHTGAQKQQQQPPPPPPESAPSLPLRAQAYLSLITLSLRNAWLHA
                     LYLDPARTALLRRLYVDPCSTSAAVRAALLHQLRRAAAEQIAASSGKVVSTSPVSSAD
                     AIDEAAVYASAREALAALASLLSESRTGWFFGVERPGEFDAALFSYTHLMMEWMGEGS
                     TAEGRVPLGMMVREAGSGELARHRERMLEVAWPEWDRRRR"
     gene            761447..762584
                     /locus_tag="THITE_2106391"
                     /db_xref="GeneID:11519053"
     mRNA            join(761447..761625,761690..762584)
                     /locus_tag="THITE_2106391"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648616.1"
                     /db_xref="GeneID:11519053"
     CDS             join(761574..761625,761690..762267)
                     /locus_tag="THITE_2106391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648664.1"
                     /db_xref="GeneID:11519053"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106391"
                     /translation="MSLTGLAELHDRGIMHTDIKPNNILIDYNEEPGKDPAISQVRIS
                     DLEDSVLLGPGEYIVGCLCGHEFWRSPESWARASQDTASDVYSFAVVAIYVMLDHMIF
                     HLSAEELQGDKAWWHILQRHVSYFGDEDGILGLLEHLGKENPFFDRVIALVEDFDEEK
                     RRTPFALWPHVDADFRDLICKMTSLDPKKRITAREALQHPWFQAGEHVG"
     gene            762652..763878
                     /locus_tag="THITE_2169155"
                     /db_xref="GeneID:11515781"
     mRNA            762652..763878
                     /locus_tag="THITE_2169155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648617.1"
                     /db_xref="GeneID:11515781"
     CDS             763056..763271
                     /locus_tag="THITE_2169155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648665.1"
                     /db_xref="GeneID:11515781"
                     /db_xref="JGIDB:Thite2_2169155"
                     /translation="MDPRSTPSTTQTSALSSTQQLPSSKIVPPAPRPIKAPSTEGFLK
                     DFTLLAEAAKRAEIAVLMRDLESVGLS"
     gene            complement(<763930..>764924)
                     /locus_tag="THITE_2125012"
                     /db_xref="GeneID:11515597"
     mRNA            complement(join(<763930..764793,764895..>764924))
                     /locus_tag="THITE_2125012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648618.1"
                     /db_xref="GeneID:11515597"
     CDS             complement(join(763930..764793,764895..764924))
                     /locus_tag="THITE_2125012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648666.1"
                     /db_xref="GeneID:11515597"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2125012"
                     /translation="MDIQSLFSVKDKVVLVTGGAKGVGRMISEAFVRNGAKVYISSRD
                     AAACRAACAELNALPGARGPDAATPLPADLSRLDECRRLARELAAREPALHVLVHNSG
                     ATWGEAYDAFPDAAWSKLLALNLQRVFSLTQALTPLLEAAAQQQQQQQQPGSSSTSNS
                     SGSGGGGGEAGAAAPVADPARVIHIGSIDGIRVPALPTFAYSASKAGLHQLSRHLAAE
                     LGPRGITSNTLACGPFPSRMMAATLREFGDEIRAANPLGRIGAPSDVGGACLFLASRA
                     GAFVNGATLVLDGGLSLMSKI"
     gene            complement(765315..>766284)
                     /locus_tag="THITE_2106393"
                     /db_xref="GeneID:11516741"
     mRNA            complement(765315..>766284)
                     /locus_tag="THITE_2106393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648619.1"
                     /db_xref="GeneID:11516741"
     CDS             complement(765655..766281)
                     /locus_tag="THITE_2106393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648667.1"
                     /db_xref="GeneID:11516741"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="JGIDB:Thite2_2106393"
                     /translation="MPDRRAQEQAAMQRAFAAHALREHPIAPDGHCLFAAVADQLVVN
                     GLPLLPLAVGGDDDDDDLGQGGLKGEMGERGAGGGGGGAAVEDGLRPHVQPYKVVRRA
                     AAGWIEAHRAEYEPFLEEPVEGYVARIRDTAEWGGQLELSALANAYGVEIRVVQGAGR
                     VEVIKPSAADGDSSSGDGRGEGTKTLWLAYYRHGYGLGEHYNSLRKAE"
     gene            complement(774801..779499)
                     /locus_tag="THITE_2106394"
                     /db_xref="GeneID:11515878"
     mRNA            complement(join(774801..775985,776051..779499))
                     /locus_tag="THITE_2106394"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648620.1"
                     /db_xref="GeneID:11515878"
     CDS             complement(join(774949..775985,776051..779129))
                     /locus_tag="THITE_2106394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648668.1"
                     /db_xref="GeneID:11515878"
                     /db_xref="JGIDB:Thite2_2106394"
                     /translation="MAVWETEDESTGPVASLPTPAEPPHRALSRTVSRGSRKSARSIT
                     PPGKKGKSRSPTPGTGDKSERGSKRSSRDVSTDENISILDPRRFTPTLHASLVSEILS
                     LRRDQEEKLKIIEGLESSLQTVREETESLRATLLSTTKESRSLKRQLSLLEGGTSSAL
                     GELARERDEAIESAAETKKRLEATQKKLRTQEEDSERVHQQWAKEKDEWEEEKRKYER
                     RIHVAESRLKVVLDEVAAFQAAQASGLNGAANGAESDAEDGGKDNDAASVRTMSMTNS
                     IRFSAANSILKANGNSLADELGFDGGFDEESDYGGRESVLSKGHSRNFSRESAPFRTH
                     RRHRSNESLARPGSSISRGKLAFNAAALERLEDGIIKEDDELPPPAPKPSYVDTGIQY
                     SPPPSPKVVPIKPSTPEPSPFLQRSERPFDVDSPPRADHEVEANQRRKRVHVGHPIPI
                     KTPGLHNLMVNGSSQTVEEPLSPPKTPKTPFQEIPPTPKPAAAPDMVSVSTQTDDLPP
                     PLQPSFLGLPMPIPSISIIPPTSRPSTPREPRLPQLCKDFGCQVNLPSTLQTTSSSMQ
                     TEEIRVDKRLDKLPPHLHPSAITSRPSSPANGAADYATEDTRQFTPIPGNLPPRNPRR
                     LDSKRSLSEVPSSPPMVSSSILEEAHDSYPGNNDDGPLSSQKAPMRRPPRISSLFAGF
                     EGNSSDEADEFMDADLSDSEYRTALSAPKPPSNSSRGAKRNSVGTVTSSENALSPKLN
                     ARFFARGLESPEGVDSVAYQMREMRDAGFGRRGSRRGGRSLMFGTKSSVMRRTAMIQS
                     GIASHQRARSPSLADPSEPPFPIPTRASSRKPPVSSSAPSDGRASPSRGFDAWPRRGS
                     SRSHYRANSIRKVRSAAALPRNQRYRRRGSRSPPPFSVSTEAPESPRLPPLPSNGSMT
                     SRTRDGYRFKTHRSQPSTTTANTTDTGAQSRGGAKQPPTVVDAIAQTMVGEWMFKYVR
                     RRKSFSMPDSKGGDDNSNDRHKRWVWLAPYERAILWSSKQPASGSALLGKSGRKLTIQ
                     SVLDVKDDNPPPKGVTQLFNRSILILTPERALKFTATNAERHYIWLTSLSFLAHSNQA
                     IPDALLVPQPKPLVDQYELPKPKRRPIRDSIRLTKAKTAVIKSDPVTAESAQTDSAPP
                     SVPTYRPPPLPDVYTLPTHARDLSRDAAEPPAIPRFSDRGAHMPVHGRKRSNTGGHVP
                     PPLSFRGFSGPAGSGGAYHASTNSTAGNSIMTAGSSDIYSNAGASAVTGSSGMTWATG
                     SMRTSEASSRPSAPVQNNFFDAIGTVRMEAFISPLSFSGRFDEFSTSYEHQQQVLQPD
                     DFRRATRRRSKELRRRASRNSRQRDSYHSRTTRATDELDDWYLRDDPFKGF"
     gene            <784107..>785057
                     /locus_tag="THITE_2083863"
                     /db_xref="GeneID:11515367"
     mRNA            <784107..>785057
                     /locus_tag="THITE_2083863"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648621.1"
                     /db_xref="GeneID:11515367"
     CDS             784107..785057
                     /locus_tag="THITE_2083863"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648669.1"
                     /db_xref="GeneID:11515367"
                     /db_xref="InterPro:IPR008030"
                     /db_xref="JGIDB:Thite2_2083863"
                     /translation="MAPTILVAGVTGNTGRGVVDTLPALLQASSTLSDHRIIALTRSL
                     QSPAAQRLARVPGVQVLEHDWADITADWLRQHGVVRAFIASHNQPDQFAAESGFHLAA
                     LQAGVRYVVRISTAAANVRPDCATYYARTHWAVETLLGAPEFAALQWTSLRPNLFANF
                     ALMTAAGLVKQFRQTGKQEQPLRLLLTEHAPIGIVDPWEVGVVAAHLLAQEDPSTHNR
                     ARYVVSGPEDITGAGIVQLVEQHIGTRVESVKFGDSSAILEAAVAAAPQWKSLIMTMK
                     DGLKVEGKGKWEADTTSKEVLELAAPKRTPADVLKALLED"
     gene            <785336..>785887
                     /locus_tag="THITE_153839"
                     /db_xref="GeneID:11515592"
     mRNA            <785336..>785887
                     /locus_tag="THITE_153839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648622.1"
                     /db_xref="GeneID:11515592"
     CDS             785336..785887
                     /locus_tag="THITE_153839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648670.1"
                     /db_xref="GeneID:11515592"
                     /db_xref="JGIDB:Thite2_153839"
                     /translation="MIFRVSRVYLRANGKVGMFAALYSSRTQTQAMILQLLLKGPAKA
                     VRFYNDKQQSSQSYVPDREARAEPGKAGRRLPKLAVATALVHCCGCCRCSSYGRRLCA
                     GRVPQRALLTTVSAPAGGGGGTVITARDRPFLLSRLRRTWKTWLGSGRNALLLPPSAH
                     RQGFRSGSGSGSDSGGGLGGRKR"
     gene            786559..787786
                     /locus_tag="THITE_2106401"
                     /db_xref="GeneID:11515521"
     mRNA            786559..787786
                     /locus_tag="THITE_2106401"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648623.1"
                     /db_xref="GeneID:11515521"
     CDS             786645..787475
                     /locus_tag="THITE_2106401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648671.1"
                     /db_xref="GeneID:11515521"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2106401"
                     /translation="MSAPAPSPLASTIKALTFDIFGTAVDWRTSITDALATAAAAKLT
                     SSSSPSSSSAALPAPVLAKLQTLTPASWALFAAQWRAAYGAFTSTFDPAAQPWKDVDG
                     HHRESLARLLGEWGLGGLYTDGEMAELSRAWHFLRAWPDSAAGLRRLRGAGFATASLS
                     NGNRALLRDLDAHAALGLDRLISAEDFGAYKPRPEVYRGACEALGLEPRQVAMVAAHL
                     KDLEAARGVGMRTVYVARPGEEEWKPEEERYARAREWVDVWVAEGEGGFEELARRLGA
                     "
     gene            791182..792033
                     /locus_tag="THITE_2106402"
                     /db_xref="GeneID:11515778"
     mRNA            791182..792033
                     /locus_tag="THITE_2106402"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648624.1"
                     /db_xref="GeneID:11515778"
     CDS             791297..791836
                     /locus_tag="THITE_2106402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648672.1"
                     /db_xref="GeneID:11515778"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2106402"
                     /translation="MLEVLDTAGQEEYTALRDQWIRDGEGFILVYSISSRSSFTRIRR
                     FHHQIQRVKESAASSPSYPGSPISAANQSAPVPIMLVGNKSDRIAEREVSTQEGHALA
                     RELGCEFVEASAKNYINVDKAFYDVVRILRRQRQAAALPMAPSGGSKHESRRTDSSIQ
                     SEKGRYRRDRERRRGCVIL"
     gene            complement(800283..801896)
                     /locus_tag="THITE_2106405"
                     /db_xref="GeneID:11516742"
     mRNA            complement(join(800283..801724,801780..801896))
                     /locus_tag="THITE_2106405"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648625.1"
                     /db_xref="GeneID:11516742"
     CDS             complement(join(800481..801724,801780..801807))
                     /locus_tag="THITE_2106405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648673.1"
                     /db_xref="GeneID:11516742"
                     /db_xref="JGIDB:Thite2_2106405"
                     /translation="MTATLQPAYLALNLLKRESCVVCDNSKPLVCPDCEAGVSMCQFI
                     YPTSCAECARATCVPVETTAAAPPSQDRSTNVGAIVGSVIGGLAAIAIITYLVWRFCV
                     RTRRQPLVQEPWDDGQDQGMDGEKSFAQRRDHRASTHTVHSIASTVLTRASNIIQIAY
                     IPGVTNRATASPTVLVPPVPPIPIAVSQAGTPASTEDQHFFVPGDLRDSTYSGLSSFS
                     DRTSYARTSYAPRSSVASTIYGKSAVVVAPAQTGMRAKPAMVSVRSAHSNTSNGTSTP
                     PVPAVDYEKYNSVRPPSPANSTFSVGSTFLNNASTATATPARAMVVRVGSVKKIGANK
                     QPKPAPDADSVASPTVSGSTIRDSAAATIIVDSPADEGPFSDPPKSATQSTTSLSAVI
                     EEATRRASQRDSTVPEKGRQRSPFGDEHASS"
     gene            804282..804873
                     /locus_tag="THITE_2106406"
                     /db_xref="GeneID:11516556"
     mRNA            804282..804873
                     /locus_tag="THITE_2106406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648626.1"
                     /db_xref="GeneID:11516556"
     CDS             804435..804761
                     /locus_tag="THITE_2106406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648674.1"
                     /db_xref="GeneID:11516556"
                     /db_xref="JGIDB:Thite2_2106406"
                     /translation="MDLLHAAATGLAVMSRLDEAISVLRMALACSASDDEVPAKQTRV
                     ELLPRLGSLYDEAQNRKEATARLEFEILEGKATRGAAETSERLGMVMIPKAQSLLAQW
                     AVEDGD"
     gene            807463..810760
                     /locus_tag="THITE_2106408"
                     /db_xref="GeneID:11521455"
     mRNA            join(807463..807625,807698..810214,810313..810760)
                     /locus_tag="THITE_2106408"
                     /product="glycosyltransferase family 2 protein"
                     /transcript_id="XM_003648627.1"
                     /db_xref="GeneID:11521455"
     CDS             join(807554..807625,807698..810214,810313..810450)
                     /locus_tag="THITE_2106408"
                     /note="CAZy_ID 269859"
                     /codon_start=1
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="XP_003648675.1"
                     /db_xref="GeneID:11521455"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="JGIDB:Thite2_2106408"
                     /translation="MAYHGRGDGYEGHPMQDLPTHHGQHDDDAQAALLNQNQGYDQDR
                     LGAHTPPVRPVSAYSLTESYAPGATTTRAGIGVSPTPPPPGHGEYAGAPGYYQPQFSA
                     DPSYRMSSVDSDESWLRRQQPNAAPSGGLKRYATRKVKLVQGSVLSIDYPVPSAIRNA
                     VQPRYRDEEGNNEEFFKMRYTAATCDPNDFTLKNGYDLRPRMYNRHTELLIAITYYNE
                     DKVLLARTLHGVMLNIRDIVNLKKSSFWNRGGPAWQKIVVCLVFDGIEKADKNVLDVL
                     ATIGVYQDGVIKKDVDGKETVAHIFEYTTQLSVTPNQQLIRPVDDSPSTLPPVQFIFC
                     LKQKNSKKINSHRWLFNAFGRILNPEVCILIDAGTKPGPKSLLALWEGFYNDKDLGGA
                     CGEIHAMLGKGGKKLLNPLVAVQNFEYKISNILDKPLESAFGYVSVLPGAFSAYRFRA
                     IMGRPLEQYFHGDHTLSKILGKKGIEGMNIFKKNMFLAEDRILCFELVAKAGQKWHLS
                     YIKAAKGETDVPEGAPEFISQRRRWLNGSFAASLYSLMHFGRMYKSGHNIVRMFFFHI
                     QLIYNVLNVIFTWFSLSSYWLTTSVIMDLVGTPVPASNTSSEHHAWPFGDSATPFINA
                     VLQYIYLAFVILQFILALGNRPKGSKWTYIVSYIVFAVIQGYIIVLSTYLVAQAFRTP
                     LEDQIKLDSASDALKSLFGGTGAAGVILVALITIYGLYFLASFLYLDPWHMFHSFPYY
                     MLLMSTYINILMVYAFNNWHDVSWGTKGSDKNDALPSAQVTKGEKDEVVVEEIEKPQE
                     DIDQMFEQTVRRALAPFKEEEKHEPKDLEDSYKSFRTMLVVSWLFSNCLLAVVITSDN
                     FNSFGIGQTATARTAWFFKFLLFATAALSIVRFIGFLWFLGRTGIMCCFARR"
     gene            812063..812895
                     /locus_tag="THITE_2106411"
                     /db_xref="GeneID:11515665"
     mRNA            join(812063..812200,812277..812376,812440..812895)
                     /locus_tag="THITE_2106411"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648628.1"
                     /db_xref="GeneID:11515665"
     CDS             join(812180..812200,812277..812376,812440..812882)
                     /locus_tag="THITE_2106411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648676.1"
                     /db_xref="GeneID:11515665"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2106411"
                     /translation="MLKIWSMKKEQEKAENAGEGTTAPAPKKKRVTAAQLRVQRDLAE
                     LSLGNTMTTEFPDPDNILSFILYIEPDEGMYKGGRFSFSFNVTPAFPHEPPKVLCREK
                     IYHPNIDTEGKVCLNILREDWKPVLNLNAVIVGLQFLFLEPNASDPLNKEAADDLRNN
                     RDGFKRNVRQAMAGGTVRGETYQRVLV"
     gene            813645..817201
                     /locus_tag="THITE_2169158"
                     /db_xref="GeneID:11519061"
     mRNA            join(813645..814034,814118..814149,814249..814527,
                     814609..815276,815360..815817,816890..817201)
                     /locus_tag="THITE_2169158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648629.1"
                     /db_xref="GeneID:11519061"
     CDS             join(813824..814034,814118..814149,814249..814527,
                     814609..815276,815360..815387)
                     /locus_tag="THITE_2169158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648677.1"
                     /db_xref="GeneID:11519061"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="JGIDB:Thite2_2169158"
                     /translation="MASRSFSKALRSPLARQLASPAVQRRTFVAAAGLVRASAVAASR
                     VAAAPAQQQVRGVKTIDFAGSKEEVYERADWPNEKLLEYFKNDTLALIGYGSQGHGQG
                     LNLRDNGLNVIIGVRKNGKSWQDAIQDGWVPGKNLFEVDEAISKGTIIMNLLSDAAQS
                     ETWPAIKPQITKGKTLYFSHGFSPVFKDLTKVDVPKDVDVILVAPKGSGRTVRSLFRE
                     GRGINSSFAVYQDVTGKAKEKAIAMGVAIGSGYLYETTFEKEVYSDLYGERGCLMGGI
                     HGMFLAQYEVLRERGHSPSEAFNETVEEATQSLYPLIGANGMDWMFEACSTTARRGAI
                     DWTPRFKEALKPVFNQLYDSVKSGEETKRSLEYNSQPDYREKFEAEMDEIRNLEIWRA
                     GKAVRALRPENQK"
     gene            818216..820145
                     /locus_tag="THITE_2106420"
                     /db_xref="GeneID:11515293"
     mRNA            join(818216..818774,818870..820145)
                     /locus_tag="THITE_2106420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648630.1"
                     /db_xref="GeneID:11515293"
     CDS             join(818323..818774,818870..819959)
                     /locus_tag="THITE_2106420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648678.1"
                     /db_xref="GeneID:11515293"
                     /db_xref="JGIDB:Thite2_2106420"
                     /translation="MGSLEDIVPRFTILDDTRPDDMSLPAFMVSTTRGFLPRMDPIVS
                     LPPEFDPLESILQRMPVKTLSGEPGLLAQGKLGDAVTTELPDLTDQVEKYKDNLPLMN
                     ALYRDYSFLASAYLLEPCHERFMRGEEYGLARDVLPANVARPIAKCAALCGFKPFMEY
                     AGSYALFNYRLVDPAQGLASDNLRLIRAFEHGLDPSSSEAGFVLVHIEMVKHSGALVQ
                     GAVACLDACAARHNTSTTSTTSTTSTTSTTSTTSTTPREDLNAGLTTVLAALRRINAT
                     METMWKRSRPERYTSFRTFIFGITSQSMFPRGVTYAGVPELGDRPVAFRGESGANDSM
                     VPLVDNLLAVPMPDTPLIEILRDFRSYRPGEHRRFLEWVKEAGEKGGLKDWALGLGPE
                     KEEEKEEEDEGLLRETRALWIRVLDQIRDFRWRHWCFAREYIIKRTSHPTATGGSPIV
                     TWLPNQLGAVMDEMVRLHDAVGGSSGGLGAEVAAIMDLVGRQREMLRKEVRKFCQERG
                     VEADV"
     gene            complement(<820732..821753)
                     /locus_tag="THITE_2148619"
                     /db_xref="GeneID:11515875"
     mRNA            complement(join(<820732..820769,820935..821753))
                     /locus_tag="THITE_2148619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648631.1"
                     /db_xref="GeneID:11515875"
     CDS             complement(join(820732..820769,820935..821643))
                     /locus_tag="THITE_2148619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648679.1"
                     /db_xref="GeneID:11515875"
                     /db_xref="JGIDB:Thite2_2148619"
                     /translation="MRPLPHSLWLLLAAQIEARAQAQAESQAQQYLHPTAIRKMPPDP
                     GAKFYHEYCAFPENAAFAPAPPLPPPPPRKPLVARAARTALDADDARRLAGNASSELP
                     LRPPFALLSGPEFVDDADAEQIPRPPPPQPPPPPSAAWDLFRRAASAVAFLERRQWAC
                     PSGTSSCASIGYPNSCCGAGETCVQVADTGLGPVGCCPAGATCGGGVSGCADGSTACA
                     SELGGGCCIPGFVCQGVGSPSRSRPPPQSS"
     gene            complement(822146..824468)
                     /locus_tag="THITE_2106423"
                     /db_xref="GeneID:11516598"
     mRNA            complement(822146..824468)
                     /locus_tag="THITE_2106423"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648632.1"
                     /db_xref="GeneID:11516598"
     CDS             complement(822449..824158)
                     /locus_tag="THITE_2106423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648680.1"
                     /db_xref="GeneID:11516598"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="JGIDB:Thite2_2106423"
                     /translation="MTLSLACRAARPSLLAGSVTRVSLTAVVSSRYVSLSAIHKGLVE
                     SEKARPQGPRADKLSSLAEGGAKRMTYAERQKAREQLARERPTYKIRKGKKDITEYPD
                     KAKPKPRGPSVYQLKAKKLHEELKTLLLAKAHGESPDSPFQPTGPRPDLADRPRRTIL
                     SRLRARDSARGGDTEDVKDVAAELRRTSTSGVSSRAADSAARVERAPPSRDADSFRAD
                     RGASRRDRGASAPRSSSPSQHTKDREPLSIPYTTAASQFLYGKAVVEAALRASRRKLY
                     KLYIYGGANRQNASDDALIQGLAKRRGVPVTIMGEDGARLMDKMASSRPHNGFVLEAS
                     PLPQPPVTALGPGPDDYAARPGYRVELGHQSAEEAAINGRPDFFPAPAATHRPLVVVL
                     DRVLDPGNLGAILRTVAFLGAAAVGITRRGSATLTPVALKASAGAAETLPLFSIASLP
                     DFIGASRANGWTVYAAVAEAPPRGAKQRRNVDLRDIEEADPLRREPCVLLLGNEGEGL
                     SRFVVQKADYEVNIPNMSASAAVDSLNVSVAAGLLCSAFLKGTARARELAVAEGTAKQ
                     SLW"
     gene            824618..831356
                     /locus_tag="THITE_2106426"
                     /db_xref="GeneID:11515764"
     mRNA            join(824618..824772,824839..825312,826386..830027,
                     830098..830302,830440..831356)
                     /locus_tag="THITE_2106426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648633.1"
                     /db_xref="GeneID:11515764"
     CDS             join(824905..825312,826386..830027,830098..830302,
                     830440..831281)
                     /locus_tag="THITE_2106426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648681.1"
                     /db_xref="GeneID:11515764"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="JGIDB:Thite2_2106426"
                     /translation="MAADNGSDDDELFVANAEPPPFTFQSDLSDDDAPDPLALDEIAS
                     ASLAALNGILGPAPKAVKQEEEQPFQDLHDDGTANGVVAAPPDQPRRDATSVIEVCLP
                     WLSPAQRAEYLKVEVDDDWPVEDEYLGQRRKRKGDDDYDDFAEQYGARKRKRHDDDYV
                     NYDDFNDDSEDDEDVPRPRGAPPKLGRIDDYLEIANGRRSTRASTRASSLLVSSDGEH
                     GAEKTGRGRRLRPRASAAARQSAHYDDRDELQDSDADPDDPTFAFVQSDIVQTKKQRR
                     RLRKLSTRAPPSGRGLSLGGDSDIEFESRRRSSRVTNTRRVMTDSYVDDDDIYYEGED
                     RTPATPKVVSMREIFQPPKSYDFKQAHRLVCGSCGYADDRNKGALIPCQGCSNSYHKA
                     CIGVRSTRDHRVTKVAAESFVLQCRFCICIYKKKDIRAPAHDVCQGCHAKNPSCVPFS
                     ERKTPKQEEALRNANDGVDPITPVEPKLLENPDNVLFRCSRCHRAWHYEHLPHPHRSR
                     DPAIDDPLNLRKHRREEYQITWLCKECQDTEEDKVDKIVAWRPLNRAAYREGQWITDF
                     DEDGIEYLLKWENKSYNHCLWMPGAWVYGVVKPMMRQAFIKRTFGEGSDEAVDGERHV
                     DSLLRWSEKEAIHDAWITPDIILDVHIAPRSREAQKKYNAMSTREKFDDDLNRIFHVT
                     KIYVKFEGLGYDDAVWDTPPPPDAGPIYDAFCEAYHEYLNGKHFQTEPFRVMKERIER
                     FRQLEFTSGIEVLQQPKGLRRGKLMEYQLEGLNWILCNFRDGRSVVLADEMGLGKTVQ
                     VVAFLSSFIQDNPRVWPFLIVVPNATCANWRREIKKWAPDLRVVAYYGGRVSQALALQ
                     YELFPNNSKELKAHVVIMSYDSAKDGETRNKFGSTKWAGLVVDEAQALKNDENALYRA
                     LNAMRIPFKLLLTGTPLQNNKRELFNLLQFIDPAMKAEDLDREFEQVTSENLPELHNL
                     IRPYFLRRTKAEVLTFLPPMSQVIVPVSMTVLQERLCKSIMERNPELIRSVFVQDKMK
                     AKERGSLSNILMQLRKCLCHPFIYSQAIEDRTLSPEVTRRNLIEASSKLMLLEIMLPK
                     LKERGHRVLLFSQFLDQLTILEDFLAGMGLKHERLDGSASSMEKQKKIDAFNAPGSDI
                     FAMLLSTRAGGVGINLATADTVIILDPDWNPHQDIQALSRAHRIGQRKKVLCFQLMTV
                     DSAEEKILQIGRKKLALDHLLIETMDDQEDAPNDVESVLKHGAAALFGEGKRKDAIVY
                     DSAAVDKLLDRSTVEETRTNEGKTAESAFAFARVWANDEGELADDLQEAEQTINMSVW
                     DQILQQRAEQARREAERTMETLGRGGRRRGAANYAGPRFEFDETQEGPKVDSDQGDGD
                     GDFVGSDKSGGESSEDEETIGTGESTPAGSNARKQGRASQAGTGPDAQDAAVKKGRSD
                     ARHAKTATTTTAAVLRPPAAQSDSEDTAQNSSKKARGRPRKDNPSGKNHAAAAAARVG
                     GGGHVSGSSASPQPSQPASSHHHHRHGANPAQAAFPGGGRGGFMALRPSSGTVTAPIT
                     KPVSTTPIPLPVVPVVPSNHPLPPASAAAPAPTYHISGTGESIPLLRPPPPAPPGAAR
                     STYTNTHSPITTQVQERLRSENCVVCLYSHPPSWECPEMRSEVQLRLAMDRLRKRAAE
                     AAGEGVDARVLEARIAFLWEKLKRVQRKVV"
     gene            <833851..>836870
                     /locus_tag="THITE_2125030"
                     /db_xref="GeneID:11515294"
     mRNA            join(<833851..835092,835157..835192,835444..836395,
                     836524..>836870)
                     /locus_tag="THITE_2125030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648634.1"
                     /db_xref="GeneID:11515294"
     CDS             join(833851..835092,835157..835192,835444..836395,
                     836524..836870)
                     /locus_tag="THITE_2125030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648682.1"
                     /db_xref="GeneID:11515294"
                     /db_xref="JGIDB:Thite2_2125030"
                     /translation="MDAPWVHHRSAYSSADRSYPNSATSAPATTSSSVAGEAPSPTDR
                     IPSTTAPPSSPALVPMEVPSLLSTPSQSSSNSQPSQLSQQSSLDLGSPSPRPAVYDGD
                     GPDPQSLSDYCADIKVLMDIDAQVQALGIHDSPSPTASRDGNSNFDSRENASSYSLEP
                     HRHGQMGAFRHSPRFDQASRPIVSDNWRAKSAADSAGPLVSSLVTTAKPSTPTTQSQA
                     QAQPRTSFVYTPARTPLTAPSNTGTAGFAQPNPNPLPTPASLSTPVSMSAPSHSQNHG
                     HGYGHHSSTGSLALSAPAYSPVSARSGNPDPPSGSQMTGSLLSANHANTDANTSLITK
                     PNTTSTVATFPVALPADALGYCFVRPNGMRTRLVPVDMLPFALQGIPPHESPGERLVA
                     LPVPGGVGADGRSSNTQMLRAVNQPNGSGGDAIQSQGQPHHTGAPKRMKVYCDKWVHE
                     GVCAFTQQGCKYKHEMPSDRATQHQLGLFLGYPAWWKRRQAELARVVPVVGASAAAAA
                     ATTTTNREGGDVAASSSSPASSSGAVAATSVTATATSTSTSTAGGRRRVGDETGAVRG
                     IDGVAGRRFGVDAVRPRQIIGCGGVNGMDISMVTSDSEREAGGAGFDHWLPTQGQTGG
                     SLGLTGSRWGLASGNGPGFSPTTATAPQTGRDRLLRPTWRFGVTPQSGDGQTLQGSDG
                     LGGYRPAGAEFATTGLFTRAWPWEQQQYALPSSQTQTQTQHRPQGQSNTTYSYGAASP
                     CTFAFHPITTTTSAPSSPFGPIAPPTPRSARPQQPDNHTTTTATTPSTRRSSPLRNRR
                     ASTTTTSPYAGPSSPLHAPAGEADNGNCKDNDSGNDNSEAAGGDEGQSRNSGLLRGLK
                     FE"
     gene            complement(838387..840328)
                     /locus_tag="THITE_2106427"
                     /db_xref="GeneID:11515756"
     mRNA            complement(join(838387..839541,839605..839802,
                     839863..840328))
                     /locus_tag="THITE_2106427"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648635.1"
                     /db_xref="GeneID:11515756"
     CDS             complement(join(838441..839541,839605..839802,
                     839863..840018))
                     /locus_tag="THITE_2106427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648683.1"
                     /db_xref="GeneID:11515756"
                     /db_xref="JGIDB:Thite2_2106427"
                     /translation="MDQAASVLLDFPPEGGIAGDAQYHAAAQSHSQKLDQLAAAPNFP
                     GFAPQLLDHVHPAVNSNSYLTLLIAARAADRLPQADLLTKVATFLSTFDARQIRYRGK
                     AFSALLDWLVDGSLFPASVAVELLTTALLRLDPAGSVLTSHHVALVKLAYSTDNVAPA
                     LPLLEKDVVFYPGVKGLFETRPPCALDLPPASYITAESGLTKLLSSSDVMQYDLLRGL
                     CFIRRRAWRPAFDALERVVTYPTRDTHACSKIMVEAHNKWILVGLLLNGKAPTLPATT
                     PPGVQKTFATLGKAYQAIGKAFEESTAQSLKTEFESVGAQVFAEENNLGLVRLVLQHY
                     QRWQVLNLRQVYTKITLEEVRARTQSAETGAPLASEADVAALVQQMIDEGMLHGAIVR
                     PPGAPAYLSFLPPDEGRSEAEFAQRMAATARRLAQLEPLVRAANERLGTSRDYIKYLA
                     GLQKKEDSGRRDYDVAFMNQIEDEDLMTGVVEGF"
     gene            complement(840330..842813)
                     /locus_tag="THITE_2106430"
                     /db_xref="GeneID:11515520"
     mRNA            complement(join(840330..840712,840796..842244,
                     842295..842552,842615..842813))
                     /locus_tag="THITE_2106430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648636.1"
                     /db_xref="GeneID:11515520"
     CDS             complement(join(840622..840712,840796..842244,
                     842295..842552,842615..842649))
                     /locus_tag="THITE_2106430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648684.1"
                     /db_xref="GeneID:11515520"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR007199"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="JGIDB:Thite2_2106430"
                     /translation="MAEQQITQGAIDAIYNDPDRAAKQFPVPVLQCLQLKTLEGKGPG
                     GGAQRYRVILSDIRNYVQCMLATQANHVVHSGQLDRGSIVRLKQYQASSVKGKNVMIV
                     LDLEVISHLGNPEKIGEPKAVEVRTQPHSTTIGGAGFYGVKSEPASETKSQVQKQVAS
                     RPAAAASGSGGHAASTIYPIEALSPYSNKWTIKVRVTSKSDIRTWHKASGDGKLFSVN
                     LLDETGEIRATGFNEQVDQFYDLLQEGSVYYISTPCKVQLAKKQFSNLANDYEMMFER
                     DTVIEKAEDQSSVPQLRFNFCNIEELRDVEKDATVDVIGVLKEVGEVTEIISKTTQKP
                     YDKRELTLVDDTGFSVRVTIWGKTATEFDANPESIIALKGTRVSDFGGRSLSLLSSGT
                     MAIDPDIPEAHKLKGWYDSTGRNNAFATHSNLASVGAAAGRKDDTKTIGQVKSEKLGF
                     DDAVYFTVKATIVHIRQENFAYPACRSENCNKKVTDMGDGTWRCEKCNLSHDRPQYRY
                     IMSINVSDHTGQMWLNCFDDSARIIMGKTADELVEMQATGDKEGLDAAFEAANCRKLT
                     FRCRAKMDTYGDQPRVRYQVMSAAPLDYKTEGHKLAELIQQMSM"
     gene            843342..844901
                     /locus_tag="THITE_2106433"
                     /db_xref="GeneID:11516606"
     mRNA            join(843342..844115,844224..844284,844350..844901)
                     /locus_tag="THITE_2106433"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648637.1"
                     /db_xref="GeneID:11516606"
     CDS             join(843437..844115,844224..844284,844350..844683)
                     /locus_tag="THITE_2106433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648685.1"
                     /db_xref="GeneID:11516606"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="JGIDB:Thite2_2106433"
                     /translation="MATTTTTTSSSPSSAAQPPPLPIIDSHIHLYPSSELSTLAWLTP
                     DHPLASQHSVTEFRAATCTSPSQSLSGFILVEADRANSSSQDWTFPLQEIAWMRRLAT
                     GTPREGEGHAPADAPLCLGLVPWAPLDRGPAELERYLAAAEREAGPEAWPKVKGFRYL
                     LQDKPARVALADEFVEGLKVLGRRGFVFEVGVDQHRRGKAQLEEVVEMIDRAHDGVEE
                     EEKVVFVLNHLCKPDLTIINQTDPSFIAWRTAMFTLSKCHRTYMKLSGCFSELPDKLK
                     ERSAEDIFAAILPWLAVVVAAFGPSRIMFGSDWPVCTVGVGEGAWRKWHKVVDMVCDL
                     AGLSLEDKAMLWSGTAKQAYKIE"
     gene            849769..851180
                     /locus_tag="THITE_2106436"
                     /db_xref="GeneID:11519108"
     mRNA            join(849769..849869,849964..851180)
                     /locus_tag="THITE_2106436"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648638.1"
                     /db_xref="GeneID:11519108"
     CDS             850010..850252
                     /locus_tag="THITE_2106436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648686.1"
                     /db_xref="GeneID:11519108"
                     /db_xref="JGIDB:Thite2_2106436"
                     /translation="MPVSQVAAPSSPIPIPSPRRNLGLITSQELFASLNATLASKTDQ
                     LVTPIHHIREHDYSVPAPPPPSPVSFRDHWPVSMRR"
     gene            complement(852288..853463)
                     /locus_tag="THITE_2106438"
                     /db_xref="GeneID:11519069"
     mRNA            complement(join(852288..852397,852525..853008,
                     853129..853463))
                     /locus_tag="THITE_2106438"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648639.1"
                     /db_xref="GeneID:11519069"
     CDS             complement(join(852851..853008,853129..853222))
                     /locus_tag="THITE_2106438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648687.1"
                     /db_xref="GeneID:11519069"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Thite2_2106438"
                     /translation="MSKQFTKAEVAQHKGDKDMYIIIDDGVYDVTGFVDDHPGGAKIL
                     KRMAGKDATKQFWKYHGKNVLEKYGPKLRIGTLKEEAKL"
     gene            complement(853464..855441)
                     /locus_tag="THITE_2106442"
                     /db_xref="GeneID:11517650"
     mRNA            complement(853464..855441)
                     /locus_tag="THITE_2106442"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648640.1"
                     /db_xref="GeneID:11517650"
     CDS             complement(853835..855205)
                     /locus_tag="THITE_2106442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648688.1"
                     /db_xref="GeneID:11517650"
                     /db_xref="JGIDB:Thite2_2106442"
                     /translation="MMASLKRLACLLWALSLSIDCARCDDTSSSSSSSSSSSSSSSSE
                     EVTMLTGTRTDAPQSRPPTGPYETFSSTVTLATTTLPTDLGALTANYTDTSQTQTVTY
                     LTGSVTTSPTASGSGTSSSTTSAAPRPTNTRPCNNYPELCARKYSNITQVGCHNSPFV
                     RAGSAAANQQYPVTDQLNDGVRFLQAQIQWPANGTEPHFCHTSCDLLDAGPITDWLRT
                     VRDWVAAHPYDVVTILLGNGNYSTPDRYAPFIEASGITQFAFSPPVVPMAADDWPTLG
                     QLILSGQRVVMFLDYMANQTAYPWLMDEFSQMWETPFDPVDPTFPCTVQRPPGLAAAD
                     ATKRLYLMNHNLNVEVSLLGQSILVPAVSQLNVTNAVQGNGSLGLAANNCRTDWGRPP
                     NVLNVDYYNYGNYPGSVFEVAALMNNVTFVNASCCGPGSSAGVRVEAAELWLWMALAW
                     LVWAFI"
     gene            856776..857992
                     /locus_tag="THITE_2106444"
                     /db_xref="GeneID:11515660"
     mRNA            join(856776..857078,857164..857992)
                     /locus_tag="THITE_2106444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648641.1"
                     /db_xref="GeneID:11515660"
     CDS             join(856860..857078,857164..857871)
                     /locus_tag="THITE_2106444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648689.1"
                     /db_xref="GeneID:11515660"
                     /db_xref="JGIDB:Thite2_2106444"
                     /translation="MGFPAALRSRLRPNTADNEKRHDSSSPSPSSPVSKEQAAGLSNA
                     AIKRATRMRRGFALSASFAYVLSWIFLILVLIGNTHPRPVLSSIYFFKLNLADIIPTS
                     VPNASLINSIAQSIGLHDFYQVGLWNFCEGYVNVGITYCSPPRTLYWFNPVAVLMSEL
                     LAGATIALPTAVITILSVLRISSQIMFGFFLTAAVLAFLLVFVSPLAVASRWWSLPLA
                     MVAFLHATLCLAASTVGTAIGLAFKYAAEAQSDLNIHAEVGVEMLVFMWLATGFAIWA
                     FAVHSGMGCCCTSRRDLRIGRRVLREGRVERQ"
     gene            complement(858934..859962)
                     /locus_tag="THITE_2106446"
                     /db_xref="GeneID:11521510"
     mRNA            complement(858934..859962)
                     /locus_tag="THITE_2106446"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648642.1"
                     /db_xref="GeneID:11521510"
     CDS             complement(859019..859852)
                     /locus_tag="THITE_2106446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648690.1"
                     /db_xref="GeneID:11521510"
                     /db_xref="JGIDB:Thite2_2106446"
                     /translation="MSAIQLSFSLRVSSGVKTVHLLGSWDNYSGQLPLSKDKSSSKSG
                     TWKGTFRFQQATLQPGQRYWYYYIIDGYHVSHNPSEDSTVEPTTGRTLNILDVPKAKS
                     SSSSSSSKSSSRKSTSSSKRHSSIGGDIPKGRPLSMSQIKAPKPVLPNATRRILENDF
                     DEDELSSRFAATGIYDDYYYDDEDVITDFGAPGSPASSVGSSLSYHSDSSGSSGYSTP
                     SSDCSSCTCERYGITRKGERVRLDCGGSRCSYEDSCSSSEDETEYIERSSRRNGIVVR
                     Q"
     gene            complement(<866061..>866297)
                     /locus_tag="THITE_2040205"
                     /db_xref="GeneID:11521535"
     mRNA            complement(join(<866061..866185,866249..>866297))
                     /locus_tag="THITE_2040205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648643.1"
                     /db_xref="GeneID:11521535"
     CDS             complement(join(866061..866185,866249..>866297))
                     /locus_tag="THITE_2040205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648691.1"
                     /db_xref="GeneID:11521535"
                     /db_xref="JGIDB:Thite2_2040205"
                     /translation="LEDYITIYLNDILIYLSLNLDLKKYIFIIKEVKYLKYIVEVGVY
                     IRPNPKKIKAIYK"
     gene            complement(<870198..>871283)
                     /locus_tag="THITE_2040462"
                     /db_xref="GeneID:11521526"
     mRNA            complement(join(<870198..870809,870861..>871283))
                     /locus_tag="THITE_2040462"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648644.1"
                     /db_xref="GeneID:11521526"
     CDS             complement(join(870198..870809,870861..871283))
                     /locus_tag="THITE_2040462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648692.1"
                     /db_xref="GeneID:11521526"
                     /db_xref="JGIDB:Thite2_2040462"
                     /translation="MASNYFDTIKGVSAFKKKRPKNSKTLSELESLPAGSNWSTAELY
                     AARLVVREDKNKQSRLLPALAPYLDHAARDYSPLRRLVEGPGKLDPLAPETELVHIHG
                     DTLGHLWAALNKLANASGVSDSAVAVGVGDMPPDVEDDEKRPYSPVPEEAAYPSANTR
                     SKRRKRQTDAQELAPSSTTQSGTSSPSQRDGSSSESEWSQGTKTDYIGKEHASVDNEL
                     EQATVDIASLFIRYVLRNCPPQANMTKHKPAYLVEFSGCAKQRLGTMGSGGTIRATAD
                     AELTVSKLDKGHYNLVKMHLPALLEAKKRFPIDHGEPKTTDQVLGQMTCEALALRLEL
                     QAPGHPGTEE"
     gene            complement(872423..873723)
                     /locus_tag="THITE_2106449"
                     /db_xref="GeneID:11521517"
     mRNA            complement(join(872423..872592,872661..872681,
                     872831..873188,873256..873723))
                     /locus_tag="THITE_2106449"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648645.1"
                     /db_xref="GeneID:11521517"
     CDS             complement(join(872560..872592,872661..872681,
                     872831..873188,873256..873641))
                     /locus_tag="THITE_2106449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648693.1"
                     /db_xref="GeneID:11521517"
                     /db_xref="JGIDB:Thite2_2106449"
                     /translation="MASAAAAERNQGDDKESRSSDLSPLSIHRLIALHSHERLLVHPL
                     LWTDRHLTLLGCHIHHRGEAGGVDGLKVVNGPPTPPESQDGDSAPSPSSDQSSVPDTR
                     VADFLTMVDVICDFLKQAGCSVKIDKRHTRFYFRGRSRDIIEYWHFDTTTPGPNSERV
                     TFACFDVHDMWALRRKYLFPLRDRLDRENPPLIRRYLKLMKRHTPADPTKDPYLVAVV
                     IALAQQQRLLWRQMCGAKRGPKLHSPDGYTVRLLFAGVPTPETSSRL"
     gene            874097..874614
                     /locus_tag="THITE_2106451"
                     /db_xref="GeneID:11521552"
     mRNA            874097..874614
                     /locus_tag="THITE_2106451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648646.1"
                     /db_xref="GeneID:11521552"
     CDS             874371..874529
                     /locus_tag="THITE_2106451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648694.1"
                     /db_xref="GeneID:11521552"
                     /db_xref="JGIDB:Thite2_2106451"
                     /translation="MLFDEWDYGDMKERLRVILTKLNRPALMRHGELVRGQRLTMSEP
                     FSAGQYWI"
     gene            <874699..>875550
                     /locus_tag="THITE_112196"
                     /db_xref="GeneID:11521617"
     mRNA            join(<874699..874818,875086..>875550)
                     /locus_tag="THITE_112196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648647.1"
                     /db_xref="GeneID:11521617"
     CDS             join(874699..874818,875086..875550)
                     /locus_tag="THITE_112196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648695.1"
                     /db_xref="GeneID:11521617"
                     /db_xref="JGIDB:Thite2_112196"
                     /translation="MRLRGPRSPFAAEAGAVSMLLEGFRMNILQDVAFDICSLSGPLR
                     ALVFLGIVRNTTLFLEGEARPEAGCPLNYKGLGTQNILVDVDTFRFPRHLDWEFAHTA
                     AWQGNCYHMPFSLLSPDAKIERRSTLRTRTCCGRQLRGTWMCASFGEAGQKLRTERLA
                     LAWSFVETLKRTATKVYASFMRLLGIPGIWTRSL"
     gene            <876122..>876909
                     /locus_tag="THITE_2140658"
                     /db_xref="GeneID:11521599"
     mRNA            join(<876122..876339,876431..876838,876900..>876909)
                     /locus_tag="THITE_2140658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648648.1"
                     /db_xref="GeneID:11521599"
     CDS             join(876122..876339,876431..876838,876900..876909)
                     /locus_tag="THITE_2140658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648696.1"
                     /db_xref="GeneID:11521599"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="JGIDB:Thite2_2140658"
                     /translation="MRAFQDDPLVQSVTAYVKDYMKHYDASHSWDHIERVVAMAHHIY
                     THSDPAFQATLDLRIIHLAALLHDVGDHKYLQPHESPTTAVANLLTSLSCPPALANTL
                     QTICLGVSYTAETRDPARTAALVAAHPELAVVQDADRLDAIGAVGLARMFTFGGARTG
                     RSMAGTMAHLDEKLVKLEGMMKTAVGREVARRRGERLAVFRGWWEEEVGRV"
     gene            complement(877293..878373)
                     /locus_tag="THITE_2106455"
                     /db_xref="GeneID:11521576"
     mRNA            complement(join(877293..877937,878010..878373))
                     /locus_tag="THITE_2106455"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648649.1"
                     /db_xref="GeneID:11521576"
     CDS             complement(join(877365..877937,878010..878198))
                     /locus_tag="THITE_2106455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648697.1"
                     /db_xref="GeneID:11521576"
                     /db_xref="JGIDB:Thite2_2106455"
                     /translation="MKTTSIFSAALASAALAHAQVQYQDGQYVCAQDNAAYCAGDSLG
                     TDIIIRCNGKVGQPGRCTDNLAGEPPLGVQPALCWQSSPTAGDAACEKNCVVYGSSGN
                     SNGTFTLPASVCTPSYTATSTGTSPSSSASSASSSPSSSNPVVTGTSETTLTTTVCPS
                     SSSSPSITGTASSTGGSFPPSSSSSSPSSPASSSPSGGSGGGNSTVIITTVTTALTTP
                     TSATTGAVQTGGAAGPVRGGSAAAALVVALGAFLV"
     gene            complement(879545..879634)
                     /locus_tag="THITE_t39"
                     /db_xref="GeneID:11516869"
     tRNA            complement(879545..879634)
                     /locus_tag="THITE_t39"
                     /product="tRNA-Pro"
                     /note="Anticodon: AGG"
                     /anticodon=(pos:complement(879600..879602),aa:Pro,seq:agg)
                     /db_xref="GeneID:11516869"
     gene            881598..885289
                     /locus_tag="THITE_2106456"
                     /db_xref="GeneID:11521524"
     mRNA            881598..885289
                     /locus_tag="THITE_2106456"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648650.1"
                     /db_xref="GeneID:11521524"
     CDS             883534..885261
                     /locus_tag="THITE_2106456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648698.1"
                     /db_xref="GeneID:11521524"
                     /db_xref="JGIDB:Thite2_2106456"
                     /translation="MFQAQQAHYALQKVSHELSKLPTQPPPASVENALREGRQPPVLV
                     EPAPRDDQSELDKSPTQAPRHHGSPDTHGESSGLGVDRDGDPFDGKRLSVQNTPFSVA
                     SVETTGTSHAEVSEALAVNIYPHQSKSVVLVNHSAKPSESSSLDPHKPAATDIPTDIP
                     VVKTTGVNGSAPVTPPQQFSMDDVDSPLRNPRAPPPPPVINFIPATPSGLTPATEKQK
                     QLGNYYEMTEERPKRSLSLLRRALSRRATERRPSPARSLLTRTFSLSRNVRRRRDEWD
                     DERPRLKRYSTADDMPADETRLHPFWRPAYAADDESSEEEYDEDEEDPDDRTYRYPPI
                     DNRPSPPRRSLSVRIKRTFAILPLRDDRYSDYPATAHEGPERRTIRRTPSGNLRVMKL
                     RRSMESLTRGPPVENARPFTAPEARPPLHQQQQRGSGGGPGRYTRLWRSLSLKARMSR
                     NHDAIGNTSGVGGEGGAASATAGPGPGPGPGPVSGPKPASGFLPALGDRINLPRRLSE
                     RRRERRTQELRRMISAPREVRDGVGDVIRRESWRDRDAMYVLLQQREQREQREQREER
                     EERLPRVTV"
     gene            complement(<887689..>887944)
                     /locus_tag="THITE_2033836"
                     /db_xref="GeneID:11521620"
     mRNA            complement(join(<887689..887747,887839..>887944))
                     /locus_tag="THITE_2033836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648651.1"
                     /db_xref="GeneID:11521620"
     CDS             complement(join(<887689..887747,887839..>887944))
                     /locus_tag="THITE_2033836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648699.1"
                     /db_xref="GeneID:11521620"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="JGIDB:Thite2_2033836"
                     /translation="FCDYCDVYLTHDSMSVRKAHNNGRNHLRNVVDYYQQIGHEKAQS
                     VIDSITSSYAA"
     gene            888421..889748
                     /locus_tag="THITE_57424"
                     /db_xref="GeneID:11521578"
     mRNA            join(888421..888692,888788..888911,888986..889748)
                     /locus_tag="THITE_57424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648652.1"
                     /db_xref="GeneID:11521578"
     CDS             join(888477..888692,888788..888911,888986..889308)
                     /locus_tag="THITE_57424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648700.1"
                     /db_xref="GeneID:11521578"
                     /db_xref="JGIDB:Thite2_57424"
                     /translation="MARLRLLLQHVCSLLLLLAVGAHALKFDIPAGTGHDRHSRRCIR
                     NFVSKDMLVVVTAIVDGYKGDGMQLNMHITDATGNEYGKPKDIAGEQRTVFTSHADAP
                     FDVCFENILTNTRYVENPTRHVELDIDIGADAKDWSAIQATEKLKPVETELRRIEEMV
                     AEIVNEMDYLRLREQKLRDTNESTNTRVKWFGLGTTFLLIALWAWQIMYLRAYFRSKH
                     LI"
     gene            889797..890990
                     /locus_tag="THITE_107944"
                     /db_xref="GeneID:11521587"
     mRNA            join(889797..890135,890244..890990)
                     /locus_tag="THITE_107944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648653.1"
                     /db_xref="GeneID:11521587"
     CDS             join(889913..890135,890244..890689)
                     /locus_tag="THITE_107944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648701.1"
                     /db_xref="GeneID:11521587"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="JGIDB:Thite2_107944"
                     /translation="MRAARAVARVRARPCLAVAVAANRLSSSSSSSHQPQPPSPARDL
                     EVGELQGAQFKIEPLRREGEDLATMRARLLYQSRKRGTLEADLLLSTFASAHLARMPP
                     ALLAEYDRFLDENDWDIYYWATQDEQQPRGEGQGQGQASGASGAGGSSGAAPADPAAQ
                     QQSPRPGEWAQTVGTFRPAYRPVPARWRDSEVLRLLRAHVESRRGGGRGGMGFMPPLE
                     EYKI"
     gene            complement(891000..893296)
                     /locus_tag="THITE_2106463"
                     /db_xref="GeneID:11521533"
     mRNA            complement(join(891000..891739,891813..891984,
                     892054..892899,893068..893296))
                     /locus_tag="THITE_2106463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648654.1"
                     /db_xref="GeneID:11521533"
     CDS             complement(join(891307..891739,891813..891984,
                     892054..892899,893068..893155))
                     /locus_tag="THITE_2106463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648702.1"
                     /db_xref="GeneID:11521533"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="JGIDB:Thite2_2106463"
                     /translation="MTTLVRTRQPLQVLSMSNQPERRHSKRLAAAAVYDEQDGDFLFT
                     RGSKRVKTAPVREEEPEPEPAPAPAPAPAKRGVGRPPKGAAKRRASPPAPTPQPPSTQ
                     PRPAAGATATTRRTSKRKSSLDHAPAAPPIEEDVALPKSKARRKVRETTVERRPPQRK
                     GRSAQPNGAHEGIEEEEDHDNEDEQPRPAGRKEATPRADMPGPSSQSQMIPLPFSDTP
                     IINRNKEFRKKGGASGGRRSSLGMRGRRASSLIDSGHSALPHREVDPAEFYKYIAAEG
                     LSEPRRMKQLLIWCGERALSEKPPHGSRGSSAILGARAIQDQLLKDFGARSEFSDWFT
                     REDVPKPPVPVVLQPNPRNVDYDAKIAELEARIERLKAQKKAWQAIAAPLPTPDPLYP
                     DPDPRKAPLPDSALLEEDEAKMLSALTSPDTAFNSFKRQARSRLQNAQAALEFKVDQL
                     ADSVHKLDMRVVTAGREADAVLALSAARLREREQREKSAVGTRDMPVMEVLRSLGRIL
                     PEGG"
     gene            complement(894545..896667)
                     /locus_tag="THITE_2106467"
                     /db_xref="GeneID:11521566"
     mRNA            complement(join(894545..895070,895152..896364,
                     896469..896667))
                     /locus_tag="THITE_2106467"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648655.1"
                     /db_xref="GeneID:11521566"
     CDS             complement(join(894755..895070,895152..896364,
                     896469..896550))
                     /locus_tag="THITE_2106467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648703.1"
                     /db_xref="GeneID:11521566"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Thite2_2106467"
                     /translation="MGVPTGAAGRGASKSPTQPSKTSPPRQDNPSDTNRDAPLKPEEP
                     ASVEPAKTLPPPPRPAQQQSGNTPDYFNSAAGSLSLEPNPFEQSFGGSAPPETPGGTK
                     LPSVAALTSPSSLLPGSTPFSWGAGSLRTGPLSPAMLSGPTNDYFGDTHHIRGGFPTP
                     NESSLRTGLTPGGSGSMFPAPSPNSQALFAQINGPAPTPGTLDFHRTALSAAAAKREQ
                     AHAQQPSSLPVAPTSQPQDMPGGGQAPKAEPKAAADPFDPHDNDAANGLFMLARGRNS
                     TQPGPVSQYPPPPPAPVQPHADPSGAPAVQPLSTNTSPQMDGAPSLTGSSVRGASEAS
                     AGSDESEVARPNTRSRGKRSSGGAAANSRRKAEDAPVKAPPAKKTKSNGGAAAANGNE
                     NGGSEDEQHDTKNGKEEASSGSKPKMTEEEKRRNFLERNRVAALKCRQRKKQWLANLQ
                     NKVEAYSNENESLTNQIVHLREEVVSLKTLLLAHKDCPITQQQNVQHAIMQQGLEPYN
                     PQMNPYGLPPAISGQPVMAGQAMNRRFS"
     gene            <897800..>898719
                     /locus_tag="THITE_2125046"
                     /db_xref="GeneID:11521569"
     mRNA            join(<897800..897932,898176..898281,898331..898358,
                     898537..>898719)
                     /locus_tag="THITE_2125046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648656.1"
                     /db_xref="GeneID:11521569"
     CDS             join(897800..897932,898176..898281,898331..898358,
                     898537..898719)
                     /locus_tag="THITE_2125046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648704.1"
                     /db_xref="GeneID:11521569"
                     /db_xref="JGIDB:Thite2_2125046"
                     /translation="MGDPQWTEHVPQHYMAVSRKPADEHGVADRRRPNPELHASDVLQ
                     IRCLKETELACHARVLQTPIAVFRRLALSAQNSATDLDGRMEDRMFALTSICSRAGSS
                     SLLATLSDVQHPLALALQRNTAGPLDRRDFAVSRKAEAFGIPRKAGF"
     gene            complement(900030..901174)
                     /locus_tag="THITE_2106469"
                     /db_xref="GeneID:11521573"
     mRNA            complement(900030..901174)
                     /locus_tag="THITE_2106469"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648657.1"
                     /db_xref="GeneID:11521573"
     CDS             complement(900333..901169)
                     /locus_tag="THITE_2106469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648705.1"
                     /db_xref="GeneID:11521573"
                     /db_xref="JGIDB:Thite2_2106469"
                     /translation="MRDPAFRRDRRDFFFARDGAPRRRQGDGDGGDGGGGGDDAQDDG
                     AEGGEVGAEAEAEAEAAAQRAEALHAVKAAFDLLEHTLLADGRAWVLGGAADAGPTLA
                     DIEAVWPFHWMTGIPGMLSDVDDNGDSTATTTSTAQQISSAAFPRVYAWVARFQAAVG
                     AAKERVRAGRVSGEEAARILLRSGFLEREEEVGVDETEPLARACGLRRGSWVEVWPTD
                     YGAAHRDRGRLVGLGPDEVVWETDAGVRVHAPRLGFRVRPAAVAGVVAAPAAGEGKEE
                     GA"
     gene            complement(902521..907540)
                     /locus_tag="THITE_2106470"
                     /db_xref="GeneID:11521574"
     mRNA            complement(902521..907540)
                     /locus_tag="THITE_2106470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648658.1"
                     /db_xref="GeneID:11521574"
     CDS             complement(902744..907381)
                     /locus_tag="THITE_2106470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648706.1"
                     /db_xref="GeneID:11521574"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="JGIDB:Thite2_2106470"
                     /translation="MTSSVLDGDGAGCETPVPPAFSPLTDPAPDLNSTGSCEPSVAPA
                     HDGTHDEAYDPEVLPDAPPAAHHDVTVTATPAAPAASAQDSNPDRRLHALSDPEEPPA
                     TAAAAAAPAAPEAITDPMHFNSGMDAAVYPSAGAGLGLYSPHPTDILMALARLSAQRQ
                     GMALPPSTVRPSQVSLPPQQALDVSDPLLQRAPDGPSTTPHADAPLESFAKLEFADGV
                     FEMTTYAIIIGRDKKALAQARRNERRLEAYQRKVRENEQLGLPPPTPPIQEGRKFSKS
                     YVSEEGGMLGPESDGEDDPRPSKRRKTSRGAASGSGDSQQPEPAGPEPVPLDEEHPTL
                     NRQYVSHTPGAAAVDLSALRPSPYYVPLVPIHSPGPNIASRTKAISRRHLMIEFNQKR
                     GVFEAIPLHKNGFFCEDVLYNTKVVLRSGDRLQIRDVEFVFTINGVPRGKTGAEVDID
                     EDRSSSRRYSEGGKEMSFDFESSHDPERRSTSPEEMEEAPPAKEDSGSELSEPPEDIP
                     EPEPEKAPEHEVMETIEKDPPALPPSLKSELPPELYDALGPIPQRKRGPGRPPKNGIM
                     SKREERLRRKAAMELAKKNMPQPPPGEPPVKRKVGRPRKHPLPENAPDRPEKRKYKPR
                     KPKNGEDGEGSNAEKTMKERRREKPKTPPLELNEADYTEEQRQKPPKNYGTLIDEVLS
                     AAPGGLTLKQIYKRIQMKYPYFYFHVESKGWESSVRHNLIGNDAFRKNEETHLWSRVP
                     GIDIDAGKKRKAASPDRPAALHTFGPPYAASATTTPQTFHAEAGSQSGYRPGTVPQRT
                     GYPPAHGQVGLGQPPPQAQPGGLPVAASAQQAPRHAYSAPAPPAPAGTPTAVYADPAT
                     ARPSQANQNATGYSSPYTSRPPPGGSTPRGDTPQAPARQDFPPSQSMSPFNGLPRAGP
                     APAQAATSGSIGPRPAQPAATGATLALKPAVAPELVKHVINFKKTVTEQLTKRTRGAE
                     AAEAIALSVIHRGLGLTAESMVPEAESLEEVVFGVFESTSKNLGANRSLHPGLLQALV
                     KFKANMIQTLEGRMKGTRNAERLILSAMDRVLGFTDRSTMPGTETERNQYEAAENVLI
                     TAIERVVTEHQKTMAALASGSAPPTASRPSLGPPAPSVPGSAAVSARPQAPTPSPAGA
                     IASSTAPLNPGMKPAHSPSTSTSPPAPAPSGPAAANPSTAAAAAQQVPRPAATSAQLA
                     AQPLAAPASHTRPPAAGLGTVQSPSPASAVAQAAAAVPNPNLVPGAVQAQGSAQVAAP
                     AHAPAQGGAEVQHPPAQRPAEVQASLKVPSLATGQTPSRSTPPVGASVTSLPNAPASA
                     PIPTASHHPAQAVPPTSSQGPIPGSAPPPSQGPGQGPAPTSAASPATTAPPPAPGTSQ
                     LSAQKPTLAAPAAPPASIPPPSQDSKPSLATAHPPQGPALPATSAPAPTPAPPTTTTT
                     TTTTTTTPQTQVRTSSASAPSSPSQSAATPMPAKPAAAAPAPAATTSASTSSQGETTD
                     QIAAGSQTPSPVADMLAPAASATPAASAEPLPAAASPAMPLPTPATTTTAR"
     gene            908637..911081
                     /locus_tag="THITE_2106472"
                     /db_xref="GeneID:11521645"
     mRNA            908637..911081
                     /locus_tag="THITE_2106472"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648659.1"
                     /db_xref="GeneID:11521645"
     CDS             910141..910968
                     /locus_tag="THITE_2106472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648707.1"
                     /db_xref="GeneID:11521645"
                     /db_xref="JGIDB:Thite2_2106472"
                     /translation="MDSNASSDSTASSATASSTKPLNPVQRQNTGFSKPARQNSDYSG
                     EKAGAGGRGYYSGEAGASQTPYMNMLLSLDKIPRMHNILVSVFVWILLVGFVIMPGSF
                     TSLKRKQDGQSVTFPVGEVSGEKRAITPGNTAAMVVGFACIVAGLFGSSWLALRWRRN
                     YVWLLNKLYLPLVFNALAGVLTTVTNVYTQQVGEWSTQAIIAIVIEASVLGTSFILFV
                     IYNYWLLRRVRSEYEEQFNYGDEKTMRRRRKAQRRVGLFARFRRARRQPPIAAGSVV"
     gene            complement(911115..>912801)
                     /locus_tag="THITE_2152701"
                     /db_xref="GeneID:11521541"
     mRNA            complement(join(911115..911865,912113..912454,
                     912559..>912801))
                     /locus_tag="THITE_2152701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648660.1"
                     /db_xref="GeneID:11521541"
     CDS             complement(join(911194..911865,912113..912454,
                     912559..912801))
                     /locus_tag="THITE_2152701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648708.1"
                     /db_xref="GeneID:11521541"
                     /db_xref="JGIDB:Thite2_2152701"
                     /translation="MGPAFLSELARRNRYNLRTLRRSPAAEISGALGDLGTLLPLMIA
                     LALQGSIDLTSTLIFSGLFNIATGVVFGIPLPVQPMKAIAAAALANHLPLRVTTAAGA
                     LVSFAVLLLSATGLLRLLARLIPVPIIKGIQLGAGLRLITSGAALILPLPWLAPPPLD
                     SRLAALLLFLLLLLTQRAARFPYALLAFLLGIAVAEEDDDDDGSAAAPAVPSATALGL
                     SVAAMNLLACWSGAMPVCHGAGGLAAQHRFGARSGASVVLLGLAKVLLGVWGSGARSG
                     SGWGLLQNHTGGQQGLIEFLRRFPGGVLGVMVIAAGLELAKVGAGLNSGAADLWEESV
                     AEGEGVGVGFFRRRRCREVGVREQQERWMVMMVTAAGILAFKNDAVGFLAGCCCHAAY
                     RAADCVERRQAEGRWGLVGERLPLLR"
     gene            complement(913104..914255)
                     /locus_tag="THITE_2169171"
                     /db_xref="GeneID:11521593"
     mRNA            complement(join(913104..913830,913930..914255))
                     /locus_tag="THITE_2169171"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648661.1"
                     /db_xref="GeneID:11521593"
     CDS             complement(join(913341..913830,913930..914138))
                     /locus_tag="THITE_2169171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648709.1"
                     /db_xref="GeneID:11521593"
                     /db_xref="InterPro:IPR014850"
                     /db_xref="JGIDB:Thite2_2169171"
                     /translation="MARTGFFHHIGTFLLFSATILLIITCISAPVVHNLSLLKVDLGD
                     SSNANTRSTVTFGTFGFCHNNVAGGGSDDCSDPHVGYSPAAVMQAIDGTDFSTYATDT
                     TRTLTKAMILHPIACGIDFLAFLLALGAGVLGSFLAALVALVAFLATAVACVIDFVLF
                     SIVRSNVNDRGQTTGANARYGPAAWTTLVAAVCSLLGAVVVFFTCCSARLHRSRTAGG
                     KGDYAAPARRRWGW"
     gene            complement(915170..916152)
                     /locus_tag="THITE_2106476"
                     /db_xref="GeneID:11521665"
     mRNA            complement(915170..916152)
                     /locus_tag="THITE_2106476"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648662.1"
                     /db_xref="GeneID:11521665"
     CDS             complement(915493..916068)
                     /locus_tag="THITE_2106476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648710.1"
                     /db_xref="GeneID:11521665"
                     /db_xref="JGIDB:Thite2_2106476"
                     /translation="MASGLVERSPLEFDYVGQQPRGGTSRPSPPPKTFLVKIVEKPDY
                     THRTHIRESLIYGRWPEREDVYHLFSDHALSKNLLSQAVPPGMAHAGLVDWESFDQLD
                     DEEKLSASLTSKTDFVRARERRRKSESKLYSLVQAYNARLAGSEQAQEGGGLLRAAEP
                     MDDAADLQDNPLARVNSTEEESLKPAVRDAS"
     gene            918655..920238
                     /locus_tag="THITE_2106477"
                     /db_xref="GeneID:11521554"
     mRNA            918655..920238
                     /locus_tag="THITE_2106477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648663.1"
                     /db_xref="GeneID:11521554"
     CDS             918857..920098
                     /locus_tag="THITE_2106477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648711.1"
                     /db_xref="GeneID:11521554"
                     /db_xref="JGIDB:Thite2_2106477"
                     /translation="MVWDGSGDEDPVLPAANAGARPPTPLRTVQPPAELQHQQQHQHP
                     QYQYGYRYHHRSQHQHQQHRTEHQQQLQHHARDASQMPPPSVPGPTGTLPPETSGKLS
                     PSRTVERLAHKLSRQSLQLGPSSDGQLQTQPTPLLLSPPDGLQEPELFVFRDRAQRAV
                     TDQSRPHPASAHTTEHNSSPSWLPPAPALDVGEPIVIDEAYAEQPDHPRLLELKQSQQ
                     RQTSGQLRGSSNARLVDQRLEDMVITGTQCNVRSEPGPSAPGTTTTTTTTTPSRPPSS
                     YPIMNAAPAFIELDPDCAMPTPDLEVDDTCAEGIDIPDDLFSFSPAEGSISLRSASRP
                     GGIRKYTVGGVSLRYRLAADAALRCANVVRSRPRMRKRTGTKTRRDSAPSLSAVASAM
                     SSPAVSVAPSSPLLPACSRPP"
     gene            <921678..>923525
                     /locus_tag="THITE_2061513"
                     /db_xref="GeneID:11521607"
     mRNA            join(<921678..922037,922107..922471,922637..>923525)
                     /locus_tag="THITE_2061513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648664.1"
                     /db_xref="GeneID:11521607"
     CDS             join(921678..922037,922107..922471,922637..>923525)
                     /locus_tag="THITE_2061513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648712.1"
                     /db_xref="GeneID:11521607"
                     /db_xref="JGIDB:Thite2_2061513"
                     /translation="MAGVQGVTFSTSGLPPLSANKEKGGFCWQDVGNEAGSTDFFDQY
                     VELGDSDAESVCGGSGGLGQFCGASSLTVSPHMSFARMIIPPGGAAQGAHQTAEAAPS
                     HLLPGTAVNNTASSSSPQQQQQQQQQQHLHPLYRSASDMTHLGNTEIEGARAHYNGLS
                     DAPGGGSISDSELLKLEGLTMRSPRIHIPQLSASEPASPPSQSTSPRKAGRLESFCNK
                     IRTKAATLHGKAKQPPDMEAQTDDGNDAAFVNGFLDDPFMRDNLLHGQFVPPLQLNGS
                     AMPQTPLQTPLLDAWQLPMSAPNGKPLWTAVPGGTYFQAVNGDAANTWWDPSADAMDT
                     DSVPLSFHAAANARNATLNLAIQLQHQQSFEYPAPPGTEDNNFAAGGLMIHMPQQPQG
                     MPSAVTHGDPNHRPTRADQHHRRPKPRAPSSGARHHQFGPGVSPRKARTASGGRSTSA
                     SRLGSASPSPKIPAASVAGSSAASCTGRLHRRSASMQTLHQAAPSSVALAPDAQAAAI
                     RKRRSWTGRRTSSSSLHHQYHTLAAAAAAA"
     gene            complement(<926041..>928456)
                     /locus_tag="THITE_2037149"
                     /db_xref="GeneID:11521679"
     mRNA            complement(join(<926041..926095,926262..>928456))
                     /locus_tag="THITE_2037149"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648665.1"
                     /db_xref="GeneID:11521679"
     CDS             complement(join(926041..926095,926262..928456))
                     /locus_tag="THITE_2037149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648713.1"
                     /db_xref="GeneID:11521679"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="JGIDB:Thite2_2037149"
                     /translation="MRWSLSRPLAVVASLAAFASPTAAEPILQSNSLNTCQENSGFSA
                     SLFKVVFTPNNHTANVDIVAVSSVQGNVVFDVEIFAYGFQIIRQQVYPCKTDLKGLCP
                     MTAGKIPLNFNIDVGESAVKQIPSIAYTFPDLDAKVRVYINMTDGDRAGQSVACVEAD
                     VSNGKTVDLLGVKWATAIVAGLALVSSAIVSGLGHQNAAAHVAASALSLFGYFQAQAM
                     IGLTGVHLPPVVMSWTQDFQWSMGIIRLGFMQSILTWYQRATGGTPSTLFDSLTTVSV
                     QVEKRALSLAKRSLALVPRSIAEPVTAVVKRELARRANIQTSSGSYIVYGIQRVAFRA
                     GIESTNLFMTGLVFFCLLVLFTAAAVAAFKALCELAVKNRWMPNDRFLEFRNGWHTVL
                     KGILFRLTLIGFPQMTILCLWEFTQKDSAAEVVLAVFFLFGMTITLGWAASKVIRIAR
                     RSVTMHHNPAYILFSDPQALNKWGFLYVQFRASAYYFIVPVLGYTLVKAMFVAFAQNN
                     GTVQAVAFLILEAAALIAASVLRPWMDKKTNSFNIAICAMNFVNSIFLMIFTEVFNQP
                     PLVTGIVGLVLWIANAVFALVLLIMLIVSTVFVFFRENPDGRYQIMADDRTSFMKSQT
                     HLTTTTELDALAATARGDKSGFKGGLDLDDDAESITSDSLRRQTEHLNVPSAAGSAAG
                     SMSGSYPGRPRSPASPVMPLFPADGPRSPPRYTDQRPASPFGAPNRPASPLTFRSPSP
                     WQRGAGYDH"
     gene            complement(931420..934362)
                     /locus_tag="THITE_2106480"
                     /db_xref="GeneID:11521605"
     mRNA            complement(931420..934362)
                     /locus_tag="THITE_2106480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648666.1"
                     /db_xref="GeneID:11521605"
     CDS             complement(931589..934246)
                     /locus_tag="THITE_2106480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648714.1"
                     /db_xref="GeneID:11521605"
                     /db_xref="JGIDB:Thite2_2106480"
                     /translation="MDHNPPRPPLRSATSSSSFSRISTVSDFTDLDSFQSALADSQLQ
                     TQPSPASLQTSGVHVGTYFSHEGYTYASPTSSWASFTGPSHFTGYSPVASTDRSLPYS
                     PGRSHAHRHYAAIPEEEDGIDLGLISSAAPVSSGGETEMSEARAASTPMFDFTSTLGP
                     TTQADEAFIQALQQQEAQGRLTGGLGAGIKTDLMLTESALLASSPVSERPLSRTFSRV
                     GRPVSRTETVRRLGQSAANRRGEVIEVVMEDHDAGASDDKVDAVDVSLVSGPDAGDPV
                     PFVMRQTTFPTSKATTAVFYPQPNWKPFSMRWPYLLFLIVLSLGLGAGVEMLYRWSAQ
                     TPLVSFRSPSEIPAAQYFAVKFLPMIIAVSYGVLWQITNFDVMRLEPFYQLSKEGGAL
                     AAESLNVDYLTQFNLFRPLRALHYRHYAVALSSVASLLANTLVPTLGAASIILTPDRD
                     TRLRSPNIEKHILLHHVWSRLLTATFAIIAFLGCILFCQLQTRRSGLLADVKGIAGLA
                     SMATVSHILMDFKDTDVATHQDIHNKLKNRRYVLRNSALAPDDSRTTNTTSTNANPTA
                     ADRYTRNHLSANPQPLMLRPLGALPFLAALVGFTALLPTVLFTPATALADRAPWLVTA
                     LAVVLKLSWGALETDVRLLEPYVILARRHAAPATLALDYTTMPVGWVAVKAAVHRHWV
                     VFWVGVGTLLAEVLTVLVTSLVTGEGKVFGALASGDGDNGSGGDSRSGGGSNTNDNNS
                     NGGGGGQGMPAEAINAGQETVPSFWLSLALALLILLYMIATAGAVFARRRRVFMPRQP
                     NTIASVLAYIHQSKMLYDFVGTSKFSAADMVRRLEARGKTYGLGWFRGRDGQSHCGVD
                     EEELLSEYKPGYDYSRATKPWEEAEVNWL"
     gene            935797..937422
                     /locus_tag="THITE_2106481"
                     /db_xref="GeneID:11521676"
     mRNA            join(935797..936359,936434..937422)
                     /locus_tag="THITE_2106481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648667.1"
                     /db_xref="GeneID:11521676"
     CDS             join(936132..936359,936434..937225)
                     /locus_tag="THITE_2106481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648715.1"
                     /db_xref="GeneID:11521676"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2106481"
                     /translation="MVNSLVWTAEEAKYLKAIFQWRDAVSSSDDEERQHQQEEDGKRQ
                     HQDQHQQQRPAGQFRILVVGGRGTGKTAILTRFAQNTFRGEGQPPDPSFERGCRHPVT
                     VDVPPVTTTSCSSPPPSSTSTTTNNIAKPQSQPAAQAQKVSYIIDAVEMPSQQLLSNP
                     QLALALSITEAAVLVYSVRDAASLQLAIGLAEFMREYFAPPAPFSSPTPSSLFCARGL
                     LGMGSRAGAGTAGPSSAGAGNGDRGRPYPVVLVGSKCDAPACGPDADPVAILQEERAV
                     SWAEARAPRRRCACPASAATCASWRCRPRPGKASTGSSARSRRRSSRCRGRQGSGGSW
                     RSGRG"
     gene            complement(937387..939287)
                     /locus_tag="THITE_2106482"
                     /db_xref="GeneID:11523410"
     mRNA            complement(join(937387..937440,937511..937762,
                     937835..939287))
                     /locus_tag="THITE_2106482"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648668.1"
                     /db_xref="GeneID:11523410"
     CDS             complement(join(937619..937762,937835..939046))
                     /locus_tag="THITE_2106482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648716.1"
                     /db_xref="GeneID:11523410"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="JGIDB:Thite2_2106482"
                     /translation="MLALPGLRVALPRGCSRRLAVLCRLQAPAAQFSTRAPSLVAAQS
                     ILFRRRPSITATQPWQATTTRSFVTTDPALRPTFSLPVTSRPLYGRRHLRHQKLLHQL
                     RPFSVHRPLFQHHQQQNNENRDSNYRAYDADDLRRQVHLARLRDAKPLVHWRGWRAVN
                     TPSTYTVVAVAVAAALAYYFAHLETVPVSGRTRFNAYGAEAARRAGEAEHARLLWELE
                     QKGLRILPAWDPRAARVRRVMRRLVPFSGLRDEQWEVFVVEDDRTANAVVLPGGKVFV
                     FSGILGLAGNDSGLATVLGHEIAHNLAGHHEERLSQNLGSGVLLYSLVILAGAFGLAP
                     ILMHYFGSSILNVAFGLPMSRLQESEADYIGLMIMAEACYDPTEAVRFWARMERAMGE
                     DALPEWMGTHPTNANRIRKIQEWLPKALEKRAQSDCSSTTAFADLFRQALRTGHIVIT
                     G"
     gene            complement(<939918..942595)
                     /locus_tag="THITE_2093593"
                     /db_xref="GeneID:11521682"
     mRNA            complement(join(<939918..941012,941083..941283,
                     941328..941647,941719..942595))
                     /locus_tag="THITE_2093593"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003648669.1"
                     /db_xref="GeneID:11521682"
     CDS             complement(join(939918..941012,941083..941283,
                     941328..941647,941719..942343))
                     /locus_tag="THITE_2093593"
                     /note="CAZy_ID 269766"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003648717.1"
                     /db_xref="GeneID:11521682"
                     /db_xref="JGIDB:Thite2_2093593"
                     /translation="MASSIVRLGAAAALAYGSGAAALQSYQLSESYNPTNFFDKFNFF
                     DGKDPNSGFVQYRNRTYASSHGLIQTGTNDVTIRVDTTGTDQNGRSSVRLESINTYNS
                     GLFIADFTHLPYAPCGAWPAFWMVGPNWPTDGEIDIYEGWNLAPTNKVVLHTDSPTIS
                     GTCRIQQGDFTGTLEYPDCWTNDPTQPSNAGCAVEEKNGLFGNAAGGVYATEWQEDSI
                     KVWSWSHNSVPADVTSGKPNPANWGKPTLAAGSQCDVKSAFRDMRLILNINFCGDAAG
                     NTWPGSACQKSTNVPACYTYVQWNPHVYNSTFWSVRSIKVLDFDYDVDQVLDFDYDVG
                     QVLDFDHDVGQVLDFDHDYLFDFDHVFNFDHDHVLDLDQHVDGVPHLHTATETESDCP
                     DDNATSTTTGAATTETGSSTSTTATATATETESDCPDDNATSTTTGAATTETGSSTTA
                     TATATETESDCPDDNATSTTTGAATTETGSSTTATATGTAAPSSSVPDVTDIVTATAT
                     ATGGFTTSTIYTTITSTITSCAPTVTNCPARTVTSVIPIGTTVCPVTEASSAPVTTET
                     ATLPEGWTTSTVYSTITYTITSCAASVTNCPARVTTSVVAVGTTVCPIASLSASPSTS
                     AGVNPSEVVSTVRSFTTVSKTTTVVLPRPSGSAAGSSSSPVLVASPAPSSSAGSSPAS
                     PSVPSVVVGGNNGTASVPPVQVVTASQPGASTSLSQPVTAGGGRMMAGSGLMALLLGA
                     AAAMLI"
     gene            complement(<944201..>944986)
                     /locus_tag="THITE_2039581"
                     /db_xref="GeneID:11523491"
     mRNA            complement(join(<944201..944395,944493..944674,
                     944770..>944986))
                     /locus_tag="THITE_2039581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648670.1"
                     /db_xref="GeneID:11523491"
     CDS             complement(join(944201..944395,944493..944674,
                     944770..944986))
                     /locus_tag="THITE_2039581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648718.1"
                     /db_xref="GeneID:11523491"
                     /db_xref="JGIDB:Thite2_2039581"
                     /translation="MKLGSLVAALTLAGSRSAADFTNTFDGITSGSSVSLTWDGVPAQ
                     QYPLCITAQVIVKTGDGFKANAYRVNLTTDASGPSYVWAGVPFPLRRVRSGIYQVELR
                     SASSAGGDTPVLAKSPYFSVGDPGIATGSSPQPTLADSQGGGASGINKPVAIGLGVAI
                     GVPSIAALIVVGWCFRKRQRKAALEKSRLKRSEFVIT"
     gene            complement(949694..950702)
                     /locus_tag="THITE_2106492"
                     /db_xref="GeneID:11523439"
     mRNA            complement(join(949694..950166,950231..950377,
                     950450..950702))
                     /locus_tag="THITE_2106492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648671.1"
                     /db_xref="GeneID:11523439"
     CDS             complement(join(949858..950166,950231..950377,
                     950450..950554))
                     /locus_tag="THITE_2106492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648719.1"
                     /db_xref="GeneID:11523439"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Thite2_2106492"
                     /translation="MGSISDFPSPSNSLYYTYAESEQYSSESQSPNNSVYGMPSAGDS
                     RYPSPGQEEGESAESAQQQKPAAKRKRENRYKNAPPAVLSRRRAQNRASQRAYRERKD
                     QRIKDLEQMLNDAKQRNEVLSQAYAALHAEYVALRASQITDPAFRHQEYDLAYGAAPN
                     MGISAGVDGLDMDVFVYPGLNTGYVL"
     gene            <952533..>953230
                     /locus_tag="THITE_2125062"
                     /db_xref="GeneID:11523402"
     mRNA            join(<952533..952577,952651..952665,952709..952815,
                     952876..953089,953147..>953230)
                     /locus_tag="THITE_2125062"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648672.1"
                     /db_xref="GeneID:11523402"
     CDS             join(952533..952577,952651..952665,952709..952815,
                     952876..953089,953147..953230)
                     /locus_tag="THITE_2125062"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648720.1"
                     /db_xref="GeneID:11523402"
                     /db_xref="JGIDB:Thite2_2125062"
                     /translation="MYSAKKDSRQRSDVHVGVVYHAGHILRWQRGGSTVPGDVSAEPA
                     GPGGPGDFRSSVNAGAYCLALVPHLIISPAISIHRSPAAIEHRAVDDWMLNRTVLDPE
                     WRLPARRFRQAAPNRMEWTVPEHHQILGELNAASNSTFRRPADLCLLRMTAA"
     gene            complement(955689..957607)
                     /locus_tag="THITE_2106493"
                     /db_xref="GeneID:11521611"
     mRNA            complement(join(955689..956165,956228..956332,
                     956405..957063,957129..957607))
                     /locus_tag="THITE_2106493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648673.1"
                     /db_xref="GeneID:11521611"
     CDS             complement(join(955789..956165,956228..956332,
                     956405..957063,957129..957499))
                     /locus_tag="THITE_2106493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648721.1"
                     /db_xref="GeneID:11521611"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Thite2_2106493"
                     /translation="MAVPRLAGLRPFGTFTFPRQWLASQSSLVLRYPSSRRGAQKPLA
                     FAVVLADRQCRLKSTSPPNQDGEGSSKQTGKASQPTPSLRSMLWRALKTDTSRAWYVI
                     RNTSFRDVMRTNPVEAFGAIVALLGAVAFLGYCVYIYYNYFYSRQFTRYPPPVAQALR
                     KALYFSNHDPDPQRALKYYKQALELCDEAGLDHFSDDVMGIKIQVAAWLEKIESYHNA
                     ITVLENLLSDCKRWVEAMEKSAKEGTLPKVEPPPAPKEGEPAVSEQPRENFWAKRTRL
                     LAKAIGISVKLANLYSDEHVLERELAHERLVWAVETSLRETQRRAKEGLKEGEGPWMS
                     PEEIGGSLEALAHSYQEKSQYHLALPLFFQALRLCEDPCHMALLMNNIATSFAEHPLI
                     TPGDAPVHAMMEESKTWASPAEQRASYLAASQRWAQNAITHASEPQGEKRTPECDQAC
                     AVSLSNLGSVLAMLGRTDEARQKFEQAIALSKKLGFDDYAAEASARLQSLPTP"
     gene            957709..959001
                     /locus_tag="THITE_2106495"
                     /db_xref="GeneID:11523396"
     mRNA            join(957709..957873,957962..958111,958236..958270,
                     958369..958426,958606..959001)
                     /locus_tag="THITE_2106495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648674.1"
                     /db_xref="GeneID:11523396"
     CDS             join(958021..958111,958236..958270,958369..958426,
                     958606..958787)
                     /locus_tag="THITE_2106495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648722.1"
                     /db_xref="GeneID:11523396"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Thite2_2106495"
                     /translation="MAGKFEPKVPVQLAPPKDDPISVEELAKANGENGGKCYVAIKGI
                     VYDVTGNKAYQPGGAYNVFAGKDASRALAKTSTKPEDVRPDWQDLPDKEKSTLNDWVT
                     FFSKRYNVVGKVEGATNFE"
     gene            959002..961403
                     /locus_tag="THITE_2106496"
                     /db_xref="GeneID:11521591"
     mRNA            959002..961403
                     /locus_tag="THITE_2106496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648675.1"
                     /db_xref="GeneID:11521591"
     CDS             959702..961111
                     /locus_tag="THITE_2106496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648723.1"
                     /db_xref="GeneID:11521591"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2106496"
                     /translation="MADLPPRFKADLEDSLRADLSANQATQAAQATQATPSTCQTPKV
                     RRWDDPPEEEPAAPPENITTMVFVKAGTIRAAPAELTTLTFTPTDSHIVTTARRPVSG
                     VTRAGSFSLVQYSPLTLAVWSATTGQRVFMPYPEGNSIFSTDYPSEGVCIEEGDSTFR
                     GFAFRGPLPAASSSSSSSSGGSGDGMKDSPLIVACPFLRAQSVSAGDWMGTRMARLEV
                     YDLARARGSRLLKMDSPLRAPVAWSPDGTLLAGVSVRDPSRVVTVVVGPNTGSSKSAK
                     EPLAGALGSVVLMGHTDEVTHLAFLPVRRGSGKGKGAVALAAEESGRALVSVGRDGYV
                     RVTDVVSGRTLRRIEIGGRAHASILQVSHDGRFVVTVWGRDVVVWDQDSGSVHSYNLN
                     AVRQVEGWPLCVSPDCRYMAYRTDDGFEVCDVLTGQFRGEFPCKGTAIMSAAFNSNGT
                     RLAVGDSGGWLQMFEVITQ"
     gene            complement(<962800..>962979)
                     /locus_tag="THITE_2029041"
                     /db_xref="GeneID:11521652"
     mRNA            complement(<962800..>962979)
                     /locus_tag="THITE_2029041"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648676.1"
                     /db_xref="GeneID:11521652"
     CDS             complement(<962800..962979)
                     /locus_tag="THITE_2029041"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648724.1"
                     /db_xref="GeneID:11521652"
                     /db_xref="JGIDB:Thite2_2029041"
                     /translation="MCDWEEFIFTCGHSVFRKKCYCHFARNHPQHLCNRVQKLRHCWD
                     QPYPCDPCAERLRQEA"
     gene            966265..968986
                     /locus_tag="THITE_2106500"
                     /db_xref="GeneID:11523400"
     mRNA            join(966265..966373,966456..966784,966848..967831,
                     967897..968566,968690..968986)
                     /locus_tag="THITE_2106500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648677.1"
                     /db_xref="GeneID:11523400"
     CDS             join(966510..966784,966848..967831,967897..968566,
                     968690..968884)
                     /locus_tag="THITE_2106500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648725.1"
                     /db_xref="GeneID:11523400"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2106500"
                     /translation="MERKHQARHKKPFKCDIEGCQKETEGFSTSNDLDRHKRCVHKLL
                     KPGEVVYRCDLGSCKDKEKDWPRQDNFKQHLKRKHDLEGVDLSRFIFRSSDAADPTDP
                     GASETFSGDTSAVANSDAASSWLGLDHAHVSPASLTTRIPSFAQTGGMTQFPRNPVME
                     ERDFTLPRAVDSSRLSGSAGLEVGPVLSDAGIPQVSARGEIAPAIDTLSRVGDPAWVA
                     PDSLSQTQPETRAFGPQLPEASPRQVAELEVDDEGPDVAAEDAQSERAEAESAVPDEM
                     ELDNPAQDSMSEDNLHDPDSEDDGPSDSTTDGQADLLRDTGAQYSSVDGVHLKSPSTE
                     MQLAADAPRPIDLDDESQASAVLRSLMEKGMLGKLLKEVGYRAAEEAETKAKEQRPPA
                     NSSAPSDGSRVNKCQDCPKTFVRRCELKKHQKRHARPYACTFAKCDKTFGSKNDWKRH
                     ENSQHFQLEIWRCAEKASGAAAADQECGKVCHRRESLKSHLERDHGIHDPATLERKLA
                     DCRMGRNFESRFWCGFCQKTIEPTGKGGPAHSERFDHIDDHFNGRGVPKADIKDWKHV
                     DTDPLESSSSSPDGGSPGRGRRDGSARGGRPEWVHVPRSASGFRKRPHSSGRDGEASS
                     RAKRAKNGRGGKRDTWWSCCSCKMYWSLALTNKCMDPCNHDHCSACEIFERSSTELRV
                     QVRAPGQDQDMAQDQDTAQENGLMA"
     gene            969587..970138
                     /locus_tag="THITE_2106503"
                     /db_xref="GeneID:11521582"
     mRNA            969587..970138
                     /locus_tag="THITE_2106503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648678.1"
                     /db_xref="GeneID:11521582"
     CDS             969647..970018
                     /locus_tag="THITE_2106503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648726.1"
                     /db_xref="GeneID:11521582"
                     /db_xref="JGIDB:Thite2_2106503"
                     /translation="MSLLTSPHPSPSCPLPLALFLVFDMFSLITEYLHLPSVCLKLSL
                     PAGGYGEQRQGEGYSEDQIVASETLGIAHAASARAWPSLWLEEDDEGIGCVAARRLRG
                     GMRTGTARGDGTGTGTGTGTD"
     gene            <973968..>975989
                     /locus_tag="THITE_2036942"
                     /db_xref="GeneID:11523389"
     mRNA            join(<973968..974653,975188..975397,975458..>975989)
                     /locus_tag="THITE_2036942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648679.1"
                     /db_xref="GeneID:11523389"
     CDS             join(973968..974653,975188..975397,975458..975989)
                     /locus_tag="THITE_2036942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648727.1"
                     /db_xref="GeneID:11523389"
                     /db_xref="JGIDB:Thite2_2036942"
                     /translation="MADPYVFGGAAFPYEDMAFSSQPFAGLDDGLLDSNMTYIDPTLQ
                     IAPTIPFANAWDAPMQRALKEPSKATFVTDASSQMPTRAQIRPTVGIPAMPPPHARFA
                     SPISSIEPSSSASARSPRADSESYYDSFPGTPPDTAVLSPFQTPVPLEPYSNAHAVQF
                     RSMGPPDYVSPYDVNPSHQSEYSESDGGVIDFTVQPGYSFDSHVSEEPAPGAATPDFH
                     AERMASPEPMRPSSPSPYPSSPAHKDGAAPPTGAIFNRKDLFTQHLKRMHAPKQVKDH
                     VLPGTSSGTTGKKPSSSSTSTSSPATQTLLAEWDARLRRLQESSIRPRCPLPQTMRCP
                     VPACGAPPFRGADAWNQRMEHVAKHMERAAQGAEPRVVFGGAADPTLVEWAARADVAI
                     IVPAPPGSGPAGAGGVSEGDGPRWVLKTPLKRGPGGSVVVLAPVAGGAAGQEEEGEAE
                     GEEIVVSQDGCGEDEDEDAEGEEDV"
     gene            <980081..>981850
                     /locus_tag="THITE_2083919"
                     /db_xref="GeneID:11523503"
     mRNA            <980081..>981850
                     /locus_tag="THITE_2083919"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648680.1"
                     /db_xref="GeneID:11523503"
     CDS             980081..981850
                     /locus_tag="THITE_2083919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648728.1"
                     /db_xref="GeneID:11523503"
                     /db_xref="JGIDB:Thite2_2083919"
                     /translation="MSCNNRTPQRNHQESASMFDSDRILDRKIERQALPGSFSSNIGR
                     KPPSPENKASVRSVRAMVRLFEQSARSSDSAKPQASRPSQASDTSGRAGGGSDGSEGC
                     RAHHDNDNKDHEPVVRHTEPSMFPAALAFGCQVEEYSLTLLKHKSYFNNRPLARCLDD
                     FCAKEKDSKPERVRAARDQANEPAVEKKRGNANGGKEGQADQGTCPITPPNRNQTSSP
                     IQQLDSLRSGLLSWQGESERDTPGPGHKWTERDPREVDRFWCKVRTELWLDEDEIYAG
                     RTGPADIVGVETSAGQDEYHSSESAAYILTPPLSDCSSPEQEHPILPAPTRPPPPVPT
                     AARRQFDSIDAPRGRQRSTTSLHDVSDQDQNCPAWDEPPPAAFPRLNISAPSEVPIGD
                     LLSEGYLYPEPELPALSEPDRPLPVPETSPRHSRHTSRSSGPWMHPPTWRSPFPLSSS
                     SPPPPVPPLPALPPPSVSSASATTTTTNHYRRHVRHRHQPHSSKASTSISISTHSVAA
                     TDGRSSDASGSAQSMHSRERTHKTSTSSTATRSSRSGSSADLSAHRHHHYPPRTAPRR
                     RLTAEEKLSEIDAFLSSDPERED"
     gene            complement(982830..986063)
                     /locus_tag="THITE_2106504"
                     /db_xref="GeneID:11521681"
     mRNA            complement(982830..986063)
                     /locus_tag="THITE_2106504"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648681.1"
                     /db_xref="GeneID:11521681"
     CDS             complement(982937..985111)
                     /locus_tag="THITE_2106504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648729.1"
                     /db_xref="GeneID:11521681"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Thite2_2106504"
                     /translation="MVHHPDRAAQVLEATVEPEDPSQWYEVPDVFSFLVRQAARLPEG
                     RRRGALAELSGTLERLIRDKRPRYFNFPQWVVGTIIAASEPDSALALYNTLRERGHYL
                     SENTKLHVGSRLAKDMRFRPLAFELLEELVRKDGLSVDDRRCAALATSLISLPDGWEE
                     GREPPERLRTLHDLYQRILSLGFTTNQVIHASMMRTLCLNGQLDLAWNIYDFMRAEGV
                     PTDLYVYSILLHGAKLAGSMDSTLRVVQEASVGDLQNRIVWNDLIDTVLVAANNESIA
                     KPGRPLPVFCSMLHIYAKFFTLESLQRLIPEDLSTLLTAPALRGLEDCEWGPKLAMLL
                     DKLPVSEPSNRVTPHADTLNIMLLGYLRSFPVAQPILDFYSHFRSLLRRGDRLAISIL
                     QEGTVPYDGVIQAVSRFPGMLNVAVDIVAGMIEDAAASAAALKEQRTLPPSDKAEGSS
                     SPFVHPRPSVHTWSILLQAFAKMKGVQEGWRILEIMRKHGVKPNRVTWNMLIDASARS
                     HDAKLTMEAFTHLEKEGYVPDTYTMRGLSRLVDNEDALNRLDQLMEQSESIKSTQAAP
                     DKTQELISQWNNARAAKVLARRPRKKQLTPRPRRRRLRERPQEMPAGESESGDQAEQK
                     DSWAGTPLVLDKTDKAGEKPRRRKKSKGEQATLPTPRTRDQASVDSYRQLYKELLPGV
                     THGAPQDSQKGEEGTTPGRGEAEEDREGRAAGEATTSSTPLG"
     gene            986301..987737
                     /locus_tag="THITE_2106505"
                     /db_xref="GeneID:11521683"
     mRNA            986301..987737
                     /locus_tag="THITE_2106505"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648682.1"
                     /db_xref="GeneID:11521683"
     CDS             986421..987179
                     /locus_tag="THITE_2106505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648730.1"
                     /db_xref="GeneID:11521683"
                     /db_xref="InterPro:IPR013169"
                     /db_xref="JGIDB:Thite2_2106505"
                     /translation="MSSHAALSAAADERKARLAQLKSLKRKQSAAVDEDSDARAPSSA
                     SVSRDDDHGSPPATATTAQTTTASSSTTSKDDAAALQHLSGRNYDPLTRGAKLGFDAP
                     PTLNLKQPTLEQQAAQLEEAARAQESGGSGGGGALDAARGIDLLTLQPRRPNWDLKRE
                     LAARMEVLNVRTENAIARLVRERLAERKKEAEEARGAGAAAGEVMGAGGEGGDADGLL
                     DGAAFVEGIRRREREEEEEARREREAEAEEFGTA"
     gene            complement(987738..988682)
                     /locus_tag="THITE_2106507"
                     /db_xref="GeneID:11521686"
     mRNA            complement(join(987738..988247,988305..988682))
                     /locus_tag="THITE_2106507"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648683.1"
                     /db_xref="GeneID:11521686"
     CDS             complement(join(988066..988247,988305..988383))
                     /locus_tag="THITE_2106507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648731.1"
                     /db_xref="GeneID:11521686"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Thite2_2106507"
                     /translation="MYPYRARSGPSKATPSTVQCQKCLKRGHYSYECKVPPQERPYIP
                     RPSRTQQLFNPKLLPKLSSETPNPLMETYVAVVDSTHAQNHS"
     gene            989809..992707
                     /locus_tag="THITE_2106510"
                     /db_xref="GeneID:11521547"
     mRNA            join(989809..990042,990105..990982,991039..991368,
                     991426..991514,991574..991905,991966..992707)
                     /locus_tag="THITE_2106510"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648684.1"
                     /db_xref="GeneID:11521547"
     CDS             join(989989..990042,990105..990982,991039..991368,
                     991426..991514,991574..991905,991966..992688)
                     /locus_tag="THITE_2106510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648732.1"
                     /db_xref="GeneID:11521547"
                     /db_xref="JGIDB:Thite2_2106510"
                     /translation="MAAVPSVPHDVGKMSFARIAAASPSKGSKPAATAPVARTPNSVP
                     VQERREDPGSAAAVSSAAAPTTVPANASAGSESPRDVQQTTNSEQVADAKVTTELKDL
                     KLETQPPPNLVVNGSLAGMAERSAKAGNSQTPSDDTSQRADSSSELGTKPPSLDGKSI
                     TSGTTFALDEKESLRPDDSASVKAAAEDDDSFSIRGSYIAGSRMGSDLAARMHRIQIG
                     DMPPRALPVHHLPAGNKSQGVGTPQSGISDKQTPADSKAALGGGTATPDGLAPNAFYS
                     QNPDEKLLEAMQSPKDRIFLLRLEQQVIEFVQDSKEPYMDLPPSNSFCRMLTHRLADY
                     YHMTHSYEAAAGAVRIFRTPFCRIPPPLSSIAATTSNSSSPAPVVMPRKIMRRGEDGE
                     LGTASAGPSKPTSEAGSDSKEKAAPAKEKLTREEREEAYNKARQRIFGSVEKTDSSNQ
                     DGEDGNGGSRASSVSAKDKTNGGKRKTNKQRRDDSESFESRSQYVAWCGPQHPTWGPA
                     APQYYPVSAAPFNTQFQQPYPNAPQPMYAPGQPYAPQMMPNNGFAPPYGGVPTYPTPP
                     MPQAVPQAVPPPPQQGYRAPNPPLGGPYGSPVPNMAQPTWPPQQGFGQTAYPPRASPV
                     PPAGIPYAYGQLPANANPNDPKSQHPIPGSYNRQAFNPKTQSFVPANGLPMQPPPPPP
                     PPAAGPYGGSSPRHGSPQFQPPHMGYGGFQQQPMPQPGYGPAPGPYGMTRQGSNNSMP
                     PYHAVQAPPHVPPPHGPPQHLPPTGPMHMPNKPGGPSGPGQTFSHLPNYGNPATLPQK
                     PST"
     gene            complement(<993743..>995027)
                     /locus_tag="THITE_2083924"
                     /db_xref="GeneID:11523404"
     mRNA            complement(join(<993743..994765,994920..>995027))
                     /locus_tag="THITE_2083924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648685.1"
                     /db_xref="GeneID:11523404"
     CDS             complement(join(993743..994765,994920..995027))
                     /locus_tag="THITE_2083924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648733.1"
                     /db_xref="GeneID:11523404"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="JGIDB:Thite2_2083924"
                     /translation="MAVDQEHFVHLARPLAPTVMGFAAGSAPLTVNIQPQAVFSVIDH
                     ATRRDIRDTQSTRVIGALVGTRSEDGSEVEVRSTFAIPHTENEDQVEVDVEYQKNMLA
                     LTLKASPRETLLGWYTTSHELNSFSALIQNFFASPETGTFPHPAVHLTISTEPGAPIE
                     TKTYISAPVAVSPERAAESCLFVEVPHKLLFSDAERAALGTVTAAAESETRAAPVASD
                     LESLAQALEAVSDLLERVSGYVGEVLDEERDGSHALGQYLMNALSLAPKVSSTQIEHD
                     FNNHIQDVLMVSYLANTIRTQIDLAQRLATAPLAGSDKDGGDKREGAGEDGGKHYDGG
                     RSGGGGGGAGRGGKRAGRTGAGARAGGGGQQREAREPRENGE"
     gene            995386..997966
                     /locus_tag="THITE_2106512"
                     /db_xref="GeneID:11521695"
     mRNA            join(995386..995709,995779..996501,996554..997966)
                     /locus_tag="THITE_2106512"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648686.1"
                     /db_xref="GeneID:11521695"
     CDS             join(995549..995709,995779..996501,996554..997856)
                     /locus_tag="THITE_2106512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648734.1"
                     /db_xref="GeneID:11521695"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="JGIDB:Thite2_2106512"
                     /translation="MAPDGRAGFRGGSRGRGALRGRGAGPGRGKRRGKATAQEPPSAR
                     FHHARLASQDESEDEAGEASEDESDVGAMESGSEDEEEQKQPAQPYMSLMRSLVESAP
                     HKAKRRKLDHAPDDDKVASKPEPTVEPAKDEEGEEEERDVDLVEEPEEDPADAPPEDL
                     FDEDDNLDSSDPFEVHFADPKEDEFQPRLKAVQAGKWRTERAAAKSTRIFLSVPDVGD
                     AEGKSLPAPVSTLSDLKLKKRLHEALAPKHAKFDEVEQTIAPMLFNYQDLLYCNRTVS
                     GSQSVRRMVCLHALNHIFKTRDRVIKNNARIARTEGNEDLELRDQGFTRPKVLMILPT
                     RQSCVKMVDMIVSICEPDQQENRKRFADGYIDKQSKFSDDKPEDFRDLFSGNDDDMFR
                     LGLKFTRKTIKYFSQFYNSDIIFASPLGLRMAIGSEEEKKVDFDFLSSIELVIVDQAD
                     ALLMQNWEHVEFIFEHLNIQPKDAHGCDFSRVRSWYLDDQAKYFRQTAIFSAFNTPEL
                     AELVRAHCHNWAGKARLQQECPGVIQHLGVKARQTFSRFEAASIAADPDARFAYFTKA
                     ILPVLAKHKARDAGGTLVFIPSYLDFVRVRNYFANNPAAAHISFGAISEYTDVPEAMR
                     ARSHFLTGRHKVLLYTERAHHFRRYQIRGVRRVVMYGLPDNPLFYREIAGGCLQKSEQ
                     ALLLEPGQGAVRVMFSRYDVMKLERVVGTARVGKMIHEQGDTFDFV"
     gene            complement(997967..998940)
                     /locus_tag="THITE_2106515"
                     /db_xref="GeneID:11521640"
     mRNA            complement(join(997967..998513,998597..998940))
                     /locus_tag="THITE_2106515"
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /transcript_id="XM_003648687.1"
                     /db_xref="GeneID:11521640"
     CDS             complement(join(998133..998513,998597..998812))
                     /locus_tag="THITE_2106515"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /protein_id="XP_003648735.1"
                     /db_xref="GeneID:11521640"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="JGIDB:Thite2_2106515"
                     /translation="MAGGHMKYRQLSRDSAHRKALLRNLVTSLIKHESIHTTWPKAKE
                     AQRLAEKLITQAKKNNEPARRKAQGILFNAHELMPKLFGELRERYLHRPGGYTRVLRT
                     EPKDKYDQAPSAILELVDGPKDMRFAMTAAAVARDRLLGKRHTDLTQKNIAKVTRFRA
                     DGRDRFEEMVGKIEAMTLASQSESSSSSSSSSSSSSSR"
     gene            999444..1000802
                     /locus_tag="THITE_2106516"
                     /db_xref="GeneID:11523481"
     mRNA            999444..1000802
                     /locus_tag="THITE_2106516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648688.1"
                     /db_xref="GeneID:11523481"
     CDS             999626..1000564
                     /locus_tag="THITE_2106516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648736.1"
                     /db_xref="GeneID:11523481"
                     /db_xref="JGIDB:Thite2_2106516"
                     /translation="MALLPSPALFLSNLSQLTGTSKKQKKTGGVTLTLSLTYLALLTH
                     ARNREAQSAVLRAQISTLDALVPPDPAHHRRRRNATVLLPDGTYRPRESLAQYERERA
                     RAGPVGSLVETAKTRWNGEVLAAVRWAQEKDWGRVREEAEEGVARLLGVELSREPVPV
                     EEQGAERAVRTQEGGGEGRHEAAHKVSEALQHAREKTAVVARAMGQEAKEVVSEAREV
                     VATGVEKAEEAVAKRMGKAHDFVERTKGAAHLAEDKAEAKADAKLLHVSDIEKALAER
                     YDSARREERMKRSVQEVLNERYIPMDQRDNSQLRLV"
     gene            complement(1000804..1002670)
                     /locus_tag="THITE_2106517"
                     /db_xref="GeneID:11521698"
     mRNA            complement(1000804..1002670)
                     /locus_tag="THITE_2106517"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648689.1"
                     /db_xref="GeneID:11521698"
     CDS             complement(1000986..1002575)
                     /locus_tag="THITE_2106517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648737.1"
                     /db_xref="GeneID:11521698"
                     /db_xref="InterPro:IPR002656"
                     /db_xref="JGIDB:Thite2_2106517"
                     /translation="MNSHGAANYEEKTSFLDGISAAHLQQRWPPPVHPHQLLAHLSAL
                     LLRAVLFLVPSFLQPHVQRRLRPRLLTTTASNPPNPGSSTSTNPSTSTSPARLSPTAY
                     LDGMRGFAAAAVFLCHYFYTAFKIAPGFGSGGGHWDLPKLPFVRLVFSGPPMVCVFFV
                     VSGYALSARPAALAHARDWAGLLRAVGSLTFRRAIRLFVPTAASTLLVVVLVRLGAYE
                     WTREFASDDRFVRNYKEHHYHRLETTREQLREWAKALFNFVHVWDWQPFGGSMAMDVH
                     LWTIPVEFRCSMVLFLTMVGTARLRRPVRMAVVAGLVLFVYWSERWEMVLFYAGMVLA
                     ELDVVRGAHGSGLAGAGALPVAASPAPGRLVRRFTTKRTVWMAVSIVGLYLMSQPDED
                     GGQAPGWVYLTSLIPKWWKDEHRYWQSVGAILFVLAVGRSAWWQRFFTLPAVQYFGKI
                     SYAIYLMHGPVLHTVGYAIERWAWGLTGVEGRAYAGGFFLASLFVVPVVIWAADVFWR
                     AVDVPVVKFAKWLEAKCSLPE"
     gene            complement(1004914..1006949)
                     /locus_tag="THITE_2106520"
                     /db_xref="GeneID:11523419"
     mRNA            complement(join(1004914..1005123,1005194..1006236,
                     1006292..1006949))
                     /locus_tag="THITE_2106520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648690.1"
                     /db_xref="GeneID:11523419"
     CDS             complement(join(1005328..1006236,1006292..1006531))
                     /locus_tag="THITE_2106520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648738.1"
                     /db_xref="GeneID:11523419"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="JGIDB:Thite2_2106520"
                     /translation="MSFSSLVQDLSLRDSGAPRRRAEASVSTIDDRASHISMAKSYTS
                     TAATSVSISGDISSQLHAGYSHPLARTWQAERQLTKSMLIYPLFISDQDDEEVLIPSL
                     PNQYRRGINRLIPFLEPLVHKGLRSVILFGVPMRPGTKDALGTAADDPEGPVIRSIQL
                     LRRRFPHLYIVCDVCLCEYTSHGHCGILREDGSLNNQLSVDRISDVAVAYARAGAHCV
                     APSDMNDGRIRAIKLKLIEEGIVHSVTLMSYAAKFSGCLYGPFRDAAGSAPSFGDRRC
                     YQLPPGGRGLARRAIVRDINEGADIIMVKPAGQYLDIISDAKELGKDLPIAAYQVSGE
                     FAMIHAAAKAGVFDLKTMVFESTESILRAGASIVISYFVPELLDWLSN"
     gene            <1009126..>1011095
                     /locus_tag="THITE_153904"
                     /db_xref="GeneID:11521680"
     mRNA            join(<1009126..1009266,1010315..1010636,1010701..>1011095)
                     /locus_tag="THITE_153904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648691.1"
                     /db_xref="GeneID:11521680"
     CDS             join(1009126..1009266,1010315..1010636,1010701..1011095)
                     /locus_tag="THITE_153904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648739.1"
                     /db_xref="GeneID:11521680"
                     /db_xref="JGIDB:Thite2_153904"
                     /translation="MSHSPNQQVNGGEAFAPMADPANTSATSNPSGTRRGSHSTQYSS
                     TTGVLSSLPHRPSFTPLHPSPLPPSLLLPSPPLPSPHPSLRQSHQPFPQPPSSLLPPP
                     LPLAYISLSASGPTVFDWLQVLSGLAAPPAAADPAVELEDPEPVAVPECDTSSCKKRW
                     EIIEVSKHTHLLAFAATAGSYGSAPPPEAFSAQRQISSWKCWLFSCRFQSFLLPNVLS
                     KDPVAVAAVVAVVAVVVVDRFGEGVAANGDSDDDSDDASRRDVRHAVRAAHQRTRRHA
                     RHCTTIFLV"
     gene            complement(1012562..1013933)
                     /locus_tag="THITE_2106522"
                     /db_xref="GeneID:11523466"
     mRNA            complement(join(1012562..1013079,1013166..1013933))
                     /locus_tag="THITE_2106522"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648692.1"
                     /db_xref="GeneID:11523466"
     CDS             complement(join(1012745..1013079,1013166..1013700))
                     /locus_tag="THITE_2106522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648740.1"
                     /db_xref="GeneID:11523466"
                     /db_xref="JGIDB:Thite2_2106522"
                     /translation="MSTANPTPSTPLSAADLLELASTDVSTPLPAAALRAALSSPPFV
                     ALPDTFNARDLGLVPGSPIRPGLAFRSGGFLQGLSPAGSAALAALGVRRIFDLRSVGE
                     HARAPDPVVDGVEGVWVRPGEQDAVVSLDEFVEGHGERGFVNMYLNVLKVYAGGIRRL
                     LEAVRDGRGEEPFLFHCTAGRDRTGVVAGLLLTLAGASRETVALDFILSRIGTEPARE
                     QLLAFALHGSRAASVETPGFHNMLSLRISCWEAFVKAVETEYGGFEGYVTKTLGFSEE
                     DLAKIRDNLVLKN"
     gene            complement(1013935..1015706)
                     /locus_tag="THITE_2106524"
                     /db_xref="GeneID:11521525"
     mRNA            complement(join(1013935..1014297,1014371..1014536,
                     1014628..1014932,1015006..1015346,1015412..1015706))
                     /locus_tag="THITE_2106524"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648693.1"
                     /db_xref="GeneID:11521525"
     CDS             complement(join(1014113..1014297,1014371..1014536,
                     1014628..1014932,1015006..1015346,1015412..1015659))
                     /locus_tag="THITE_2106524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648741.1"
                     /db_xref="GeneID:11521525"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106524"
                     /translation="MASLLRRIPWWGRRPPSAPRVFANPNFERISADCRIEEETFSDY
                     VAARYYPVHIGEVFISRYQVVGKLGYGAYSTVWLARDLNEHRHVALKIFIRSQSMGSD
                     AERELRIYQHMAEVSSKSKHPGRKAVRTLLDSFKVVGPDGEHQCLVHPPLWESVKGLI
                     GRNPIGRLPSPVLGIILHRLFLALDFLHTECHLIHTDLKIDNIMFGAEDDSIFEKFEE
                     AELNNPSPRKEVEGGRFIYVSRQLDAPKELAPPVLCDFGSVVSGEQVNTRDVQPDLYR
                     SPEVILDMPWSYEIDIWNVGCMVWDMFEGGHLFSGRDPEHHAYRSRAHLASIIGLLGL
                     PPRELIARGKRGAEFFSEKGDFKANIPLPPPRSLEQIETNLQGDDKERFLQLMRKMLR
                     WVPEQRCSAKELLQDAWLKGQL"
     gene            <1016440..>1017149
                     /locus_tag="THITE_112236"
                     /db_xref="GeneID:11521577"
     mRNA            join(<1016440..1016559,1016715..1016746,1016984..>1017149)
                     /locus_tag="THITE_112236"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648694.1"
                     /db_xref="GeneID:11521577"
     CDS             join(1016440..1016559,1016715..1016746,1016984..1017149)
                     /locus_tag="THITE_112236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648742.1"
                     /db_xref="GeneID:11521577"
                     /db_xref="JGIDB:Thite2_112236"
                     /translation="MRSFSTSARKLLQYLGYPFADLPGPWKTATETYLHNGAAKKVGV
                     IKSVEILHRNDGSSPVHKSHYNPNDPEEVISVRIEDENGNKRTHHIYSDGTGTGFVGD
                     KRE"
     gene            complement(1018248..1019393)
                     /locus_tag="THITE_2106528"
                     /db_xref="GeneID:11521536"
     mRNA            complement(1018248..1019393)
                     /locus_tag="THITE_2106528"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648695.1"
                     /db_xref="GeneID:11521536"
     CDS             complement(1018277..1019137)
                     /locus_tag="THITE_2106528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648743.1"
                     /db_xref="GeneID:11521536"
                     /db_xref="JGIDB:Thite2_2106528"
                     /translation="MSNDRPAKPRGLRKLLFGDRGINIRSPAPGRYSSAVCGYWTGLE
                     ASNPKTIPDEADPYTQALKQLSASHSPALDDLPLRRPVATGASSPTQSGGMPEQVAQI
                     SPAEDTTHQGSDGRPQITGRRYHRLADGGVYVEFVDVSAHEHHGHAPTNKVQPASGIP
                     PFNTISSTNHAQGSGTLGAPDHAATEGSRPSTPPIPPISPARRNAVHNLQQASVAAAT
                     APIGLAQEVREAYGSRWTHPWRISAPADPHGGGGAPELRKGESSNSMRDDEVTRGSRA
                     SRTSSEVARR"
     gene            complement(1019870..1021108)
                     /locus_tag="THITE_2061555"
                     /db_xref="GeneID:11521666"
     mRNA            complement(join(1019870..1020231,1020290..1020372,
                     1020430..1020510,1020569..1020598,1020653..1020676,
                     1020781..1020811,1020872..1020928,1020995..1021108))
                     /locus_tag="THITE_2061555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648696.1"
                     /db_xref="GeneID:11521666"
     CDS             complement(join(1020030..1020231,1020290..1020372,
                     1020430..1020510,1020569..1020598,1020653..1020676,
                     1020781..1020811,1020872..1020928,1020995..1021038))
                     /locus_tag="THITE_2061555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648744.1"
                     /db_xref="GeneID:11521666"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="JGIDB:Thite2_2061555"
                     /translation="MTRKLKYHEQKLLKKHDFINYKQDNNHRHHDVARRYMIQKPEDY
                     HKYNRLCGSLRQLAHRLSLLPPENEVRRKHETLLLDKLYDMGILSTKSKLSQVEHNVT
                     VSAFARRRLPVVMTRLRMAETVQAATKLIEQGHVRVGVEEVRDPAFLVTRNMEDFVTW
                     TVGSKIKQNIMKYRDKLDDFELL"
     gene            1021288..1022459
                     /locus_tag="THITE_2106534"
                     /db_xref="GeneID:11521556"
     mRNA            join(1021288..1021460,1021547..1021917,1022035..1022459)
                     /locus_tag="THITE_2106534"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648697.1"
                     /db_xref="GeneID:11521556"
     CDS             join(1021355..1021460,1021547..1021917,1022035..1022268)
                     /locus_tag="THITE_2106534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648745.1"
                     /db_xref="GeneID:11521556"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="JGIDB:Thite2_2106534"
                     /translation="MACRQWLSTAARQCQSGMAQQKHLRTFSTSAPVADIRSLFPNSQ
                     AVKRSNNNNRANASNPSAALQSMLAEGMERGGPLSAAEQQQVLAQQLQPKEYVRELRF
                     AAVTDNYMRQMPRRWKTGDVYAPRDLSPTEMDKWRQARPPETDVVDMFGFNPLDNYKN
                     FALISEFMTTMGRIKHSSDTGLRPVNQRKMAKAIRRAIGMGLHPSVHFHPEILRMSRL
                     SLPVASIPTKSHPSQNRL"
     gene            complement(1022488..1025545)
                     /locus_tag="THITE_2106536"
                     /db_xref="GeneID:11523393"
     mRNA            complement(join(1022488..1022793,1022984..1025341,
                     1025408..1025545))
                     /locus_tag="THITE_2106536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648698.1"
                     /db_xref="GeneID:11523393"
     CDS             complement(join(1022628..1022793,1022984..1025304))
                     /locus_tag="THITE_2106536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648746.1"
                     /db_xref="GeneID:11523393"
                     /db_xref="JGIDB:Thite2_2106536"
                     /translation="MPSSLTRNVYLRLLASHGLLRPCAALPSRCLAVPSRPRPCPCPC
                     PHSHPHQYPLLVRRQPRRTFFGIFQKPPRMLKEPEIEPGYDVLLLFNSLETDNARPPA
                     REELLKGWRQFVQHKRRNHRRALNSTQAYLTLQLLSHLVETAPETEGHGDDLSFSDLR
                     AALWVTATRPPKGTSEYHLELAKLLYGEIERRIQNMRDLGIDEEMIKEAVGGKDAGDF
                     ELFLTALTQYGGSLEAAERLAEFRAQLDGEQKMAARVKVFWTLVLRGLAKEGREEDLL
                     REYKKAEEAHLEYLPQVHEIMTTFFASRDRVEETKHWFEKPIHANRMRSPKAYMAAVR
                     FAIRNGEQQWLQPIFEQLINSNPPKEWWDVVFQWAVLVLDKGVEDIKQMIQVMSTPKE
                     GREGGKQGKEGPKPDAATIDALIQAAIEKQNPYLAERFLSLGAELQIQPRASTYILQM
                     DYRLDAKDFSGVQAIYDKLLKGEVTVSQDEDLPVLNKYLRALCAVAEPDLGRILDITA
                     DLEHRHATLEPETVVALCMVFLRSDNQYDVIDTLSLHTVSYSLEERAQVRRAFVEYCL
                     DRRVSTARVWDCYSLLRQFFPETEPAERVRLMDAFFARRRPDMACLVFGHMRSQDSPA
                     QRPTPDMYVRCLEGLGAHPDPESLRMVYNMLKMDTSVQLDTRLYNGLMLAHAACDEPD
                     TAVDFWRDITNSAEGPSYRSLEIVFWACERLPYGDRTARGIWQKMQRLDLDVPPEVFA
                     AYCGALAGSGHLEEVIRLIRGMEASVGYGPGMMTLGVTYNALPGRERKEQFEAWAKAE
                     YPDIWSQLEKKGRQETLRGTKFNIVRELKA"
     gene            1026119..1027584
                     /locus_tag="THITE_2106538"
                     /db_xref="GeneID:11523441"
     mRNA            join(1026119..1026553,1026629..1027584)
                     /locus_tag="THITE_2106538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648699.1"
                     /db_xref="GeneID:11523441"
     CDS             join(1026172..1026553,1026629..1027272)
                     /locus_tag="THITE_2106538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648747.1"
                     /db_xref="GeneID:11523441"
                     /db_xref="JGIDB:Thite2_2106538"
                     /translation="MAPTPPTVVSLKQSFLTTQTRLLSQPLAPTRAWRNNNSSTNTNN
                     ETSDETNPPLPDKAIDDALFKLNHRLQQHARRVYAPQATRHVAEQIDQLYWNAAEAAS
                     ARDRSGDDGDEEGEAAEALNLGADLANPSVIATLPLQWADADANAGDGPPPPAPTPET
                     QRYAALAADLHALAQRKQQAAARVARLRRMQALLEPFSPSPPSPTQGSLNNADDPSTS
                     SSSGGGGGSSVQDNLITRNGAIEAELSRMRMLLARVGGRVGRLREAAEAEAEAEAEAE
                     PAGGAGQGGRDRRGGGENGELAGISSSSGGDGAARAGGGGGERGGTVGDVEAEERRKV
                     GLLLERF"
     gene            complement(<1027991..>1031987)
                     /locus_tag="THITE_2073178"
                     /db_xref="GeneID:11521649"
     mRNA            complement(join(<1027991..1028443,1028951..1029291,
                     1029391..1030251,1030315..1030451,1030515..1030585,
                     1030639..1030953,1031015..1031254,1031447..1031736,
                     1031885..>1031987))
                     /locus_tag="THITE_2073178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648700.1"
                     /db_xref="GeneID:11521649"
     CDS             complement(join(1027991..1028443,1028951..1029291,
                     1029391..1030251,1030315..1030451,1030515..1030585,
                     1030639..1030953,1031015..1031254,1031447..1031736,
                     1031885..1031987))
                     /locus_tag="THITE_2073178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648748.1"
                     /db_xref="GeneID:11521649"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="JGIDB:Thite2_2073178"
                     /translation="MPVVLQGAATEVQLTPQKKVDEFWRKFTTKAPGKATTVLPKNEL
                     AERLAKRAAAKDRAGGSTKKTTTSYEEAAALCRAKVEQIVAECRRVNQKYSDPHFDLD
                     FDLRSGRRDCLESLSNVKDDYSSDDDDSSSVKRVGEIFDDPKFYIDGPTANDVRQGND
                     GDCWLMAALCTLSNKPGLIERVCVARNEDVGVYGFVFHRDGEWFSEIIDDKLYLIKPD
                     YDEARMGKRANIDRALWEQIDRPDSEEDYRKAYQSNSAALYFAQCEHPNETWLPLLEK
                     AYAKAHGDYAAIEGGFTGEGIEDLTGGVTTELFTNDILDKEYFWKEELMKVNQDFLFG
                     CSTGLWGLGYGERKGIQEGHAYSVMRAVEIDGQRLLLLKNPWGKGEWTGAWSDGSKEW
                     TPEWLTKLNHRFGDDGAFWISYKDLLRKYQTFDRTRLFGPEWKVTSTWTTLNVSWALE
                     YHDTKFSFTLAKPGPVVIVLSQLDDRYFRGLEGQYVFGLGFRVHKAGEDDYLVRTHTS
                     YRVNRSCNVELDLEAGEYTVLIRIDAERIEGILPPEEVVRRNAKQRRDKLLRIGLAYD
                     LAHSKARIVETPEEKTAREAYEKRKKEKRRSQIRKAVMEEKHKRHYIKRKEWEAQRKE
                     NAWKKELRRKRAEKREAKRKAAEEEAKRKEEEADNKEETPTAAQEENQAEEQASAGVC
                     EPGASGAQEDESQPKVHGKQAETEALAGEGSDAAENTPPSSTTDVPVPAAAEGGQKPE
                     AAEKVDQGGQNPASEAPVPAPPKGNVQDATSKKTDAPAQPGVRVPQSADEDDDDISDI
                     CSIRSVSDITDRELDLIVKENESRPPPPPPRMSGPPPPQRPDEFERDPWNAVAVVGLR
                     IYYKVAEEDKDAEGLVTLRVVRPNRWELMSDDEESGGDGEGGEDGEKETAEEGKAEGE
                     GLNESLVLDVDDSAKDAMVKGG"
     gene            complement(1033160..1035907)
                     /locus_tag="THITE_2106543"
                     /db_xref="GeneID:11521702"
     mRNA            complement(join(1033160..1035276,1035332..1035907))
                     /locus_tag="THITE_2106543"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648701.1"
                     /db_xref="GeneID:11521702"
     CDS             complement(join(1033540..1035276,1035332..1035424))
                     /locus_tag="THITE_2106543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648749.1"
                     /db_xref="GeneID:11521702"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="JGIDB:Thite2_2106543"
                     /translation="MRCATIHRKLGTHVSKVKSLSMDSWTNEQVDNMRKVGNVISNKL
                     YNPENKKPPVPIDADEADSAMERFIRQKYVSRTLSTNKKHAGGSDLDDTPPPLPPKTP
                     PSRFGLRSASSIFPLGSKAKKAHEPTSPRNPRDSREHPPQPPPRTTSAGAFGASINRD
                     RGDGESTEQKLAKLRDMGFADDHRNSMVLKGVGGNLEKAVEALVRLGEGSGRPPTLLT
                     PARAATMPATRSLTPSAGSETSRARPVSPASTNPFDMLETPPPPQPLSSQSTGTLQTK
                     NPYVSTNPFGAPQQTPAALDLAFQNMSLAPPSQPLFPHHTGGLVAQQPYQPPMTAPLT
                     APLTPPAQGYAAVGVNGNQTYGTAAQLAGATYNPFFTAQPAQQPLSINTAQFGGSLSS
                     NPFARSPTRIQSPSLSQIPEQTQQNVYTQPVQPQATNPFFAPTTSAPQQLYAGQMQLP
                     PQAGLAPQMTGYSQQLQQPPPRADKASIMALYNYPQLAPNKNSTQTPFQASTDAELTT
                     TPAQTPSSLFPPQTFPQQQQQQQQPQQQQSHPHQPQSQPTSVSPAAGSKNPFAGAGAA
                     GRLADATPKHNVSRESMMALGLEWSNGRHSPDAFASLSARDTR"
     gene            complement(1037123..>1039121)
                     /locus_tag="THITE_2061567"
                     /db_xref="GeneID:11523377"
     mRNA            complement(join(1037123..1038602,1038663..>1039121))
                     /locus_tag="THITE_2061567"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648702.1"
                     /db_xref="GeneID:11523377"
     CDS             complement(join(1037517..1038602,1038663..1039121))
                     /locus_tag="THITE_2061567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648750.1"
                     /db_xref="GeneID:11523377"
                     /db_xref="JGIDB:Thite2_2061567"
                     /translation="MGRTLEIAGQGPITLEDALEEEYNVISRLSYGPANEKLYRELWE
                     ERSSIEALTRHHLGLSKRDSCKVLPPASWIRGAFNVCVFVDVRRAVHHGSSERVVFRC
                     PLPHKLAEARYPGSIDEKLSCEVGAHIWVEEHCPEIRTPHLFGFGFSDGRHFTHTRHV
                     SFFVRTVHRFWRAVYQLFRFPLLSRFVRNPPRQSLSSAYMVLEYLGPETGQTLSKTFD
                     AYRGDKPRRGRLFKGIARIMLSLARLPQPRIGSFQFHDDGTITLTNRPLSCSVMILEN
                     EGATRTMQSGETYNCTDAFVSDMLTFHDHRFLSQPNAVFDENDCYTQMAVKTLLRVLS
                     HAHIKRELRNGPFPLQLTDLHASNIFVDDQWNVTGLIDLEWLCALPAEMLDVPYWLTG
                     CAIDEIKGEKLAHFDEVRQEFMRIFEEEAQTAKSTTQAGHNLDLGKIMQDVWESKGVW
                     FWHCLSSVNAMYLLLEAHFFPSLSLEADKLISKFWCQDPEDVVRKKLADKRAYDEELR
                     SLFHNE"
     gene            complement(1039884..1040510)
                     /locus_tag="THITE_2106547"
                     /db_xref="GeneID:11523412"
     mRNA            complement(1039884..1040510)
                     /locus_tag="THITE_2106547"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648703.1"
                     /db_xref="GeneID:11523412"
     CDS             complement(1040159..1040353)
                     /locus_tag="THITE_2106547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648751.1"
                     /db_xref="GeneID:11523412"
                     /db_xref="JGIDB:Thite2_2106547"
                     /translation="MTVSETNSISSPPPPSSSSPTKNVAFYLAASTSRRALSPLAAFS
                     PTTKLSTLPPPSLSPHPPWA"
     gene            complement(<1040562..>1042006)
                     /locus_tag="THITE_133689"
                     /db_xref="GeneID:11523395"
     mRNA            complement(join(<1040562..1040660,1040722..1041172,
                     1041254..1041265,1041331..1041598,1041889..>1042006))
                     /locus_tag="THITE_133689"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648704.1"
                     /db_xref="GeneID:11523395"
     CDS             complement(join(1040562..1040660,1040722..1041172,
                     1041254..1041265,1041331..1041598,1041889..1042006))
                     /locus_tag="THITE_133689"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648752.1"
                     /db_xref="GeneID:11523395"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_133689"
                     /translation="MTPPESLTMSFPSGDRPLDNYQFTFESYLTDSDRIEADVSYHFP
                     NDVSENERVEEQYEILKMVMDGRLHLAPFSRDHPPRKVLDIATGTGNWAIEMGDLYPE
                     AEIIGTDLSPIQPSFVPPNVRFFVEDSSDDWDYPSEFDFIHTRMTISCWSDMKTQIIQ
                     RAFDHLRPGGWLECQEAPATIDCDDGTMPDDYAWLRWSLDFQAVSRLANRQSEIGPYL
                     KDWMREVGFVDVQEVTFKLPLNGWPKDPRLKHIGMLWQRNLLEGVSAFSLGMFHRFMG
                     KSVEEIELSLVDVRKCLFDRSVHAYHRLYVVFGRKPETA"
     gene            <1044381..>1046077
                     /locus_tag="THITE_12695"
                     /db_xref="GeneID:11517694"
     mRNA            join(<1044381..1044542,1044759..1045323,1045396..1045517,
                     1045571..>1046077)
                     /locus_tag="THITE_12695"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648705.1"
                     /db_xref="GeneID:11517694"
     CDS             join(<1044381..1044542,1044759..1045323,1045396..1045517,
                     1045571..>1046077)
                     /locus_tag="THITE_12695"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648753.1"
                     /db_xref="GeneID:11517694"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="JGIDB:Thite2_12695"
                     /translation="LGPARTHAHLLQAVLPALNGQARSPRYLGFVTGGVLPIAEAADN
                     LVSAADQNVQAGWTHSASTAVEDAALRMLIALLELDRPGPRSETGWGGRTFTTGATAS
                     NLLGLACGREAVVARRAAAKGAGPVAVAELGLLAACRAVGVAEIRVLTSMAHSSLLKA
                     ASVVGLGHESVKEVGVSAEEPWRLDLDAVERELASGEADGVVSIIVVSAGEVNTGRFA
                     TNVLDMPKLRSLADRYGAWIHVDGAFGLFARALPKTDEFLALHAHAAGLELADSIAAD
                     GHKLLNVPYDNGIFFCRDAAVLTQVCSNPNAAYLASSGDPDAILSPLNIGIENSRRFR
                     ALPVYAVLLSEGRDGIAAMLSRMVLLAREIAAYVRDSEHYEWLPSQDASLESTYIIVL
                     FRAKDAALNDVLVDRINATGKMFVSGTRWDGKKAVRIAVGSWRVDVERDAAVIKEVLT
                     DI"
     gene            complement(1046217..1046934)
                     /locus_tag="THITE_2106548"
                     /db_xref="GeneID:11515514"
     mRNA            complement(1046217..1046934)
                     /locus_tag="THITE_2106548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648706.1"
                     /db_xref="GeneID:11515514"
     CDS             complement(1046282..1046557)
                     /locus_tag="THITE_2106548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648754.1"
                     /db_xref="GeneID:11515514"
                     /db_xref="JGIDB:Thite2_2106548"
                     /translation="MAQGEVKKTPKPNPGGKGGKAGGKQQAKKSGVSKAKKSKTTADK
                     IQKKYTAGLVAKTEQMLGERAGHLELIGKGRKKGEERKFKGGSRKFG"
     gene            complement(<1047004..>1049265)
                     /locus_tag="THITE_2140706"
                     /db_xref="GeneID:11515479"
     mRNA            complement(join(<1047004..1047474,1047537..1048841,
                     1048894..1049002,1049066..>1049265))
                     /locus_tag="THITE_2140706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648707.1"
                     /db_xref="GeneID:11515479"
     CDS             complement(join(1047004..1047474,1047537..1048841,
                     1048894..1049002,1049066..1049265))
                     /locus_tag="THITE_2140706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648755.1"
                     /db_xref="GeneID:11515479"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="JGIDB:Thite2_2140706"
                     /translation="MTTIRFVPFSSEIELPFYTALFSSKLDHDKLDDSARPVLGLYEP
                     RVQADPESSARMQILGNALTSNDVPMGMSRAKGYIKNVNTIEEFKNTDKSAMITDAGR
                     QIWEAIQDGTIYSVPSLLSSFAILSFADLKKYRFTYWFAFPALHSDPPWKQTGPVGRL
                     SSKESTALVDAVGTWRYAVSNEGEHGFFLAKKVRGEDGTPQPLLDDAPPDIGYRWEIG
                     SLRDFETGFFSDVGEEDRYVAFVDPSNYPESPAWPLRNLLVLIKQRYRLNKVQILCYR
                     DTQARRHEARSIILPVAVDETDDTQPAKMPNVTGWERDGSSKLRARLANLAEYMDPTR
                     LADQAVDLNLKLIKWRLAPNLDLDTIKSTKCLLLGAGTLGSYVSRNLMGWGVRKITFV
                     DNGAVSFSNPVRQPLFQFGDCLNGGKPKALRAAEALKEIYPGVEAEGHVLSVPMLGHP
                     IQDEAKVKADFSKLQQLVDAHDVIFLLMDTRESRWLPTVMGKASDKIVMNAALGFDTY
                     VVMRHGAAPEDGSEETLGCYFCNDVVVAADSMKDQTLDQQCTVTRPGVAAIASALLVE
                     MLTSLLQHPKKHHAPAPAPTTGSGHERDPPDHALGIVPHQIRGFLSSFQNMVIHGRSY
                     PQCSACSKPIVSAYKTEGWEFVRKALNSREYVAELSGLAEVQRQAEAAAGEVEWSEDE
                     ALGEEEGEGVLI"
     gene            1049806..1051553
                     /locus_tag="THITE_2106553"
                     /db_xref="GeneID:11521193"
     mRNA            join(1049806..1050066,1050137..1051191,1051252..1051553)
                     /locus_tag="THITE_2106553"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648708.1"
                     /db_xref="GeneID:11521193"
     CDS             join(1050045..1050066,1050137..1051191,1051252..1051299)
                     /locus_tag="THITE_2106553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648756.1"
                     /db_xref="GeneID:11521193"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="JGIDB:Thite2_2106553"
                     /translation="MFIGICGSICAGKRTIARYLVEHHDFTQLYLSPGYQGGVDGTIS
                     RAGASNEGNGDVSNSREQHVFSTSAELLDFVTKRWRQRWVTTDIPTESDLDLYARRPF
                     FLLISVDAPLTVRWRRFQARQRSLATSATTSDATSSSPSLSASLADGADPSAITSLEA
                     FATLSDTHLYSPLTGQHPLLSRATVRLLNTSPSLAHLYATLGKLDLANPDRLRPSWDS
                     YFMSLASLAAQRSNCMKRRVGCVVVRDKRVISTGYNGTARGLPNCGEGGCGRCNAARE
                     GSGHGLSTCLCLHAEENALLEAGRERVREGAVLYCDTCPCLTCSIKIVQVGITEVVYS
                     QGYSMDRETAEVFRQAGVRLRQFVPPANGLIYLEKPEMCT"
     gene            complement(<1052596..1053120)
                     /locus_tag="THITE_2106555"
                     /db_xref="GeneID:11519131"
     mRNA            complement(<1052596..1053120)
                     /locus_tag="THITE_2106555"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648709.1"
                     /db_xref="GeneID:11519131"
     CDS             complement(1052597..1052791)
                     /locus_tag="THITE_2106555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648757.1"
                     /db_xref="GeneID:11519131"
                     /db_xref="JGIDB:Thite2_2106555"
                     /translation="MPAVSLPVVARDTFSQIAKRSNWASRNAGVMVVFCIVFIVGVGL
                     IGLFIHKKLQARREKRQQIV"
     gene            complement(1055469..1056692)
                     /locus_tag="THITE_2106556"
                     /db_xref="GeneID:11517668"
     mRNA            complement(join(1055469..1055960,1056032..1056336,
                     1056403..1056692))
                     /locus_tag="THITE_2106556"
                     /product="glycoside hydrolase family 61 protein"
                     /transcript_id="XM_003648710.1"
                     /db_xref="GeneID:11517668"
     CDS             complement(join(1055591..1055960,1056032..1056336,
                     1056403..1056468))
                     /locus_tag="THITE_2106556"
                     /codon_start=1
                     /product="glycoside hydrolase family 61 protein"
                     /protein_id="XP_003648758.1"
                     /db_xref="GeneID:11517668"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Thite2_2106556"
                     /translation="MKFSLVSLLAYGLSVEAHSIFQRVSVNGQDQGLLTGLRAPSNNN
                     PVQDVNSQNMICGQSGSKSQTVINVKAGDRIGSLWQHVIGGAQFSGDPDNPIAHSHKG
                     PVMAYLAKVDNAASASQTGLKWFKIWQDGFDTSSKTWGVDNLIKNNGWVYFHLPQCLA
                     PGQYLLRVEVLALHSAYQQGQAQFYQSCAQINVSGSGSFSPSQTVSIPGVYSATDPSI
                     LINIYGSTGQPDNGGKAYNPPGPAPISC"
     gene            1057611..1059050
                     /locus_tag="THITE_2106558"
                     /db_xref="GeneID:11517162"
     mRNA            join(1057611..1057961,1058052..1058342,1058441..1059050)
                     /locus_tag="THITE_2106558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648711.1"
                     /db_xref="GeneID:11517162"
     CDS             join(1057827..1057961,1058052..1058342,1058441..1058806)
                     /locus_tag="THITE_2106558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648759.1"
                     /db_xref="GeneID:11517162"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="JGIDB:Thite2_2106558"
                     /translation="MASKLTPVLMRTAARTASRTAARPLAAQARAFSLSARKQSDTLM
                     VHRNTPDNNPDIPFKFTEQNEAIIAEILKRYPPQYKKAAVMPLLDLGQRQHGFTSISV
                     MNEVARILEMPPMRVYEVASFYTMYNRTPVGKFHVQACTTTPCQLGGCGSDAIVQAIK
                     EHLGIKQGETTADGLFTFTEVECLGACVNAPMVQINDDYYEDLTPETIKSLLTALRES
                     AADVSKAAAVPKPGPLSGRKTCENSAGITSLTSEPWGIEKTRPDL"
     gene            complement(<1059193..>1060974)
                     /locus_tag="THITE_41298"
                     /db_xref="GeneID:11521162"
     mRNA            complement(join(<1059193..1060455,1060615..>1060974))
                     /locus_tag="THITE_41298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648712.1"
                     /db_xref="GeneID:11521162"
     CDS             complement(join(1059193..1060455,1060615..1060974))
                     /locus_tag="THITE_41298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648760.1"
                     /db_xref="GeneID:11521162"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="JGIDB:Thite2_41298"
                     /translation="MDSFKLLKRRTTELFQSLEQSLPSLPSLPSLPSLGGQGSSTMKG
                     TWEKIQVPPLLRSSHSADIVDGNLYIFGGEVQPRRPVDNDMHVIKLPSSGAQADYYAI
                     KAKPAKPSTHDQELAIPTLGDVPAPRVGHATAVIGPRIFLFGGRGGPDMTPLDEAGRV
                     WVFDTRTHLWSFLDPAPAAAHLPRESAPYPAPRSYHCAVATPRPSPPTTTTHPAPSHP
                     HPPKNPAETLRDWALGQPDPALGTPQNPVVGVLAERAVDREDLGYGTLLIHGGCLAGG
                     ARTADVWAFDVRSRVWRRLPDAPGAARGGAALALAGGRLYRFGGFNGADEEGGQLDFL
                     ELGLDVFDDQVVRGEAALTVGRHDRGGWQSLFFGKEDVGYKEVDPAELPLEAGAAAGA
                     AGAGAGAAEHRWPGNRSVAGFEAVTVGGGREYLVLLLGEREPSGQGHAAAGRFWDDVW
                     AFQVPAEGGSLASVADTAFSVVGRSGEGRWMRVEMAPHDDEDDASAEGPGPRGWVATA
                     TMGQLEENGIVVWGGLDEGNRRLGDGWILRLG"
     gene            complement(1061712..1064417)
                     /locus_tag="THITE_2106560"
                     /db_xref="GeneID:11517684"
     mRNA            complement(1061712..1064417)
                     /locus_tag="THITE_2106560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648713.1"
                     /db_xref="GeneID:11517684"
     CDS             complement(1061733..1064189)
                     /locus_tag="THITE_2106560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648761.1"
                     /db_xref="GeneID:11517684"
                     /db_xref="InterPro:IPR006823"
                     /db_xref="JGIDB:Thite2_2106560"
                     /translation="MEAEKDRITHQPGREDWRPDAPGCRDPERCRQPACAASAWGRIP
                     HRRLLGYWCAVFSLIIVTPFLLGSLLPQDALRWAAPWLHATGHPATPLISGDRYLIGV
                     GKADITGPVVEINLMGYADPKQLGTGLRQRLYSRAFIIADVDRPEERFVYLVLDTQSG
                     DTAIRYGILNGLKELGPSYAVYNHHNVAVTGTHSHAGPAGWLNYLLPQITSKGFDQQS
                     YRAIVDGALLSIRRAHESLQPGYLSVGTTKVHGANINRSLFAYLANPEQERAKYNVSA
                     DDDGSVEKDLTLLKFQRASDGKNIGVLTWFPTHGTSLLGNNTLIAGDNKGVAAYLFEK
                     SVRDDPTAAENFIAGFSQANVGDTSPNVLGAWCEDGSGQMCSFENSTCSDGRSQACHA
                     RGPFFRVKDNGASSCFEIGRRQFEPARALYDQLQRNPTPVGGGPVKAFHSFHNMSGFS
                     FLLPNGSEVRTCPAALGYSFAAGTSDGPGAFDFTQHSGNENTTSPVWRVVSRLLKDPT
                     PAQRACHYPKPILLDVGEIDTPYAWTPNVVDVQAFRVGQLVIIVSPGEATTMAGRRWK
                     QAVQDAFVRLSEAEPRRGVSQAPSPVVVLGGPANSYTHYITTEEEYAIQRYEGASTLY
                     GPHTLAAYINVTLSLLPYLGADAAPPPPHDKVGLFPPDNANRSLSFITPVIRDGPPLF
                     RRFGDVLTDAQRLYRRGEWVKVVFVGANPRNNLRLEGTFAAVEKLTAGPAAAGAGPGG
                     QQHEQQAWTRVRDDSDWSLVYHWRRTSEVLGSSEVEIVWETEDWADRGVYRIRYYGDA
                     KSLGGDIQAFEGVSSAFTLV"
     gene            1064882..1065952
                     /locus_tag="THITE_2106561"
                     /db_xref="GeneID:11517062"
     mRNA            join(1064882..1065009,1065078..1065952)
                     /locus_tag="THITE_2106561"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648714.1"
                     /db_xref="GeneID:11517062"
     CDS             join(1064973..1065009,1065078..1065745)
                     /locus_tag="THITE_2106561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648762.1"
                     /db_xref="GeneID:11517062"
                     /db_xref="InterPro:IPR008409"
                     /db_xref="JGIDB:Thite2_2106561"
                     /translation="MPSITTVHESLPYIDADPTPAERAAAEALIAEERALVPDDPHHA
                     LLPPPPTTTRFLTPLLAAELSRLSTAAAEQATTDTDTTTPRKPLPKLSALDLTRYEAP
                     TPPSPTALAALPRSEAAQQLQAALARAYTSHSYVASRRAHLALLDSYGKNAWLVGNEA
                     LEGEVRAVERELAETRRAIDEVTAQRREMQDGAGAELRGLEEAWRRGVGRVLETEAAA
                     ERVRREVLELRRRAAS"
     gene            complement(1065952..1067702)
                     /locus_tag="THITE_2106562"
                     /db_xref="GeneID:11517076"
     mRNA            complement(join(1065952..1066860,1066939..1067453,
                     1067515..1067702))
                     /locus_tag="THITE_2106562"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648715.1"
                     /db_xref="GeneID:11517076"
     CDS             complement(join(1066159..1066860,1066939..1067415))
                     /locus_tag="THITE_2106562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648763.1"
                     /db_xref="GeneID:11517076"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="JGIDB:Thite2_2106562"
                     /translation="MSSSGFTSPFGANSNPFGSSRIEAGGMQRVAEEEENDTITSPTT
                     PHFGQSAGNTFQGPFGGDASSDPQQSGLRGPPSTEGYPAQYNFARRTSVSAESLKPVA
                     DSYDNWTPPVHPKSPEQLARLKTAISGNFLFSHLDDEQCAQVLGALVEKPIPTKGIKV
                     ITQGDAGDFFYVVEKGSFEVYVNSSGSLQPGPDGMGQKVGTIEAGGSFGELALMYNAP
                     RAATVISAEPQCTLWALDRVTFRRILMESTFARRRMYESFLEEVPLLATLTPYERSKI
                     ADALESQKFPAGHTIIREGDPGHSFYLLESGEAVAYRSGNDTPVKHYKKGDFFGELAL
                     LNDAPRAASVVSQTEVKVARLGKSAFQRLLGPVEGIMRRTRYVGVKTGVEDMDPLQSQ
                     "
     gene            1069590..1071150
                     /locus_tag="THITE_2106565"
                     /db_xref="GeneID:11517078"
     mRNA            join(1069590..1069885,1069970..1071150)
                     /locus_tag="THITE_2106565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648716.1"
                     /db_xref="GeneID:11517078"
     CDS             join(1069664..1069885,1069970..1070977)
                     /locus_tag="THITE_2106565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648764.1"
                     /db_xref="GeneID:11517078"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="JGIDB:Thite2_2106565"
                     /translation="MAPRRRRGAGPNAGDDAHSDTDAPKNRPPNTAFRQQRMRAWQCV
                     LTPKLIVTIFSILAAIYLGFGAYLTYLAHTVRDIRIDYTDCATTAPNGTFGPLPQEHI
                     TAHFANSDGAHDPYQAEWMRETRTVKVANYTSDRTYCLVRFNIPEDLQPTISFFYNLE
                     NFYQNHRRYVNSFNAKQLLGDAVDGGTINASTCDPITYDPLGSGKIVYPCGLVANSIF
                     NDTFSTPLLLSVRDSSASNRTYNFTTQGIAWPGMKDLYGETKYNYSQIVPPPNWHDRY
                     RYGYVDNNPPPNLKEDEAFQNWMMLAAAPNFFKLYQKNENETMVAGQYQVDIESNFNT
                     TVYNGRKAFVLTTISTMGSRNIWPGIIFLIVGGICLILDVYFILSFFLWKPRKLGDPS
                     YLSWNQPSAPQGHASAS"
     gene            <1072047..1075713
                     /locus_tag="THITE_2073202"
                     /db_xref="GeneID:11515632"
     mRNA            join(<1072047..1072223,1072305..1072389,1072451..1072572,
                     1072647..1074252,1074321..1075713)
                     /locus_tag="THITE_2073202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648717.1"
                     /db_xref="GeneID:11515632"
     CDS             join(1072047..1072223,1072305..1072389,1072451..1072572,
                     1072647..1074252,1074321..1075429)
                     /locus_tag="THITE_2073202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648765.1"
                     /db_xref="GeneID:11515632"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="JGIDB:Thite2_2073202"
                     /translation="MGDIKIDGKTFQERMSHFVGAWKADKRSGDALFGGVSSIVILMG
                     KVGEEPEFFKNNAMHFWLLGYEFPTTLMLLTPDTMYIVTTQKKAKYLDQIKSGRFPVE
                     VLVRGKDAAENEKLFLKITDAIKAAGKKVGVLSKDTSKGPFIDEWKKIFADNCKDVEE
                     VDISTALSVAAFSVKDEAELRAMRTSSKACVALLNPYFLDEMSDILDQEQQIKHSELA
                     DKVSNKIDDAKFWKSVELPNRQKLPADFEPDQLDWILGPVVQSGGKYDLKWQADADNQ
                     PLHPGIIIAAMGLRYKSYCSQIARTFMVDPNKSQESNYRFLLAVHNLVLKEIRDGVAA
                     KDVYNKAYALVKSRKPELEKHFLKNVGFGIGLETKDSTLILNGKSTRTLRDGMTLCIT
                     TGFTDIQNPDPQDKNSKVYSLVLTDTIRVRDVEPVVFTGDAPTDADAISFFFKDDEEV
                     QPSPKKEKRDSRVGAVATKNITSTRLRSERNTAPDDDAEKKRREHQKELAAKKQREGL
                     AKYAESTAGKNGVEVKKFKRFESYKRDTQFPPKVRDMGIVIDQKNATIVLPVMGRPVP
                     FHINTIKNASKSDEGEWSFLRINFLSPGQGVGRKDEQPFEDASAHFVRSLTFRSTDGD
                     RYADIANQISNLKREAVKKEQEKKDMEDVVEQDKLIEIRNRRPAVLDNVFIRPAMEGK
                     RVPGKVEIHQNGIRYQSPLSTTQRVDVLFSNVRHLFFQPCQNELIVIIHLHLKDPILF
                     GKKKTKDVQFYREATDIQFDETGNRKRKYRYGDEDEFEAEQEERRRRAELDRLFRSFA
                     EKIAEAGRNEGVEVDMPMRDLGFNGVPNRSNVYIQPTTECLIQITEPPFLVITLEDVE
                     VAHLERVQFGLKNFDLVFVFKDFSRPPCHINTIPVESLEDVKAFLDSSDIAYSEGPLN
                     LNWSVIMKTVTANPHQFFVDGGWGFLQNESDSEDASEEEEEESAFEISESELDAASES
                     SEEDSDYDSNASAEGSDEADVSEEEEGEDWDELERKAKKRDRESGLDDEDRGGKKKQR
                     KR"
     gene            <1083983..>1085960
                     /locus_tag="THITE_2125099"
                     /db_xref="GeneID:11516894"
     mRNA            join(<1083983..1084056,1084454..1084520,1084568..1085003,
                     1085132..1085198,1085265..1085298,1085371..1085518,
                     1085640..1085787,1085828..>1085960)
                     /locus_tag="THITE_2125099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648718.1"
                     /db_xref="GeneID:11516894"
     CDS             join(1083983..1084056,1084454..1084520,1084568..1085003,
                     1085132..1085198,1085265..1085298,1085371..1085518,
                     1085640..1085787,1085828..1085960)
                     /locus_tag="THITE_2125099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648766.1"
                     /db_xref="GeneID:11516894"
                     /db_xref="JGIDB:Thite2_2125099"
                     /translation="MSQSTVHSSLPTLPNVALFGNAVQGKRAKTHDPSLARSQMEMAE
                     YKSKRPAAQHPTGGKSKQPQEHDESCQWLPATLTSSHGPCVPPLSMAAIHTKRSWRHP
                     ASVVCWNGWRNWDFSAATNSVCAWEQQPAWTDRTTPRSMGISAQRRLTPGASSRSVYT
                     ENATVGAAMGSSARTNSTAPPNSRRDALLLGKSMQVACMSLSKWFSGAAGQLVVMTGI
                     LVSIDVTPRGPHPGVPNLIEDGSPVLGNGSGLRYPGPHFQTAGPSSASASDAGHKYGG
                     WLTASPLGSGLPSACAMVNSPNYTLHLPAGVMSTLSKRKMDWTLHNGVLPAAAVRCNL
                     RTLAHTERCVCSAARRFWASSLLFSPWATRCRQA"
     gene            1087399..1089231
                     /locus_tag="THITE_2106568"
                     /db_xref="GeneID:11521190"
     mRNA            join(1087399..1087569,1087662..1088508,1088571..1088879,
                     1088941..1089231)
                     /locus_tag="THITE_2106568"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648719.1"
                     /db_xref="GeneID:11521190"
     CDS             join(1087723..1088508,1088571..1088879,1088941..1089123)
                     /locus_tag="THITE_2106568"
                     /note="Contains conserved domain ZnF_GATA[cd00202], Zinc
                     finger DNA binding domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648767.1"
                     /db_xref="GeneID:11521190"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="JGIDB:Thite2_2106568"
                     /translation="MAATLVSPSAPYHHRPHHNSFSSGYPHSAPPTSIPGMISPVEPR
                     RASDESEPGHSHRQSLPSLPSISEVFSDRKPLAYGPPPSSAPMPPAQSLPSPFSATAP
                     PRPFADVASPDKTTSPRALHPAPSTFPSRTEALPAFSDPARPPLASRPIPPPLNTFPG
                     QHPSPPVKLEHLEAEQRPAAQPAQPLPGLYAETGRLPPGQLPLSAYPISPRHSGPPLP
                     SPYEAQRPPVYGEETGYSPHRPSEYKADFDKHFQTYGYQDALQIIMSSCRTGYHFAEA
                     YGAAAREQQGSQPIPSRMPTENEVSLLLNSLILALKKLEEVRDMVQQNRIQNERARDS
                     GSRKPEDEDISMYGDGIKPAYALSEVKKRRGRAAPPGRCHSCNRIDTPEWRRGPDGAR
                     TLCNACGLHYAKLERKRQLDQRSLRPKPADERK"
     gene            complement(<1096458..>1099082)
                     /locus_tag="THITE_2125101"
                     /db_xref="GeneID:11517347"
     mRNA            complement(join(<1096458..1097591,1097656..1098241,
                     1098298..1098423,1098485..1098633,1098702..1098767,
                     1098883..1098955,1099072..>1099082))
                     /locus_tag="THITE_2125101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648720.1"
                     /db_xref="GeneID:11517347"
     CDS             complement(join(1096458..1097591,1097656..1098241,
                     1098298..1098423,1098485..1098633,1098702..1098767,
                     1098883..1098955,1099072..1099082))
                     /locus_tag="THITE_2125101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648768.1"
                     /db_xref="GeneID:11517347"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="JGIDB:Thite2_2125101"
                     /translation="MGLLALGTALDWPEAKKQAHLVRSWGIKQLLEIWNKAKGKERDA
                     MLWGDEVEYLVVTYSKDDPKVLLSLRQADILKALASDTALSKAKCAPPLPDGSNAHTS
                     QPPPVFHPEFGRFMLEATPGKPWGIEFKELLEVEPNMRLRRCIARDHMRANEYPITLT
                     TFPRLGCPGVFTEPFYPVSGPRLRSQFVPDEIANPHIRFPTLAANIRSRRGRKVQVNV
                     PVFRDEKTPWPWKDPTVNYDLHQWPEDDDVRNGAAPDNFIHMDAMAFGMGSCCLQITF
                     QAKNINEGRQMYDQLSPLGPIMLALTAATPVYKGFLADTDVRWNQISKAVDDRTPEEL
                     GEKPLVNDRWRIPKSRYASNSTYISEDPRLRPEYLDPDLVIDEDIKQQLLDGGMDDRL
                     ATHFAHLFIRDPLVVFSEDLEKLDLSKTDHFENIQSTNWQHMRFKPPPADNSIGWRVE
                     FRPMEIQITDFENAAFAVFMVLITRVILSFDLNFYIPITKVDENMETAHARDAVLSRR
                     FYFRRNPFPTSSSRTARSSSASGASTPVVSRPPTPTGPVEDEYRLMSVNEIINGSAYA
                     RATASYSNLQPADSAAAGSTSASSPEQQQKQAQAGDENDDDFPGLIPLVESYLDSVNV
                     DVATRCRLAAYLDLIRRRASGELWTAARWIRHFVARHPAYRRDSAVGEAVARDLVAAV
                     VQIGQCESAGQELRSLCAEQVPGLEMLLGGLR"
     gene            complement(<1101185..>1104063)
                     /locus_tag="THITE_39109"
                     /db_xref="GeneID:11515728"
     mRNA            complement(join(<1101185..1103685,1103754..>1104063))
                     /locus_tag="THITE_39109"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648721.1"
                     /db_xref="GeneID:11515728"
     CDS             complement(join(1101185..1103685,1103754..>1104063))
                     /locus_tag="THITE_39109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648769.1"
                     /db_xref="GeneID:11515728"
                     /db_xref="JGIDB:Thite2_39109"
                     /translation="LLGRMACRLSRLCLATLTILPAVAAAATTNITSEILDFVPVCAQ
                     ACFQSFISANFDAAICGNSPSLDCLCRQRGSSGYTIGEGALSCLVGESRFGACNGQDV
                     ATYNMCVGIARAAPETHSTIVATLVVPQSGTGPLLVPTALPTTSSRGMATVTISTTPT
                     PTVSLPTGTETSPTTASTGLAAPASTPTASPDTSAGQAQLSSAQIVGITLGCIAVVVF
                     GIMLVLIARCVRRSRFGDLERGFSRLRDSMSFGRKSRPLSAPGVQISSPLIGAPVRNP
                     AAARRQPNMQQGGVGLAIPPIPARGGVLARPSPALASLLAPPPTSVRPANAAPASAPT
                     TSVSSVPKVVVTPASESQPPSVRQSPPKPILTLAIPKGPEQATRVPASVRDSVVTEFA
                     EDGEGDLAPGTIIWRPPASDPQSASTTYYADRAGNWILSNPSTRQAQASIPTKTVIQE
                     APSAPVEVELPSPDHKTRAERASDVYGGFVPDAVVSPLRLPRKPGQPRLGSPIAFKDQ
                     RRMPQLSSPNLSERLSQTAESPGGAPNQVKNRPPDPYFAAVRDSRDLTGVRSKRRSAR
                     RASRRISLESATSIESAAAGPFEDEDLSPVTESLHTPISPGKSPVKYPKIPRSNEGQQ
                     APGSDLLPPENQYNVWRPPGHSSTAGAGSLPKTKTATPSAAPQSSAGPTRPWNAPNMQ
                     PAPNRNPGRARTGSPEARFKLAPAIEAQYWERQRQVANPASYWNQPPQTNPSARRAQP
                     PTARARAQQQQPLPPLPPPSPPYELPAESPPRRRRFATATPPQQQQQRPQQQQQQQQQ
                     QRPTGPRRPTDLPTPQATPDNHSPASRKQPQAQSQSQSQSSLLAKRRGADKAAALSLG
                     NGNGIGIGSGRKGRGWKKEEEPLPQPPQQPRQQEKQKQEKQQPPQQQQQYQEYGPVPI
                     TPGWVPELTPTRRGEDLVLDVQ"
     gene            complement(1106375..1108129)
                     /locus_tag="THITE_2106580"
                     /db_xref="GeneID:11521475"
     mRNA            complement(join(1106375..1106937,1107005..1107242,
                     1107311..1108129))
                     /locus_tag="THITE_2106580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648722.1"
                     /db_xref="GeneID:11521475"
     CDS             complement(join(1106458..1106937,1107005..1107242,
                     1107311..1108017))
                     /locus_tag="THITE_2106580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648770.1"
                     /db_xref="GeneID:11521475"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2106580"
                     /translation="MADLASRISKPSDAPASDAPAPAEGNGTEQPIDDGLNRGLIESS
                     YDVEVKLSDLQNDTDNPLASGVSSFEELGLSKQINDGLLAMNFKKPSKIQEKALPLML
                     SNPPRNMIAQSQSGTGKTAAFVLTVLSRVDFTQPTQPQALLLAPSRELARQIQGVIKT
                     IGQFCENLIVEAAIPGSISRETGVKASAVVGTPGTVLDLVRRRQFDVSKLKVLVIDEA
                     DNMLDQQGMGDQCLRVKNMLPKNIQTLLFSATFPDKVMNYARKFAPNANEIKLRHQDL
                     TVKGISQMYMDCPDESKKYDILCKLYGLMTIGSSVIFVKTRESANEIQRRMEADGHKV
                     SVLHGAYEGQNRDALLDDFRSGRSKVLITTNVLARGIDVSSVSMVINYDIPMKGPGDR
                     EPDAETYLHRIGRTGRFGRVGVSISFVYDRKSFEALSQIADWYQIDLVQLSPDDWDLT
                     EKKVQDVIKSSRARPEYAPSALGN"
     gene            1108850..1111612
                     /locus_tag="THITE_2106586"
                     /db_xref="GeneID:11517692"
     mRNA            join(1108850..1109056,1109127..1109338,1109415..1110991,
                     1111074..1111612)
                     /locus_tag="THITE_2106586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648723.1"
                     /db_xref="GeneID:11517692"
     CDS             join(1109012..1109056,1109127..1109338,1109415..1110991,
                     1111074..1111474)
                     /locus_tag="THITE_2106586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648771.1"
                     /db_xref="GeneID:11517692"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="JGIDB:Thite2_2106586"
                     /translation="MAEVDVIPTLGSELKDGFKPANAWVANGIAWLDDIQSFYRERSA
                     IEKEYSAKLNALAKKYFEKKTRKSASLSVGDTPAMTPGSLESASLTTWTTHLTSLEAR
                     ADEHERYGNDLIGKVAEPLKHMGVRFEELRKRLAEYAEKLERERDASYADLRKMKGKY
                     DAACQEVENKRKKTESSFDKAKAQSAFQQQILEMNNVKNSYLIAINVTNKQKEKYYHE
                     YLPQVMDSLQDLSEFRTLRLNGLWSLAAKLEATMLQQSAGVIDHLSQEITRNQPHLDS
                     MMYIRHNMGTFQEPANKVFEPSPVWHDDGAMIVDETAKIYLRNLLNKSKSQLGELRRE
                     ADKKRREVEAVRRVKEKIRDGTEQKDEVAVVSQLFALQEDLHQVDRKRITVEVEVSTI
                     TSTVGDVTLGAKNHNFKSQTFKIPTNCDLCGERIWGLSAKGFDCRDCGYTCHSKCEMK
                     VPAECPGEQSKEERKKLKQERQEAANALVKPSSGPPEHVAELPGLSRSDTVTSGKSGY
                     AASSQRSMTGPLSPADETPPDVPSATRPTSTAAPSAGAGAARKHRVIAPPPAAYVSEL
                     PGSTPNGSSQASEQQKAKMLYAFEAGGPGELSVPEGRDLVILEPDTGSGWVKVRAGYK
                     EGLVPATYIEITPAAPTAPAAILPQHTGQSTYSNSGSSIGTAAGTSGAKKKGPAVAPR
                     RGAKKLKYVEALYDYAAQSEAEHSMVEGERFVLIKEDPGDGWAEVEKGGVTKSVPASY
                     IQLV"
     gene            1112591..1114959
                     /locus_tag="THITE_2073214"
                     /db_xref="GeneID:11521188"
     mRNA            join(1112591..1112944,1113020..1113591,1113676..1113764,
                     1113839..1114169,1114309..1114959)
                     /locus_tag="THITE_2073214"
                     /product="glycoside hydrolase family 72 protein"
                     /transcript_id="XM_003648724.1"
                     /db_xref="GeneID:11521188"
     CDS             join(1112815..1112944,1113020..1113591,1113676..1113764,
                     1113839..1114169,1114309..1114557)
                     /locus_tag="THITE_2073214"
                     /note="CAZy_ID 269713"
                     /codon_start=1
                     /product="glycoside hydrolase family 72 protein"
                     /protein_id="XP_003648772.1"
                     /db_xref="GeneID:11521188"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="JGIDB:Thite2_2073214"
                     /translation="MRSLTLMPVLATVLSLGTAKPTPTKPEPPSKRASLPTVTMSGNA
                     FWQGKDRFYIRGIDYQPGGSSAMADPLADPNVCKRDIAEFKKLGVNTVRVYITDNSAN
                     HDECMNELADAGIYAIIDANNPLYSLNRLDPGPSYNTLYLQSVFATIDAFIKYDNTLA
                     FFSGNEVINDNVNSTLAAPYVKAVTRDMRQYIKSRNYRSVPVGYSAADVAQNRMQLAH
                     YMNCGTDDERSDFFAFNDYSWCNTNFHESGWDQKVKNFTGYGIAIFLSEYGCITNGRD
                     FGEVKALMSSDMTPVYSGGLMYEYALEDNGYGIVKIDGDKVEEQPEFKKFASALSANP
                     APTGDGGFTSTTKAVACPTKDANWLVDTTLLPAIPENAKKFMTDGAGTGPGLKGSGSQ
                     NAADSGTSAGDAQPGSGAASGSSSSSSENAAAPAGRVALAGIDKAPFVITGLVMLLTL
                     TGTLLL"
     gene            complement(1115008..1116396)
                     /locus_tag="THITE_2106590"
                     /db_xref="GeneID:11517079"
     mRNA            complement(join(1115008..1115515,1115627..1115706,
                     1115812..1116396))
                     /locus_tag="THITE_2106590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648725.1"
                     /db_xref="GeneID:11517079"
     CDS             complement(join(1115166..1115515,1115627..1115706,
                     1115812..1115978))
                     /locus_tag="THITE_2106590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648773.1"
                     /db_xref="GeneID:11517079"
                     /db_xref="JGIDB:Thite2_2106590"
                     /translation="MCGPHVHLALSPSRDTRLSRLRLVAVDEPVLFLSFSYPRHSQNE
                     SVVTNPLFSQVCNLANAASLLWHAYKSLPSPSNQVNWAGFYTRDPLSPPSAPQLILGP
                     FQGKVACQTIAFGRGVCGTAAAAGATQLVRDVARFPGHIACDAASRSEIVVPIVAAGR
                     GVVAIIDVDCAVEDGFDEVDREWLERLAKLLAEACDWP"
     gene            complement(1119130..1122065)
                     /locus_tag="THITE_2106593"
                     /db_xref="GeneID:11521230"
     mRNA            complement(join(1119130..1120686,1120744..1121790,
                     1121860..1122065))
                     /locus_tag="THITE_2106593"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648726.1"
                     /db_xref="GeneID:11521230"
     CDS             complement(join(1119216..1120686,1120744..1121790,
                     1121860..1121948))
                     /locus_tag="THITE_2106593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648774.1"
                     /db_xref="GeneID:11521230"
                     /db_xref="JGIDB:Thite2_2106593"
                     /translation="MEMVIPPRDHGPSTYRYTWDENGEVTQVTRIRDERAFSTERLTP
                     GRQTAQWPFQSVVTDIEIPSPVSPLSQQRRATTHSSWQPYQPNQPYQPYQPYRPPQNS
                     DRRCSEGTDDPPAERDIVPDYVVNFMRGETPETVSRRKRSTSHGSNYRYHSIYGGGVH
                     TVTPQHGVADLVVPLPQDLQQQHRSHVADFEGFHVRDDSLPSLERVDSREGDEQQRFL
                     AAAEELGQKTEGEAQGHGGNSRWWWWRCCRSGGWRAGMALGVLATFIILIAGFVCLVA
                     AISGVALKEGRLLVFEGSCTTADQVNWGLHVVINVFVAVLVAAANYTFQVLSSPTRDE
                     VTAAHRRKEWLDIGVPSLRNLGSIRGSRTLLAVVVLATAASTQIMYNAVIFVSQTAPD
                     FKAAVVGESFVSGAPLSGDVSAINGGLSTADLSALQQLVARNEFVRLSAPACIDQFGG
                     AFEPDYSLVLLISNAKASPLSQTPEGTSLVSDQSSIQYCLAQPAPAPTCAVNLNSSLL
                     GTVALLNSIALVATGAVLFKHSSSFRPLATLGDAISSFLDEPDPETQRACLLSKTDVC
                     QGRWPLTEAKYWEPKHHYWLRSVSFPRWIAALLLWATCVGLATAGLAVSVNNDPAARL
                     SPFGTASPHALALLPAGTPAAAAAVVASLPQLLLALLYFAVNALLATYYLSHESSLFA
                     TRSARPLRVSADPVGAQTTSLYLALPIPISGALASLFATMSFLLSQSFFPVSVQLLNY
                     PLDPANNPTPSSPSSSTITALGLSGTALLALLVLLGLLATAVLALGLRRAPAAAMVNG
                     ELRGNPMALPAGSCSAVISARCHPLARERAGLSGKPVMWGVVREGVGFGVSHCGFTAG
                     RAGLVEAGRNYA"
     gene            1123657..1125333
                     /locus_tag="THITE_2106599"
                     /db_xref="GeneID:11521189"
     mRNA            join(1123657..1124400,1124483..1124625,1124686..1124924,
                     1124984..1125333)
                     /locus_tag="THITE_2106599"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648727.1"
                     /db_xref="GeneID:11521189"
     CDS             join(1124004..1124400,1124483..1124625,1124686..1124924,
                     1124984..1125092)
                     /locus_tag="THITE_2106599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648775.1"
                     /db_xref="GeneID:11521189"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="JGIDB:Thite2_2106599"
                     /translation="MDPYSAEGELINLHSHFHQGQYQEAADYDASALSPENALAARVL
                     QLRARVALGRAEEVLAEVRGAAEPELQAVGALAELALGRADAAAATAEALAKAHGAAN
                     ATVQVLAGTVLQAVGRSEEALALLAQHQGSLDAVALIVQIHLQQNRNDLAVKEVAAAR
                     RWAQDSLLVNLAEAWVGLRLGGEKYQQAFYVFEELAQAPATSSVRTLVSQAVAELHLG
                     RTEEAQAALEQALKKEPENADAIANMLVLSVITGKSPEEWTSALQKADPEHPFLKDLA
                     EKSDLFDKAAAKYKAKAAA"
     gene            <1125705..>1127461
                     /locus_tag="THITE_2037905"
                     /db_xref="GeneID:11517063"
     mRNA            join(<1125705..1127055,1127148..>1127461)
                     /locus_tag="THITE_2037905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648728.1"
                     /db_xref="GeneID:11517063"
     CDS             join(1125705..1127055,1127148..1127461)
                     /locus_tag="THITE_2037905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648776.1"
                     /db_xref="GeneID:11517063"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2037905"
                     /translation="MSSPDQKADPLPVAAEADTDASALEKAPETPPAATATSSSDERE
                     IRGIRWFLICLALYVSALMYGLDTTIAADVQGAVVGTFADDVAQLAWIGAGFPLGSVA
                     AVLPYGFLFTAFNMKWLYVAGIVLFQAGSALCGAAPSMGALVVGRVLAGVGGTGIYLG
                     GLNHFSAMTTRRERSVYLTGTGFVWGVGAILGPVAGGGFSVSPATWRWGFYINLVIGA
                     LTAPIYLFCLPSIDPAPGKSLRERAAALDYLGFVLSAATWVFFAVGFVFAGGRWAWDD
                     GRSITFVVLFGVLLASYTLQQYFCIFTTPDTRSFPGHLLRSRTQVLLYITTSCANAAM
                     FFTTFYIPIYFQFTRSDDSLMAAVRLLPFLLVLITFNLATGWALPKIGYYMPVCLVSG
                     AIMTLAAALFLGYLSPTTPPAYIYGFSVLMGVGSGITMQLGYAVASLKVSRPADVFGA
                     INMQNIAQIGATVICLVVAGQAFQTSAVRNLDAALAGRGYSRAQLQAMVSGTESALFD
                     SLSGELRAKVIDAVVAAMRRAFVIPLVAGAVSIVSAVLMRRERLFA"
     gene            1129060..1131598
                     /locus_tag="THITE_2106603"
                     /db_xref="GeneID:11517354"
     mRNA            join(1129060..1129176,1129261..1129414,1129479..1129964,
                     1130114..1131598)
                     /locus_tag="THITE_2106603"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648729.1"
                     /db_xref="GeneID:11517354"
     CDS             join(1129356..1129414,1129479..1129964,1130114..1131350)
                     /locus_tag="THITE_2106603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648777.1"
                     /db_xref="GeneID:11517354"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2106603"
                     /translation="MPQREVLDFLVQYHIRELNWIKLVIHETTFLYRYQQWWANHDAH
                     SVADVEFAVLILRICTYALQFLPSQTPNHAGDTIHGMSRGDILRACTDVADSLARACV
                     LLDAKGLLVRVQHLLYAALRASCEGRTDQFWDGVVSACRAALRAGIHMDGGAPATACY
                     GGGEMERELNRRTFCGLYVLDSHLARQLDRTPILPDDLITTNLPQMRFIPDLARPPPE
                     TSTSASTSTSTLPPTPAPDPITERVLQAQLGLFWRRHPPNPKPSPSNDGTAKTACPYD
                     PAAAERRHEAFVTTYLAALPACFALAAPDPDPSMAPPRLALQRRLLQIAIYDSVCWNH
                     RGLLVLLQQQKQQQQQQGVVGGEEGEKGERQRHHRLRLPAYKRVLLRVQKRRMARAAM
                     RELVAVRELHALFGGGGVQTRFAAIIFNSFEAATVLLLLLCLCGGEPDGLFDVGEGKG
                     EGEGQGEGEGGEDAEVDAGDEILGLRWDADGGRLTREGMLRAAEEALERLRALAGVSE
                     MAAAGVEVVASLLERAKKGAEADQTSRELPGGASATPVWTIPPPEDSDLDELPDWMSR
                     SAFGSVMPGDPNSFFGLQLHNSGFLLF"
     gene            1133634..1137756
                     /locus_tag="THITE_2106608"
                     /db_xref="GeneID:11517664"
     mRNA            join(1133634..1133987,1134057..1134101,1134211..1136485,
                     1136573..1137327,1137437..1137756)
                     /locus_tag="THITE_2106608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648730.1"
                     /db_xref="GeneID:11517664"
     CDS             join(1133820..1133987,1134057..1134101,1134211..1136485,
                     1136573..1137327,1137437..1137661)
                     /locus_tag="THITE_2106608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648778.1"
                     /db_xref="GeneID:11517664"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="JGIDB:Thite2_2106608"
                     /translation="MIRILPSRLKPVCSNSSAANSTPNSRSSSPMRNKGDTPSPEGRP
                     DNGLALNVVILRARNLAAKDRGGTSDPYLVLTLGDAKHITHTESKTLNPEWSEQCQLP
                     VSGVQSLILDVCCWDKDRFGKDYLGEFDLALEEIFADGKVEQPPRWYPLKSKRPGKKT
                     SVVSGEVLLQFTLLDSTNRLATHEQIFDKFVALVKSAPGADVSRNPTPSRTPVLAPVA
                     KGKTPSPPPPLGERRENDNDEEDEYDVYEDETPEDEDPTKPESAEKRRRRLRIKGLKR
                     KKRENPYEFTNGGSDVVGIIFLEISNITDLPPESNLTKTSFDMDPFVVASLGKKTYRT
                     KTIRHNLNPVFNEKMIFQVLNHEQSYSFSFTVIDHDKYSGNDFIASVNFPVKDLIEKA
                     PKADPETGLYNLRDVPEYSAPVQRPRFMRLGLSRTPSSQSLSKLARPGISKSSSASSS
                     AALTATAPASTPTASQLPADAIPEGAQPAVPSTGVLQPGDNAVAAAASTLGETTPSDG
                     EDSDFLPYTLPLKMKNQEKWEAKHNPVLTIRAKYMPYPALRQQFWRAMLKQYDTDESG
                     RISKVELTTMLDTLGSTLRESTIDSFFQRFPHKASDSDDAADLTVDEAVICLEDQLQA
                     KSRPPGVADRMKNLLPDADKVKNLVPIPGVSGKGGAGGAETPAETTETPSELQTTDSS
                     TVAVPELGTPGEEGDLLDRDDLNISTAEEHVVEIRECPICHQPRLNKRKDADIITHIA
                     TCASQDWRQVNNLMMGGFVTSSQAQRKWYSKVITKISYGGYKLGANSANILVQDRITG
                     QINEEKMNVYVRLGIRLLYKGLKSNNMETKRIRKLLKSLSIKQGKKYDDPASKAEIPK
                     FIAFHGLDMSEVLLPLDEFKNFNEFFYRALKPGSRPCSAPNNPRIIVSPADCRSVVFN
                     RIETATQVWIKGREFSVRRLLGNAYPEDVARYENGGALGIFRLAPQDYHRFHVPVDGI
                     MRQPRTIAGEYYTVNPMAIRSALDVYGENVRVLVPIDSPEFGRVMVICVGAMMVGSTV
                     ITRTEGEEVRRAEELGYFKFGGSTIVLLFESGKMVFDDDLVDNSNTALETLIRAGMSV
                     GHAPSEPQWTPDMRKDEDQITAADKAEARRRIQGQVSASDAADAAATDAAGAAGGEEE
                     SSLEDSGSG"
     gene            complement(1138167..1139568)
                     /locus_tag="THITE_107962"
                     /db_xref="GeneID:11517633"
     mRNA            complement(1138167..1139568)
                     /locus_tag="THITE_107962"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648731.1"
                     /db_xref="GeneID:11517633"
     CDS             complement(1139118..1139372)
                     /locus_tag="THITE_107962"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648779.1"
                     /db_xref="GeneID:11517633"
                     /db_xref="JGIDB:Thite2_107962"
                     /translation="MAPTYTMSAHLCKQIYSSWRQTRQSSPEPHPLPSPPASTASTAS
                     YLPRSPSPEKQSLDSERGEASHPPLTRQSSLGSSWRWGSR"
     gene            complement(<1140403..>1141106)
                     /locus_tag="THITE_2038503"
                     /db_xref="GeneID:11516873"
     mRNA            complement(join(<1140403..1140767,1140785..>1141106))
                     /locus_tag="THITE_2038503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648732.1"
                     /db_xref="GeneID:11516873"
     CDS             complement(join(1140403..1140767,1140785..1141106))
                     /locus_tag="THITE_2038503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648780.1"
                     /db_xref="GeneID:11516873"
                     /db_xref="JGIDB:Thite2_2038503"
                     /translation="MILEALVQQKHPGSASLASVCQEWHLVHYIRLEIELPRYTWRCC
                     GRDVSVTVAKHNSSIVSEGIWKLFHVLSSWNSEGQTCIASGFALELNVYCLSYSKHWF
                     KTSIPNARSEDDDSNWHDPPHGWVNGRQVFLPPASAIPRLFGKIWIDIQKELPEADSV
                     TRPIVRRQLRHTPYPSDFQAVLEQLSALEQPIFEPWRRWENTWRVIQGGRRRFATMPL
                     RTRPQISGYL"
     gene            complement(1142078..>1144812)
                     /locus_tag="THITE_2073219"
                     /db_xref="GeneID:11516723"
     mRNA            complement(join(1142078..1144442,1144500..1144569,
                     1144632..>1144812))
                     /locus_tag="THITE_2073219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648733.1"
                     /db_xref="GeneID:11516723"
     CDS             complement(join(1142543..1144442,1144500..1144569,
                     1144632..1144812))
                     /locus_tag="THITE_2073219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648781.1"
                     /db_xref="GeneID:11516723"
                     /db_xref="JGIDB:Thite2_2073219"
                     /translation="MLVKAMLVKTQARRVLGRPRSLLPAILVFLVVCWLGLVHHDSVN
                     QRLAFEGRPQSLDRDPDERRDRELQAQRRLFEEEHRQLEKKPGLGAIYGQTLETLVDN
                     HTRTEEQEARLGSSNATISSKPQPVTFNPYPKYNSPEWNEHHAPYVPCVGPTGRIVED
                     IRVYKGLPRDFPKPGFGSYSVLGLDGTLCFERETRLGQYGLSPLMDKNGQEINWDNVR
                     WGDLQESCLERNRARFARSGPKNTYVNQDVDSSADLKRDATPGSIKHPLGRLWRRSSP
                     QASKWLRDEPSAGADQSDESNNATAKYEPRTALLLRSFSGKTYTENDKQVIRSLITEL
                     SLRTGGEYQVFLFVHIRENDRDITAEEAYQKAVEEHVPAEFRSIALLWNEPAVDLQYP
                     ALTEKARRVHNGQFLSVQMFMQEYREFDFVWNWEMDSRVIGQHYDVLTRLGEWARKQP
                     RRGIWERNERFYIPSVHGDYDTQFRASVEAAVGGETIWGAPDVPVVKPLGPKPPVATA
                     AEDNYEWGVGEEADLIELAPLFNPVNSGWVMRNQVWGYRSRTFPWGKLPRRATIVTQS
                     RLSRRLLDVMHTEDMRGNHVASEMVAQTTALLHGFKAVYAPMPVFFDRAWSGEQLAKW
                     FNGGPNGQSGSFGSAMGWGQEGRYLGSTWYYRALPPQRLYNNWMGYEDTGIGGADWEA
                     EHGRPCLPAMILHPIKEIKPTEKGYSTDSRLPYD"
     gene            complement(<1148690..1151150)
                     /locus_tag="THITE_2106614"
                     /db_xref="GeneID:11515863"
     mRNA            complement(join(<1148690..1150749,1150804..1150920,
                     1150977..1151150))
                     /locus_tag="THITE_2106614"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648734.1"
                     /db_xref="GeneID:11515863"
     CDS             complement(<1148851..1149787)
                     /locus_tag="THITE_2106614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648782.1"
                     /db_xref="GeneID:11515863"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="JGIDB:Thite2_2106614"
                     /translation="MDEMKPKPRPVPPLKLPPRGPFANDRPSPLSARPPRSGERGYDP
                     RIDPAVQNPRYARGRAAPPSPSVNRPPQEGLTVQTPSDVLSPSTAGLSSPRWTSSPER
                     IPDAQQRSPPQEQRQPRERSRSRPRDATSQPSRGNCKACGLPIKGKSISSADGRLTGR
                     YHKPCFVCHTCQEPFSSATFYVLDDKPYCELHYHKLNGSLCGSCGRGIEGQYLEDESA
                     VKHHVGCFKCGECGMALRDGYFEVNGKAYCEKDAWRLVQQPWMAGGGGGSSLRPPHPG
                     LPGGPRGAPGGGYHPSRLGPPGPRPRMEKRMTRLGM"
     gene            1155752..1158283
                     /locus_tag="THITE_2169187"
                     /db_xref="GeneID:11515641"
     mRNA            join(1155752..1156800,1156883..1157485,1157571..1158283)
                     /locus_tag="THITE_2169187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648735.1"
                     /db_xref="GeneID:11515641"
     CDS             join(1156058..1156800,1156883..1157485,1157571..1157874)
                     /locus_tag="THITE_2169187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648783.1"
                     /db_xref="GeneID:11515641"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="JGIDB:Thite2_2169187"
                     /translation="MAPHAETDAGSANGGGHYHANGIGNGHGNGSASATRPKFVVNSP
                     NVVYTDSEIRSKYTYRTTKVTEGADGTRVVTPVETVYDFKVDTKVPKLGVMLVGWGGN
                     NGTTVTAGIIANRRGLVWETRNGRQAANYYGSVVMGSTLKLGTDSKTLEDVNIPFHDI
                     LPMVHPNDIVIGGWDINGMNLADAMDRAKVLEPSLKALVRKEMAAMVPLPSIYYPDFI
                     AANQEDRADNLIPGSKACLAHVEQIRKDIRDFKAANNLDKVIVQWTANTERYADIIPG
                     VNDTADNLLKAIENGHEEVAPSTVFAVACILEGAPFINGSPQNTFVPGAIELAERHGA
                     FIGGDDFKSGQTKMKSALVDFLINAGLKLKSIASYNHLGNNDGKNLSSQRQFRSKEIS
                     KSNVVDDMVAANTVLYGKDEHPDHVVVIKYIPAVGDSKRALDEYFAEIFLGGHQTISM
                     SNICEDSLLASPLIIDLVVITELMTRIQWRLHSDGDNGKFKSFHSVLSVLSYMLKAPL
                     TPPGTPVVNALAKQRAALANIFRACVGLEPESDMTLEHKLL"
     gene            complement(1159360..1162539)
                     /locus_tag="THITE_2106626"
                     /db_xref="GeneID:11521185"
     mRNA            complement(join(1159360..1159958,1160048..1161766,
                     1162199..1162539))
                     /locus_tag="THITE_2106626"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648736.1"
                     /db_xref="GeneID:11521185"
     CDS             complement(join(1159878..1159958,1160048..1161703))
                     /locus_tag="THITE_2106626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648784.1"
                     /db_xref="GeneID:11521185"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2106626"
                     /translation="MTIHSRWSVPIPRCSLQQWIFGSACGPVSDHKAFIDPDNPDTNF
                     LTMANYRLLAKRVALGLRKAGLKRGDRVLIFSGNSLIFPCVFLGVLMAGGIVSGANPA
                     FVPRELAYQLKDSEASFLFVAAPSITTAFAAAAEAGLPRDHIFVLGNDTLPVPHLALF
                     AQPAPGVKGRIDGARHWTELLAGNRLEAVSWSWQEPDNPEETTCCLNYSSGTTGVPKG
                     VEISHHSYVANGVGVVHINRLRPDFAEKIQNDRGLAFLPFYHAYGQTYFIANLPHLGV
                     PVYVMPAFDFLKMLAHIQRFRITTLPVVPPIVVRLAKDPNTKDYDLSSLESIGSGAAP
                     LTREVCEEVERRFPGRDMYVRQGWGMTEVTCTAMSWDPTRVGPSAGVGELLPNCSARL
                     MSLDGQTPVTKAGERGELWVTGPTLMRRYWRKPEATSDAIVVDADGTRWLKTGDVAFV
                     DRYQPGAIFHVVDRVKELIKVKGNQVAPAELEGLLLESPDVADAAVIGVTIRGEELPR
                     AYVVRKPGSKASENDIARWLRDKVAAYKHLRGGVVFVDQIPKNPSGKILRKVLRERAQ
                     NEVSDGARKPKI"
     gene            1163776..1164753
                     /locus_tag="THITE_2106627"
                     /db_xref="GeneID:11517520"
     mRNA            1163776..1164753
                     /locus_tag="THITE_2106627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648737.1"
                     /db_xref="GeneID:11517520"
     CDS             1164291..1164653
                     /locus_tag="THITE_2106627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648785.1"
                     /db_xref="GeneID:11517520"
                     /db_xref="JGIDB:Thite2_2106627"
                     /translation="MMRLWAWHRPGTAADYASVVVPLDEAHQHSHSYRLRRRSDPAGQ
                     LDDDAFEEEDHGGRDKDGDDEDTGMLMSGAAAEYSIEGLRREVRRGGRGEKWTAYESE
                     FLSSPWLPVSPLVWCVGS"
     gene            1164720..1166373
                     /locus_tag="THITE_2106628"
                     /db_xref="GeneID:11516702"
     mRNA            join(1164720..1164837,1164909..1166373)
                     /locus_tag="THITE_2106628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648738.1"
                     /db_xref="GeneID:11516702"
     CDS             join(1164832..1164837,1164909..1166234)
                     /locus_tag="THITE_2106628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648786.1"
                     /db_xref="GeneID:11516702"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2106628"
                     /translation="MQGVSLTLPSLSAEFGISEKSVRYTTSSLFIGLCLGSFFWGIGS
                     DIMGRRIAFNLTLLITSVFGTAAAWASSWGGVCLMYAALGFGVGGNLPVDGALFLEFL
                     PDASSSLLTLLSVWWPVGQLCSSLFAWYFIARWPADEGWRNFVLTIGIITFAMFLVRF
                     FLFQMFESPKYLLSRGRQAEAVAVVQGIAFKNGRRTWLTEEVLDAVVDDASPRARSRL
                     STTNIIKNRLASFSAERIRPLFSNPKLGLTTSLIWFCWATIGMGYPLFNAFLPQYLSH
                     GGDSGAVLASEMTGETYRNYAITSVVGVPGSLLAAYSVDMKSPFLGRRGTLAISTLVS
                     AIFLFLFVQLGTSPSSQLLFSCVEAFAQNIMYGVLYAFTPEIFPAPVRGAGTGVASFL
                     NRATGLLAPIIAATVPGDGTTTPVYLSAALILAAFVGICMVPIETRGRQRL"
     gene            complement(1166309..1167866)
                     /locus_tag="THITE_2106630"
                     /db_xref="GeneID:11521700"
     mRNA            complement(join(1166309..1167450,1167565..1167866))
                     /locus_tag="THITE_2106630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648739.1"
                     /db_xref="GeneID:11521700"
     CDS             complement(join(1166383..1167450,1167565..1167609))
                     /locus_tag="THITE_2106630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648787.1"
                     /db_xref="GeneID:11521700"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="JGIDB:Thite2_2106630"
                     /translation="MSAFISLLGWSFLPGLVTSWTQSLYYNITIRAGDPKPQPGTPRF
                     AEHRRRIHILVVALYLLYTIYEADYEVQRAGSFYADLGVPLNATEREIKSRFRRLAAV
                     YHPDKAAGSPNAAADVNAYFVHLQTAADTLSDPARRFAYERFGPDVLSWTPRCVTVRD
                     FVARGAQALVPYYGAAAAVLYGLGFLGYLEWGRFERWLVLAALFLFEAHCVTRPAPPA
                     VLDRVVNPLLVWLSRGRRPPYLQFQAIALARKLSVTVYIAFSQIGPLLTADTSGGQVV
                     TGGRKGADDEAALRQGLERLEKTVRLLDADAARLLEMEMVPFAGDEETRKSMWAKVKE
                     WLVQNTIRADPMVRDALGRSLAKRRMNAPAGARGTK"
     gene            1167890..1167971
                     /locus_tag="THITE_t1"
                     /db_xref="GeneID:11521678"
     tRNA            1167890..1167971
                     /locus_tag="THITE_t1"
                     /product="tRNA-Ser"
                     /note="Anticodon: AGA"
                     /anticodon=(pos:1167924..1167926,aa:Ser,seq:aga)
                     /db_xref="GeneID:11521678"
     gene            complement(<1168343..>1169104)
                     /locus_tag="THITE_2039513"
                     /db_xref="GeneID:11516601"
     mRNA            complement(<1168343..>1169104)
                     /locus_tag="THITE_2039513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648740.1"
                     /db_xref="GeneID:11516601"
     CDS             complement(1168343..1169104)
                     /locus_tag="THITE_2039513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648788.1"
                     /db_xref="GeneID:11516601"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="JGIDB:Thite2_2039513"
                     /translation="MSEFVADDEIQYPSGFGLGDVVGWGTTGMVVLDKSSNTVVKVPF
                     DHNNEECILRMQRERDVYERFTQCGGHEGLLSYHGVFESGIRLEYAPHHNLRLHLGAS
                     NISPAQQLRWAIQIAEAIKFVHDAGVIHGDLTCANIFLDAYLNAKVADFAGPSIDGSP
                     LLVVVTESHEIPGPRLSVQADLFALGSVLYEIMTGHPPYEGLDDAAIRALYLNRKFPE
                     TASLGAIGTIIEQCWQGNYSGAEAVVEKLRGIASI"
     gene            1170287..1171791
                     /locus_tag="THITE_2106633"
                     /db_xref="GeneID:11521657"
     mRNA            join(1170287..1170844,1170898..1171791)
                     /locus_tag="THITE_2106633"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648741.1"
                     /db_xref="GeneID:11521657"
     CDS             join(1170461..1170844,1170898..1171422)
                     /locus_tag="THITE_2106633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648789.1"
                     /db_xref="GeneID:11521657"
                     /db_xref="JGIDB:Thite2_2106633"
                     /translation="MGNAPEAKVKPQWLTYMDEFAVQDDVDAVEKETLVFIRELLLAP
                     DTDEHATERAIQAVQAYYREMYCPPDDPYWKQDPGYGVLQVIGSIVPHVFALVEHIPF
                     DDVRHKRLADLLLGLKEQAVQEFNPEDPQLGWDPRPLDEMAYDDWNAMHCASTLFPPL
                     CYCPDTDNNGCASAFPNDPMDRCNRTLSVYTLLARLTPIMGGKSGYWAVTDVVEGLEE
                     PASPRSTPLVLNAAAVIATQFVQFAGEVLVRLVDDAKWRTWAAKLKNIADNPPADAEW
                     DLQKHARKAYERMTELRPDLFQEVSN"
     gene            1172066..1172152
                     /locus_tag="THITE_t2"
                     /db_xref="GeneID:11523465"
     tRNA            1172066..1172152
                     /locus_tag="THITE_t2"
                     /product="tRNA-Lys"
                     /note="Anticodon: CTT"
                     /anticodon=(pos:1172099..1172101,aa:Lys,seq:ctt)
                     /db_xref="GeneID:11523465"
     gene            1172413..1173163
                     /locus_tag="THITE_2106635"
                     /db_xref="GeneID:11516587"
     mRNA            1172413..1173163
                     /locus_tag="THITE_2106635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648742.1"
                     /db_xref="GeneID:11516587"
     CDS             1172544..1173047
                     /locus_tag="THITE_2106635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648790.1"
                     /db_xref="GeneID:11516587"
                     /db_xref="JGIDB:Thite2_2106635"
                     /translation="MEDRRHDPLVVSEALEYCLQSWRVAPTADSCRYLTPLLLANGGP
                     GLLKKGASGHHNDSPPALSVRDFPACSRSSRRPSAIREQHYKGKQRRSCQPPCASNPQ
                     TWWRTQIGQHWTTPDAADPTFQHYRSVADYGADSSGKEDVSDAPRRGRLNHLPRKYLG
                     LGSRPRA"
     gene            1173621..1174501
                     /locus_tag="THITE_2106637"
                     /db_xref="GeneID:11521650"
     mRNA            join(1173621..1173720,1173865..1174065,1174141..1174501)
                     /locus_tag="THITE_2106637"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648743.1"
                     /db_xref="GeneID:11521650"
     CDS             join(1173705..1173720,1173865..1174065,1174141..1174304)
                     /locus_tag="THITE_2106637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648791.1"
                     /db_xref="GeneID:11521650"
                     /db_xref="InterPro:IPR003033"
                     /db_xref="JGIDB:Thite2_2106637"
                     /translation="MSLKNDKFPASAAFDEINKALNANEADRKDAIKQGNAVFAFVLK
                     NAAGETESWHIDLKNKGAVGKGTGENPNVTLSLSDSDFGNLVAGKANAQRLFMSGKLK
                     IKGDVMKATKLDPILKKAQTKAKL"
     gene            <1176117..1180625
                     /locus_tag="THITE_2061620"
                     /db_xref="GeneID:11523414"
     mRNA            join(<1176117..1177838,1179477..1179630,1179690..1180625)
                     /locus_tag="THITE_2061620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648744.1"
                     /db_xref="GeneID:11523414"
     CDS             join(1176117..1177838,1179477..1179630,1179690..1180243)
                     /locus_tag="THITE_2061620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648792.1"
                     /db_xref="GeneID:11523414"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="JGIDB:Thite2_2061620"
                     /translation="MDPPSKKRGFLGFTGLFRSSPAPAADSDANSDAPSKAPAPAPSQ
                     REFGSASAPHSPMKRASESQLASRKIIGRPQGPSSKLSQSISASDIAHRPSAAAVATP
                     RRMPGDNPNKPPPSLFSASAAAHAPAHVPKSTSFSGVTSTPRNIFRSSALYSRPAHST
                     FSPRVPANTLTQSFPPTTPGKPPRGSTADVNGRILANTSSSELFTMRIPSPPRHLTGE
                     MLAKEVPDDPNRSGSIYADEFLAHYCPPDLDEHQRRQFFCILDLRRLKYAADEVFTKK
                     DWKINILNFAKEYEKSRSLIMLRYGLYEFKTVRPSEAVKREWKQKHGIPDSDEESDVV
                     PKTNGTAKRKAEEDLAPSSTLMASVSGANKRARAPETSSKNKRKADAEPDENHPAKLQ
                     KPVLEKAAPTPQKPPSATKSMFESIANNAQSTSFAKPAGKSLFASSTAAKPTVFDAAP
                     KPAAATSNIFSHLSDESKGSGNEGADEESETSSNAEEDQSEAQDASQSDDHAASGGVS
                     TPQFGDVKRTTTNGTSNLSSDGESTQGRSIFERITRGSDGQPIRKLPPGDGTPFAALT
                     AKERSASPSSSFGATPGPIFNFGGSSQTSGAPVFSQQPPAATSFFGNSLAPGGGTSTG
                     TNSPFTFGGASSLATTPAATTPEPSAKAEDGQETNADGDEAPQEQISLTDGGPGEEDE
                     SAVHEVRTKALKLVTDAGSDEESGANADKAKSKNSWKVQGLGPLRILKNKTTGAVRML
                     LRAEPRGHIALNKTVLPDFTYKADNKYVKVTTASDDGKGLETWILQVKTAAAAEALAA
                     ALEEHKKANKK"
     gene            complement(1181534..1183057)
                     /locus_tag="THITE_2106645"
                     /db_xref="GeneID:11523460"
     mRNA            complement(join(1181534..1181976,1182048..1182431,
                     1182558..1183057))
                     /locus_tag="THITE_2106645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648745.1"
                     /db_xref="GeneID:11523460"
     CDS             complement(join(1181867..1181976,1182048..1182431,
                     1182558..1182963))
                     /locus_tag="THITE_2106645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648793.1"
                     /db_xref="GeneID:11523460"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="JGIDB:Thite2_2106645"
                     /translation="MAQRPLPPSPAPAAAAYSNLSYFRVTTPAPFVAHVEIHRPAKLN
                     TFIEAMWLELRRVFRQLSGDADVRAVVLSGAGERAFTAGLDVTAASESGLLLSPAAGE
                     AGSGEDGARRAARLRRHIAEMQECISAVERCEKPVICVMHGISIGLAIDIAACADIRV
                     CAKDTRFAVKEVDIGLAADLGTLARLPKAVGSQSWVKDVCLSARDFDAAEALSVGFVS
                     QVHESKAAALAAAFKTAAFIASKSPVAVQGTKELLNHSRDHTVEDNLRYTGVWNAAAL
                     QTSDVAAALTSGLERRKPTFEKL"
     gene            1185105..1188497
                     /locus_tag="THITE_2106649"
                     /db_xref="GeneID:11521684"
     mRNA            join(1185105..1185296,1185439..1185582,1185641..1188497)
                     /locus_tag="THITE_2106649"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648746.1"
                     /db_xref="GeneID:11521684"
     CDS             join(1185242..1185296,1185439..1185582,1185641..1188351)
                     /locus_tag="THITE_2106649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648794.1"
                     /db_xref="GeneID:11521684"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="JGIDB:Thite2_2106649"
                     /translation="MAAPNPNRPEVGDILIVIHDFQARSSDELTLAKGDRVELLERDD
                     EFGDGWFLGKHTVNGNSGLFPEVYTRPAPKAATHAPVLSPPKQPLTPLAEAAKEQKTA
                     AASQPAEETRSAPEPDSKPGPAALPLSSFKSPIPPTSPAPPSASSAPAVVGSGPSSTA
                     RPNTSTDSHVLHETLTVINEHITDFNTAQGSASLRNGNDSSSEYSSQLDHRISYIQGE
                     ETDEEEETVHTRQEVESWSADQVAEYLFTAGVEKQHCEVFRDQEITGEVILGMDQTSL
                     FIKALDLGSVGRRLKTWQKIKQLQDQVNGQAPSTGRNTQTYGSDAGSDAGRVRSRTNT
                     ITSSGPRLSPLNEASLSAMAHRQSQTQKPGPYEPVSPVSPLVDSPTRTFHDKRPSAAS
                     VRDLHHSRRHSSNDYRLTGTTLNTPSISSPKPPMSGALARPAVSHKKQPSFDRNWTLG
                     SATAQASRPLSSAGLQDGLSGQVADLQDSAVELDRGYFSGPDADSRRRNVLKKRDSMQ
                     ASPRPSYAEEQRVRSATALSRHSRLGSTDSVRDSPLSPAAQKYYGVAKRSPSAATADS
                     FRHISGSKEAAPPTVTRLDSNSSNQSQSSPKSAIKRLSQVNHPDFNVSVMLRSGFGGL
                     RAASDAVTGSERAKVSPVDPPSKESPMYSPARTGSSTPSGGASFDLDSPDARKSPSTV
                     ATPASRSSRKKTKQETSAYTRGLQKISPQEAMKDADYSGWMKKRSANLMATWKPRLFV
                     LKGRRLAYYYSEDDEQERGLIDISFHRVLPADNERLTGLHATLTGASSTPAMPAGSHI
                     TTSAAADAERDPAKESDSIFIFKLVPPRAGLSRAVNFTKPTVHYFAVPNIKQGRLWMA
                     ALMKATIDRDDTQPITTTYQQKTISLAKARQMRHRPPALMNLDEPDDAGSEKKGSAGG
                     GKDSNGLGIVYGEVDSAIAGLEKFGLQQHPESARPGGFGGGLGSEKDTSLLPQSA"
     gene            complement(<1189097..>1190394)
                     /locus_tag="THITE_2140739"
                     /db_xref="GeneID:11521661"
     mRNA            complement(join(<1189097..1189208,1189343..1189768,
                     1189820..>1190394))
                     /locus_tag="THITE_2140739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648747.1"
                     /db_xref="GeneID:11521661"
     CDS             complement(join(1189097..1189208,1189343..1189768,
                     1189820..1190394))
                     /locus_tag="THITE_2140739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648795.1"
                     /db_xref="GeneID:11521661"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2140739"
                     /translation="MSGLLKLLFTRLTLPPAAAIAGKTVLITGANTGLGREAARHAAS
                     LGADTIIMGVRSVAKGEAAKADIESSLAAASTGTTTTTTTTRFLIWPLDMASFASVRA
                     FAARVRQHVHDDHGRLDIAILNAGIASSNFTATPDGWETSLQVNVLSTALLALHLLPL
                     LQRRASNNQPEHRPHLTILTSDIHATARFAERSNTPILTALNDRAQWARSQTTAGAAE
                     RYAVTKLLDLFLAQALAHHTTAQKGGTATTGEEGVAGAGAGVVVINAVAPGFCKSELL
                     TREQSSSAAPPPLALLLLRVVQALVARPVAEGSKTLVHAATAGVGSHGAYLDHQAIAS
                     PGGLAAGAEAAGLRDKLWAEIIAVLREVDPDVVAGF"
     gene            <1191217..>1194013
                     /locus_tag="THITE_2083982"
                     /db_xref="GeneID:11523536"
     mRNA            join(<1191217..1192325,1192351..1192546,1192621..1192653,
                     1192722..1192837,1192912..>1194013)
                     /locus_tag="THITE_2083982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648748.1"
                     /db_xref="GeneID:11523536"
     CDS             join(1191217..1192325,1192351..1192546,1192621..1192653,
                     1192722..1192837,1192912..1194013)
                     /locus_tag="THITE_2083982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648796.1"
                     /db_xref="GeneID:11523536"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2083982"
                     /translation="MLGLTATAETSALACVPCARSKARCDRKVPCTRCVLKKLTCRAR
                     VSKRRGAKDSPNINNAQATRFQVDNDGSGRGTRETTHGIWMDWSLRFDAVRTVSQSSQ
                     GLAQAGPRGNYGSQFLAQLVSAAAAAADDAGTSLSQFLPTPADLQHFIAPNFSLAPCL
                     GAGMNVDSSPDALLASLAPCLGAGMNVDSSPDALLASLSHGEATDGHVPAASTLPRRM
                     EPPSVDSETEALESWPLFRCNPAAPSSSSTSNPTGPSQVKKLSALLRDVSMSTTTNTA
                     RPSGSSTAVEPLLAGTRETLTAVLQGLFHEAQQLYGFQSSPDDGLDVLTLPPPSEMDF
                     LLRAAVDCYAPHYPAALLTAVEVNERIGANRATATLWPSAPWRPAPPGRILRLPSAVD
                     ICRISLHKLVERNVQLASDPEFMQCALLLVIAMVWSGDKRLMEMGMYHKAMYLEMHLR
                     ASLHASRDDQLARLDTSADAPHRCEILKSQGMLNRATYSWLVLDYELRLFQDTPATSF
                     LSVANLDLPMPSFDVALSAASPGDSAPNAGQHTLNVARSIKDWVARFTDANDTSTMGH
                     VSPHTLRILLCHLADQVLHLRSRIDGLCSTGNQTHHHLRRRSRRNDTPTAALLSMQMR
                     EVQGLLKKWFDLAETRRRGPPGGDTDTSTAVAAAHRANAVIYHLTMLSTMVSFPEIER
                     LARRGPDDARAAEAARAHTHHQPHHHHHLDPDDAREIAVHCGQALRSLRGLTASPSGP
                     SPAPPLWWAAAVYRAVLVAWANSANMMMMSQGGSSPAAGSLLRVQLDALPARYDAAVL
                     SDPDPATGEAVSLAEPKAILRYGVRLLELGVQSAFAQGVRLRLMAMARRWEDV"
     gene            1194459..1198764
                     /locus_tag="THITE_2106651"
                     /db_xref="GeneID:11523535"
     mRNA            join(1194459..1197404,1197465..1198764)
                     /locus_tag="THITE_2106651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648749.1"
                     /db_xref="GeneID:11523535"
     CDS             join(1194804..1197404,1197465..1198421)
                     /locus_tag="THITE_2106651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648797.1"
                     /db_xref="GeneID:11523535"
                     /db_xref="JGIDB:Thite2_2106651"
                     /translation="MSNRLFNFSTTSDTSTTNPTLPRLPSTPDRHSRTNTGASPNKQP
                     DRDDPFRSSAAATHRSTTPAGPPPSRPPVSSVGSFTPAGAPSASYLGSSIMRGVTASG
                     GGAGSSGAGGQGKTEDMTPPPVGLFTGIGGGFAGGAGFTGGMGVGVKGKGNLFAAMGN
                     GGSGGRRRNNTPLGRSVLTAQQPRKPSRLSRAVVVDELDHLRRATEDNVRTFGVPVDD
                     DDDDEGGEGAEGEEGNGEEREEVEGDEEGDMWLDMPAERQDAGDDPGDDPGELPDTGD
                     ASDLLMLATPAATERVRREAEDIYRASAMQTGGAARRREFRFAAIAKDAYYQLGTAPL
                     TEPPQIILGTENLVARLYDEGVAEAEDEERMDDTLATVAGKLTGLWNSYLDQLPRPTE
                     EHAAEIGPGPHATPFEKANYLANLALQIHHTRYEEGGLARAEPLPETLFRWLDEYHDM
                     YGNQVDDILRYRPSPACHSLFWQAVFIALLRGKVGDAARLLRQAGWGHVRRGQRGEYA
                     YVGRALENVQRAAEETIAVLENCPGYEGNWEIWSSDWTLFRVRARGALEHLRRFAEGK
                     EGAFGDSAFSASAGSARGKQSLTGLARRAESQVPWEIYENLNIVFDIVLGQKDAILEA
                     AQDWLEATVGLFGWWDEPKPSEERPFSMAQSRSRSQALVLASAQPAADTESYLDRLAR
                     AFHAAVESDFHFNSQNPVEIGMACVFEDNIKAVIGLLRGWSLPVAAAVAEIASLGKWL
                     PPHNPAGIYGLEDLDMDDLEVLGMDPGAPDEVDGIKDSTLVQYAQALADCDGLSAVKD
                     KSGVSRDGWELSIGVLGRMDSPERSDEMARDLVQHLVQELRVDSNEMVDRLWTLLNEL
                     GMIEYAQDTAETYGDILARDSHRYGEAMWYYALAHRPNKVREVMNLLISYSLIQSTAF
                     PPMADLDEYLRKLLTDRKNTLEQCANQDMEAAELLGKMLSGYASLRQFYEIRDNEQAL
                     PHATPQARRQQAAAALVSVIASSDDNIRGGLFDQTRDGIVSEDFLLALLGEALVFVSD
                     PDDPSAVHPTHGQHAAAISLDQIDVMLKAVEDLQAVGSRVYNACDEFLQLVLASAPGG
                     LKGSTPADLLKKSGGGGAGGGSSNFVLAGSSRVASQLQKSLSGSGGALGKVPVKRGWD
                     WRTLVTARTKGEDIIRRLRLGLARDLASLWVAEADAMAW"
     gene            complement(<1199185..>1199693)
                     /locus_tag="THITE_2012900"
                     /db_xref="GeneID:11523514"
     mRNA            complement(join(<1199185..1199424,1199559..>1199693))
                     /locus_tag="THITE_2012900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648750.1"
                     /db_xref="GeneID:11523514"
     CDS             complement(join(<1199185..1199424,1199559..>1199693))
                     /locus_tag="THITE_2012900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648798.1"
                     /db_xref="GeneID:11523514"
                     /db_xref="JGIDB:Thite2_2012900"
                     /translation="PPPSPLPDFVYKITPTAPPDPIPEEYPPSDLDRQDGFIHLSTSW
                     QLPITADLFFQSARSFYVLKLRLANFDAAAVRWDETEGTNGCPHLYGNFGARDVVAVR
                     EFRRREDQSWKEALAGEEERKWL"
     gene            1200633..1202786
                     /locus_tag="THITE_2106655"
                     /db_xref="GeneID:11523512"
     mRNA            join(1200633..1200842,1200953..1201082,1201191..1201326,
                     1201402..1202042,1202147..1202786)
                     /locus_tag="THITE_2106655"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648751.1"
                     /db_xref="GeneID:11523512"
     CDS             join(1200822..1200842,1200953..1201082,1201191..1201326,
                     1201402..1202042,1202147..1202364)
                     /locus_tag="THITE_2106655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648799.1"
                     /db_xref="GeneID:11523512"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2106655"
                     /translation="MASTAGKTITCKAAIAWGPGQELSYEDVEVAPPKAHEVRIQIYY
                     TGVCHTDAYTLSGKDPEGAFPVILGHEGAGIVESVGEGVTNVKPGDHVVALYTPECKE
                     CKFCKSGKTNLCGKIRATQGKGVMPDGTSRFRARGQDILHFMGTSTFSQYTVVADISV
                     VAVRQDAPMDRTCLLGCGITTGYGAARITAGVEAGSNVAVFGAGCVGLSVVQGAVAQG
                     AGRIIVVDVNPAKEAWARKFGATDFVNPTRLPEGKTIVDQLVEMTDGGCDYTFDCTGN
                     VSVMRAALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLP
                     GLVTDYLEGRLKVDEFITHRKTLAEINDAFEVMKQGECIRAVLDMQK"
     gene            1204838..1206143
                     /locus_tag="THITE_2106658"
                     /db_xref="GeneID:11523511"
     mRNA            join(1204838..1205267,1205403..1206143)
                     /locus_tag="THITE_2106658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648752.1"
                     /db_xref="GeneID:11523511"
     CDS             join(1205127..1205267,1205403..1205477)
                     /locus_tag="THITE_2106658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648800.1"
                     /db_xref="GeneID:11523511"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="JGIDB:Thite2_2106658"
                     /translation="MPKKLRCSFENCKAAAQRISGDCTFCQGHFCSNHRLLEDHKCRN
                     LEDCKREAFEQNAMQLDKERTQVIKTA"
     gene            complement(1206145..1208016)
                     /locus_tag="THITE_2106660"
                     /db_xref="GeneID:11523517"
     mRNA            complement(join(1206145..1206938,1207046..1208016))
                     /locus_tag="THITE_2106660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648753.1"
                     /db_xref="GeneID:11523517"
     CDS             complement(join(1206329..1206938,1207046..1207833))
                     /locus_tag="THITE_2106660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648801.1"
                     /db_xref="GeneID:11523517"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="JGIDB:Thite2_2106660"
                     /translation="MRTSRVAKETSKYFDSGPATTVLPRRSTRSSLARFAHADGPAAA
                     TTKGNGNAHNADADLAFGSDIEDAVQTTVTRKRKRTTTLAQSSPRRAATRTTRAEVKT
                     QVKTETKTEHELDAGEDLGAKPTPKPRGRARKPARKTTDATTGETKVEPPSDWEEVYR
                     LVKEMRLTGPAANAAVDTMGCERLARPDASARDRRFQTLVALMLSSQTKDTVNAEAMA
                     RLHNELPPHKPGAPPGLNLENMLAVDPALLNELIGKVGFHNNKTKYLKQTASILQSDF
                     ASDIPPTVAGLCSLPGVGPKMAHLCMSAANGWGRVEGVGVDVHVHRITNLWGWHATRT
                     PEETRRALEAWLPRDRWREINWLLVGFGQTVCLPVGRRCGDCELGLRGLCRAAERGKV
                     AEGRRRRAALERRELKVEVDVDGEGGVKVKKEEQEEVEVEVEEEMVAGEVATNEPVPG
                     PLSGTEVKVEDGTGG"
     gene            complement(1208170..1210375)
                     /locus_tag="THITE_2106661"
                     /db_xref="GeneID:11523477"
     mRNA            complement(join(1208170..1209567,1209637..1209936,
                     1210000..1210375))
                     /locus_tag="THITE_2106661"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648754.1"
                     /db_xref="GeneID:11523477"
     CDS             complement(join(1208509..1209567,1209637..1209936,
                     1210000..1210059))
                     /locus_tag="THITE_2106661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648802.1"
                     /db_xref="GeneID:11523477"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="JGIDB:Thite2_2106661"
                     /translation="MAEYTGGSVEADHLCVLVHGLWGNPDHMRSAAKALRDRFPPEQV
                     YILVAKRNSGYFTYDGIELGGERVCLEIEEELEKIRSGGGHIKKLSVVGYSLGGLVAR
                     YAIGLLFARGVLDELECMNFTAFASPFLGVRTPLKGWANQLFNVLGARTLAMSGRQLF
                     GIDRFRDTGKPLLAVLADPNSIFMSGLARFKRHTLYANIINDRSAVFYTTGISKTDPY
                     ADLSKVTVHYLPGWEDVILDPARPVSPAAPTAPPTSLRATLETWARRVPLVAALALVI
                     PLGVVAFLVNSAIQTARSSRRVRLHERGLAGIPVQDFRRVSLWIKEIREAVEHTYENL
                     NSAQHQAYLVDDGEEDDNDDDGTATTNGAVAAKANGDASGGRGKGSGEDDNGGDDGKA
                     LLALERKQSRQQEGGFPTLALAPYQFAAIQALERLNWRKYHVWIHKVRHSHAAIIVRS
                     ERSGFDEGWLVLRHWATEEFLV"
     gene            complement(1211466..1212355)
                     /locus_tag="THITE_2106663"
                     /db_xref="GeneID:11521628"
     mRNA            complement(1211466..1212355)
                     /locus_tag="THITE_2106663"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648755.1"
                     /db_xref="GeneID:11521628"
     CDS             complement(1211569..1212069)
                     /locus_tag="THITE_2106663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648803.1"
                     /db_xref="GeneID:11521628"
                     /db_xref="JGIDB:Thite2_2106663"
                     /translation="MARGLVSPVLEKKPTPIEPVPTCIVNEAGRGEPGVCGREAASGR
                     ECAAPVCAERLCQYRHADGQRCRKTPLRLEHGTKYLAASWFPDITQSVNCEDHEKHNC
                     VQLIDGVARCSEMSTPLRNCCPAHDAVQCKWGAQGGVRCSRRAEEGSRHCENHRWYEQ
                     PLSHLP"
     gene            complement(1212858..1214502)
                     /locus_tag="THITE_2106664"
                     /db_xref="GeneID:11517688"
     mRNA            complement(join(1212858..1213255,1213393..1213728,
                     1213948..1214147,1214245..1214502))
                     /locus_tag="THITE_2106664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648756.1"
                     /db_xref="GeneID:11517688"
     CDS             complement(join(1212947..1213255,1213393..1213728,
                     1213948..1214147,1214245..1214299))
                     /locus_tag="THITE_2106664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648804.1"
                     /db_xref="GeneID:11517688"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="JGIDB:Thite2_2106664"
                     /translation="MSAELTPLLSGTEHRDAAATSPSDPIDRVLGAGGGRLPLNIGHR
                     GFNAAFPENTMAAFQGAVAAGAHAIETDLHLSRDGVVVLSHDATLKRCYGTPERIADC
                     DWAHLRTLRTLREPRQPMARLVDLLTWLASGEEEEEGKEGKASSSSLSSVWVLLDVKM
                     DDDPAELYGAIARVIDSVAVPAGTRPWKERIVVGGWNEHFLHHAREHLPGYALAYTGG
                     SLLYAARFLSDAHPDVHFNLRQQTLVGPVGAAFRRAVRKRGRKLFVWTVNEPLWMECK
                     ATYYHYYYYPPLAQFRGCWLSSP"
     gene            complement(1216326..1219253)
                     /locus_tag="THITE_2106669"
                     /db_xref="GeneID:11516870"
     mRNA            complement(join(1216326..1217548,1217605..1217962,
                     1218016..1218613,1218672..1219253))
                     /locus_tag="THITE_2106669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648757.1"
                     /db_xref="GeneID:11516870"
     CDS             complement(join(1216331..1217548,1217605..1217962,
                     1218016..1218613,1218672..1219155))
                     /locus_tag="THITE_2106669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648805.1"
                     /db_xref="GeneID:11516870"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2106669"
                     /translation="MPGILPMKVIKVGNSSQSRIAQACDRCRSKKIRCDGIRPCCSQC
                     ANVGFECRTSDKLSRRAFPRGYTESLEERVRALEAEVRELKDLLDEKDEKIDMLSRMH
                     DNRRSPTEQFQTPPAAEVKKDAAAPAKEDTFRVQASPLLLGVENSDSYFMGASSGRAF
                     IESFKRKMQESGKPCSDFNPEAFLHIQGCYPLTAKPPAPTMRIPPRLLSDRCVNVYFQ
                     EWAPLFPVLHKPTFLRVYEEFVADPEKVKNNHKLAQLYLVFSIAALSGEQPDLQQVAA
                     CEQQWQRSLEAVLMDNTMMTLQCLLLALMYCTIRADYKRLQHYKGIAVGLSHRLGLHQ
                     SQKRFSFGVLTIETRKKVFWTLYVLDCFSAAILGLPKLLKEEDVHAEFPSDTDDEYVT
                     EKGFQPSLPGEATRLSNALALFRCSRILGKVLEKIYPSASSHELSLQQLSALGVELDD
                     WYEKLPQHLKLTFKQDKPSTDVTGSRSPILALAYYYIRTLIFRPAVTSSLGPKAAPAL
                     ISVGESSKHMIQIIQLLEERNMSFSFCLNKADTLVLCGMVLLYQTMDLKQDSKLLKDN
                     EKLVNAIIKAAEKAKAPGCYSLKKVAGTLITIDEPPPQSLPTPSSQSPDTCLAAPPPP
                     RTSSTTSHKGHPTLGRQLAASMSETDLLAQQEKLRRMTMSAHVQQRAAGPLPARSRGS
                     FDSPRPALPLSQRDHRLSLSQAQAAQAAMLARLSTSPNARQAMDYLHLDSRSQPTSPV
                     HTRGPYPSVTHAQQAHLYTQLHKGSGVSTAEWEALLGSIEGGQLNVYDAIYGGPGLAL
                     AETPVSATTATPAAWSPDSWDLTGLHLGDYAPPGTGSSHSVVSLSEDGLSSSDDLISV
                     GSMDFRNPLIPASTTADGYVLDGLDGFGL"
     gene            complement(1221420..1223646)
                     /locus_tag="THITE_2106671"
                     /db_xref="GeneID:11516887"
     mRNA            complement(join(1221420..1221795,1221901..1222959,
                     1223022..1223646))
                     /locus_tag="THITE_2106671"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648758.1"
                     /db_xref="GeneID:11516887"
     CDS             complement(join(1221682..1221795,1221901..1222959,
                     1223022..1223288))
                     /locus_tag="THITE_2106671"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648806.1"
                     /db_xref="GeneID:11516887"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Thite2_2106671"
                     /translation="MPRPALPIQDLPAWVHLNEVSFNQVEVASIEGKGYGVVCKTDLS
                     AGNADSNNPALISVPHDLVLNSTAVSEYAKEDKNFRQLLDAVGRRSGRADVLLFLLVQ
                     TAMTSRSGPPLVGVSNPWTEYLRFLPETVLVPTLWTEDERLLLQGTSLEAAVNAKISA
                     LDAEFAQIVEKSSDIACWRELLWDGGTVSFTDWIRLDALYRSRCLELPVHGESMVPCI
                     DMLNHSATPSAYYDENPQDDVVLLLRPGISLAEGDEITISYGDAKSAAEMLFSYGFID
                     PRSTADSLVLPLSPFPDDPLAKAKLVAFGQAPKIHVARESDGSIRWRSEFAYLMCINE
                     EDGLEFRILQQTDGAQQLRVFWQDEDVTDRTAGFESLIQTHPLAAILRLRVVTVIQEH
                     LQNQLQRLQSSTPPNRATPLQREDCFRAALLLRQIETRILDDAIKILEQERSTLMKDE
                     NVVAYLGLTEATESDQAVEEASNEADDFS"
     gene            1223648..1225391
                     /locus_tag="THITE_2106673"
                     /db_xref="GeneID:11521459"
     mRNA            join(1223648..1223876,1223960..1223969,1224056..1224567,
                     1224652..1225259,1225311..1225391)
                     /locus_tag="THITE_2106673"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648759.1"
                     /db_xref="GeneID:11521459"
     CDS             join(1223783..1223876,1223960..1223969,1224056..1224567,
                     1224652..1225259,1225311..1225337)
                     /locus_tag="THITE_2106673"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648807.1"
                     /db_xref="GeneID:11521459"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="JGIDB:Thite2_2106673"
                     /translation="MPRDPLIGLVGKPSAGKSSTLNSLTDASSKVGNFPFTTIDPQRA
                     IGYLQIDCACARYGLSDRCKPNYGACVNGRRSVPIELLDVAGLVPGAHQGKGLGNKFL
                     DDLRHADALIHVVDVSGTTDAEGKNTRGYDPSVDIAWLRSEIVAWIRGNLMEKWGSIK
                     RRHVAAKATAVETLQNQFSGYGSTSAVVARTLDKLGLKEPLEEWSEETIDRVVNAFTD
                     EKFPTVIALNKIDHPDADKNIAKIAKMQDPNTIVLCSAISEIFLRKMAKQGYIRYTEG
                     SEFVDTREDLIAAGDPDGGGLKELDEKNRNRIENLKDMVLYRFGSTGVVQVLSKAAEM
                     LGLVPVFPVRNTTTFGSGAGDSKYVFRDCVLVKKNSTVADVARKVMGDAPIAYIEGPG
                     GIRVAEDQVVAVGKNDILSFKIGK"
     gene            complement(1226139..1226610)
                     /locus_tag="THITE_2106674"
                     /db_xref="GeneID:11516889"
     mRNA            complement(join(1226139..1226262,1226351..1226459,
                     1226533..1226610))
                     /locus_tag="THITE_2106674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648760.1"
                     /db_xref="GeneID:11516889"
     CDS             complement(join(1226215..1226262,1226351..1226459,
                     1226533..1226549))
                     /locus_tag="THITE_2106674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648808.1"
                     /db_xref="GeneID:11516889"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="JGIDB:Thite2_2106674"
                     /translation="MPFTASDICKIIFAIILPPLGVFLERGCDADLLINILLTILGYI
                     PGIIHALYIICKY"
     gene            1228302..1229313
                     /locus_tag="THITE_2106676"
                     /db_xref="GeneID:11516868"
     mRNA            join(1228302..1228583,1228710..1228751,1228812..1229008,
                     1229077..1229313)
                     /locus_tag="THITE_2106676"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_003648761.1"
                     /db_xref="GeneID:11516868"
     CDS             join(1228569..1228583,1228710..1228751,1228812..1229008,
                     1229077..1229203)
                     /locus_tag="THITE_2106676"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_003648809.1"
                     /db_xref="GeneID:11516868"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="JGIDB:Thite2_2106676"
                     /translation="MAPIAKKSGAKKGPKVTKKFVINASQPASDKIFDVSAFEKFLNE
                     KIKVDGRVGNLGETIKISQQGEGKIEIIAHNDLSGRYLKYLTKKFLKKMQLRDWLRVV
                     STSKGVYELKFFNVVNDEAEEDED"
     gene            complement(1229334..1230648)
                     /locus_tag="THITE_2073277"
                     /db_xref="GeneID:11521568"
     mRNA            complement(join(1229334..1230280,1230378..1230648))
                     /locus_tag="THITE_2073277"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648762.1"
                     /db_xref="GeneID:11521568"
     CDS             complement(join(1229439..1230280,1230378..1230516))
                     /locus_tag="THITE_2073277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648810.1"
                     /db_xref="GeneID:11521568"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Thite2_2073277"
                     /translation="MAADVRNTQPPTPAPEPPQPQAAAKKSNKNYRGFVAGVFSGIAK
                     LSVGHPFDTIKVRLQTTASTRFSGPLQCLAQTLRHEGLAGLYKGATPPLVGWMFMDSI
                     MLGSLSVYRRVVQDNLFNPPWHPAHDPSQPLPAHGHGLAGMLAGATVSFVAAPVEHVK
                     ARLQVQYAARKSERLYSGPVDCLRKVWRWHGLRGVYRGLQATLLFRSFFFFWWGSYDL
                     FSRWMRQHTRLSAPAINFWAGGLSAQVFWVLSYPSDVVKQRIMTDPLGGGLNDGVRRF
                     PRWKDAAKAVYKEGGAMGFWRGFLPCFLRAFPANAMALVAFEAAMRALPE"
     gene            complement(1230802..>1231808)
                     /locus_tag="THITE_2061664"
                     /db_xref="GeneID:11521534"
     mRNA            complement(join(1230802..1231324,1231425..>1231808))
                     /locus_tag="THITE_2061664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648763.1"
                     /db_xref="GeneID:11521534"
     CDS             complement(join(1230932..1231324,1231425..1231808))
                     /locus_tag="THITE_2061664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648811.1"
                     /db_xref="GeneID:11521534"
                     /db_xref="InterPro:IPR009580"
                     /db_xref="JGIDB:Thite2_2061664"
                     /translation="MSSTIAKGAVAQAQATSSTTATAASPATAALQPVQTKQTPLAQG
                     ARHAFPAALAGLFMARFSALVADPVSTMATTLPLTAALQVGYAVLCLPAAGSQGAKAA
                     RKPKQRPGENPKKRAGVDGTGPNAIATAILALLLSLLVTPFLHAALVLFGAPFLTHGA
                     HTLLCAAHLAVLALLPLFYVHGVDAPAWAAVGGFAAPLDETSGGLAGAVAGAWLGAVP
                     IPLDWDREWQKWPVTILCGLYGGYVLGRVLGGTLVWGKRF"
     gene            complement(1231988..1233294)
                     /locus_tag="THITE_2106681"
                     /db_xref="GeneID:11521619"
     mRNA            complement(join(1231988..1232388,1232457..1232602,
                     1232664..1232760,1232832..1233087,1233175..1233294))
                     /locus_tag="THITE_2106681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648764.1"
                     /db_xref="GeneID:11521619"
     CDS             complement(join(1232084..1232388,1232457..1232602,
                     1232664..1232760,1232832..1233000))
                     /locus_tag="THITE_2106681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648812.1"
                     /db_xref="GeneID:11521619"
                     /db_xref="InterPro:IPR002848"
                     /db_xref="JGIDB:Thite2_2106681"
                     /translation="MAPPMIDPALFGELKSKIEEDISVRKELDQILDDLEQHVSFTQG
                     LLSRIHSTPRSKYATLLSEVEGGIKKEIETTGRLSTFASQYPYYKYNHKWTRTVQDAI
                     STVILCAWLGGMSPASKPGEVGRLLTLEDVGEAFGVPVNLKDRDAFHITIEEYLLGLI
                     AVIDELSRLAINSVTLGDNAMAVQISGFIKDLHAGFQVLNLKNDILRKRVDSIKYAVK
                     KVEDVVYDLSLRNLIPQESQ"
     gene            complement(1233820..1235859)
                     /locus_tag="THITE_2106686"
                     /db_xref="GeneID:11521539"
     mRNA            complement(join(1233820..1235179,1235234..1235859))
                     /locus_tag="THITE_2106686"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648765.1"
                     /db_xref="GeneID:11521539"
     CDS             complement(join(1233911..1235179,1235234..1235557))
                     /locus_tag="THITE_2106686"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648813.1"
                     /db_xref="GeneID:11521539"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2106686"
                     /translation="MASTALYVAVAVVLVGVYFLARPGALGKPRPVSLPLPPGPPTLP
                     ILGNVHQAPKSHAWLQYHAWSKTYGPIIHLNMAGQHVIILASSKAAHDLLAKQGATFS
                     DRPRFVVAHELALQGMHMLLRPYNERFKLHQKLEAPVLGERAAKAYLPIQDLESKQLV
                     VDLLKAGDGPIDCHDHMERMTASIIYSLFYGHRVLTAKEAILLQAHAVNHEFDQLAQV
                     GKYLVDSFPVLNNLPAFLAPWKAEAASHWQRQRALHVGNLERGLASEGWIVAKQMQKA
                     VDTQGINMPTDELALDIGIMADAALDASSETMAWFVLACITEGHRGWMARAQANLDGV
                     VGRARLPAFEDRPALPYIGAIVEELLRWRPAGAAGVPHFTKVESSYESFRIPANSVVI
                     ANHWSITREEAVFGPDVEDFVPERWLDTKSGQARELPTAGFGYGRRICPGRHVARNSL
                     WIAIARVLWAFNVEPELSETGEAVAVDTKGTDGLVTKPLPFKARFSPRGDWVRDVLTM
                     EGDTWAVDHHEVLDKLAVGVFI"
     gene            complement(1249190..1249901)
                     /locus_tag="THITE_2169199"
                     /db_xref="GeneID:11521544"
     mRNA            complement(1249190..1249901)
                     /locus_tag="THITE_2169199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648766.1"
                     /db_xref="GeneID:11521544"
     CDS             complement(1249215..1249472)
                     /locus_tag="THITE_2169199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648814.1"
                     /db_xref="GeneID:11521544"
                     /db_xref="JGIDB:Thite2_2169199"
                     /translation="MNIPGEGVEFCPVRTNPHWSQTHYDRVQFADFNYVQVAQYGEVK
                     YFQPSDSEDDNAPEVDADDNGDGEFLASTAKESSLTDGSRC"
     gene            complement(<1253275..1255356)
                     /locus_tag="THITE_2106691"
                     /db_xref="GeneID:11521580"
     mRNA            complement(<1253275..1255356)
                     /locus_tag="THITE_2106691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648767.1"
                     /db_xref="GeneID:11521580"
     CDS             complement(<1253580..1255036)
                     /locus_tag="THITE_2106691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648815.1"
                     /db_xref="GeneID:11521580"
                     /db_xref="JGIDB:Thite2_2106691"
                     /translation="MLISYVQVEWVNKGRMTREFKKFLFRLNRKDYQEALATISKGIS
                     DLEGLTRLSVSLEPARRRRTRGRVLNILRDLSTSIYRALRSSILCNDSHDVGLELNAP
                     PIEAGYDDEDEKVRHSVQFTMAISSEVHDGAARRHVWDEISIKPAEPAAESMKQPLDA
                     TPVVSCSPATKPKRAKKISFVVAQKLLSVGSVESPAPGVKVAMANLAQHATRVAFIDT
                     SVDDANRTPGPLVDLCVALKNARGDERPACYGHLIDKGQHTERCFRVYPRGSAADSDT
                     WSVVTLRDVLEQRDGLQPLASLKEKIRLAHIVASSVLQLSKTPWLPEAPTSTHVYFFK
                     RGPRLSYEHPFLLRNFPERERGGGPSSSSSQDPSPRAPNTVVSLDRNPTLFALGIMLL
                     EIVLGASLDALREPHERALAVPGDTRGLVRDSVTAHRLLEQRVALISPAYKVVVERCM
                     GCVASRDLDEEDFRREVYGRVVLELEAILGHTSLG"
     gene            1255733..1259296
                     /locus_tag="THITE_2106692"
                     /db_xref="GeneID:11515363"
     mRNA            join(1255733..1256847,1256930..1258887,1258980..1259296)
                     /locus_tag="THITE_2106692"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648768.1"
                     /db_xref="GeneID:11515363"
     CDS             join(1255784..1256847,1256930..1258887,1258980..1259065)
                     /locus_tag="THITE_2106692"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648816.1"
                     /db_xref="GeneID:11515363"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2106692"
                     /translation="MSHNPSPGAIAQNVHVVLQSFRNLFHALDERDASTDLHRSLISR
                     FENESTRFKMWAGNLGAHQRGRASLDYRLREAPHLQEQVVYLLKDLSQSLQDAVSMVC
                     REERRSHLGIGAQPEALDIKQQPLHSSDDPERRSEDSFSGSDDDEAPLQNGPTELCVD
                     VAEAIDCLLRLSVAIANPAPHERARVGDAEDVSIRETYDIRYVQEKFPMMDPALSGVL
                     GKAITRRRQFFRYREAHHAKLAAGLERLGHDGNAKDTGQTEIVPKTVASSLPSHFKEL
                     TGIDLRTSVFDEDRGSETGMSQTSYATSAGFMPEEVDGQPVEPPAPLKVPPLPAAAQH
                     GSFECPFCYRMVSASTRSAWKRHVFGDLRPYTCLFPECAESHADFDRRHLWEAHISQH
                     HWQSFYCPFTCDTSFPSASELRQHLSHQHMPGATDEQLNAVVSLGKRAAAADTANECP
                     MCRHTVIGLRPYIRHVGRHLEQLALFALPHLEDENHSEGGRSDQESGTSSCDDEIHGV
                     DNDEPHERTEPIELARDDLGQDDISTLETVNNLGNVYRKRGRLTEAESMFQRALEGQE
                     NALGRDHPSTLQTVHNLGIFYANQGRLTEAESMFQWALEGQEKALAQDDVSTLDTVCS
                     LGSVYWKQGRLTEAESMYQRALEGYKKALGRDHPSTLQTVHNVGIFYGTHGRLTEAES
                     MFQWALEGREKALGRDHLSTLETVYNLGIVYENQGRLMEAESMFQWALKGREKALGPD
                     HLSTLSTVNNLGIVYENQGRLMEAESMFQRALEGREKALGRDHPSTLETVHSLAVLYA
                     TQGELTEAESMYQRALRSAPQGPDQNAKRPIIATPGHRLSDRGSGNLSRDINQSSNEG
                     QHYAQPASSSPRSRAAGHVPSSAVVDEEGDQSLRDRSPPRRGALNVGPRHPVKPNRPF
                     FDRGYYEYINPSDLAGYDQADRPFQPGHNQDEDVEANAPPGAKWTKTKRHLVSPETLT
                     TFKERFEVRDDFVIVQRMLSEEEFHRYWSFTAMSIEREMKAMLEEQKREEPSESEHDG
                     DRNRD"
     gene            complement(1259298..1260747)
                     /locus_tag="THITE_2106694"
                     /db_xref="GeneID:11519154"
     mRNA            complement(join(1259298..1259811,1259878..1260083,
                     1260143..1260347,1260428..1260747))
                     /locus_tag="THITE_2106694"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648769.1"
                     /db_xref="GeneID:11519154"
     CDS             complement(join(1259726..1259811,1259878..1260083,
                     1260143..1260347,1260428..1260611))
                     /locus_tag="THITE_2106694"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648817.1"
                     /db_xref="GeneID:11519154"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Thite2_2106694"
                     /translation="MSGIWGWFGGGAAQKRKDTPKNVILDLRTQLEMLQKREAHLTRQ
                     IEEQDQIARKNVNTNKAAAKAALRRKKIHEHNLEQTLNHIGTIESQMNAIESANINQE
                     TFMAMQRASEAMKSIHGKLTPAKVDETMDKLQEYNRINEEIAEAMGSINVGPQVDDTE
                     LEDELEELQQQELEDKMLKTGAVPVDSIQRLPTVANGEIKGKAPAAPVAEDDEEAELR
                     KLQAEMAI"
     gene            1261271..1262208
                     /locus_tag="THITE_2148687"
                     /db_xref="GeneID:11519138"
     mRNA            join(1261271..1261399,1261677..1262208)
                     /locus_tag="THITE_2148687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648770.1"
                     /db_xref="GeneID:11519138"
     CDS             join(1261311..1261399,1261677..1262013)
                     /locus_tag="THITE_2148687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648818.1"
                     /db_xref="GeneID:11519138"
                     /db_xref="JGIDB:Thite2_2148687"
                     /translation="MSNGPRPSQLCLLSALPTKQVGDKVRFLGCVSSYTPASGVLALE
                     HRLPEESCSVLALVDVNLVLESLSADQTRVGEWINVIGYITDVAPSADGKKPHSQAPR
                     VHAQAVLLWSAGPVDVRRYEASVRGLNAIMCSDSCHRAS"
     gene            complement(1263287..1263910)
                     /locus_tag="THITE_2106696"
                     /db_xref="GeneID:11515701"
     mRNA            complement(1263287..1263910)
                     /locus_tag="THITE_2106696"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648771.1"
                     /db_xref="GeneID:11515701"
     CDS             complement(1263379..1263543)
                     /locus_tag="THITE_2106696"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648819.1"
                     /db_xref="GeneID:11515701"
                     /db_xref="JGIDB:Thite2_2106696"
                     /translation="MSSSSSSTMNKYWIPHLDIHKKVITQELQYYLGPGATVRPFTRD
                     VGDPCFPASR"
     gene            complement(1264233..1264862)
                     /locus_tag="THITE_2106697"
                     /db_xref="GeneID:11515846"
     mRNA            complement(1264233..1264862)
                     /locus_tag="THITE_2106697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648772.1"
                     /db_xref="GeneID:11515846"
     CDS             complement(1264288..1264500)
                     /locus_tag="THITE_2106697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648820.1"
                     /db_xref="GeneID:11515846"
                     /db_xref="JGIDB:Thite2_2106697"
                     /translation="MPKRDKLTHQEGKWQIPHEDDGSSRPRCMNPSPPSPKPKSPPRF
                     DAADTTMNPNPTNLSQLRRRISLQGS"
     gene            1264862..1265409
                     /locus_tag="THITE_2106698"
                     /db_xref="GeneID:11515669"
     mRNA            1264862..1265409
                     /locus_tag="THITE_2106698"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648773.1"
                     /db_xref="GeneID:11515669"
     CDS             1265149..1265394
                     /locus_tag="THITE_2106698"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648821.1"
                     /db_xref="GeneID:11515669"
                     /db_xref="JGIDB:Thite2_2106698"
                     /translation="MSWLKHGLCVLLVSEHTAFALDALDLKAKAIPRQWCTLSPMLAS
                     VWIGPILTMTVIHASGASFQISPNNSVARRLRTRFQM"
     gene            1267294..1268904
                     /locus_tag="THITE_2106700"
                     /db_xref="GeneID:11515360"
     mRNA            join(1267294..1267959,1268014..1268904)
                     /locus_tag="THITE_2106700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648774.1"
                     /db_xref="GeneID:11515360"
     CDS             join(1267438..1267959,1268014..1268805)
                     /locus_tag="THITE_2106700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648822.1"
                     /db_xref="GeneID:11515360"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="JGIDB:Thite2_2106700"
                     /translation="MWWLINACSSAIFLLSIVLSIPIAFDVGGRDAGLAYSLSLFLFY
                     FFYSVSKLLTPERSRVRWFFTSLVGLSQWIIIPTLLIWSLNRFSVEASSAGWVSRTFS
                     HITSTHHKTWKEWFFGQEGFVETVALGAWDSTLSYSSPVFQMLEGFCSLLVIQAAGQI
                     TRWLVNRGRSDTWVILLLVFSASIISSAVYFLWRVISFPQINNLDATLIGVAMTSAAF
                     LCAFGIASGRGNPVESSLLFAYAVLCVYQIFTDYQPSPEAAAAAEQAAAAQPDFPPLP
                     PIIMASYSTLLHMLSSLPSAVNSSFQFLYAAFQTITPSVIISLTYRIIVFYCATRIIP
                     AVRELGATAIMEEPTLEDTEGANRLIGFLSWFSPSMLIAVYTSLLLQHFSVSSSGDDV
                     GWTLRAGDAGGSTWRWVNLAATMGLYAVELYLGGNGDGGVHWKTD"
     gene            1270302..1271478
                     /locus_tag="THITE_2106701"
                     /db_xref="GeneID:11515820"
     mRNA            1270302..1271478
                     /locus_tag="THITE_2106701"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648775.1"
                     /db_xref="GeneID:11515820"
     CDS             1270412..1271047
                     /locus_tag="THITE_2106701"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648823.1"
                     /db_xref="GeneID:11515820"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="JGIDB:Thite2_2106701"
                     /translation="MASTPPPTDQPVKRKRGRPPLSPSQRKPKPAPTGRPRGRPKGSG
                     AGVKKRTSAVAAATAAAATAKASSSGGSDATTTAPRRGRGRPRKNAPRVLEGVVADVE
                     AEEGKKGVGAGAGDGGEGEPVVKKRGRGRPPGSGKKQKLAQRRAAEAAAAATATAPKR
                     GGSGGGRRSVGAGKKVVEEEEKEETGVGEDDGDFEEDGEEVEVEEDGEDED"
     gene            1271480..1276785
                     /locus_tag="THITE_2106703"
                     /db_xref="GeneID:11515841"
     mRNA            join(1271480..1275984,1276269..1276785)
                     /locus_tag="THITE_2106703"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648776.1"
                     /db_xref="GeneID:11515841"
     CDS             join(1272024..1275984,1276269..1276645)
                     /locus_tag="THITE_2106703"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648824.1"
                     /db_xref="GeneID:11515841"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="JGIDB:Thite2_2106703"
                     /translation="MAKKGKSTSSAPAPNPAPAAGKAAKKDTKKPPATEGDFIVFTNS
                     DKDNTKNRRGGGGPSKPSTPAANPIDGAAAAPDGQPRPTVRQLIGGASWTGKLPVNLL
                     SEHCQKQRWEKPDYTTIKTKDGFSVLVSLGARNPKTGELTKLPPFKLPPSHAHLAVRP
                     TALEAKHCAATYALYRVCSMKNLHISLPPDYKALWKDFEALKKVDVKEGRGWMYEADP
                     FQAAREREEAKAAAEKKRALAQAQREKAGDAAGQPGAALAFRGAGGGAAGGGGGGGGG
                     AGAHSLMRGWATVPKIEMGNKTRSQLEDLLRRETVWNPHGVVMPPQQKEAIVKEFREL
                     GFRQSHVEEAVEECKDREETLEWLLVHVPEDDLPRWALPERYTAGVTVAATDLRREGA
                     IKRLSESGYSIDLCRKILDASGGDEGKAAEALQKLLLSSGAGDHDAAPQEEESNSWRD
                     PDECWDEEMATLEASFGDKFTRTSPEVCQIRLESVVNGTNVDVETYLQFRKSPQYPAQ
                     VILSVVAPLPAYIKLSVIKKALAYASESLQGEEMKIYFLASWAQENINEIIEKPGALR
                     DVAAVSSAASEEHTHVARPARRRPRYPKPIDWTPNPRSTQEWMARIETPAYKKMLSQR
                     ERLPAWQVRAEVVRTVTENQVTIISGETGSGKSTQSVQFILDDLYSRGLGNGANIVVT
                     QPRRISALGLADRVAEERCTPVGHEVGYSIRGESRTGPNTKITFVTTGVLLRRLQTSG
                     GRVEDVVASLADVSHIVVDEVHERSLDTDFLLSIVRDVLYKRRDLKLILMSATLDAAS
                     FRDYFMADRQDVTVGLVEISGRTYPVQDYYLDDVIRMTGFSVGSRNDFDDDGFSTPSG
                     EQQADPINKTIQKLGTRINYDLLVETVRAIDADLSTTQKAGGILIFLPGVAEINRACN
                     ALRATPSLHVLPLHASLETREQKKVFAAPPPGKRKVVVATNVAETSITIDDIVAVVDS
                     GRVKETSFDPTNNMRKLEETWASRAACKQRRGRAGRVQAGKCYKLYTRNLESQMAERP
                     DPEIRRVPLEQLCLAVRAMGIRDISLFLSRAPTPPEATAVEGAITMLRRMGALDGDEL
                     TALGQQLAMIPADLRCGKLMVYGAIFGCLDDCVTIAAILSTRSPFLSPAEKREEAKQA
                     RMRFARGDGDLLTDLRAYQEWDAMMSDRGVPQRRVRQWCDENFLSFPALSDIASTRSQ
                     FYTSLSELGIRPPPPSSSRAPSSSSAPLLRALTASAFAPQICRIQFPDKKFATSVSGA
                     VELDPEARTIRYFSQDHGRVFIHPSSTLFDAQAFPSGAAFLSYFTMLSTSKVFVRDLT
                     PFNAYTLLLFSGADIALDTQGRGLLVDGWLRLRGWARIGVLASRLRGVIDRLIARRVE
                     NPAFSSVALDGGSSSSAAGAANGGGGIGGGGGGGGGSGEGEVEREREREREIIRLVTR
                     LVELDGLDA"
     gene            complement(1277780..1280440)
                     /locus_tag="THITE_2106704"
                     /db_xref="GeneID:11517369"
     mRNA            complement(join(1277780..1278995,1279069..1279578,
                     1279925..1280440))
                     /locus_tag="THITE_2106704"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648777.1"
                     /db_xref="GeneID:11517369"
     CDS             complement(join(1278093..1278995,1279069..1279578,
                     1279925..1280158))
                     /locus_tag="THITE_2106704"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648825.1"
                     /db_xref="GeneID:11517369"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="JGIDB:Thite2_2106704"
                     /translation="MAERYIPEHRRTQFKAKSTFKPEELRRRREEQQVEIRKAKREEN
                     LAKRRGIGTGENRPGASLGAAPDSDDENPPSDSQLNEELPQMVAGVFSDQIDLQIQAT
                     TKFRKLLSKERNPPIEEVIKTGVVSRFVQFLRSPHTLVQFEAAWALTNIASGSASQTQ
                     VVIEAGAVPIFVELLNSPEPDVREQAVWALGNIAGDSPQCRDYVLSQGALRPLLALLG
                     DSRKLSMLRNATWTLSNFCRGKNPQPDWNTIQPALPILAKLVYSLDDEVLIDACWAIS
                     YLSDGSNDKIQAVIEAGIPRRLVELLMHASTSVQTPALRSVGNIVTGDDVQTQVIINC
                     GALPCLLSLLSSNKDGIRKEACWTISNITAGNSAQIQAVIDANIIPPLIHLLSHGDLK
                     TRKEACWAISNATSGGLQKPDQIRYLVSQGCIKPLCDLLACPDNKIIQVALDGLENIL
                     KVGELDKQAAGDGVNSVNRFALFIEECGGMEKIHDCQTNANEEIYMKAYNIIEKYFSD
                     EDENADEAMGQNQQFGFGAANGTQQGGFNFGANGAESMDM"
     gene            1280656..1283275
                     /locus_tag="THITE_2106707"
                     /db_xref="GeneID:11519088"
     mRNA            join(1280656..1281125,1281190..1283275)
                     /locus_tag="THITE_2106707"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648778.1"
                     /db_xref="GeneID:11519088"
     CDS             join(1280957..1281125,1281190..1283072)
                     /locus_tag="THITE_2106707"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648826.1"
                     /db_xref="GeneID:11519088"
                     /db_xref="InterPro:IPR011564"
                     /db_xref="JGIDB:Thite2_2106707"
                     /translation="MAARKGASLQPPPEPSLPPKFTKIRAVLDEQVSPGGFVNVIGLV
                     KDCQLPIPTSGTDYKCTLTLCDLSTEDGEQHGLKFVIFRPEASMPQVAAGDVVLVTSA
                     RVQRYQANPLSLITNRTTSVRVYAASKIPHPPQSAQIALAPGVAPDKYTPGPQEHAYV
                     ACLYHKIDKSLIPDEQQFQERAAQSLNVKSKFSLLKDVQEGGFYDLVVQVATDPYVGL
                     DMTSLYVSDYTENPHFYPHAWQGLSDSTLGGGDPYGYGYASPSTPPSNKQWVGPYGKM
                     TIQLTCFEPHATVIRDEVRAGQWIALRNVQIKYGRDGRYLEGFLRGESNDADPTRVNV
                     HVLETHDPETVDPKLKEAIRRCRDYTREKNKQIKAVKAAHAVGLKRKASRSEEPGKDH
                     LNARERRRLARAAAEQKEKQNLINEELRLNVNDRIICEAHNGAYSTVESILEPTVYET
                     TVDGENAALVLPFTCAKYTARVRVVDFFPPALQDFACSRVPTEFDVLSDNEDDSDCPS
                     SSSEDEAAAGANRIWEWRFALQLEDPEPPPTSTRKNGGKTGQRPRLWVMVDNIEAQCL
                     TGLDATDLRADDRALAQLRERMFTLWGDLEEHKARAAARERSRGEQNEKQGKSRRPPR
                     PPLDSSDAEDDGEGGNIGEVVSNKPFTCCIRQYGIRAKDQEGGEKWVRCFGLFGTKIC
                     T"
     gene            complement(1283277..1287593)
                     /locus_tag="THITE_2106708"
                     /db_xref="GeneID:11515661"
     mRNA            complement(join(1283277..1286693,1286759..1286967,
                     1287051..1287593))
                     /locus_tag="THITE_2106708"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648779.1"
                     /db_xref="GeneID:11515661"
     CDS             complement(join(1283643..1286693,1286759..1286967,
                     1287051..1287486))
                     /locus_tag="THITE_2106708"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648827.1"
                     /db_xref="GeneID:11515661"
                     /db_xref="InterPro:IPR013721"
                     /db_xref="JGIDB:Thite2_2106708"
                     /translation="METSDNAATSSPAPTSTARRSGRVTKPPAKFTPDAPAAHKRKRG
                     AQHDDEDDENELPNDEVDDGSDVNGDDPEDSAVEEPSRATKKKKKPSASQQSAKSRRP
                     AAKKPKTNGNAPAHEPVRAAQLPSRPKKAVRVAVAQGEANGLYADIFASGDSSDKVAT
                     EWYHKYQADDAAAVTDLVNCILLAAGCDQQVTQDDIRDPENCSNRLADLQNVYAEEGI
                     TDYPLISRAKTTKSFRELLVGFFRSLVTVLHETDVLYTDSALMENIARWVASMSSSTL
                     RPFRHTATTVALAMEVALVEAAKKLDDRITKLTQQVNAEKSRKGKNRERLAAVQKNLE
                     EAEQCRQICQDQITDFFETVFVHRYRDIDAKIRAECVEALGTWIWLLPTFFMEPEYLR
                     YLGWMLSDVTAQTRHEVLKQLARILKRDAEKLGHFIERFRPRLVEMATKDADVGVRVA
                     AISVIQILKDTGMLEPDEIDSIGRMVFDSELRVRRAVVDFFAGCVNDSIETKVEEMGG
                     ADAVDELFGDDEEDDYFSPRRDWISIKCLAELLAAYDSQLEEENRTLPVRGLDIAVEM
                     VQAVAPETRLSLASQVLFEKIDQVKNWELLSGYLLYDHTTSTKAKASSKRTSNEVALK
                     HAVAPEGKEEVVLLEVLASAVRLSLASVSEGDRSRRKQRPDAVEGVEDSAVHLATIIP
                     RLLNKYGAEASTAVIVLRLEHSLPLDVFQQLRQDSTTYSRLLDEICTQFDRHVDRGVL
                     AEATAALLHARQYDELEETTDNKISELWETVINALRHFDKTQELRNRGNMEAPAVTQL
                     GSVLLKISKLASIADCIEVLEAQGQSKDSERPVIELLIHTVHRGKLDQVDEALDDLED
                     EAVSYAIQAAHFYFMWKVRTLITSVQSDTAIPAPAIERLESLRKTFANNLIWTLSSRG
                     TNDELRLFATGALCDLHVLFASLREAVKQQPSSPRRDASGALLEPLFEPIQPGLTKEF
                     IEIYNAAERAYARVTKRTLLAGPASEPAQPKDDDVVDLDEEEEEEDEDEDEAEANMSP
                     TERKGKELKLERALCELAGKLVLAILARALDHAGPRPGRLRRRMLRNQTRLGANLRET
                     LAFLDEAKLKERVAAAAAGKKKPAATTAAGGGGAGGKGKKPAATPAPAAGGRGGGSSA
                     AANGGSGAASGSGKKAAALSAEIVVAEDDESELSEPEPEPEEGSAEDLRDDPIEEDAA
                     EQEDEEGEGDGGGGADKMDEDESVLGD"
     gene            complement(1287729..1289106)
                     /locus_tag="THITE_2106709"
                     /db_xref="GeneID:11521508"
     mRNA            complement(1287729..1289106)
                     /locus_tag="THITE_2106709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648780.1"
                     /db_xref="GeneID:11521508"
     CDS             complement(1287950..1288942)
                     /locus_tag="THITE_2106709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648828.1"
                     /db_xref="GeneID:11521508"
                     /db_xref="InterPro:IPR002669"
                     /db_xref="JGIDB:Thite2_2106709"
                     /translation="MNSPFPRSSSAAGEGRIVVRLLPEGISGLESFTYQYPLKLITPM
                     RPAETKSALVFLLSYGGGLVGGDRVHLSVDVKPGARLSLVTQGHTKIFKSTTPDIVTR
                     QTMRVSIAAGGAVCLLPDPVQPFEASVYEQIQIFRLARSASLCLLDWVTQGRSARGED
                     WSFVRWAGRNEVWTVADGALARDRLLVRDAVILDSHRAHPQLPTLRESMHGMGVIGTL
                     VLRGPLMRKLGEFFLAEFAALPRLGARDWRSDDAMKEADASLSPREKWRAGRLQLEKE
                     SRVLWSAASIRGCVVVKFGAPAVEAGRLWIGSMLAQEGSITEHFGEQALMCVSK"
     gene            1289110..1291397
                     /locus_tag="THITE_2106710"
                     /db_xref="GeneID:11521520"
     mRNA            join(1289110..1289803,1289871..1291397)
                     /locus_tag="THITE_2106710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648781.1"
                     /db_xref="GeneID:11521520"
     CDS             join(1289461..1289803,1289871..1291096)
                     /locus_tag="THITE_2106710"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648829.1"
                     /db_xref="GeneID:11521520"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="JGIDB:Thite2_2106710"
                     /translation="MSADSQTTHSTAAPATGPTTSRLPSSTPAPASAGRGSSAASKFK
                     PKGVRRSEAERARMAEEQLRIQEQRDAEEARRLARLNRGRARGRGRGRGGLFRGTLRT
                     SAAAGPLSAGVSFGGGGGPSGSGGYAYASGSGAGFAKGEGESKRDKGLYGVSGIIDNS
                     RINADMLYNYVEISDEEDGGSVTSTKKKSRPIMPMGIRRVEHKEEGVTMTTAAEIEAQ
                     EKAGELGEEESDEDGLFVSGAAVGEADEPARDEGTLEPQSTRDSVTVKKEDGEEGAMD
                     LDKIPEGIKAPDSPEMKKKVPVSEQKPKKKSAAPKDLESEIISEELQTMLDLFTVQGD
                     DALGGDGAANNAALEGHMFLFQFPPVLPPLKAVPRDGASKNPTSIKAEPDDDVVMLNQ
                     PPVSIDLTRDSDRKVKKEGDGEEGGDGNAQDEGDELKEGGYLGNLVVRKSGKVELSWG
                     GQTLQLMPGIQSNFLSTAALIEYADVKPGDTSQTAGVAYGMGKIQGSFTLAPAWADED
                     DWVVDPKDLTIPEQ"
     gene            <1291926..>1293418
                     /locus_tag="THITE_40924"
                     /db_xref="GeneID:11521529"
     mRNA            join(<1291926..1292078,1292252..>1293418)
                     /locus_tag="THITE_40924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648782.1"
                     /db_xref="GeneID:11521529"
     CDS             join(1291926..1292078,1292252..1293418)
                     /locus_tag="THITE_40924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648830.1"
                     /db_xref="GeneID:11521529"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="JGIDB:Thite2_40924"
                     /translation="MGEQANADEGIHLVVIGAGLAGLSAALATKLANPAHRVTVLEAV
                     NELQEVGAGLQITPNGTRLLSAWGLTPALAPLAAVPESLSVHRYDGTKLLAHEPALQA
                     QVRARYDGHPFWDLHRVDLQQALVARCGELGVALRLGARAVQVDFEAARVRLRDGAAV
                     QGDVVLLADGLWSAIRPQFVGRACPPVLTGDLAYRITLRADELEGEDAEELRAWVRRP
                     AVHFWIGPRAHCVGYSVRAGEVYNLVLLCPDDMPPGVVKAEGDKDEMRARFEGWDPLL
                     TRFLRQVKGVVHKWKLMWLDALPDWANEKGTFFMAGDCCHPMLPYLAQGANSSLEDGA
                     VLGSLLGRVRKSDMARQLPCVSKLYQKLRMERGRKIQLETFRQRDDSHLEDGEAQEKR
                     DALMLSMLGKELKGPFPSRWTCPVIQPFLYGYDAYAEAEKAYEENPF"
     gene            complement(1293525..1295074)
                     /locus_tag="THITE_2106712"
                     /db_xref="GeneID:11521560"
     mRNA            complement(join(1293525..1294143,1294203..1295074))
                     /locus_tag="THITE_2106712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648783.1"
                     /db_xref="GeneID:11521560"
     CDS             complement(join(1293631..1294143,1294203..1294991))
                     /locus_tag="THITE_2106712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648831.1"
                     /db_xref="GeneID:11521560"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2106712"
                     /translation="MAAEPDTEKGHPASRTPSQPDDAEDAGRAPREEFQPPDGGLFAW
                     SQVLAGIFINMLAWGYPSTFGVYQLHYRDTLKLPESQISWIGSLQVFLAFAMCTVSGR
                     LADAGYVKSTILAGSFLVVFGTFMTSLCTEYWQIFLAQGLCTGLGLGIIFMPPLSVIN
                     SYFVTKRSSALAISATGTGLGSVVFPATIQYLIPRIGFPWAVRCAAFVALFVSILAVL
                     ILRPQLRPRKSGPLIEWDAFKEGPYLLYILGAFLFFWALYFGFFYINAYARNVIHFST
                     TDSVQLLLITNGMSVPSRPLVGYLADQHFGPINLYTFHTLVLGCLIFAWTGVTTRTGM
                     YVFAVFFGLANGAAQGLFAGSLASLTKDPRKMGTRFGMVCTIVAFASLAGPPTAGAII
                     DKSGGRYLWAQVWAGLVIVLAAVTIAAARYAVTGSKLWVKI"
     gene            complement(1298602..1300718)
                     /locus_tag="THITE_2106716"
                     /db_xref="GeneID:11521538"
     mRNA            complement(join(1298602..1299816,1299888..1300718))
                     /locus_tag="THITE_2106716"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648784.1"
                     /db_xref="GeneID:11521538"
     CDS             complement(1298650..1299510)
                     /locus_tag="THITE_2106716"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648832.1"
                     /db_xref="GeneID:11521538"
                     /db_xref="JGIDB:Thite2_2106716"
                     /translation="MSEEDKDVAMQLIRLCGGPSQARRSGSAMDDTFSGRADAASSVG
                     ATSDAGSSSEDEEPAARRQKLDSSGNHKRMFGTTSSHFAGPKDSAEASADESEGSDGA
                     EKGTMAASGKNRKLKANTLSGAKARAQSSPKMKASKVSKPKVKKTPSATVPMTPASLP
                     ASRKPSVASNPAFSLGPGEEEQPDLSTKPRCQRCRKSKKGCDRQRPCGRCRDAGIPAE
                     LCISEDEGNGRKGRYGRHMGVPIKREDMPPPAPALLPAAPVGADMGALAATANPAGPA
                     AVDKNKKRKR"
     gene            <1302769..>1304116
                     /locus_tag="THITE_2125155"
                     /db_xref="GeneID:11521516"
     mRNA            join(<1302769..1302785,1302838..1302909,1303209..1303501,
                     1303702..1303747,1303781..1303816,1303879..>1304116)
                     /locus_tag="THITE_2125155"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648785.1"
                     /db_xref="GeneID:11521516"
     CDS             join(1302769..1302785,1302838..1302909,1303209..1303501,
                     1303702..1303747,1303781..1303816,1303879..1304116)
                     /locus_tag="THITE_2125155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648833.1"
                     /db_xref="GeneID:11521516"
                     /db_xref="JGIDB:Thite2_2125155"
                     /translation="MTDAMVRPDLQAAAAKGPVQQPIAGWGGPCVLDRWIKATSLHKT
                     IVGFEAPQFEAQSPRMFCVRWHAASTRTGCVLPMHLASCNRSHASPPVHREAILNEQV
                     GTLVGSRCDFADLQHASLDIPALSQKRQMTEATDHPRRADRRWAIAQLKKDISAGRNR
                     DIEVPSAEKAGPAATELAPGGKDQETESRRTSMLELESARRNYQSSRLGKPGPGLHPS
                     LRKRAPPGVRCTVRA"
     gene            1305346..1308043
                     /locus_tag="THITE_2106718"
                     /db_xref="GeneID:11521528"
     mRNA            join(1305346..1305516,1305733..1306917,1307000..1307539,
                     1307608..1308043)
                     /locus_tag="THITE_2106718"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648786.1"
                     /db_xref="GeneID:11521528"
     CDS             join(1305505..1305516,1305733..1306917,1307000..1307539,
                     1307608..1307907)
                     /locus_tag="THITE_2106718"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648834.1"
                     /db_xref="GeneID:11521528"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="JGIDB:Thite2_2106718"
                     /translation="MDAKPQRPPRAAATAAGNENIFPAKDSMHHRHKSTGNLTTTTAA
                     GALNAPPKRTAFGDVSNTARTRAVDLAGKPIDKDAVKARAKPAALVSVRDTRVDRKDN
                     KQVGPHEARSRTITTSKGISNSTKSQPSAPLQAANLGPRGASLAQPPMRNGASKKATT
                     THEDDRYDQKLNVRRDAASPVDDMAVLVVKPVKDPRHYKSQPVLRADQQSIRHTQNKV
                     VSKTDGAIDPSGESDVDDNVTEAAYEDAVEQLSDAVIDGAVRDALAEVKRMEYNSLYL
                     ADYDQAMQPSRISEAPRSPKALPELPVAPESEEYWDEEEEQEYYDEQGYTTAHSYRSL
                     GDNTGSGPTTMLAPSVTASAQEELERAKAYVLEHQTEYEIEEDAWDVSMVTEYSDEIF
                     AYMRELEAQMLPNPHYMDIQTEIQWSMRSVLMDWLVQVHHRFCLLPETLFLAVNYIDR
                     FLSVKVVSLGKLQLVGATALLVAAKYEEINCPSVQEIVYMVDSGYTVDEIQKAERFML
                     SMLQFELGWPGPMSFLRRISKADEYDLETRTLAKYFLEITIMDERFVSSPPSFLAAGA
                     HCISRLFLGKGGWTPSHVHYSGYTFSQLKPLINMLFECCQYPGKHHSAVYDKYATPKY
                     KHSSTFIESKIASGVTLAQLYAGKAAQLEPSSLLVDDRIGRPFPVVDNPIPITA"
     gene            1309753..1312329
                     /locus_tag="THITE_2106721"
                     /db_xref="GeneID:11521548"
     mRNA            join(1309753..1310076,1310142..1311323,1311400..1312264,
                     1312313..1312329)
                     /locus_tag="THITE_2106721"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648787.1"
                     /db_xref="GeneID:11521548"
     CDS             join(1309888..1310076,1310142..1311323,1311400..1312128)
                     /locus_tag="THITE_2106721"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648835.1"
                     /db_xref="GeneID:11521548"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Thite2_2106721"
                     /translation="MSKVATVKEAVKETLVGSHEPAQLSAQAKARFNRHAIKDPETGE
                     LYLGPEQFIDAIAPPHEDYHKIKREQFAILFSVADRTNKGRLTLADWGYFENLLSKPD
                     AEYEIAFRLFDVDRLGTVKYEDFRRLYELNKGPDSIPFDWDCEWAKLYIGSKTKRHSM
                     DYQQFSQMLRGLQGERVRQAFQRFDVDGDGYIEPEEFALIIRQTAKHKLSDHLLDNLH
                     TLCNIAQGSKVSYANVRAFLNMINEMDLVELIVRRACAKSKDGRITRAEFLNQAAKIT
                     RFSLFTPMEADILFHFASLDEPSGRLGLRDFSKVLDAAWRRRDEEEESRPVVEVKSRG
                     GQFVAQAIESAYSFVLGSVAGAFGAFMVYPIDLVKTRMQNQRGASPGQRLYSNSIDCF
                     RKVVRNEGVRGLYSGVLPQLVGVAPEKAIKLTVNDLVRGWFTDKQGKIWWGYEVIAGG
                     AAGGCQVVFTNPLEIVKIRLQVQGEVAKSVEGAPKRSAMWIVRNLGLVGLYKGASACL
                     LRDVPFSAIYFPTYSHLKKDVFGESPTKKLGILQLLTAGAIAGMPAAYLTTPCDVIKT
                     RLQVEARKGESSYTGLRHAAKTIWKEEGFRAFFKGGPARIFRSSPQFGFTLAAYELLQ
                     SVLPYPGKKTEAKVAPGVAEAVSTLKEKAVDSPFYRSRNALKILLDLDEHFGQTPLRP
                     NAQGWKALPGWMGAKTA"
     gene            complement(1312873..1314712)
                     /locus_tag="THITE_129549"
                     /db_xref="GeneID:11521515"
     mRNA            complement(1312873..1314712)
                     /locus_tag="THITE_129549"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648788.1"
                     /db_xref="GeneID:11521515"
     CDS             complement(1312988..1313944)
                     /locus_tag="THITE_129549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648836.1"
                     /db_xref="GeneID:11521515"
                     /db_xref="JGIDB:Thite2_129549"
                     /translation="MSGNSPSFLTLPLELRLEIYTHLLVLPPPPPPETLTTIYRCSHP
                     YTASSSSSQLPASDPARSESTSEPEPTVHPQILRVNRQIHHEATPLLYTLNTFLAHPA
                     AMTALPTLYSHHHQHHHHHPHSAPQSRTRSKTIPITTPPRLTNLITRWHVRLRLDAPP
                     PPQAPWWDRAAVARAFTGAEALTLEIEWGAAVPGGAAAEVLRVFEGVRGVRRVRIAGA
                     AGSGLEGYVAWLRARMMMRPGGNKEAAVGVRQEGKGRGWGGETDGEGLGWKVDGDEEQ
                     DGDELREDGNGNWDGDEDWDEEYVPADETERNMLRRWMLDYP"
     gene            1314984..1316213
                     /locus_tag="THITE_2106724"
                     /db_xref="GeneID:11521603"
     mRNA            join(1314984..1315257,1315362..1316213)
                     /locus_tag="THITE_2106724"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648789.1"
                     /db_xref="GeneID:11521603"
     CDS             join(1315110..1315257,1315362..1316053)
                     /locus_tag="THITE_2106724"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648837.1"
                     /db_xref="GeneID:11521603"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Thite2_2106724"
                     /translation="MGFLEFLSAVFGVIYFTAWSVSFYPQVLLNFRRKSTSGTTVDFP
                     LINCLGFAAYATSNLAFYYSPLIRAQYAARYKGLTPTVHFNDIAFAAHALLLSVITTS
                     QYFFPGAWGFTPSKGNRPSRFILGIFFGCVVGIVVVLFIVLGSPERDSTQKAVSSWVW
                     LDAIYAVSYVKLIVSLIKYTPQVIVNYRNRSTRGWSIWQILLDFSGGILSIAQQAVDS
                     YLQRDWSGITGNPVKFALGNVSMLYDLIFMTQHYVLYRGADGKPEEADSLLGRADEER
                     RID"
     gene            1316735..1318006
                     /locus_tag="THITE_2106726"
                     /db_xref="GeneID:11521530"
     mRNA            1316735..1318006
                     /locus_tag="THITE_2106726"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648790.1"
                     /db_xref="GeneID:11521530"
     CDS             1316924..1317880
                     /locus_tag="THITE_2106726"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648838.1"
                     /db_xref="GeneID:11521530"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="JGIDB:Thite2_2106726"
                     /translation="MNDWGRTPPGLASNRWKSILITGAATPVGVWAVQLAKLAGAARV
                     VGTCHANDVNLVLELGAHEAYDWEGEGSLKDWRKGHFSVVLDLMGGVTLTRAWRLVAG
                     RGMILSLAGNAREAKPNLVNQLITSLGSFSFGNSPRCLELVRSLARRGLVKPVCDPKD
                     VFELGDFEKAMQRLSSHSRGQVVLTLDSEPPLELIDQLDIYGDVSLRRAEITADMIEE
                     AEGEDDEEPLELLRWLGTVGSNGPNLAQLAPEELMPPPTRFLTKKIKDRARLGRRRAS
                     GNVMRSGPAARQRRGGVAPSPGEEGTPSPPSQSVVDTGLVER"
     gene            complement(1319180..1321417)
                     /locus_tag="THITE_2106727"
                     /db_xref="GeneID:11521612"
     mRNA            complement(join(1319180..1319845,1319899..1320802,
                     1320908..1321417))
                     /locus_tag="THITE_2106727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648791.1"
                     /db_xref="GeneID:11521612"
     CDS             complement(join(1319249..1319845,1319899..1320802,
                     1320908..1321062))
                     /locus_tag="THITE_2106727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648839.1"
                     /db_xref="GeneID:11521612"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2106727"
                     /translation="MAHDPGPAEAGDSKVAQVLNADEHGLQGGNNVSTSAPPIQDYDV
                     ERVEKVYRKLDLRIIPAFWALYFLSSAIRSNIGIAQTMNESAGHDLASVLGLSPRDTS
                     TALALFYVSYVLFDLPSNLVMSRLSPRAWMARIVTAVGVVGTCFAAVQAAWSLKLLRF
                     LLGLVTAGMWPGMAYYLTLFYPPSRTGKRIGMYFTASQVSAAVVGLVSAGFQQMDGLR
                     GLVGFRWMFLVYGLLGVVLGISLLWWLPERPLAPGEERVRSWYARWLPPSPEALKGED
                     AVVHYHDLRRVYHARPWNLRDLWHVLIDWRLWPLVLMYFGVVGVGIGTQLYGNVIISS
                     IDSTFTGVQISLLFAPIWMMDFCAILLVTPISDRFHRYRALFFSAAVCIQIAGLLTVT
                     FALSNPWARYGGLLMVGFGLGPTVPICMTWTSEIFQRRHREVGVAAASALVSGLGNLG
                     SITTTYALYTGWPEDAAEGPHQYRKSNFTMIGILCMSIASSFVMTGLLRIFGNEPSQK
                     ISSGGSSAVDSDEYLDGAARREVHQRGFDRMWWNRSSKASPEA"
     gene            complement(1321427..1323116)
                     /locus_tag="THITE_2106728"
                     /db_xref="GeneID:11521518"
     mRNA            complement(join(1321427..1322431,1322499..1323116))
                     /locus_tag="THITE_2106728"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648792.1"
                     /db_xref="GeneID:11521518"
     CDS             complement(join(1321576..1322431,1322499..1322686))
                     /locus_tag="THITE_2106728"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648840.1"
                     /db_xref="GeneID:11521518"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="JGIDB:Thite2_2106728"
                     /translation="MSAVELPEPFASIPRKALTFGPSPIQHLPRISQALGGQVNVYAK
                     REDCNSGLAYGGNKTRKLEYLLPDALAQGCDTLVSIGGVQSNHTRQVAAAAAAVGLRA
                     ALVQEHWVDWADAGYDRVGNVQLSRLMGADVRLDPSAFGIEHKPTLAKLRDELAAQGR
                     KPYYIPAGASDHPLGGLGFARWAFEVAMQEREMGVFFDTVVVCAVTGSTMAGMVAGFK
                     LVEKLGGRKRRVVGIDASAKVQQTFEQVLRIARQTAAKIGLTEEDITEADIILDDRYH
                     AGTYGIPDAQTIEAIKFGARTEAFITDPVYEGKSLAGMIDMIRKGEIPAGSTVLYAHL
                     GGQLALNAYSSLE"
     gene            complement(1323067..1324473)
                     /locus_tag="THITE_2106731"
                     /db_xref="GeneID:11521228"
     mRNA            complement(join(1323067..1323414,1323511..1324473))
                     /locus_tag="THITE_2106731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648793.1"
                     /db_xref="GeneID:11521228"
     CDS             complement(join(1323352..1323414,1323511..1324350))
                     /locus_tag="THITE_2106731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648841.1"
                     /db_xref="GeneID:11521228"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2106731"
                     /translation="MKPKTVLITGCGKESLGNALAKEFRRRGHTVFASVSSLASVDPS
                     LSEAGCHVLELDVTSTASIDQAVTVVTNLTRTTTDEGSLDILINNAGIMHIMPFADTP
                     VEHARRVFEVNTLGPWAVTRAFLPLLLAAGLSGSGGGSGGAKVGNVCSVNEVLCPPFL
                     TAYNASKAALESMSRTMRRELAPLGVQVVTLKCGCIETGLFNSPDVSMSGPTCPETSV
                     YAGLREWIGRREFLKVGRFFKREVVAEDLVRELLKENTSAVVWKGGLATIHWLLSFGW
                     ETMMDRTLIKGNHLDTMSWSPPKD"
     gene            <1326239..>1326644
                     /locus_tag="THITE_2084022"
                     /db_xref="GeneID:11517163"
     mRNA            join(<1326239..1326381,1326491..>1326644)
                     /locus_tag="THITE_2084022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648794.1"
                     /db_xref="GeneID:11517163"
     CDS             join(1326239..1326381,1326491..1326644)
                     /locus_tag="THITE_2084022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648842.1"
                     /db_xref="GeneID:11517163"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2084022"
                     /translation="MSLPKTYKHTVFKAQGEPLTLEEVTLRAPAEGEILVKVEACGVC
                     YSDISGKVQKANESQLLRPLKTAAVGVLSEGQGNQNIASVKATVIIVVWRNIAF"
     gene            complement(1330374..1331823)
                     /locus_tag="THITE_2106736"
                     /db_xref="GeneID:11515361"
     mRNA            complement(join(1330374..1331007,1331065..1331823))
                     /locus_tag="THITE_2106736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648795.1"
                     /db_xref="GeneID:11515361"
     CDS             complement(join(1330491..1331007,1331065..1331483))
                     /locus_tag="THITE_2106736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648843.1"
                     /db_xref="GeneID:11515361"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2106736"
                     /translation="MSVVYEPRNFIHDGGYPPIDDHHHDATADVDRFPDPNDADPSDA
                     VVNELATTVATFTAPPPPFDDTSEPRLDLSAGPTTETTTATAAPKEDSPTTTTPQRVK
                     AIPKPDREVTRNLQGKFVCTWPGCAEEPKEFGRKCEWNKHMDKHDRPYKCAAAGCEKL
                     PGFTYSGGLLRHEREVHGKHGGPKNSFFCPHVNCKRHAGKGFSRQENLNEHLRRVHTQ
                     NGTPLNGGEGETDDGASDNMAAAGQKRKRDDDSDLREEMKRLRQENEELRRQVQAQTQ
                     QTVVMMQKITQLQQALESRMPAAAPQAPMATASIL"
     gene            complement(1332181..1332717)
                     /locus_tag="THITE_2106739"
                     /db_xref="GeneID:11521498"
     mRNA            complement(1332181..1332717)
                     /locus_tag="THITE_2106739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648796.1"
                     /db_xref="GeneID:11521498"
     CDS             complement(1332247..1332624)
                     /locus_tag="THITE_2106739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648844.1"
                     /db_xref="GeneID:11521498"
                     /db_xref="JGIDB:Thite2_2106739"
                     /translation="MYLALHRNHGNTERCSTLEVLARWPVNSFLGGAVQGVLGSARQR
                     FAGIQSIFAMIQYNLSGWTVKLVAVALPWSLNLRISLAQLASAAWRSQRPLWTLPEKH
                     AANCAKTGMAEGQLERPVFRAAI"
     gene            complement(1334926..1336136)
                     /locus_tag="THITE_2106741"
                     /db_xref="GeneID:11517365"
     mRNA            complement(join(1334926..1335823,1336029..1336136))
                     /locus_tag="THITE_2106741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648797.1"
                     /db_xref="GeneID:11517365"
     CDS             complement(1335093..1335794)
                     /locus_tag="THITE_2106741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648845.1"
                     /db_xref="GeneID:11517365"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Thite2_2106741"
                     /translation="MNDNPKHIVQEAYDHVAEWYLRWIDGQISPRERYAAKVLQHALS
                     PQQPQQQQPPETQQPPSPRPRPRILDLGCGPGIPVTRLLLDGGADVVANDISPKQLAM
                     ARERCPQAHFVGGDAAALAFEPASFDGVVSFFTIFHLPRAEQKGLLAKVCAWLKPGAL
                     FAFNLATVDEEEIYGEFLGHGMFWSSYGVEANVAMVREAGLEVVEVEVLESEPDEGIE
                     FMWVVARKGLGGEPQ"
     gene            1339866..1342084
                     /locus_tag="THITE_2106743"
                     /db_xref="GeneID:11515527"
     mRNA            join(1339866..1340441,1340511..1340545,1340610..1342084)
                     /locus_tag="THITE_2106743"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648798.1"
                     /db_xref="GeneID:11515527"
     CDS             join(1340036..1340441,1340511..1340545,1340610..1341875)
                     /locus_tag="THITE_2106743"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648846.1"
                     /db_xref="GeneID:11515527"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2106743"
                     /translation="MSWPYTLLTAIPLALAGAFVAQTVIGLLRNYRAARSLGVPLRFI
                     PISPMNPFWMLVDRGVLSFLSRRFPFLRDTSFTRYNWRGWEVKDRYRSHHEMGDIWVL
                     VTPFKNWVYINDPEALIALFRRGSDFPHPVFITELLNVFGPNISTAEGQAWKTQRRIA
                     LHCFNEQNNEVVWREALTLARDMRDYWTSKPSVDTAAADLRTLSLHILSRAGFGKSFP
                     FESQEDQKKAAGSAPGAPATVNYKEALQIILENLVLIVGLGTKFLAKPWLPKKLRDIN
                     TACVAFRAYMTQTYEEEKAAYLDGRPTESNLMQSMIRASQADAKSGADGGLTEAEIYG
                     NMFAFNFAGHDTTAHTLTFAMFFLAANPEVQDWIAEEIHRVLGDRPIDAWDYRSDFPR
                     LKRCLAVMYETLRLYDIVPVIKWTADKAQSLVVGGKTYMLPPNSMIAPSYGSLQTDPR
                     FWGADSLEWKPSRFIVKRSESDDARQDEEFRIPVRGSFIAWSDGARDCPGRKFSQVEF
                     VATMAGLFRDDWRVSPVLLPGETPDAARRRVLDLVENDSGMVLLQQMLHPERAPLVWK
                     RK"
     gene            <1342506..>1343468
                     /locus_tag="THITE_2084027"
                     /db_xref="GeneID:11517547"
     mRNA            <1342506..>1343468
                     /locus_tag="THITE_2084027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648799.1"
                     /db_xref="GeneID:11517547"
     CDS             1342506..1343468
                     /locus_tag="THITE_2084027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648847.1"
                     /db_xref="GeneID:11517547"
                     /db_xref="JGIDB:Thite2_2084027"
                     /translation="MPLPLSAASTIASYAIRPADPKPSFFSIELSQAEHRIRLINAWG
                     DAIRPGTRILELGCGQGTCTQALAEAIRPPPASSETGTAASEGETKGGGGGGGGGHID
                     AVDPGAPDYGSPFTLGQAQAHLSAGPVGSLITWHRAEPVAFLAAHPGRTWDVAVLAHC
                     VWYFASPGELGRILAALRGRVARVLIAEWALRATEPSAAAHVLAVLARGAFEAHRVGS
                     CQNVQTPLSPAAIRRAAEEAGWAVEGETVVVPEKELADGYWETAMVVGEGFVQDVERE
                     IGDERVKALLKSARDATIAAADAVGGAKGVRSMDVWVATLVPGE"
     gene            1345662..1347607
                     /locus_tag="THITE_2106747"
                     /db_xref="GeneID:11521453"
     mRNA            join(1345662..1346606,1346684..1346850,1346913..1347607)
                     /locus_tag="THITE_2106747"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648800.1"
                     /db_xref="GeneID:11521453"
     CDS             join(1346182..1346606,1346684..1346850,1346913..1347409)
                     /locus_tag="THITE_2106747"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648848.1"
                     /db_xref="GeneID:11521453"
                     /db_xref="JGIDB:Thite2_2106747"
                     /translation="MALDLGSLPPPPPISRHTVQMAGLLVDVYGLAELRPGAARVSCL
                     WLHHPRTRSKEHMADIAARCVGAWNARRDGADADADAAAAGGRERERGLLALAYDQRN
                     HGSRLVDERANASWREGNAMHAVDMLGVVQGMVADQRVLLDLVEGYLFPNAEGNRKID
                     QHLALGVSLGGHSVWQLMFAEPRVEAGVVVVGCPDYINLLSDRARLSKLSTYSVQDNG
                     ASFLGSKDFPQSLVAACAKYDPKAIFFGASAVPGAEASGAADEAARKIVRERLRGKKF
                     LLCSGGDDKLVPYRCSEPFLRWFKQATESWFKEENVSVDDRVYPGVGHSFSADMISDS
                     VRFVVDAVAGADKEVAVGNIDEQRASKI"
     gene            complement(<1347689..>1348653)
                     /locus_tag="THITE_2039422"
                     /db_xref="GeneID:11517679"
     mRNA            complement(join(<1347689..1347960,1348009..1348367,
                     1348463..>1348653))
                     /locus_tag="THITE_2039422"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648801.1"
                     /db_xref="GeneID:11517679"
     CDS             complement(join(1347689..1347960,1348009..1348367,
                     1348463..1348653))
                     /locus_tag="THITE_2039422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648849.1"
                     /db_xref="GeneID:11517679"
                     /db_xref="InterPro:IPR003848"
                     /db_xref="JGIDB:Thite2_2039422"
                     /translation="MPLSHLVIVCGHAIWLGGPKNGWDEAEWLIEGYKQGETPTFIEH
                     IKAGVKLLSEDESAVLVFSGGPTRKETVLSEAQSYHNLAVANSYFGLLPTTTTITTTT
                     NNGNNQLPTTRILLEERALDSYHNILYSLILFWRHHAAWPRRLTIVSHAFKRTRLVDG
                     HCAAIGFPLDRVGFVGINPPGVDTSGGLEGLSAAGEKAEAMRGVQLAMGQWAEDPHGV
                     GEELAGKRRRRNCWGVHQRLFLDAAERDRSGVDVRVLADGSEALVEGGRRPWARE"
     gene            complement(1348710..1350225)
                     /locus_tag="THITE_2106750"
                     /db_xref="GeneID:11515712"
     mRNA            complement(1348710..1350225)
                     /locus_tag="THITE_2106750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648802.1"
                     /db_xref="GeneID:11515712"
     CDS             complement(1348900..1350114)
                     /locus_tag="THITE_2106750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648850.1"
                     /db_xref="GeneID:11515712"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="JGIDB:Thite2_2106750"
                     /translation="MIDLGLARVSRLVQHVPQTWKAIHVAGTNGKGSICAYLSAMLTA
                     SGLSWARFTSPHLIDRWDCIAVNGKPVSESVFRDAENLVKQRDQEGRVGATEFELLTA
                     TAFEIFHRQNVEYGVVEVGLGGRLDATNVLKQKAVTVIAKIGLDHQAFLGNTIEEIAL
                     QKAGIIRAGVPCVVDGSNQPSVLRVIEEHAREVGAELHYPAIASVSEALSGEGFEPHQ
                     VQNLACAHAAFRLACPGDDRPLAHFLPMIKQMQWPGRLQRLDLQKIMGRPQEALLDGA
                     HNPQSAEVLAHYVSRHLRSGDQPVTWVVAATQGKDMNGIFSLLLKPDDRAAAVRFGPV
                     DGMPWVKPADPVGLLELAAQYGVQEPAMYDAGDDIRAALTWASQVAGDGPLVIAGSLY
                     LVSSVLRLLRES"
     gene            1350634..1352460
                     /locus_tag="THITE_2106752"
                     /db_xref="GeneID:11517043"
     mRNA            join(1350634..1350893,1351111..1351618,1351681..1352460)
                     /locus_tag="THITE_2106752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648803.1"
                     /db_xref="GeneID:11517043"
     CDS             join(1350883..1350893,1351111..1351618,1351681..1352364)
                     /locus_tag="THITE_2106752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648851.1"
                     /db_xref="GeneID:11517043"
                     /db_xref="JGIDB:Thite2_2106752"
                     /translation="MGLRLYQPPVESDIPAKPTIDRAALSRSTIRRVLDRNEDRLRER
                     RRRVLAAAAAYNSFDARRGLSAVEPPAIPPATTDSSGTRSGSEHGRRALRDAANRMSL
                     LDERLAAVFGERWTNLHTETNPSPLRDEDNNPSPMLAMAVDSEFLPRRSRLRPEPTYT
                     LSSIRSTQAPDHPSRSATRSPVGTSRSRRQGGRWMDSILRADSRQSLNGPGEGSWSRP
                     TAPSNRPWTHHTGLGSLGAVDGLGDRNRSLSPEGDNVWDTLLSTLTPDPQPPSVGSSF
                     ASATASASAAATQSNATASSRTSFTTQDTAEESAFDPPCDSGCDNSDTEGDNDEDEMD
                     AIQPPRRRRTYAEVVRDSNDDPLELLGGIGGMQRIVRNLARREDIPDEWWAEVGLSRT
                     LSREASSN"
     gene            1354540..1360736
                     /locus_tag="THITE_2106760"
                     /db_xref="GeneID:11521473"
     mRNA            join(1354540..1355090,1355488..1355622,1355685..1355714,
                     1355788..1355852,1355911..1356349,1356408..1356750,
                     1356817..1357319,1357381..1357941,1358025..1358168,
                     1358224..1358710,1358766..1360736)
                     /locus_tag="THITE_2106760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648804.1"
                     /db_xref="GeneID:11521473"
     CDS             join(1354914..1355090,1355488..1355622,1355685..1355714,
                     1355788..1355852,1355911..1356349,1356408..1356750,
                     1356817..1357319,1357381..1357941,1358025..1358168,
                     1358224..1358710,1358766..1360696)
                     /locus_tag="THITE_2106760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648852.1"
                     /db_xref="GeneID:11521473"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2106760"
                     /translation="MAPPPTPRPASSGVAERPYHGGANGRAVVAAKVTPGTPRREQQA
                     LRQEKAVQDPGLRDYRLGDCIGKGAFGSVYKAFNWGTGEAVAIKQIKLADLPRSELRM
                     IEAEIDLLKNLHHDNIVKYIGFVKTADCLNIILEYCENGSLHSICKAYGKFPENLVGV
                     YMTQVLQGLQYLHDQGVIHRDIKGANILTTKDGTVKLADFGVSTSTLAGPDKEAQVVG
                     TPYWMAPEIIQLSGATSASDIWSVGCTVIELLQGKPPYHNLAAMPALFAIVNDDHPPL
                     PEGVSPAARDFLMQCFQKDPNLRVSARKLLRHAWITGCRRSDAPVSKAPANFSQAVEE
                     VKQWNKALKSSENNLRVSTGSENGGPPGQAHRANLATSAKVPLAPATKQRSTADAFRS
                     PEPADDDNWDNDFATTISPSALHLPHIKGQDNFGGLLSGDRLKAFASVDGQREDSENW
                     DSSFGGELGTIKGLGHWSEMDLQEETIRPLPKKTEKTRESRLRGQEHHGHRRQRSGKG
                     GSNSSQPKSPVKPLGTKFELPPRPDIIYREQSTEDYSDLFADNDHVFDRRLSLANKDT
                     PQLFHPSDLTSSAPKSTQRPTGGSSTRRSKTTSPASASSSSRPALLPPAEPDPPVRRA
                     RSTVEITKFAEDEGDEDFSDIFGADGDPLVESEESDRGSETDGQVGGGGGGGGQLILS
                     RLSNNSWLGDDEDEDDPFAMMDPGWDEMDLEANIARDRHARLAERVEELVRSMKITKG
                     EEVVGKLAEDLLALLWENDEVKALIIGAHGLLPILEILETCTLKSRQHMILQLLKIVN
                     AIILDDVELQENLCFVGGIPIVTKFAARQYSNEIRLEAAAFVRQMYQTSTLTLQMFVS
                     AGGLNVLVEFLDEDYETSQDLVLIGVNGIWNVFELQGPTPKNDFCRIFSRSKILDPLA
                     AILHKVLDEDRDELSELVEGRIVNIFYLFSQAEPYVKEAVAERQVLKTVLKDLRRMTP
                     SHQITMLKFIKNMSMCSTVLDALHSADAIDFLIDVLSHSMKKGQKNFREISNQVLNTM
                     FNLCRLSKERQEYAASNGIIPLLLKIMRTDRPPKEFVLPILCDMAHSGSKGRRYLWQN
                     NGLDFYVSLLADQYWQVTALDAIFVWLQEETAKVESHLLDGNFTAAIISCFNPTKANA
                     FDPNLLEPLLKLLRLSPATAASLAKAEMYAGIAQKLSHKKAVVRLNLLRLVRNIMDGC
                     EANGLSMSALSASSTGRQLRMLFDDIQTLADKDPAVLVRNLASELIRSHIDVELQHDA
                     MSLSGLGLGASAGPGSSAGSGPRSRSGPRRNTSYTPPGLHLSMSMPPTPTQGHRLTQS
                     SSAYIEIAATPKRSAVGLTQERDPAFYRPRSRDGLPVTNIPRRISDTPPAGPASITTN
                     STTAANTSSSSSSSTTATTPTTTPAPPSKSRLPRTSTQYAASRPSLISAVSAPPPLSS
                     GGGTPSAGRRESLSASSVHGGGSGGSNYKENVLYHNHHHNNFNHVQGQSQSRAGRIRS
                     GSSVTVASNASSAAAGASGGGGASQYSASPTGGVFAAGAGGAGSGGLMPPAVVGPSAS
                     AAGGGGGNGKGGYGSAAGSSSREVSDGSGGGSGGKRRSRAPSSNSGSEGRWS"
     gene            complement(<1362045..>1363814)
                     /locus_tag="THITE_112327"
                     /db_xref="GeneID:11517171"
     mRNA            complement(join(<1362045..1362862,1363019..>1363814))
                     /locus_tag="THITE_112327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648805.1"
                     /db_xref="GeneID:11517171"
     CDS             complement(join(1362045..1362862,1363019..1363814))
                     /locus_tag="THITE_112327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648853.1"
                     /db_xref="GeneID:11517171"
                     /db_xref="JGIDB:Thite2_112327"
                     /translation="MDRLPEEIIAMIITHLAADPPNHHHHGNPGAAPPRTTGLAAYAA
                     VSRRWQPRIEALTFAHITLTPARLASPLAARALTPDRVRRLVRSIYLDVLLPPYDEAA
                     RRRVEDDAERAANDAVFTDAVRRLFALLAAAGAGEDYRPKIHLSLAARCESDMEDWEG
                     RHRRRPVSPTAPRDLFERRYESSYLDLRLATPGQSAEGEAEALPEVHCILGFGVQRID
                     SPLLHYRHFAPRALCLMASRMSGLEQVYWVLRDKEKRDVELRKKLRADFADSLQALPP
                     TLRSFHLLYGGPAPKDHFFERPSILDEADPDDHDKLSLALHKLSQRLFEFHLTADVGP
                     EIFWPSGSAELDDQQPQHGENAGDSPSPPYWPNMMYYGINPGAISPSGRWRFRRRTDS
                     FGDDSDHVVESDVSDSSDVAPGDEIHRAFREEVDPDAVRPLLLAAARAAGRMPALRHM
                     SFVIGSPPTNAGWLRVSYTTAPSSRRSARLGGGDAPRLVVGGRPLSHLDLEKEVVEAW
                     EEAARKHSDAELRCALVTKRLFDRYWAAP"
     gene            1364377..1365519
                     /locus_tag="THITE_2106764"
                     /db_xref="GeneID:11517073"
     mRNA            join(1364377..1364529,1364755..1365519)
                     /locus_tag="THITE_2106764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648806.1"
                     /db_xref="GeneID:11517073"
     CDS             join(1364481..1364529,1364755..1365392)
                     /locus_tag="THITE_2106764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648854.1"
                     /db_xref="GeneID:11517073"
                     /db_xref="JGIDB:Thite2_2106764"
                     /translation="MTRTVVYGSALVAVVAATAMTLTAILSPRWVSYTVAAPAGGTVT
                     DTIGLHHRCASSTGRCLPFPDEARCQAGGSEGRAFCSMWRSAGFLMNLAAVAELATVV
                     GFLAVMAGGKVKRQGGWKVLGGMLGAVAAAELVAMAVVVSCCLCLFLFLFCYLTPVVL
                     RSAADGMKAYLFDHNELFLVPGYRLDSSWYLCMLSAAVALLAAAGLAISAFVLPPEDG
                     YQLLSDPSGV"
     gene            <1366385..>1368390
                     /locus_tag="THITE_112329"
                     /db_xref="GeneID:11523510"
     mRNA            join(<1366385..1366419,1366648..1368298,1368379..>1368390)
                     /locus_tag="THITE_112329"
                     /product="Delta(24(24(1)))-sterol reductase like protein"
                     /transcript_id="XM_003648807.1"
                     /db_xref="GeneID:11523510"
     CDS             join(1366385..1366419,1366648..1368298,1368379..1368390)
                     /locus_tag="THITE_112329"
                     /note="orthologue of Saccharomyces cerevisiae ERG4;
                     orthologue of S. cerevisiae ERG4"
                     /codon_start=1
                     /product="Delta(24(24(1)))-sterol reductase like protein"
                     /protein_id="XP_003648855.1"
                     /db_xref="GeneID:11523510"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="JGIDB:Thite2_112329"
                     /translation="MSGRYSLRQTPRKKELFDGMIETPARRSIRRKTPLPPESDDAES
                     TSASEAMEAKSVRQRRAPKFTEHVGEPTPPESPVERDVQPSTKAAPTQANGAASEGGG
                     SAEEKKKKKVVDGWAPGTDPKVDLSGEYEFGGPWFVSLMMVGFPVLMWYMWIGATAYD
                     GRFPTPAPGQSWADFGRHLVHLVYTGAFPHAKAWLMYWTFFVLEGAFYCLMPGVWAYG
                     KPLPHEGGRQLKYYCSAYTSFYTTIALVLGLHFSGLFPLYTILDEFGPLLSVSIISGW
                     LVAIVAYVSALARGAQHRMSGNHVYDFFMGAELNPRMFGILDFKMFFEVRLPWYILFL
                     ISLAAAARQWERYGYVSGEVGFILMAHFLYANATSKGEELIVTTWDMYYEKWGFMLIF
                     WNLSGVPLSYCHCTIYLANHAPEEYRWSRPALAALYVSYLFVYWVWDSANSQKNRFRA
                     MSRGKLIKRNTFPQVPWQTLHNPKTIETGLGDKILADGWYGLARKVHYTCDVYFAVTW
                     GLVTGFKSPFPWFYPVFFTVMIAHRAWRDITRCREKYGDAWREYERQVPYLFIPYVF"
     gene            complement(1369157..1369277)
                     /locus_tag="THITE_t38"
                     /db_xref="GeneID:11516739"
     tRNA            complement(1369157..1369277)
                     /locus_tag="THITE_t38"
                     /product="tRNA-Lys"
                     /note="Anticodon: CTT"
                     /anticodon=(pos:complement(1369242..1369244),aa:Lys,
                     seq:ctt)
                     /db_xref="GeneID:11516739"
     gene            complement(1369700..1371215)
                     /locus_tag="THITE_57625"
                     /db_xref="GeneID:11521513"
     mRNA            complement(join(1369700..1370144,1370201..1370464,
                     1370535..1370664,1370790..1370802,1370964..1371215))
                     /locus_tag="THITE_57625"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648808.1"
                     /db_xref="GeneID:11521513"
     CDS             complement(join(1370080..1370144,1370201..1370464,
                     1370535..1370664,1370790..1370802,1370964..1370977))
                     /locus_tag="THITE_57625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648856.1"
                     /db_xref="GeneID:11521513"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="JGIDB:Thite2_57625"
                     /translation="MTDACPVYAPFFGAMGCTAAIVFTCLGASYGTAKSGVGIAAMGV
                     LRPDLIVKNIVPVIMAGIIGIYGLVVSVLISDALTQDNYALYTGFVQLGAGLAVGLAG
                     MAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALLMNSKATLNIS
                     C"
     gene            1371319..1372165
                     /locus_tag="THITE_2106775"
                     /db_xref="GeneID:11517707"
     mRNA            join(1371319..1371616,1371678..1371694,1371750..1371858,
                     1371920..1372165)
                     /locus_tag="THITE_2106775"
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /transcript_id="XM_003648809.1"
                     /db_xref="GeneID:11517707"
     CDS             join(1371500..1371616,1371678..1371694,1371750..1371858,
                     1371920..1372063)
                     /locus_tag="THITE_2106775"
                     /codon_start=1
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /protein_id="XP_003648857.1"
                     /db_xref="GeneID:11517707"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="JGIDB:Thite2_2106775"
                     /translation="MSAQNESAAWPKAEDPALVQELLDCVQQASHLRQLKKGANEATK
                     SINRGTSELVILAADTQPLSIVLHIPLISEEKNVPYVYVPSKVALGRACGVSRPVIAV
                     SLTSNESSSLQPKIRALRDKVERLAM"
     gene            1373422..1375336
                     /locus_tag="THITE_2106778"
                     /db_xref="GeneID:11517023"
     mRNA            1373422..1375336
                     /locus_tag="THITE_2106778"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648810.1"
                     /db_xref="GeneID:11517023"
     CDS             1373428..1375104
                     /locus_tag="THITE_2106778"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648858.1"
                     /db_xref="GeneID:11517023"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="JGIDB:Thite2_2106778"
                     /translation="MGALGGVAPASVAPVSVGDEEEEDAAGEVASETEGGPAASGEDG
                     GDAAAAAAAAGRRSSVAQDVIGRRGSYGRFAQRWFSRAGWAMRQKRQLGLSADGAPAP
                     AGGKKAAGTAVPMTSSVPDDADGSAAAISLLPKLLRTSQILFGSSKTFYFAYDHDITR
                     SMANPRVPEAPLQPLHEHVDPDYFWNRHMMQPFIDAGADSLALPLMQGFVGQRTFVVD
                     SHPPQVDEGAQDDSVELSDFSSSRAASPSSPHPPPPAPGKATANMRPTEKKFDITVIS
                     RRSIKRAGLRYLRRGIDEDGNVANSVETEQILSPADAAWDPAARVYSFVQTRGSIPLF
                     FTQSPYSLKPVPVMQHSADANFAALKKHFAALRRRYGSVQVVSLVEKHGVEEPIGRLY
                     EETIQRLNEESGTKEDKDKVGFEWFDFHAVCRGMKFENVSLLLQTLGSKLEDYGSYVS
                     VNDRLVAKQKGVLRTNCMDCLDRTNVCQSSFAKHMLDLQLREQGYDMAAQLDQENVWF
                     NTLWADNGDAISKQYASTGAMKGDYTRTRKRNYRGALTDAGLSLTRLFNG"
     gene            complement(1376153..1377642)
                     /locus_tag="THITE_2106779"
                     /db_xref="GeneID:11517022"
     mRNA            complement(1376153..1377642)
                     /locus_tag="THITE_2106779"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648811.1"
                     /db_xref="GeneID:11517022"
     CDS             complement(1376258..1377526)
                     /locus_tag="THITE_2106779"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648859.1"
                     /db_xref="GeneID:11517022"
                     /db_xref="JGIDB:Thite2_2106779"
                     /translation="MVGKKRAPSASKASHVKQKEVKKPAHLANSASSAPAAAKTTTRH
                     NTKSQGEPDGQLQLTPSNPDRKQQQRVLDVFRHAFSDTLASPNFTAALQSVKQALYDR
                     DFARAFNDPESLAVYAARWSPTRALCYASVLTGIQKHLELLFTRKGDDDGDGEHEATP
                     EPPSQQLHVLSIGGGAAELVALSAFLNANPSLSGAITLLDSGPWATVVTQLTNALTTP
                     PPISKYASAAAKQANTAFVPASHLQPTFLQRDALTLTQAELTSLLGGPAATAPRLITL
                     LFTLNELFTAGGIGKTTAFLLALTAAAPAGSLLLVVDSPGSYSEASVGGGGSDKRRYP
                     MQWLLDRILLGTRREPVVGDEPPGTCWAKLESRDSEWFRLAEGGAGQHQQQQRLEYPI
                     ALENMRFQMHLYRAERASSGESGDGDRDGE"
     gene            1378677..1381855
                     /locus_tag="THITE_2106781"
                     /db_xref="GeneID:11515675"
     mRNA            join(1378677..1378967,1379121..1379167,1379268..1379363,
                     1379440..1379524,1379596..1381254,1381320..1381855)
                     /locus_tag="THITE_2106781"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648812.1"
                     /db_xref="GeneID:11515675"
     CDS             join(1378914..1378967,1379121..1379167,1379268..1379363,
                     1379440..1379524,1379596..1381254,1381320..1381436)
                     /locus_tag="THITE_2106781"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648860.1"
                     /db_xref="GeneID:11515675"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="JGIDB:Thite2_2106781"
                     /translation="MGFSDVDQLAINTIRILAADATFKANSGHPGAPMGMAPAAHVLF
                     NKIMRFNPKNPKWVNRDRFVLSNGHGCMLQYALLHLYGYDVSIDDLKAFRTVDSITPG
                     HPEAHDTPGVEVTTGPLGQGISNAVGLAIAQAHTAAVFNKPGFDLIDNYTYCFLGDGC
                     LMEGVSAEACSLAGHLQLGNLIAVWDDNHITIDGDTNQAFTEDVLKRYESYGWHVLTV
                     EDGDHDLAGIEAAIKKAQEVKDKPTLIQLKTTIGFGSKQQGTHGVHGSPLKADDIKQL
                     KEKFGFNPEQSFVVPQEVYDICHKAAAAGAAAEEEWNKLFAKYGEQYKAEHDELARRL
                     RGDLPEGWEKHLPTYTPADAAVASRKLSETVLNKIFEAVPELVGGSADLTGSNLTRWK
                     GAIDFQPPATGLGTYAGRYIRFGVREHGMGAILNGMAAYGTVIPYGGTFLNFVSYAAG
                     AVRLSALSRVRVIWVATHDSIGLGEDGPTHQPIETLTHFRALPNCMVWRPADGNETSA
                     AYYVALVSKHTPSILALSRQNLPQLEGSVIDKAIKGGYVIHEQEGADITLVSTGSEVC
                     ICIDAVKVLAEKHNIKARVVSMPCFEVFDTQPKEYQLSVLPDGIPSLSVEVMSTMGWE
                     RYTHEQFGLNRFGVSGAYKDIYKKFEFTPEGVAKRAVATVNFWKNVPNIRSPINRAFQ
                     QIL"
     gene            <1382079..>1384118
                     /locus_tag="THITE_2041094"
                     /db_xref="GeneID:11515419"
     mRNA            join(<1382079..1382129,1382237..1382842,1382937..>1384118)
                     /locus_tag="THITE_2041094"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648813.1"
                     /db_xref="GeneID:11515419"
     CDS             join(1382079..1382129,1382237..1382842,1382937..1384118)
                     /locus_tag="THITE_2041094"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648861.1"
                     /db_xref="GeneID:11515419"
                     /db_xref="JGIDB:Thite2_2041094"
                     /translation="MDDEKLKAEKMAAAKKKFEQMRKAKAKKAAAGGSSSGKKGEAAA
                     TTATTATEEAPSSPATDAVSEKQDEDQQQQPQEQEQHQDQDKPTEEFPPAAEPEAKEA
                     AAAPTTSSSGGTTPSLAQQSKARSTSFRQGSVSLSTGGGPLSPGLGVLSPEGETAPDI
                     YRKHVLRIEELERENRALAKEARDAEKRWQKAEAELADLREGEGGHGGAGLGEGEVGK
                     LKNELAALQRQNAQLQAQLARRHGSSPSISMSTAPATSTELEAQLRSKSATIETMSLE
                     MSRLRAQVERLSVSASAPSEQIAALEEKLARADKTAQRAQRELHDLKLELEQASKRAV
                     KEGSERASAETKLRALEREAAAAAAARDELARRADALEKKVATLTTLHREQDGRSQAL
                     RREKERLEKELGELREKVDRVEAENARLRKRDAAEGGGDDDGVDELVEEERLRLERRV
                     RELEAENTDLRRGIWHEKRKEMQLGPDEASAAAGIGRFETVDLGGGGGGGGGGGGGVL
                     FSSARKGHAGGGGGLSDFLASGLNALTGAAGGGAGHAQYDDLLEDDDMEFDEEAFRRA
                     REEEQKKRIERIKEIKRSLKNWEGWRLDLVENRRGGGEGIGEIFEV"
     gene            complement(<1384759..>1385625)
                     /locus_tag="THITE_2030431"
                     /db_xref="GeneID:11523437"
     mRNA            complement(join(<1384759..1385046,1385101..>1385625))
                     /locus_tag="THITE_2030431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648814.1"
                     /db_xref="GeneID:11523437"
     CDS             complement(join(<1384759..1385046,1385101..>1385625))
                     /locus_tag="THITE_2030431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648862.1"
                     /db_xref="GeneID:11523437"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="JGIDB:Thite2_2030431"
                     /translation="TLTYPSPPESTTAILLLFHGLGDTPAPFTRLAENLRLPGVLAIA
                     VRGTAPLPGAALLLSSSSSSSSDGDAGGAKNQSSRSGSDGYGYGYHWGDDLRLDVAGG
                     GRGGGGPALDAADDPGFERARAWVMDRLIGEVLVARCGWEVGDVLLFGFGQGGALALG
                     LASALRMAGRNRVQERGEGGKAKFKGVVAIGAGLPPSMVPSVSGLGKAETPVLVCCGR
                     ESEVVDEDAVELLEREFKDVRVVRWKRASDGMPTNREEALPMMQFFAERLRSG"
     gene            complement(1385994..1388590)
                     /locus_tag="THITE_2106787"
                     /db_xref="GeneID:11515814"
     mRNA            complement(1385994..1388590)
                     /locus_tag="THITE_2106787"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648815.1"
                     /db_xref="GeneID:11515814"
     CDS             complement(1386348..1388312)
                     /locus_tag="THITE_2106787"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648863.1"
                     /db_xref="GeneID:11515814"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="JGIDB:Thite2_2106787"
                     /translation="MGETTPQVTSRAVDVERQDATDSDATVVGTDHPDAPIRDAPPLV
                     EDLEEENRPPTPRFIQDEGAWKRFKWVPYPVRRVIRSTVKWARGPPTPVRYRIEPLFP
                     LVQHAPIVLLDKYLPRKLHRAFAVIAYFAVWLVTFALLMRDGQNAAEIPAWGTPTLIG
                     CGSTYWASGNGCGLDGVDCRPFTDAGFPFLCPANCASYQVLNPRAVGDQEVIYRSLVI
                     GGPPASGEGPAVYRGDSYICGAAIHAGVISNANGGCGVVKLIGQQTNFNSTAANGITS
                     IGFDSYFPLSFTFESGIECEFHDMVWSLLAVSVVFTAVFSLFVTSPALFFFPVFTVLY
                     WTVGMATDTPNHSDIPSLFSTEIGNFLPAAFVGWVMYDKMGIRRTLKGLTAQVEKTVL
                     WLGAAWVGALTNYTLDFIPIQRLTPHDLNQQPGARAALAIIVLILAVIAATQVWFFRQ
                     EGRLIRNLQLYALLVLGIIISVTLPDLNLRIHHYILALLLLPGTSLQTRPSLLYQGLL
                     VGLFVNGIARWGFDAVLQTDYALLGDAPMGTALPSIRTPTITANSSITFSWDPPPGAY
                     DGISVLVNDVERFRTYFYDTAVVVTNVTWVREAGLRAKEYFRFAWMKGSSRGDYTRAG
                     TWDATGQFWTPMAPGPSRLRARDEAELLRV"
     gene            1389239..1391414
                     /locus_tag="THITE_2106788"
                     /db_xref="GeneID:11521481"
     mRNA            join(1389239..1389778,1389843..1391414)
                     /locus_tag="THITE_2106788"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648816.1"
                     /db_xref="GeneID:11521481"
     CDS             join(1389580..1389778,1389843..1391263)
                     /locus_tag="THITE_2106788"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648864.1"
                     /db_xref="GeneID:11521481"
                     /db_xref="InterPro:IPR002616"
                     /db_xref="JGIDB:Thite2_2106788"
                     /translation="MRFELLQTALRDGAAARLGRLAFTGRRAIDTPNFIGVTSRGALP
                     HLTPDNVVRHLQTSGAFMALEDFIERPQQYSKRVPPIFQTPANTKHSSRLHAFTAMPQ
                     SVTTVLSARRHPAVQSPIGNTNNSVSIFTSTGFQVLTTKEYLSAVQCLSPDIAIPPSD
                     LTYGPLAPNSKRALRMAERTDEWVVEWFDELPPDSRISTFAPVLPVPYSIQWEYLSRL
                     AEDYLPSSRLSGLAVYDPDLLPDLADYCAPLLPLPRLSLSNPPTPHHILRQIALGIDL
                     FALPFINTLSDAGLALDFTFPPPPPPPPSSTTSSPTTTTTTTTTTTPRPLAIDLADPS
                     NATSLAPLSPSCSCYACTSHHRAYVHHLLSAREMLGWTLLQIHNHAVVAAFFAGVRAT
                     LAGTDSANAAPANNATTTTTAAGSSPGPGESVGAAGAGVISDAAAGSETTSSSLSSPS
                     TTTTTFEQAVRQFALAYEAEFPEGVAQRPRARGYHYKSVGGGEGRRNKPAWSKLNDGG
                     VGDGGAETPVDGGAETPVDGGAETPVDGEGV"
     gene            complement(1391414..1395225)
                     /locus_tag="THITE_2106790"
                     /db_xref="GeneID:11517514"
     mRNA            complement(join(1391414..1393876,1393930..1394158,
                     1394217..1394600,1394655..1394851,1394910..1395028,
                     1395108..1395225))
                     /locus_tag="THITE_2106790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648817.1"
                     /db_xref="GeneID:11517514"
     CDS             complement(join(1391565..1393876,1393930..1394158,
                     1394217..1394600,1394655..1394851,1394910..1395028,
                     1395108..1395109))
                     /locus_tag="THITE_2106790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648865.1"
                     /db_xref="GeneID:11517514"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="JGIDB:Thite2_2106790"
                     /translation="MFEKSLYDLIRGLRNHKGNEKEYIQSCLKECRSEIRSQDMDVKA
                     TALLKLVYLEMVGHDMSWASFHVLEVMSSQKYHQKRVGYLAAVQSFRPDTDVLMMATN
                     LLKKDLSVATPTVISLPIAALPHIVTPSLAMSLLGDLLPRLSHSHAAIRKKTVVTLYR
                     MALVYPETLRAAWPKIKERLMDGDEDPSVTAAIVNVVCELGWRRPHDFLPLAPRLFEL
                     LVDGGNNWMAIKLIKLFATLTPLEPRLVRKLLPPLTNLIRTTPAMSLLYECINGIIQG
                     GILGEGEDFSAREEVASLCVSKLRGMVSVNSDPNLKYVALLAFNRIVVTHPFLVAQQE
                     DVILECIDSEDITIRIKALDLVQGMVSSDNLVSIVSRLMRQLKASSAALSQRQNGLEG
                     QDHETDSSDEGIADSRWRRKTQESTPPLPDDYTVDVIGRILRMCSQDNYANMVDFDWY
                     IDVLTQLVRVAPTPRARDPDLDASKSRTPGDISEKIGNEIRNVAVKVKAIRAAAVRAA
                     ELVIARMSSEVSLSRTMVSGALKPVAWVVGEYALQLLSPDDTLRHLLDLAPRIADPEV
                     LATCLQAILKLLAHVAGDNRALWTPERKSTVALQMARIIHVLEPFALHPYLEVQERAV
                     EFIELLKLTAEAAAGQPPSTDEVQQDPPLLLTQAIPSLFAGWELNSVAPGTQQNVPLP
                     DDLDLDEPIHPNLDGLLAQADSLMLPTQGEDEFEVYYNQKPPPTSMSSEPAINRLLDA
                     PEEVSSSYQHAEESYLDPDIVARRKAERMERYRDDPFYIPDSARSGGASTPIHNILQK
                     ENGPDLDIDSIPIMQLDLDRLSLSGRGTPAAEKQQQQQPAKPKPRQRIVVAADETLGF
                     GGSGSGLSTPRTAAAYDSETNSINNNNGQPRKSKTATAAAGASKRPKQQSLLQVDSSH
                     LGDLSLDGGGGDALAHERQQREEAEMAQALREVQRLRLEMQRANERIQVAQGVPAEGV
                     VVAAKKKKKTRKMGAGAGKKEGAGTGAGSGAVEGGEGPDTEGVVKAKKKKKKAPTTGD
                     GGGGSGEGEAAGVGGEGEAAPAAKAKKKKARRVVKLDDDGDAAAAAEGQS"
     gene            1395564..1397080
                     /locus_tag="THITE_2106794"
                     /db_xref="GeneID:11521094"
     mRNA            join(1395564..1396146,1396262..1396690,1396740..1397080)
                     /locus_tag="THITE_2106794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648818.1"
                     /db_xref="GeneID:11521094"
     CDS             join(1395769..1396146,1396262..1396690,1396740..1396985)
                     /locus_tag="THITE_2106794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648866.1"
                     /db_xref="GeneID:11521094"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Thite2_2106794"
                     /translation="MAPSLLRPTTQLSPEAALTLSQQAPTILRSSPSTVSSSALNALF
                     ASSEKPELWLQYENLILACLRTGDERSAHQCLERLVARFGPDNERVQALNGLVKEAEA
                     KNNSELEAVLKEYDQILSENDTNIPIAKRRIALLRSMGRLSDAASALVQLLGFSPTDA
                     EAWSELSDVYLSQGLYPQAIYAMEEVLVLAPNAWNVCHPTTAIARDLSPMLMQPVQIH
                     ARLGELHYMNATAPGAGSGSYQKSMAEAIKRFSRSIELCDDYLRGYYGLKLVSQRVLR
                     DPGKPPVRSGDSEFALPDRSTIERLNELATAKLSEIVRRSTAQDRGWRGYSEAEIAAA
                     RELLSGDASASLAIKR"
     gene            <1402036..>1402588
                     /locus_tag="THITE_2042902"
                     /db_xref="GeneID:11519052"
     mRNA            join(<1402036..1402377,1402451..>1402588)
                     /locus_tag="THITE_2042902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648819.1"
                     /db_xref="GeneID:11519052"
     CDS             join(1402036..1402377,1402451..>1402588)
                     /locus_tag="THITE_2042902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648867.1"
                     /db_xref="GeneID:11519052"
                     /db_xref="JGIDB:Thite2_2042902"
                     /translation="MEAAQKAKEEAEAEAARKAAEEAEWRKKLEAEAKLKAEIEAREK
                     LEAERKAAEEAKAAEEAAKKEQEALKKRLLEEAKAKVEEAAQKKEKPPIKFKDAVGRK
                     FSFPFHLCQTWQGMEELIKQAFLHVDVIGPHVQEGHYDLIGPDGEIILPAVWEKVIQP
                     "
     gene            1402627..1404059
                     /locus_tag="THITE_2169213"
                     /db_xref="GeneID:11523459"
     mRNA            join(1402627..1403010,1403215..1404059)
                     /locus_tag="THITE_2169213"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648820.1"
                     /db_xref="GeneID:11523459"
     CDS             join(1402808..1403010,1403215..1403230)
                     /locus_tag="THITE_2169213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648868.1"
                     /db_xref="GeneID:11523459"
                     /db_xref="JGIDB:Thite2_2169213"
                     /translation="MPIPPPPVGAGWPGMAGGVPGPRVRPGMEPQIVQVEPGKPPKKR
                     DKGGAPSSMLGWMAGSKPKAAGKKKSKH"
     gene            complement(1404051..1405254)
                     /locus_tag="THITE_2106801"
                     /db_xref="GeneID:11521391"
     mRNA            complement(1404051..1405254)
                     /locus_tag="THITE_2106801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648821.1"
                     /db_xref="GeneID:11521391"
     CDS             complement(1404188..1405120)
                     /locus_tag="THITE_2106801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648869.1"
                     /db_xref="GeneID:11521391"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="JGIDB:Thite2_2106801"
                     /translation="MRLAHWRLLRTRVHLERLAPTIPLSRTPSQTTQHLTGPPPAARS
                     LTTTTSLSSGSSWLLSALPSFIPNPSHPPPPKTLRARRLLPYAPSQIYTLIADIDSYS
                     RFLPHCTHSRVTRWTTPPQPTPSPPPPPPNSPTPSPAHAATTTTVRHPALADLTIGWG
                     PFTQTYTSRVYCVPASVVEAVSGAAETSIPAAVLRAAGYDVPQPQQQQQQQQQQRGAQ
                     GTCAGHGGSRDGETGAGGIFESLVTRWTVTPAAGPPGGESEKGWTEVALSVTFRFANP
                     ALGFAVGQVADEKVGEMVEAFEGRARELFGPRRA"
     gene            1405577..1408165
                     /locus_tag="THITE_2106802"
                     /db_xref="GeneID:11515530"
     mRNA            join(1405577..1406934,1406988..1408165)
                     /locus_tag="THITE_2106802"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648822.1"
                     /db_xref="GeneID:11515530"
     CDS             join(1406040..1406934,1406988..1407934)
                     /locus_tag="THITE_2106802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648870.1"
                     /db_xref="GeneID:11515530"
                     /db_xref="JGIDB:Thite2_2106802"
                     /translation="MELQTGSQARSPSTMTLSFPIIFLLSTNLGSEELQRLEEQIPTL
                     TYDINEAEIVLGKVFRKERALFELRKHKLATEEVDPLERSAPASPNPKRAKLMTPAPA
                     SSDIDSDTASEGEIQRRLAGPSPAEPTVRVVKLAWFTDSVKTGVVLPTDDYLVYEGRK
                     VPPTAPAKAPQPRPAEKVAEVMKRALADASSSPRSPQPRPSHGRRGETYASHPVRPLL
                     RQTTSEHDMDTQLPPIPDYLHTPYSCQRPTPVHPPNEAFMAELDKIKTARTLTGDKIG
                     VRAYSSAIATIAAYPYTIQTAQEVARLPGCGSKIARLFQEFKDTGQIREAREDETDPK
                     LAVLKLFYGIWGVAETTARDFYNRGWRDLDDIVEYGWDSLTRVQQIGVKYYDEFQTKI
                     PRAEVEAIANTILEHANRIRQGFQMVIVGGYRRGKLESGDVDVVLSHPDEAATHNFVE
                     RIVVSLERGRYITHTLSLSTANSERGQAPVSWKGDNRKAGTGFDTLDKALVVWQDPVW
                     TTGEARNPNPHRRVDIIISPWKTAGCAVLGWTSGTTFQRDLRRYCKKELSLKFDSSGV
                     RSRKDGSWVDLESGPDGKPAPDMLTAERRVFAGLGLQWRPPEERCTG"
     gene            1408758..1409807
                     /locus_tag="THITE_2106804"
                     /db_xref="GeneID:11515649"
     mRNA            join(1408758..1408930,1408998..1409155,1409312..1409483,
                     1409597..1409807)
                     /locus_tag="THITE_2106804"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648823.1"
                     /db_xref="GeneID:11515649"
     CDS             join(1408902..1408930,1408998..1409155,1409312..1409483,
                     1409597..1409681)
                     /locus_tag="THITE_2106804"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648871.1"
                     /db_xref="GeneID:11515649"
                     /db_xref="InterPro:IPR001129"
                     /db_xref="JGIDB:Thite2_2106804"
                     /translation="MAITIPDEYGYVLLAASSTFIVSFFHSGLTSRKRRAAGIKYPIT
                     YASPEQAEKDPKAFAFNCAQRAHANFMENHTSALAAMLISGLKYPVYAAGLGAVWSVS
                     RVFYALGYVNRGPQGREAGAAVGALANLTLVGMAVYTGLGAALKW"
     gene            1410562..1413399
                     /locus_tag="THITE_2106808"
                     /db_xref="GeneID:11517550"
     mRNA            join(1410562..1410586,1410647..1410826,1410884..1411014,
                     1411082..1411853,1411919..1413010,1413087..1413399)
                     /locus_tag="THITE_2106808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648824.1"
                     /db_xref="GeneID:11517550"
     CDS             join(1410734..1410826,1410884..1411014,1411082..1411853,
                     1411919..1413010,1413087..1413317)
                     /locus_tag="THITE_2106808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648872.1"
                     /db_xref="GeneID:11517550"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="JGIDB:Thite2_2106808"
                     /translation="MDYDALKEQWGEVEDRDGVRLSWNVFPSTRMEASRLVVPIGALY
                     TPLKEKPDTPLLQFEPVTCKQPCRSVLNPFCQVDVRARLWICPFCLSRNPLPPHYKDI
                     TANAIPPELHPSNTTIEYRLSRPAPSPPIFLYVVDTCQEEDSLAALKESLIMSLSLLP
                     EHALVGLITYGTMAQVHEIGYTECAKSYVFRGSKEYSAKQVQEMLGLVQPVLRPGMPP
                     HQAGRPMMGPAARFLLPVAQAEFQLTKALEQLQKDPWPVTSDRRNLRCTGVALSVAVG
                     LLETSFQNAGGRIMLFAGGPATEGPGMVVGPELREPIRSHHDIDRDNVKYYKKALKFY
                     DNLAKRAAHNGHTVDIFAGCLDQVGLLEMKGLCNSTGGHMILTDSFTSSMFKQSFIRI
                     FEKDADDNLLMGFNAVLEVLTTKELKVTGLIGHAVSLNKKSTSVGETECGIGNTCSWK
                     MCGIDPKASYGIYFEIAQGGPSQHPQSQKGMIQFLTYYQHSSGQFHLRVTTIARNLSG
                     PAGDPAIAQSFDQEAAAVLMSRIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDD
                     PSSFRLEKNFTLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVSNSLIMIQPT
                     LDSYTFDQEGGVPVLLDSTSIQATHILLLDTFFHILIFHGETIAEWRKAGYQDQEGYE
                     NFAALLEQPKEDARELIMDRFPLPRFIVCDHGGSQARFLLSKLNPSTTHTSGAGAYGG
                     VGAQSAQTIFTDDVSLQTFMEHLMKLAVSGTN"
     gene            1414399..1416139
                     /locus_tag="THITE_2106815"
                     /db_xref="GeneID:11515678"
     mRNA            join(1414399..1414547,1414613..1414646,1414750..1414870,
                     1414986..1415310,1415392..1416139)
                     /locus_tag="THITE_2106815"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_003648825.1"
                     /db_xref="GeneID:11515678"
     CDS             join(1414544..1414547,1414613..1414646,1414750..1414870,
                     1414986..1415310,1415392..1415405)
                     /locus_tag="THITE_2106815"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_003648873.1"
                     /db_xref="GeneID:11515678"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="JGIDB:Thite2_2106815"
                     /translation="MPPKFDPNEIKIIHLRATGGEVGASSALAPKIGPLGLSPKKVGE
                     DIAKATGDWKGLRVTVKLTIQNRQAQVSVVPTASSLIIRALKEPPRDRKKEKNIKHNK
                     SVSLDEIIEIARTMRFKSFSKTLKGGVKEILGTAFSIGCQVDGKSPKAISDAIEAGEI
                     DIPEE"
     gene            1419554..1425038
                     /locus_tag="THITE_2106817"
                     /db_xref="GeneID:11515604"
     mRNA            join(1419554..1419593,1419715..1421355,1421425..1423419,
                     1423475..1424087,1424147..1425038)
                     /locus_tag="THITE_2106817"
                     /product="glycosyltransferase family 41 protein"
                     /transcript_id="XM_003648826.1"
                     /db_xref="GeneID:11515604"
     CDS             join(1419857..1421355,1421425..1423419,1423475..1424087,
                     1424147..1424845)
                     /locus_tag="THITE_2106817"
                     /note="CAZy_ID 269902"
                     /codon_start=1
                     /product="glycosyltransferase family 41 protein"
                     /protein_id="XP_003648874.1"
                     /db_xref="GeneID:11515604"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Thite2_2106817"
                     /translation="MLPLVQMHQMVQPPVDFLSHRQVQLRPDYAPHHNGSHLAQPSPR
                     LHGTDSTPRAFAIRSAQHVPALHRITTNFTRLHAHDQAEHSLRRKTPNGTIDNGYDGA
                     LAHLASGPPPLKHMIVPASSQIFPTAMVHRPANPSVDAMFQQPQVGPWPYSGTAPPAQ
                     FDAGMEALNGSTGTPQGWGMGSPNGALGPAPGDGAVFPQPMPQGNYPATPLQPLLGPE
                     YQQPLSQTIYSPGGYQQPAAWRDGGLGSRTFIPLANNYTPQNSVDCAFMSPQSTIHHG
                     LANAPGLGQPHPFSLPLPSHPLDDGFARYGQNHLAQRAAHPAHGSVPMMPMAGYLAKA
                     AAKGGAGSAARFREWALQSAHKAYNDLLLYLTSAKKANHVRSTSGSKTSSKMVVYPKP
                     SITGSGSENAMRSLSGSVEPTASHAHMMAQKEAAARAFACGLPQQPYQELGSPVLNAK
                     TSLDMLSTLCEQSGWKWVEGMLLGGCLHYGLERYEEALEWFRRIMTLDESHVEAISNI
                     AATLYCLNRHEEAEQHWVRAIKLRPSYLEAVEHLVSFLCSVHRSAAAVNAIEFVQGSL
                     KIRDESGVPRDPASETASDADSSSTTTLADSNPDSYVLDSEASDSPDRRFASMVENSK
                     APGFGSSGYRIPGSENGRMMLLIHAKGNILYSLKDIDRAAEAFEEVVLIGAGRQFRGI
                     RSLIQRIQTVLAPRDPMSGRHPGSPRESLSAPLLLTPDKAKLTAQFVFAPTGGQLPGL
                     QHVSEGAHKKSVVATTSNSLLSLAKIYQDAMSGGGVSSGLARQPAGVGDILSLYYLSL
                     SLQESPSTANNVGILLAGVQQTSPAPSLSVSDLGQAASIPGIVPGSGLALALAYYRYG
                     LTLDPKHVHLHTNLGSLLKDIGQLDMAISMYEQAVACDGTFDIALTNLANAVKDRGRI
                     SDAIKYYQRAVAANPDFAEAVCGLSTALNSVCDWRGRGGVLLAGGKYDRWHVDDKGML
                     QDVKSRGQGSGLMQRVVDIVRRQLKESASWGRGLLQEQSILQLAAQLRDAGARSSDRF
                     LDLEAELRKWAGRPGEGYRILRLIERATLAAMRRWYQEKHIMGVRSPGPYRRPKPPAS
                     LTIPSAPTVLPFHTFTYPLPAKDVRMISQRNALRISFSTLRSPWIPATVYEPPAPPSP
                     HLNVGYVSSDFNNHPLAHLMQSVFGMHDPKRVKAFCYATTVSDRSVHRQQIEREAPVF
                     RDVSAWSSDRLVDQIVKDNIHILVNLNGYTRGARNEIFAARPAPIQMSFMGFAGTLGA
                     EWCDYLLADATAIPPSTLRPHRINLTLGDVFRDEEDADAEDWIYSENIIFCRDTFFCC
                     DHKQSADGHNEKGMTWEEDQRRRWKMRKELFPNLPDDAIILGNFNQLYKIDPTTFRTW
                     LRILAAAPKAYLWLLRFPELGETHLRRTARDWSGEGVARRIIFTDVAPKQQHISRARV
                     CDLFLDTPECNAHTTAADILWSSTPLLTLPRYEYKMCSRMAASILKGALPKGEEGEQA
                     ARELIARDEKEYEEFAIRLANGLSYRPRVLPASAGAGAGAGVGSGGNAAGEVYGEGVG
                     RLAELRRLLFESKWTCALFDTRRWVRDLEEAYDIAWDRWVKGEGGDIYL"
     gene            1434279..1435852
                     /locus_tag="THITE_2106830"
                     /db_xref="GeneID:11519050"
     mRNA            1434279..1435852
                     /locus_tag="THITE_2106830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648827.1"
                     /db_xref="GeneID:11519050"
     CDS             1434538..1435716
                     /locus_tag="THITE_2106830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648875.1"
                     /db_xref="GeneID:11519050"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Thite2_2106830"
                     /translation="MPSDQALSKKGWEGEEDLRLLELHAAYGPNWTHIARGMGSKSAK
                     QCRERYTQQLRPGLNRSPISEEEGRRIMEMVQESGQRWAQIARNLGTNRSDNQVKNWW
                     NGAKRKETSKRQDAAQSQNQNQQYRHDYPPSPGLAALPERRGILPPIPLELPLRKDSA
                     TAAFEAQPHSSCRSYDVERPPSLVSDNGSSWSSSQPSSASSSPTTFSQPSLVPLHPSS
                     QHHPDGYSGVFHHRMEGFEPTRWTSTGFPPSACSPEPSVGCPSPAPTSPARGAPSSAT
                     TTHSHDYNLALPPLLLPQTKPDSNCYRDSPNSATSKPGSSSSSFGPVRRSSEILQPPS
                     QLSPLNRFAKTAPATPVTRASSSRWEPYATQRPSAAAHPQQHQGGEANAKGSLSFLLN
                     "
     gene            complement(1451043..1453237)
                     /locus_tag="THITE_2106835"
                     /db_xref="GeneID:11517339"
     mRNA            complement(join(1451043..1452409,1452460..1452546,
                     1452624..1452943,1453032..1453237))
                     /locus_tag="THITE_2106835"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648828.1"
                     /db_xref="GeneID:11517339"
     CDS             complement(join(1451307..1452409,1452460..1452546,
                     1452624..1452943,1453032..1453210))
                     /locus_tag="THITE_2106835"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648876.1"
                     /db_xref="GeneID:11517339"
                     /db_xref="JGIDB:Thite2_2106835"
                     /translation="MSARLAMLPLADGGAVDSAAAGKGRGGAEGTWYNPNLMQMAETL
                     GTVMMTGGATEGLPVAYNSCVLALIEGFYRLTRELRATEKELAELKISREMELEQFRG
                     MTEEWVEKSEAYRAEIKRLELLLAKESKDGVACVALARQGSLVDRAGSKRFQANLKRI
                     SNSEEQDVVKEKGCARSGVEPVGGPAQATTSYKTPGDTPRILDTQNDILVSRILEERE
                     MQEQRARQRLGRPRAAPVLIRLQGDQEPRNVRKEDVVRGQERRGSTTNTVAHEEAEGM
                     DPSRHGVAPPDDTRQRRPQLRVTTNLGLSTDNESTSSESDSSPQMLPAGVGFGAQSTH
                     IDKEKDGASRAEEGRFPLLATNEVTYQDPRMPVVQEQGYERVQYFSATILSPQPPAES
                     RAGPPQATVAQVPAALKELGDRKARTKHKRPSFLKGGTLSLHQPSRKQHRRGYSFEKG
                     DDEVLSVAPSPTWEPESYITGAKSPSEEGTGEADQYQAVMPGSAQGAVTQQSTTDMST
                     TAASFTSPGSGSVTHSTSTGTIKWVGNGNEDGNVDGGNAKAGDITDCYPGHNDV"
     gene            complement(1454519..1456452)
                     /locus_tag="THITE_2106837"
                     /db_xref="GeneID:11521126"
     mRNA            complement(join(1454519..1454906,1455051..1456038,
                     1456107..1456452))
                     /locus_tag="THITE_2106837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648829.1"
                     /db_xref="GeneID:11521126"
     CDS             complement(join(1454671..1454906,1455051..1456038,
                     1456107..1456208))
                     /locus_tag="THITE_2106837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648877.1"
                     /db_xref="GeneID:11521126"
                     /db_xref="JGIDB:Thite2_2106837"
                     /translation="MDLDIEMDVDDVQDVPIPAVPQAYTNDIITGEEQEPGEVEEALD
                     DRATGDVSDKALVPYKVHLRGLDTFNPDDVKAYLAEHYSTSQFNRIEWIDDTSANLIF
                     KSESVAQEALVALAAVDIADPTQLPPLEDIPAKSYSKKPESMLRVRVAVAGDKKVAGA
                     AERSRFYLLHPEYDPEERRRRGEFSRGKYRDRDDRYRRDRRGGRRRSDDDAEPFDVNL
                     YDDDASARATRTRRRSTSRRRSASSSSETKRASSRIRRNREKELFPGRTSGGGASLRD
                     RSASPPRDRDGDAEMDLDEDARAAAALRSRERGRSIKERLLRDNSAKELFPSKVSNKA
                     KELFPDKVSSSSSGKAQMDQISETTVLASASLADRITPRPTTAASGGFSIRGMASKRG
                     NDPGIAIKGTGPSVKELFPEKFGNAGKELFAEKLEGRGRRRQRAEDSFY"
     gene            complement(<1457134..1458297)
                     /locus_tag="THITE_2073368"
                     /db_xref="GeneID:11523488"
     mRNA            complement(join(<1457134..1457220,1457282..1457719,
                     1457834..1458297))
                     /locus_tag="THITE_2073368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648830.1"
                     /db_xref="GeneID:11523488"
     CDS             complement(join(1457134..1457220,1457282..1457719,
                     1457834..1458226))
                     /locus_tag="THITE_2073368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648878.1"
                     /db_xref="GeneID:11523488"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2073368"
                     /translation="MDNPLHRAAVHRALQRKSQGQQQAEHPRQHLAHDRAASQRLHLS
                     QFEIGRPLGKGKFGRVYLVRHRESGFICALKVLDKAQIAREKAEVHVRREIEVHSNLR
                     QPGILGFYNWFHDERRIFLVLEYAAGGELYRLLRREGRFPEKRAARYSAQVAAALRYL
                     HSKHVMHRDIKPENILIGLYGELKLADFGYSVHAPSNRRGTLCGTLDYLPPEMVAAGR
                     KKYSGAVDQWTLGVLTYEFLTGEAPFEDSPAMTTRRIERGDMKPLPASISKEAKHYVH
                     SLLVLDPSKRLSFDDALAHPWIVKHCGPR"
     gene            complement(1459351..1461839)
                     /locus_tag="THITE_2106844"
                     /db_xref="GeneID:11521195"
     mRNA            complement(join(1459351..1459521,1459692..1461839))
                     /locus_tag="THITE_2106844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648831.1"
                     /db_xref="GeneID:11521195"
     CDS             complement(1459946..1461655)
                     /locus_tag="THITE_2106844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648879.1"
                     /db_xref="GeneID:11521195"
                     /db_xref="JGIDB:Thite2_2106844"
                     /translation="MSAPSASPSPLQVAANAPPDDAKMPKGHCRYILLQPGIKGQRCA
                     CVNFSLNKDIPSATCDCGHLACYHNTEPDSSTDQRMELELLKKRLHQLEEQLSKGQDD
                     ILDGVVSRLNEVEDHLEKSREEFGEQIKGVYRNVSMSWRSIEQVERRSQQQDDQIRQI
                     YDKLRDHDEQLDRLHAGQLELRDADLSLEERIENLTETLEEEEEEWRLSVAAAAAAAT
                     GRPRRRSTSDTSRPNIPLGPLGAGAALLDALHSHPHRSPAGGPFTGTPSNRGPGDGNE
                     RDDRRLTPPNRPQRPSPRPTRFPASAPSTGAWTVHISLLPHAFVPMPFERNTNAYQRC
                     LSRGLHRMVAVQGRDAASFRAAVEKAFGQFLRGREWMPLQAKLCDAETLLGLPMLRPL
                     DENLLRQVNGGFDHAFLRRHCAVLDANGVIDSLYIAMRRHTISWHTLRHSPVFMEGLE
                     DCWKYDPLLDRDPYDGDMAVDDEDRPAAGDITTAVRPPLQTAGLKRPLTEMSRSNSFG
                     SAGAGSGSSVGTPAGGCASSGISPAGPDAGPDEARVKRSCPAPPPQGAIVGIRRRDPI
                     KTV"
     gene            complement(<1464631..>1465307)
                     /locus_tag="THITE_2125195"
                     /db_xref="GeneID:11521408"
     mRNA            complement(join(<1464631..1465074,1465188..>1465307))
                     /locus_tag="THITE_2125195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648832.1"
                     /db_xref="GeneID:11521408"
     CDS             complement(join(1464631..1465074,1465188..1465307))
                     /locus_tag="THITE_2125195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648880.1"
                     /db_xref="GeneID:11521408"
                     /db_xref="JGIDB:Thite2_2125195"
                     /translation="MWVPSGARCILVSRPARPRVAAFGSATPPPDNAAIGPFAPISAS
                     RASRASQMQLRRNDSGMTAGRPETCRVTATLRPYDPLIAISPGVLGGRGVPAAAVPED
                     QQGLTGQNSGCLLEWLLHDKDAAVRQPTSSQPLCLLSVSERLSVLLIMLPGAVNLECE
                     CNLDESEVIRVLFRGDADRKEVGEVRG"
     gene            <1469004..>1472840
                     /locus_tag="THITE_28849"
                     /db_xref="GeneID:11515758"
     mRNA            join(<1469004..1469642,1469868..1469946,1470064..>1472840)
                     /locus_tag="THITE_28849"
                     /product="uncharacterized protein"
                     /note="Has EST support. signal in last exon only"
                     /transcript_id="XM_003648833.1"
                     /db_xref="GeneID:11515758"
     CDS             join(<1469004..1469642,1469868..1469946,1470064..>1472840)
                     /locus_tag="THITE_28849"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648881.1"
                     /db_xref="GeneID:11515758"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="JGIDB:Thite2_28849"
                     /translation="PAPNCFAMLQLSRQGRSALRSRFICTSCRTLLLASGAPPPRLLG
                     VAARRCAARQYSTEPQEQKQQQQQQPQQQQQQQQQQQQQQHSAEKPDSRREVTPGAGQ
                     GPEKKPEHFKKEADNEREKKETEKEAEEHAVKETSKQAKAKAKAKEKAKARRKKAKLR
                     KKARKEARKKADLEAKKEAKKEVNKVKRAKKVAKERGPDSEAEQTPPPPGRRQLAGAL
                     AMLKRVLRQELQEDAPHISKAMVNSPAVVNSPAVVNSPAVVSTATQASGAAEKPTADD
                     QPVEKADVAKPARPRPSPLSPQPPKLLSALEPSPFLGRRRKRAAFTVSRIDARKLELT
                     PVEKPQPPVSRLAYGLDRVLFNPGVYHLQDPRSRVFNFDPYLARIMPIKEFDFNAIKQ
                     YVTSSKDTTLIKTAAEHGKKYTGSTSSMTSTLSHFHFLLSAWRRINPAMMSFKYPVDS
                     YNFTRITRAPAATFLHWKDGTYAIDADKEFDTANILSMLGKSMEKFLTLPKEKFEKYR
                     RSNSDQLTDEDRNGPESYHYTTMGDFLMRSQLDAYDPRLPGTGMFDLKTRAVISIRMD
                     ARDYHKGLGYEIRKRFGPWESFEREYFDMIRSAFLKYSLQVRMGRMDGIFVAFHNTER
                     IFGFQYIPLEEMDVSLHGQANLTLGDREFKLSVHLLNKVLDKVTAKFPGRSLRLHFET
                     RGANGGTPFMYIFAKPVTPPEIEKVQGAARATIEEFERRILGLARQEEPPPEEAEDDG
                     EEAMDELDAEDFDEAEDYEAASSGTWEDVMNKVEDELEDEEHGVTFVRDAIEDALQES
                     GLLRGTAPDDIPRYVDAFLDALTKDKGRPTVPGGPESAETARDQLTELVESKPPVEPA
                     EDGSEPDGTETSAPTAASEHEGSGHETRDGASAEAPATNASPAEEPTLKDLLIKLAGQ
                     IQAIPSEQRAAHDQNEDKLDESDEGVPAYAPQLRKIERLLSELTEQPKEGEAAEKDER
                     GRVVESGTVSVEAGGEVAEKKHEQAAEDDGKTTPEAAPTGPATTTEAGQGATQGLVEE
                     PTGGEVYGLILTIRNKVNGEYVVRPQRMRAQHQWTVEYAMEEISPARVHNLYQMVIRR
                     RRKALYPEERDDQSSAARWHAMFQGRLERYSERGRRFRSRENRRQRSQPVHVYGVDRP
                     YPYHAVFPEDAEDATKGAE"
     gene            complement(1473606..1475795)
                     /locus_tag="THITE_2106847"
                     /db_xref="GeneID:11519147"
     mRNA            complement(join(1473606..1473872,1473963..1474933,
                     1475021..1475795))
                     /locus_tag="THITE_2106847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648834.1"
                     /db_xref="GeneID:11519147"
     CDS             complement(join(1473822..1473872,1473963..1474933,
                     1475021..1475549))
                     /locus_tag="THITE_2106847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648882.1"
                     /db_xref="GeneID:11519147"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="JGIDB:Thite2_2106847"
                     /translation="MAANDYYNPHQKPLPDAAYHSSSSTSTFAPPYSSQPNLAPGARP
                     SQGVSASPFETVFDDHVYPASTHQPTPSSSQHRLSHQDTAYHGHSPVSPDDMTYNHSA
                     DDIPLQDSAPRPPPKDEEMQDHVYDAPRPKKPRRGRVRFGELGMLGSGRKKIPFVVYF
                     FTLVQAAVFIGEIVKNATETGSPIMIHPSFNPMIGPSPYILVNMGARFVPCMHNMEGI
                     QNANEPLPWPCPNSTSQDPTLPENRCTLSELCGFGGVPEPAYKPGTPLDTQPAPNQWF
                     RFITPIFMHAGVIHIGFNMLLQLTLGRDMEKSIGSIRFFLVYMSAGIFGFVLGGNFAA
                     TGIASTGASGALFGIIALTLLDLLYSWRDRVNPVRDLAFIVLDVVISFVLGLLPGLDN
                     FSHIGGFLMGLALGICVLHSPNSLRRRIGDDVPYASSHVSRGSAALGTPPGFLQNPVG
                     FFKGRKPLWWAWWLIRAGALVVVTVVFILLLNNFYIYRATCSWCKYLSCLPVSNWCDI
                     GNLQLPGS"
     gene            complement(1477854..1478768)
                     /locus_tag="THITE_2106850"
                     /db_xref="GeneID:11521480"
     mRNA            complement(1477854..1478768)
                     /locus_tag="THITE_2106850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648835.1"
                     /db_xref="GeneID:11521480"
     CDS             complement(1477916..1478686)
                     /locus_tag="THITE_2106850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648883.1"
                     /db_xref="GeneID:11521480"
                     /db_xref="JGIDB:Thite2_2106850"
                     /translation="MPSQQPPPPGPSPASQQQQQQPPPPAPPPPPAAAEESTPPPTPY
                     NKFTHNAAIAMAVLGPIALLLPTRGSATKSTLQNALLGGAAFWGFNQLAEDYTGKSIT
                     ARSAERWGAMLGVSFPSFSFSSSSSGGAGQGKEEEKEKENQKKKETESSTSLWLPTER
                     AVRNKELMEAERRRRAEAEGRPYKGKDTRGLWERLWMGGEEEGWKEKRLEEERKALES
                     GKGYGGLIMDQVREVWGGKDKSGREEGDGKGKGEGKKE"
     gene            complement(1478770..1480179)
                     /locus_tag="THITE_2106851"
                     /db_xref="GeneID:11519158"
     mRNA            complement(join(1478770..1479712,1479837..1480179))
                     /locus_tag="THITE_2106851"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648836.1"
                     /db_xref="GeneID:11519158"
     CDS             complement(join(1479062..1479712,1479837..1479884))
                     /locus_tag="THITE_2106851"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648884.1"
                     /db_xref="GeneID:11519158"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="JGIDB:Thite2_2106851"
                     /translation="MDQLREFFVGPEPQAQLRKCNALMRSHARQLDRDIARSKQQKAQ
                     AKKLILEADRRASRDPQRRAQARRDMRVFARELIRCRRMTARLYTVKAQLSSVQMQVN
                     EAFAVRKSEGSIRAGAGVMRDVNALIRLPEFAGTMQELSRELIEAGIIEEMVHENLPE
                     DGVADIEEEAAEREVDKVLGEVLKDRKATAGKLPTAPIAVEPVTATTEQEEEDDNTEA
                     MMDQMRNRLEALRN"
     gene            complement(1480180..1483412)
                     /locus_tag="THITE_2106853"
                     /db_xref="GeneID:11516733"
     mRNA            complement(join(1480180..1481302,1481357..1481448,
                     1481500..1482060,1482114..1482229,1482288..1483412))
                     /locus_tag="THITE_2106853"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648837.1"
                     /db_xref="GeneID:11516733"
     CDS             complement(join(1480476..1481302,1481357..1481448,
                     1481500..1482060,1482114..1482229,1482288..1483343))
                     /locus_tag="THITE_2106853"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648885.1"
                     /db_xref="GeneID:11516733"
                     /db_xref="JGIDB:Thite2_2106853"
                     /translation="MPFFSLAAGLLRQIRDITWPADRMPPGEAYSSSQGQRHQQHQFP
                     QAQVQQHQPVPQPRPSGPPAPQPLLPHPQYAPQPYVNGSQQYQHQQVQYAHPQYAQQP
                     AQLYPRSALPPQPRHHQQHQHLHQQYPLYNDTFLQPAPPTQPASAPAAPPMSAPMSAP
                     VQFVNPSHLQQAPAPRPPSNVLPPPQPQPQPASAMKPQLPRADQGRQPMPAKASPKME
                     EGRPLSRGTPKLLAREPRRPSSSAGVTKSPATPQASSHVETLPLLLSVAEDCFEKAAA
                     AAQRVARSMTASEVAEHHKLVATGLGCMNVALKSNKLWPRLEARLCLRYASVLIEETT
                     NITDAETTLTRGISVCETHRFLDLKYSSQFLLMKTLFQRNPKAAFKSIESHIADCTTY
                     KHVPWIYAFRFLKAAFHLQSGTAADNHAIENLRKIAGIANQRGDKAIFILAMLLEGLA
                     HLSTMKEDWATRVQMCIAQASKLQLDESVRTPQTDVLLLLLDLACSLHLKTHQISAQK
                     LGALQRRLEELKQAPDWSPQSGDVLLPVNRMQNTPQIVSHDTRAVLRPGTNGVDYLVV
                     STLGKQEAWALAYVLNGIVAQYKASTPGRSSGMWAEAVRLLEESKPVSSPQSLPQALQ
                     QANWARELVCYAQLLTGLQAATLSDWAKVKSCLETVQDCEPRSEFLSVLTLYLEGVFY
                     QGTAKLEQAVEIWKDKKFEMDWSGAPRAGRSRIETELSILAALNRLWILQEPKQADDA
                     ETAELIDLLRPICEDNPDQEIRTVYNLVLSSIRTNPPLSINQVKRHIQQALAGAQQTS
                     NTHHLSIALNIMRCKLFENVVGEQALKSAKAGSAQARKSGNVLWMSVADGMLAQSLEM
                     QGALAEARAAHAAGARLANEAFAKTQV"
     gene            1483971..1485904
                     /locus_tag="THITE_2106857"
                     /db_xref="GeneID:11521484"
     mRNA            join(1483971..1484674,1484737..1484820,1484879..1485014,
                     1485077..1485191,1485253..1485367,1485417..1485545,
                     1485600..1485904)
                     /locus_tag="THITE_2106857"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648838.1"
                     /db_xref="GeneID:11521484"
     CDS             join(1484123..1484674,1484737..1484820,1484879..1485014,
                     1485077..1485191,1485253..1485367,1485417..1485545,
                     1485600..1485740)
                     /locus_tag="THITE_2106857"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648886.1"
                     /db_xref="GeneID:11521484"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Thite2_2106857"
                     /translation="MDWLGRARISFTSSPSPLVLQKKDGTTTDLLKVCEASTPPCQLN
                     PLLFNGHVQTMWTAVKAHGPPIYYRRRIFEADHKTYSGTFAVDFAVDPHQDVDESLPP
                     RTAYFSEADFAKLASDDSRPMLIVLHGLSGGSHEIYLRHAIAPLALNGGNWEVCVVNA
                     RGCANSKVTSGVLFNARATWDVRQVVNWARKTFPNRPLFAVGFSLGANILTNYVGEEG
                     PNCQLKAAIAVANPFDLEVSNKALQRTLLGKQVYSRVMATNMKKLINMHKDTVLKHTN
                     LNFDRIQNVTYLHEFDREVQTVTWGYPTENAYYRDASSSDAVLAIRIPFLAISALDDP
                     IAVYEAIPFQEFTQNPCTVLCTTSLGGHLSWFEMGGGRWHARPICNFLNHMATEINLD
                     ALSPTPNGKAPESQFATDFDPMRRKLRILSG"
     gene            complement(<1486367..>1486834)
                     /locus_tag="THITE_40832"
                     /db_xref="GeneID:11521483"
     mRNA            complement(<1486367..>1486834)
                     /locus_tag="THITE_40832"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648839.1"
                     /db_xref="GeneID:11521483"
     CDS             complement(1486367..1486834)
                     /locus_tag="THITE_40832"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648887.1"
                     /db_xref="GeneID:11521483"
                     /db_xref="JGIDB:Thite2_40832"
                     /translation="MAPTRTVKNKHAATKSSSSGSKGSKKKSAADGVSKTKGRSGSKA
                     KAPATQVKGRPNLPGLDKNKKKKQRVYTDKELGIPELNMVTPVGVTKPRGKKKGKVFV
                     DDRVRSAHTSLPSSSCPPRHSFPSNLLTPTYRKVWRPSSRWCKPRRKGRSSPR"
     gene            1487007..1488254
                     /locus_tag="THITE_2106862"
                     /db_xref="GeneID:11515488"
     mRNA            join(1487007..1487453,1487532..1488254)
                     /locus_tag="THITE_2106862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648840.1"
                     /db_xref="GeneID:11515488"
     CDS             join(1487177..1487453,1487532..1487944)
                     /locus_tag="THITE_2106862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648888.1"
                     /db_xref="GeneID:11515488"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="JGIDB:Thite2_2106862"
                     /translation="MSSSQPAIRWAAFTRDTNETKIQIAINLDGGAFPPDTDPRLQVS
                     GADGHASQSSKSQTISINTGIGFLDHMLHALAKHAGWSLALACKGDLHIDDHHTAEDV
                     CLALGYAFARALGTPTGLARFGHAYAPLDEALSRAVVDLSNRPYAVVDLGLRRERIGD
                     LSTEMLPHCLHSFAQAARITLHVDCLRGSNDHHRAESAFKALAVAVRQATSRVAGREG
                     EVPSTKGTLSV"
     gene            1495494..1496636
                     /locus_tag="THITE_2106864"
                     /db_xref="GeneID:11515420"
     mRNA            join(1495494..1496071,1496322..1496636)
                     /locus_tag="THITE_2106864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648841.1"
                     /db_xref="GeneID:11515420"
     CDS             join(1495902..1496071,1496322..1496481)
                     /locus_tag="THITE_2106864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648889.1"
                     /db_xref="GeneID:11515420"
                     /db_xref="JGIDB:Thite2_2106864"
                     /translation="MPSINDNKHNEATDASWEATRGAVYGAVKWGVASALLGGLGYVL
                     SPVYRGLTIQFKVYLQMSGMVLGSMIEADRRLRQYEARIRMQRRLATEQAYWQSIERE
                     LGKDEDE"
     gene            complement(1496638..1497981)
                     /locus_tag="THITE_2106865"
                     /db_xref="GeneID:11515316"
     mRNA            complement(join(1496638..1497438,1497503..1497723,
                     1497794..1497981))
                     /locus_tag="THITE_2106865"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648842.1"
                     /db_xref="GeneID:11515316"
     CDS             complement(join(1496690..1497438,1497503..1497723,
                     1497794..1497900))
                     /locus_tag="THITE_2106865"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648890.1"
                     /db_xref="GeneID:11515316"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="JGIDB:Thite2_2106865"
                     /translation="MPAVRAEVKGESSTAAYKAVTAHANADDSPAYELPWVEKYRPVF
                     LDDVVGNTETIERLKIIARDGNMPHLIISGMPGIGKTTSVLCLARQLLGDSYKEAVLE
                     LNASDERGIEVVRQRIKGFAQKKVTLPAGRHKIVILDEADSMTSGAQQALRRTMEIYS
                     NTTRFAFACNQSNKIIEPLQSRCAILRFAKLTDAQVVKRLLQIIEAEKVEYSDDGLAA
                     LVFSAEGDMRQAINNLQSTHAGFGFVSGDNVFKVVDSPHPIKVQAMLKACYEGNIDAA
                     LDSLRELWNLGYSSHDIISTMFKVTKTIPTLSEHAKLEFIKEIGFTHMKILEGVQTLL
                     QLSGCVARLCKLNMDPKKFELPTK"
     gene            complement(1498124..1500219)
                     /locus_tag="THITE_2106867"
                     /db_xref="GeneID:11515639"
     mRNA            complement(join(1498124..1498277,1498331..1498606,
                     1498678..1500219))
                     /locus_tag="THITE_2106867"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648843.1"
                     /db_xref="GeneID:11515639"
     CDS             complement(join(1498250..1498277,1498331..1498606,
                     1498678..1499780))
                     /locus_tag="THITE_2106867"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648891.1"
                     /db_xref="GeneID:11515639"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="JGIDB:Thite2_2106867"
                     /translation="MAGFHGCLLSQLRQSRVQVARYVGRTPSRAYSTPPNGSIPAAKK
                     KYVPTQGTYPLGFKTSGTVVGVKPSNKTKPDLALLTSDVPCAAAAVFTKNKFQAAPVT
                     FSRSLLQKKGNRGIQGVIINSGCANAVTGKGGLEDAAKMAQEADKCIGQTDSTIVMST
                     GVIGQRLPIDKILDKVPAAHQALGGSHEHWLTAAKAICTTDTFPKLMSRTFTLPSSPA
                     VEYRIAGMTKGAGMIHPNMATLLGVIATDAPVSPAALPSVLKHAVDRSFNSITIDGDT
                     STNDTIALLANGLAGGREVAAGTPDLDAFRAVLTDFAAALAQLVVRDGEGATKFVTIR
                     VTEAASEETARRVASTIARSPLVKTALYGKDANWGRITCAIGYSLISEPGQPINEVPI
                     APEKTNVSFIPTDGTAELKLLVNGEPEQVDEARAAEILELEDLEILVRLGMGNKQATY
                     WTCDYSHEYITINGDYRT"
     gene            1500558..1502064
                     /locus_tag="THITE_2073385"
                     /db_xref="GeneID:11515776"
     mRNA            join(1500558..1501048,1501108..1501205,1501546..1502064)
                     /locus_tag="THITE_2073385"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648844.1"
                     /db_xref="GeneID:11515776"
     CDS             join(1500811..1501048,1501108..1501205,1501546..1502001)
                     /locus_tag="THITE_2073385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648892.1"
                     /db_xref="GeneID:11515776"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="JGIDB:Thite2_2073385"
                     /translation="MSSVSSEIMDAYWAAPPLARTLTTAIVVTSISVHLGLLSPVWIY
                     FTEDRLFRLPPEIWRLATNFFLSGPQIGIIMDPYFAYQYLKQLETSNPKFPRKEDVLW
                     YLITVGGLIILINRAFLGGAFFLQGLLIAMVYTATQDQRGVKTGFFFFTVPAQALPYC
                     MIGASMLMNPGIIPLQISGIVAAHLHDFVTRLWPEFGGGWNLLPTPAFVSWLVQTPAV
                     LRRPYGSAIRQPSGPTTDSSTGASAGSVLPDSWRTRGAGRRLGGN"
     gene            complement(<1502479..>1504434)
                     /locus_tag="THITE_133760"
                     /db_xref="GeneID:11523403"
     mRNA            complement(join(<1502479..1503812,1504293..>1504434))
                     /locus_tag="THITE_133760"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648845.1"
                     /db_xref="GeneID:11523403"
     CDS             complement(join(1502479..1503812,1504293..1504434))
                     /locus_tag="THITE_133760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648893.1"
                     /db_xref="GeneID:11523403"
                     /db_xref="JGIDB:Thite2_133760"
                     /translation="MATPRGCPTVPLKDLNPASAADPVRAVWCVDGGPSRNLPRATAC
                     RRYFERSGPGWARIAKTSSSSFRPLDGRVLLTATGSHGENGNMALAGSHILPRDSDSG
                     SNGTLTTGAIAGIACGAGALFLGAAGLFIVYWRRQRQFDREDEYYENHFEGRGPPGST
                     APAVTYTMDYKMDDPQHNEGDHGSSYTYSPEKASYPFSPLSALESASAMPTHPAYIPR
                     ALVRGRTTPSNRSVATASPPPFPTPAFSSASTSNSKTQPDDAMIQAYLNAATAAQPQP
                     QPSPPPQAGDAPTESDSSFSGGLPLQSYPPRTHSAPTTVPAMVFPSISSPPHSASSTT
                     DSARASGSGRTSHGRPPPARRPPPPPLKNLSTSPGAKPLSGRENATISGPLAFPQHYH
                     HPGYQPGSGSGSGWIREDDTSDAAAAQGQSQSQSQSESGGRMRSFRARAFSSPRGGGG
                     GGGGEREAKKKEKKEKKKKQRNSGGHRFYAEVEIGNGSDIW"
     gene            complement(<1507152..>1507481)
                     /locus_tag="THITE_2042370"
                     /db_xref="GeneID:11515729"
     mRNA            complement(<1507152..>1507481)
                     /locus_tag="THITE_2042370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648846.1"
                     /db_xref="GeneID:11515729"
     CDS             complement(1507152..>1507481)
                     /locus_tag="THITE_2042370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648894.1"
                     /db_xref="GeneID:11515729"
                     /db_xref="JGIDB:Thite2_2042370"
                     /translation="IDIYYDDVVIGSYDFGTTNGYLSYLRAIFEALYKCNIFIGPNKS
                     FIAFPSAIVLGRMVNSIGISTIAERLVAITTLEFLYTLKDLKYFIGATGFIYYNILLY
                     SILIALL"
     gene            <1527125..>1528010
                     /locus_tag="THITE_2125208"
                     /db_xref="GeneID:11523443"
     mRNA            join(<1527125..1527515,1527625..1527826,1527905..>1528010)
                     /locus_tag="THITE_2125208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648847.1"
                     /db_xref="GeneID:11523443"
     CDS             join(1527125..1527515,1527625..1527826,1527905..1528010)
                     /locus_tag="THITE_2125208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648895.1"
                     /db_xref="GeneID:11523443"
                     /db_xref="JGIDB:Thite2_2125208"
                     /translation="MAPPNIPLATRLLPLILLLLLPLLPGPTSAEILGALTITNALTR
                     REGGGGGGKAEVGGVGSRTGVVAAYPLFRGAARGWRGRRGSGTEGVGEGGEEKRVKEG
                     EGEGEEGVVSRADGPLAGLTWQVQGLTRVADTHLNSTDFLFALVDDQSKETSCSVAVP
                     GSDPTASWYGRSCVVHPNYSISWGYIKETDSAVMTVCDRNNGTGAWFGFQNITAASFL
                     GDSKKEPVYYTGCS"
     gene            1528561..>1529948
                     /locus_tag="THITE_2093691"
                     /db_xref="GeneID:11521426"
     mRNA            join(1528561..1528956,1529030..1529341,1529408..1529420,
                     1529483..>1529948)
                     /locus_tag="THITE_2093691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648848.1"
                     /db_xref="GeneID:11521426"
     CDS             join(1528812..1528956,1529030..1529341,1529408..1529420,
                     1529483..1529948)
                     /locus_tag="THITE_2093691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648896.1"
                     /db_xref="GeneID:11521426"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="JGIDB:Thite2_2093691"
                     /translation="MKIGCLQFAPRVGEVADNIARADAVLSRAKPEDVAGLDLLVLPE
                     MAFSGYNFKSLQHILPYLEPTAGGVSGRWARDAARRYGCAVAVGYPEMAGQSGSDPEC
                     YNSLVVVKPDGDVVAHYRKSFLYYTDATWAREGQGFYGGTLDNHQVAMGICMDIKFMA
                     PWNAYEFAFHILGVRADLVILSTAWQVLDERTAFLSKPELPDMGTISYWVRRLEPVVS
                     AGRSEETIVVFANRCGVEEEVTYAGSSTVLGIKDGVVSVYGCLGRGTEELLIVDTDKP
                     PFGTFVKSGEEEPADEEPGVPVPVPDPGPRGGAIQ"
     gene            complement(1530788..1530860)
                     /locus_tag="THITE_t37"
                     /db_xref="GeneID:11517687"
     tRNA            complement(1530788..1530860)
                     /locus_tag="THITE_t37"
                     /product="tRNA-Met"
                     /note="Anticodon: CAT"
                     /anticodon=(pos:complement(1530825..1530827),aa:Met,
                     seq:cat)
                     /db_xref="GeneID:11517687"
     gene            1532862..1533500
                     /locus_tag="THITE_2169219"
                     /db_xref="GeneID:11515573"
     mRNA            1532862..1533500
                     /locus_tag="THITE_2169219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648849.1"
                     /db_xref="GeneID:11515573"
     CDS             1533060..1533227
                     /locus_tag="THITE_2169219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648897.1"
                     /db_xref="GeneID:11515573"
                     /db_xref="JGIDB:Thite2_2169219"
                     /translation="MCGRPAAPSSGNLGTSSLGVGVHPGRFSALYRSAPEGEEEADGT
                     EEEQGGACSDG"
     gene            <1533634..>1533980
                     /locus_tag="THITE_154050"
                     /db_xref="GeneID:11515887"
     mRNA            join(<1533634..1533747,1533816..>1533980)
                     /locus_tag="THITE_154050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648850.1"
                     /db_xref="GeneID:11515887"
     CDS             join(1533634..1533747,1533816..1533980)
                     /locus_tag="THITE_154050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648898.1"
                     /db_xref="GeneID:11515887"
                     /db_xref="JGIDB:Thite2_154050"
                     /translation="MHDGRLQRRYSASPSPTLIPTACKARGVTRGGATIPRMWAAKVW
                     EASPGNLDVTLHARSGDSVGGRRLSAAAEPRSNPRPVGWDSSTGGILP"
     gene            1536696..1538863
                     /locus_tag="THITE_2106872"
                     /db_xref="GeneID:11516738"
     mRNA            join(1536696..1536954,1537014..1537353,1537415..1538499,
                     1538556..1538863)
                     /locus_tag="THITE_2106872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648851.1"
                     /db_xref="GeneID:11516738"
     CDS             join(1536810..1536954,1537014..1537353,1537415..1538499,
                     1538556..1538575)
                     /locus_tag="THITE_2106872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648899.1"
                     /db_xref="GeneID:11516738"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="JGIDB:Thite2_2106872"
                     /translation="MRIACLQFASHVGDVDRNLSRADAVLSTADPDELDRLDLLVLPE
                     LAFTGYNFRSLQHISPCLEEAGSGISSLWARTTALKHNCTVVVGYPETVDISAKWPAS
                     PEYYNSAVLVNGEGDTVGNYRKSFLYYTDETWALEGGNGFFSGQLPGLGHVVMGIGTD
                     LNPYKLESPWDAFEFGSHIIQAQANLVILAVAWQTHQDAASFNRSPQEPDLETLVYWV
                     QRLEPLIRADKEDEVIVVICNRSGTEEDATYTGTSAVLGIRQGEVFVYGVLGRGVDDL
                     LVVDTDCPPRCRLTDAESAEADQQSADKSGLDRETGGRETGGDLEVPNDAMADESEVC
                     QCHIVDSGTELRLDVSSARKATSPRLPWLAQPDGPGGAPTNSRSPTRLQIPTRPLLDE
                     YVPIDSAVTDDIIIDTPGFADTPGFASRSARFKLAIPGSPWRFPSKQSPYPWHAHDGT
                     HSAVFGAGATLTPITPFDEDGWTGTPIDAKAPQWFWKHEPTLSALKESIAEEEEEVSK
                     TSEAQAVQATEHEKQAGAGPA"
     gene            1538864..1539724
                     /locus_tag="THITE_2106874"
                     /db_xref="GeneID:11515338"
     mRNA            1538864..1539724
                     /locus_tag="THITE_2106874"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648852.1"
                     /db_xref="GeneID:11515338"
     CDS             1539201..1539416
                     /locus_tag="THITE_2106874"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648900.1"
                     /db_xref="GeneID:11515338"
                     /db_xref="JGIDB:Thite2_2106874"
                     /translation="MKPQCQCRIPVAGGSRPHADHRHHNHRHHYHRYQQQQQQQQQQE
                     RNRDRLKPAVIRPLNDDHGIFALCVGI"
     gene            1542101..1543854
                     /locus_tag="THITE_2106876"
                     /db_xref="GeneID:11515642"
     mRNA            join(1542101..1542536,1542594..1542657,1542734..1543854)
                     /locus_tag="THITE_2106876"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648853.1"
                     /db_xref="GeneID:11515642"
     CDS             join(1542272..1542536,1542594..1542657,1542734..1543823)
                     /locus_tag="THITE_2106876"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648901.1"
                     /db_xref="GeneID:11515642"
                     /db_xref="JGIDB:Thite2_2106876"
                     /translation="MRTSTARLAVAVAAVVSAPLAASLFASPDSPCAKYCGNVLGRTS
                     TDEMACDSGSLSQTSTGVVWEQCIRCLLTGTYASGSPSDMQALLYNLRFNMEYCLFNA
                     PVNPCITSRACGPLADAVNYKNLTTSVGAYDYCSLWAEDAVPRCTPCLYELPDGNYTN
                     NYVMILEAACEQKPAPGSTVSISGDPFDTVNGVTIVPPQPTYSTVPAPDYGPVSLGAR
                     VGIAFGGLAFILALAGFCIVCNGKRRRRAFLRELERRHGAQGWPHPKTPYVGGAGGSS
                     SGGGPEMFETPVSQRPLRGWENDSPVSAQPDGPYPRYFSPYTSQYNSPVSGPESAGAS
                     TAAFNQWPTATQEKLLMQMHAHHEKRQNELAIGIALGGDDASLRSKASNLNLNGYPVE
                     SKGKEREEAYELHEVESPSENGNRTGKGESRSYNEKHPQPHYRMPAEPQAPVLHHPGY
                     GRHHGSRPGSSGTGGAVGGMDQ"
     gene            1544325..1546475
                     /locus_tag="THITE_2106879"
                     /db_xref="GeneID:11519157"
     mRNA            join(1544325..1544938,1545014..1545069,1545135..1545804,
                     1545888..1546475)
                     /locus_tag="THITE_2106879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648854.1"
                     /db_xref="GeneID:11519157"
     CDS             join(1544667..1544938,1545014..1545069,1545135..1545804,
                     1545888..1546353)
                     /locus_tag="THITE_2106879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648902.1"
                     /db_xref="GeneID:11519157"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="JGIDB:Thite2_2106879"
                     /translation="MADSAAQGDDGQYVIKPQTTVPSLDTSTWPLLLKNYDKMLVRSG
                     HFTPIPNGSSPYKRDLKSYISSGVINLDKPSNPSSHEVVAWLKRILRVEKTGHSGTLD
                     PKVTGCLIVCIDRATRLVKAQQSAGKEYVAVIRFHDTVPGGEPAFAKALETLTGALFQ
                     RPPLISAVKRQLRIRTIHESKLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLGLLLGVG
                     AHMQELRRVRSGVMSEDDGSMVTLHDVLDAQWQYDNSGDESYLRKVIQPLETLLCTYK
                     RLVVKDSAVNAVCYGAKLMLPGLLRYDAGIDAHEEVVLMTTKGEAIAIGIAQMSTVEM
                     STCDHGVVAKVKRCIMERDLYPRRWGLGPVATEKKKLKADGKLDKYGRPNEATPAAWT
                     QNYTDYSAAAEAAASSAAAPEAAAAASPEKKAPEAAAAAAPAAVAEEKADDDKKKRKK
                     HEGETAEEKAERKRLKKEKKEKKKAEKGKEAEKDDSD"
     gene            1547962..1550179
                     /locus_tag="THITE_2106882"
                     /db_xref="GeneID:11517634"
     mRNA            join(1547962..1548530,1548593..1548847,1548901..1550179)
                     /locus_tag="THITE_2106882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648855.1"
                     /db_xref="GeneID:11517634"
     CDS             join(1548227..1548530,1548593..1548847,1548901..1549901)
                     /locus_tag="THITE_2106882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648903.1"
                     /db_xref="GeneID:11517634"
                     /db_xref="JGIDB:Thite2_2106882"
                     /translation="MASHLSLSKLPRLLTLLTLFSAALRSSALQVTPNSPCSSACLDS
                     PTLDASDPNSSNTRNSDITCKDADYSSAAGTKFKNCMTCLQNSTFSQGQESDIMWFLY
                     NLRYTASYCLFGFPNATNIGSNPCATSKACGSLQEALEDGIPDPRNMTAYSYCSAGGG
                     EAMASSNYDLCLPCVSADGTTTYLANYFVALEAGCQQQPAPGVRLGLNDTVFSSTLIS
                     IVDPATLGKEGGSKSGLSPPAIVGIVIGAVAVLLLTAACSFVCFRRRRNRRAHASAEA
                     DFFSRFNRRHHSSMSFQCQTHMVSPRFWPGAEEGVSTPFTDGRDAQPYGSAIAKSQDN
                     QHDNSSYASRKAPMAAAPLQISTTVPLTPPPQAYTSPSYGGGVNHSPSDFKSPLSAES
                     VHSSSALLPSIRPYVPAEHGVHVQGSPPPPSSTFSSPTSGTGPSATGMTPLLKSSGWP
                     LAEKQQQQQEKPPKRIIRLSNPVAPPPPTPLRTSRSSGMLAKKSPKLVGTGSPVESRE
                     IQTAFAAPPKR"
     gene            complement(1550933..1551281)
                     /locus_tag="THITE_2106884"
                     /db_xref="GeneID:11515871"
     mRNA            complement(1550933..1551281)
                     /locus_tag="THITE_2106884"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648856.1"
                     /db_xref="GeneID:11515871"
     CDS             complement(1551007..1551189)
                     /locus_tag="THITE_2106884"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648904.1"
                     /db_xref="GeneID:11515871"
                     /db_xref="JGIDB:Thite2_2106884"
                     /translation="MGGWALGVGAKACWLAGWLAGCGAGARIKKGGRTRNMAVIKHYV
                     ADRGPLLKKKESMASS"
     gene            complement(1551283..1556251)
                     /locus_tag="THITE_2106885"
                     /db_xref="GeneID:11515374"
     mRNA            complement(1551283..1556251)
                     /locus_tag="THITE_2106885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648857.1"
                     /db_xref="GeneID:11515374"
     CDS             complement(1551364..1556160)
                     /locus_tag="THITE_2106885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648905.1"
                     /db_xref="GeneID:11515374"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="JGIDB:Thite2_2106885"
                     /translation="MAAPANNAFGAPPVQAAHNSFRAPVVNNPFGAPSAQTSVLAPSS
                     ASSRQPSPASTQHPPAGPSAKAQLKSQLDAAKKGPRSGRSPSPSTSKAPPTGPSSQQL
                     SVGATKANTMTRRNNKLTGGKPQAASNAGRFGGREGQTPESQRANPFGSAKPSAGQEK
                     VAPTAPNTRLPPGGRRKQPGRLERPQPPRSSSRQGRPKAPLIGEPSERTKQLSPFAFD
                     YANKLYDHLRKENIAPPEWPAEPGNPNNRAAVESFNADFKKYRDKVTASLRKADLIDD
                     PEKRRKLKDALPFKGICEEMCPEFEQIKRIIEDTVSTEEKAVGPDGLTLWPDRSRMVK
                     RYGRSSAGSDAPLPMDVRSVDALRRTTDYLFNDLLQSESNLPSMHSFLWDRTRAVRKD
                     FTFHSQKSAEEMKDMVYCFEAIARFHATALHLLSKKGFANESFVQKQEFEQLGNTVLS
                     LMEAYDACRDKHVQCENEAEFRAYYLLVNAEDPSIANRIPAWGKEFWFESEEVQTAVA
                     LVQAMEDVRKPKGPIKPHRPTSLADTSFTNYFSIVEDPRVSYTMACIAEVHFTQVRQA
                     ILKNLVRAYARSRDAPRTITASDLNAILRFDTPEEAVEFAELHGLEFSTWVPEGKPPV
                     TEPYLLLNDKRKYVPPPQVGQSFSGTLVERKRSTQSLPYVIYNTIFEEPAEKSPSSAE
                     DSPGLFVTRTAAAPDNSPLGTPSPPLQPAEPSTATAPSTSPFGTVFQTTQAPKTTPSA
                     AAPTGTTTPTFAGFQTSQPSASTQAGKSAFSFLNIPQASSTAGSSPKIPSLLGQPTAS
                     SLAASNPAQAPGLFDFLKGFKSTPAPSATTTTPTTGPAPGPMPSAAALPNGAASKPTV
                     ASTLLGNASSSQVKPTGPISSSSLLGTSPSSGTAPFSTTQLPKPAEQQPAPAAPAIPS
                     IFVSPPSATSSSTNQGLQPAFFPASTQPRESTNLSSSAPAVPALATPAAALPIAQPAP
                     KRDPFGDFTKWFVNADDGLLEHFTEETLRNLLWDVWQGFQREEAERKRREEDEKSWRL
                     AREHQNYRLRVKYFYRWRNNARSSATKRILREGKEKMRLYREQQQAIQRRQQAEKEKA
                     EKEARRAAERQAVEDSRRISLLATSVRRRGSVAYSADHDPEEQLLASGIFSGLRDDPR
                     SLARRVVREAAAADGGDAWSMASASRSFRYPESELELEPAPSARDSPDTSSVGGRREG
                     WKTRSLREKFGIEPRRSLSASGSVVNGASFLSSSSRFRQSLPGSSSNKTTNFSRKRSA
                     EEDGDDQDGEARRRSLYSSNAAPKTNGFARSRHWDLRARGFVPTPDGNWLPEAIVKAG
                     KQRDSALEPESPRSEPRGYDHDPELLPDRDPSPTPSDLRLRLARLKQSRPHGLGHGTR
                     HSVDLPPAASGFATDRWLLSPASPPHPPFASRHPANAANGAATAHAASRSPAADISPP
                     PPPPPAASHPTPGIRPVSLHGKRKRTTEDADFATADRGIDGVAGDHQQSPSPSPSSSA
                     ARKKKANLDLDLNFNLDLHRLRRRDGGDADVDLHPPAAVPGREETCAMVENTRRMLRE
                     LREFMDRADREEGRAAAPGAGVPAAAPAAAGAAVGGESEVGVYSGR"
     gene            complement(<1556961..>1558208)
                     /locus_tag="THITE_2037550"
                     /db_xref="GeneID:11517352"
     mRNA            complement(join(<1556961..1557703,1557929..>1558208))
                     /locus_tag="THITE_2037550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648858.1"
                     /db_xref="GeneID:11517352"
     CDS             complement(join(1556961..1557703,1557929..1558208))
                     /locus_tag="THITE_2037550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648906.1"
                     /db_xref="GeneID:11517352"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_2037550"
                     /translation="MASLELAQDKHTGQQQQQQQQQQREVPPHRSHDPQYNQKRSDPF
                     QFGSRYLGEDDDVFEFNAWDHVETDDAYKEYAEQQYAMQRQAPVSEFDKKRFNSDPAK
                     WWNLFYKNNAANFFKDRKWLQQEFPILDKVTQEDAGPVTVLEIGAGAGNTAFPVLAKN
                     KNPQLKLHACDFSKKAVEVMRSHESYDPKVMQADVWDVAGDELPPGLGEGSVDVAVMV
                     FIFSALSPLQWQKAVENVYRVLKPGGEVCFRDYGRGDLAQVRFKKGRYLEENFYIRGD
                     GTRVYFFEKDELADIWTGKHGSADGAQAARFEIEELGVDRRLLVNRAKKLKMYRCWLQ
                     GRFRKK"
     gene            <1558843..>1560132
                     /locus_tag="THITE_112373"
                     /db_xref="GeneID:11523434"
     mRNA            join(<1558843..1559019,1559080..>1560132)
                     /locus_tag="THITE_112373"
                     /product="histone acetyltransferase GCN5-like protein"
                     /transcript_id="XM_003648859.1"
                     /db_xref="GeneID:11523434"
     CDS             join(1558843..1559019,1559080..1560132)
                     /locus_tag="THITE_112373"
                     /note="Contains conserved domains: COG5076, COG5076,
                     Transcription factor involved in chromatin remodeling,
                     contains bromodomain; pfam00583, Acetyltransf_1,
                     Acetyltransferase (GNAT) family and pfam00439,
                     Bromodomain, Bromodomain. 1| histone acetyltransferase
                     GCN5 [Ajellomyces dermatitidis]"
                     /codon_start=1
                     /product="histone acetyltransferase GCN5-like protein"
                     /protein_id="XP_003648907.1"
                     /db_xref="GeneID:11523434"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="JGIDB:Thite2_112373"
                     /translation="MDKAEPQSLLADHGQAPRAVKRAASEEPNGTSDGKRIKTTSDVQ
                     PQATASSWRVPYPERPAVVEERNGEIEFRVVNNDGERQSIIILTGLKCLFQKQLPKMP
                     KDYIARLVYDRNHLSMAIIKKPLEVIGGITYREFRHHKFAEIVFCAVSSDQQVKGYGA
                     HLMAHLKDYVKATGPVMHFLTYADNYATGYFQKQGFTKEITLDKSLWMGYIKDYEGGT
                     LMQCSMLPRVRYLEAGRMLLKQKETVLAKIRAQSKSHIVHPPPQQWANGNVTPIDPLS
                     IPAIQATGWSPDMDALARVPRHGPHFNELRRFLYQIQNHKQAWPFLNPVNKDEVPDYY
                     TVITSPMDLSTMEEKLERDLYATPRDMIADLKLIFSNCRQYNDPSTVYAKCAAKLEKY
                     MWTLIKEIPEWYDLLEE"
     gene            complement(1560379..1561489)
                     /locus_tag="THITE_2106887"
                     /db_xref="GeneID:11516550"
     mRNA            complement(join(1560379..1560581,1560668..1560715,
                     1560823..1561026,1561113..1561152,1561221..1561489))
                     /locus_tag="THITE_2106887"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648860.1"
                     /db_xref="GeneID:11516550"
     CDS             complement(join(1560454..1560581,1560668..1560715,
                     1560823..1561026,1561113..1561152,1561221..1561400))
                     /locus_tag="THITE_2106887"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648908.1"
                     /db_xref="GeneID:11516550"
                     /db_xref="JGIDB:Thite2_2106887"
                     /translation="MFSRFPPHDERIRLLTVSSSQNPIGSIDKADLKRFIAWAETNFD
                     LPCLHEFLTAVPTAELEPITQDYVQSDEADMGMTYQELTIFGRLRKLNKLGPFGMFQR
                     LVHDWSADRERKPDDDAPYYTPAQVAEKVKKFFHFYAINRHKMTTLTPALHCNDYSPD
                     DNRFDLRPFLYPPFWKSWSFKRIDMELEKIEKKRASTKH"
     gene            complement(1561490..1564005)
                     /locus_tag="THITE_2106889"
                     /db_xref="GeneID:11521496"
     mRNA            complement(join(1561490..1561594,1561647..1561730,
                     1561791..1562182,1562252..1562324,1562393..1563295,
                     1563360..1563437,1563515..1564005))
                     /locus_tag="THITE_2106889"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648861.1"
                     /db_xref="GeneID:11521496"
     CDS             complement(join(1561544..1561594,1561647..1561730,
                     1561791..1562182,1562252..1562324,1562393..1563295,
                     1563360..1563437,1563515..1563568))
                     /locus_tag="THITE_2106889"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648909.1"
                     /db_xref="GeneID:11521496"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="JGIDB:Thite2_2106889"
                     /translation="MGHLVTVATCSLNQWVLDWEGNLGRIIESIHQAKAAGARLRVGP
                     ELEICGYSSLDHFHELDVYTHSLEMLRRLLLDKSTHGILLDVGVPILHRNLRYNCRVI
                     CLDGKILLIRPKMWLANDGNYREMRHFTPWMRPRETELFHLPKMLAEVQGETHVLFGD
                     AVISTPETAFGAETCEELFTPKAPHIDMALDGVEIITNSSGSHFTLRKLDTRLQLIME
                     ATRKSGGVYLYANQQGCDGERLYFDGCAMIIVNGDVVAQGSQFSLNDVEVVTATVDLE
                     EVRSYRAAISRGLQAAASTAKYQRIQTPFELSSEDDDADVSKAPSLPIQPRYHPVEEE
                     IALCGGCYLWDYLRRSGAAGYLVPLSGGIDSCATAVLVYSMCRIVMKAVEEGNQQVIE
                     DVKRIARYGDEGVLPKTPQELCNQVFTTLYMGMKKQSSRETRQRARDLSAAIGSYHVN
                     LDIDDIYEAQKKLVVDTVGFEPRFKVEGGSVQENLTLQCLQARIRMVTAYEFGQILPT
                     ARKRPGGGSLLVLGSANVGESTLPPFFPRQIDGGSW"
     gene            1564486..1566565
                     /locus_tag="THITE_2106895"
                     /db_xref="GeneID:11515754"
     mRNA            join(1564486..1566306,1566388..1566565)
                     /locus_tag="THITE_2106895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648862.1"
                     /db_xref="GeneID:11515754"
     CDS             1564589..1565629
                     /locus_tag="THITE_2106895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648910.1"
                     /db_xref="GeneID:11515754"
                     /db_xref="InterPro:IPR002853"
                     /db_xref="JGIDB:Thite2_2106895"
                     /translation="MEVAQTLVRAVIRAFYSTQDVLVIEALTTHSALRDDELAYLMKM
                     NLKDLHRLCASLRDARFIAVHTRPEMQAGKTRPINRTYYYIDYRQTIDAIKWRVYKTD
                     KDMQGSVQPVDESKEYSCPRCRAQWTQLEVLDSASAQGFMCQRCGTLLERAKEREAPG
                     HQQLSRMNNQFKFMTDMLQQVDQVVVPECTFDKAIQAARPIVRDPTHEVAASVPVDTG
                     LNKPSAVKGLANVGPKTMQVTISDGDNEQERLEERKRKERLLRENALPSWMTESSVPP
                     ITSQPSQTSQTRSFEMVDAADDEVDLVPSKRVKLETADTSTAAAADDKSAVMSFKMEE
                     EDEDELEFEDVV"
     gene            1571928..1574157
                     /locus_tag="THITE_2106899"
                     /db_xref="GeneID:11515458"
     mRNA            join(1571928..1572022,1572140..1574157)
                     /locus_tag="THITE_2106899"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648863.1"
                     /db_xref="GeneID:11515458"
     CDS             1572313..1573992
                     /locus_tag="THITE_2106899"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648911.1"
                     /db_xref="GeneID:11515458"
                     /db_xref="JGIDB:Thite2_2106899"
                     /translation="MTPDMSGTPPDDGSLHEQAVETPTLGPTVPKSPRLSRNPSFSGS
                     SSYQEDWDPFPPLDRLTVLDILDNFTLSHQLEKLQKGISAQTEKVRKSRQAFGNRSRM
                     ARERMVDEWRRRVPSAEEQLERYRKRMRASVEKLGARWNDTKAISLREKISFIFGVMN
                     IFVSGYLIGGYAEWFHLWYTGQVLYFMPIRFYTYHKRGYHYFLADLCYFVNFLLILSI
                     WAFPSSKRLFTAVYCLAYGNNAVAIIMWRNSLVFHSFDKVTSLFIHIMPCATLHCIVH
                     LVDPALQAKRFPAIWTIKNSPPGSATAYANVLSMLAWSTIPYAFWQLCYYFFISVRRR
                     EKIAAGRPTSFTWLRRSYSKIWIGKIVLALPEPLQEPAFMLIQYIYAVLTMLPCPLWF
                     FSRWASAAFLLLVFAWSVYNGSTYYIDVFGNRFQKELEAMKAEVAKWQNSSDGPAAGV
                     QSPPLAPREDGTAAALAAAATPAAPGAMATTASPAAAAARSSLADAISGKALDDRGTS
                     GFAAVDNIPLLNDERPAAVIATGADMDVGARDVARERKTGSGSGSAGQSLS"
     gene            complement(1575244..1577341)
                     /locus_tag="THITE_2106900"
                     /db_xref="GeneID:11515554"
     mRNA            complement(join(1575244..1576597,1576650..1576774,
                     1576828..1577341))
                     /locus_tag="THITE_2106900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648864.1"
                     /db_xref="GeneID:11515554"
     CDS             complement(join(1575285..1576597,1576650..1576774,
                     1576828..1577174))
                     /locus_tag="THITE_2106900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648912.1"
                     /db_xref="GeneID:11515554"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2106900"
                     /translation="MSLHGAGMPGAASDDAGARFSKPLPSTATPDRPIAGFNALSAPS
                     TTAMRASSEQFLHHGPSSSRASSASRQARSSAAHSGTEGPGRASDGLDALDKQRERLY
                     GSPRRKRQRIDADRFIPARSGRDLQSGYQLIPPPPRPAPERGRPRSPPRGYRSQKSEE
                     ADQTFRELLRTELFEDTVPQTSPRWTPEHERMRTPPRGPDPALPTSLTPSTPQKNLFS
                     YVSPRHQHLVGLSTPRKTPQRAHSLLPDPRLDTYSTTPITYNSQQMLLAPRRQHRTVS
                     KVPFKVLDAPNLAEDFYLNLMDWGSSDVLAVGLGSGVFMYNAQNGKVAKLCTLEDDKV
                     TSVSWIQKGTHIAIGTKKGLVQIWDAQKFKRMRTMTGHTARVGSLAWNAHILSTGSRD
                     RTILHRDVRAPDQWVKQLIGHKQEVCGLKWNCQDGQLASGSNDNTVLVWDKLQDHKPL
                     WTFTEHIAAVKALAWSPHQRGLLASGGGTADRRIIFHDTVRGNVRNDVDTGSQVCNLM
                     WSKNSNELVSTHGYIQNNLVIWKYPSMSRVASLTGHTYRVLYLAMSPDGTQVVTGAGD
                     ETLRFWEVFKPKQPVRLLGGSIDLPVIR"
     gene            complement(1579801..1581307)
                     /locus_tag="THITE_2106902"
                     /db_xref="GeneID:11515630"
     mRNA            complement(join(1579801..1580088,1580152..1581307))
                     /locus_tag="THITE_2106902"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648865.1"
                     /db_xref="GeneID:11515630"
     CDS             complement(join(1579811..1580088,1580152..1581082))
                     /locus_tag="THITE_2106902"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648913.1"
                     /db_xref="GeneID:11515630"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="JGIDB:Thite2_2106902"
                     /translation="MVRNIVLLAGTSHPRFVADVAAMLGVSPASCVLSKFSCGETRCE
                     IRDSVRGKDVYIVQSFGVGPAGVDGDADAGGAEGGGSGRGEVDGDGEVAGVKEAERER
                     EKAARHTVNDYFVELCIMISACKTGSAKRVTAVLPLFPYSRQPDLPFSKAGAPLVGLS
                     RGIGKGEADGGGDGGGGKAKPVEYTFESVPVTPGPNIPQTVGLRSPELDVVEMMRGAS
                     LEKEGDVTWRKASSSGWGSPTLPPQDKQTGNYTTHDYENPSLMMALQAKSGHKQFMAQ
                     AGSLMADLLTCAGADRILTCDLHESSYQGFFDIPVDNLYARPLLKRYIQHHIPNYRDA
                     VIVSPDAGGAKRATAIADSLGLAFALIHKGIAYLLFSLLLTIVPKLIRTITPSQNAVR
                     RRSRKPPKQP"
     gene            complement(1582939..1584908)
                     /locus_tag="THITE_2106904"
                     /db_xref="GeneID:11515723"
     mRNA            complement(join(1582939..1584204,1584266..1584908))
                     /locus_tag="THITE_2106904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648866.1"
                     /db_xref="GeneID:11515723"
     CDS             complement(join(1583138..1584204,1584266..1584587))
                     /locus_tag="THITE_2106904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648914.1"
                     /db_xref="GeneID:11515723"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="JGIDB:Thite2_2106904"
                     /translation="MVMPTVVSDRFASLDYTEFTNNHVFLKSCNNGFFEHNHHGHHDH
                     HDGGKIDSAKQLIGEALRERVENIDSESCEPGEEDTFFVADLGEVYRQHLRWKRNLPR
                     VKPFYAVKCNPDPKLLELLAALGTGFDCASKAEIEQVLGLGVDPSRIIYAQPCKTNSY
                     VRYVASQGVRQMTFDNADELRKIARLFPGAELFLRILTDDSSSLCRLSLKFGASLDST
                     DSLLALARELGLNVVGVSFHVGSGASDPGAFLKAVQDAHVVFQQAASHGFCLKTLDVG
                     GGFCSDASFEEMAGVLGAALDEYFPARSGINLIAEPGRYFASSAFTLACNIIARRTIE
                     DVSAASYMVYVNDGLYGNFSSIMFDHQHPVAKVLRSGARTLYNTPAAEATDSVDGIEY
                     SIWGPTCDGIDRITESIRFSVLLDVGDWLYFEDMGAYTKCSATTFNGFTNDHEVIYVC
                     SEPGAKALLGLP"
     gene            complement(1587391..1590868)
                     /locus_tag="THITE_2106907"
                     /db_xref="GeneID:11516866"
     mRNA            complement(join(1587391..1590333,1590407..1590868))
                     /locus_tag="THITE_2106907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648867.1"
                     /db_xref="GeneID:11516866"
     CDS             complement(join(1587588..1590333,1590407..1590693))
                     /locus_tag="THITE_2106907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648915.1"
                     /db_xref="GeneID:11516866"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="InterPro:IPR013578"
                     /db_xref="JGIDB:Thite2_2106907"
                     /translation="MLRSTARRAAKAATNLAQYPKPGEQLHGFTLLRAKHVPELELTA
                     LHLRHDKTGAEHLHIARDDSNNVFSIGFKTNPPDDTGVPHILEHTTLCGSEKYPIRDP
                     FFKMLPRTLSNFMNAFTASDHTFYPFATTNAQDFKNLMSVYLDATLHPLLKESDFTQE
                     GWRIGPENPQALATGAEVKPEDRKLVFKGVVYNEMKGQMSDAGYLFYVRFQDHIFPDI
                     NNSGGDPQKITDLTYEQLKNFHAQHYHPSNAKLFTYGDMPLADHLREIDAQLSAFEKI
                     KGDPTIHRPIDLSSGPREVRLVGPVDPLVDLNKQFKTSVSWVLGDTSNVVESFSLALI
                     SALLTDGYGSPLYKGLIETGLGTDWSPNSGYDSSAKVGIFSIGLTGVQEADVPKLKPT
                     VQEILRSVREKGFERSKIDGYLHQLELSLKHKTANFGMSLLHRLKPKWFTGVDPFDSL
                     AWNDTLAAFEREYAKGGYLEGLMDKYLLNDNTLTFTMAPSPDFVQELAKEEEARLKSK
                     ISKAIEIAGSEEQAQAALEARELALLAEQAKSNTEDLSCLPSVHVQDIPRQKEPVVLR
                     TETVGEVKLQLREAPTNGLTYFRAINTLENLPDELRSLIPLFADSIMRLGTKDMTMEQ
                     LEDLIKLKTGGVSVGYHSASRPTDYTQASEGLVISGMALDRNVPAMFDLLRKLIVETN
                     FDSPAAAQQIRQLLQAAADGVVNDIASSGHAYARRAAEAGLTWDAFLREQVSGLSQVK
                     LVTSLANRPESDQLEDVIAKLKTIQQIALAGTMRAAITCDRESVASNTSALSGFLGSL
                     RPGDAKFPPRRTEQFARNIKSFYPLPYQVYYGALALPTVSYTSPDGAPLQILASLLTH
                     KHLHHEIREKGGAYGSGAYSRAIDGIFGFYSYRDPNPLNTIKIMRDAGRWAVDKKWSD
                     RDLEDAKISVFQAIDAPRAVNEEGMSNFVYGITEEMKQKRREQLLDVTKDQVREVAQR
                     YIVDALSRGAERLVFLGEKRDFVDESWEVTNMDINGTP"
     gene            1591583..1594080
                     /locus_tag="THITE_2106911"
                     /db_xref="GeneID:11515526"
     mRNA            join(1591583..1591637,1591802..1591891,1592073..1592348,
                     1592422..1592570,1592628..1592871,1592929..1594080)
                     /locus_tag="THITE_2106911"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648868.1"
                     /db_xref="GeneID:11515526"
     CDS             join(1592127..1592348,1592422..1592570,1592628..1592871,
                     1592929..1593444)
                     /locus_tag="THITE_2106911"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648916.1"
                     /db_xref="GeneID:11515526"
                     /db_xref="JGIDB:Thite2_2106911"
                     /translation="MSDIQKIEHLTKRCSDLLSEMKRHERESIKHKKRGDQLQKDKDN
                     SRNELNKTVSLKEKLEKLCRELQKENNKLKNENKTLSDTQVRSQNTWDERYSGLLRRM
                     DEYQEEKDNPRKQVVDMEVEELFCQRFKSFIDQYELRELHFHSQMRTKELEVQYHMAR
                     YEREKKNYEAELARSRQLNAQVQTFTKTEAELRHQLNVYVDKFKQVEDTLNNSNDLFT
                     TFRKEMEDMSKKTKRLERENEILKRKHDQVNGNIIKMAEERNKNLSEIDELRKKLEKL
                     NGIIKQMQQQGRGIPQGLTGTVDHEYAEGELDGDESEYEDDEYDEGEDEEEVSDEGDE
                     YDDETEDELHQQQQQQPQMYGPERPPPAPAAAAATATTNGHR"
     gene            1594971..1596188
                     /locus_tag="THITE_2106916"
                     /db_xref="GeneID:11517506"
     mRNA            1594971..1596188
                     /locus_tag="THITE_2106916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648869.1"
                     /db_xref="GeneID:11517506"
     CDS             1595159..1596163
                     /locus_tag="THITE_2106916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648917.1"
                     /db_xref="GeneID:11517506"
                     /db_xref="JGIDB:Thite2_2106916"
                     /translation="MSYGTRGAVRRKVSSEEDPNVIPRTAPLGFLGRLPFKIVGSLRY
                     KPSAANLREHPGSGGTAQGYQGSAGQEEREPLLGSSEEEDAARRQKGSPRQRARSRSD
                     TTTSGDTSSSYRSRGDLFPSDGEGDEDAVPLDDEFTVALERVDDQGSTRTHNSKGKRP
                     ADRDRNLSRTHSRTTLSSGNTPNDSRGSSNPVSPSRTMEEAMGFPSLEDLQREEEQAE
                     REEHEELERRRQAAAQLAVQRGLSKDPSGRASEATGGIEGKDGSLDREAPLRPPEGQV
                     PGASPGATGDAESGEVEVEEPKPRSAISPEPALSPTLKANGESRVQSTFVPARLPHFD
                     "
     gene            1597252..1598568
                     /locus_tag="THITE_2106918"
                     /db_xref="GeneID:11521332"
     mRNA            join(1597252..1597413,1597482..1598568)
                     /locus_tag="THITE_2106918"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648870.1"
                     /db_xref="GeneID:11521332"
     CDS             join(1597350..1597413,1597482..1598488)
                     /locus_tag="THITE_2106918"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648918.1"
                     /db_xref="GeneID:11521332"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="JGIDB:Thite2_2106918"
                     /translation="MSSQPQTGPITTPLTTLLGIRHPILLAGMARTSGAALAAAVSNA
                     GGLGVVGGFMYTPEQLREIVAELKARLRAPDLPFGIDLALPQVGGGARATNHDYTGGR
                     LDELVGVAIESGARLFVSAVGVPPREVIERLHAAGILVMNMVGHPKHAVKALERGVDM
                     VCAQGGEGGGHTGDVASSVLIPAVVDVARRYRPKMLGGEQPAIVVAAGGISNGRGLAS
                     SLMQGAAGVWVGTRFVASVEAGCSEEHKRAVVSCGFEDTERTLVLSGRPLRMKTNDYI
                     RKWHAQPDRIQELCSKGIVPLEHDLEQGNEVDVPHLMGQVAGAIDKIQPAGEIVDEMV
                     AEAVEMLKLANTYLGGNKPSKL"
     gene            complement(1599120..1600364)
                     /locus_tag="THITE_2106919"
                     /db_xref="GeneID:11521366"
     mRNA            complement(join(1599120..1599820,1599906..1600110,
                     1600226..1600364))
                     /locus_tag="THITE_2106919"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648871.1"
                     /db_xref="GeneID:11521366"
     CDS             complement(join(1599417..1599820,1599906..1600074))
                     /locus_tag="THITE_2106919"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648919.1"
                     /db_xref="GeneID:11521366"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Thite2_2106919"
                     /translation="MANFRRFRPDDLHKLSKCNLDPFTETYELGFYLQYYAKWPSLFQ
                     VAEDQHGNIIGYIMGKLESSPDVYRFSEHYLPWHAHITAVTVAPEARRLGIGRLLTEQ
                     LEVAADANNAWFVDLFVRVSNHKAIAFYKSMGYSVFRVVKDYYGDHSSDPTLSSEDAY
                     DMRKPMKRDVNREHVREDGEKYEVDPSDVW"
     gene            1602045..1603657
                     /locus_tag="THITE_2106924"
                     /db_xref="GeneID:11515679"
     mRNA            join(1602045..1602895,1602965..1603657)
                     /locus_tag="THITE_2106924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648872.1"
                     /db_xref="GeneID:11515679"
     CDS             join(1602222..1602895,1602965..1603475)
                     /locus_tag="THITE_2106924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648920.1"
                     /db_xref="GeneID:11515679"
                     /db_xref="JGIDB:Thite2_2106924"
                     /translation="MSSPQTPRHSPHPSLDFHSAASYTSYSPQQDRRQSKASSYNDSS
                     MDLGISGGGAGADGGGGLGNLADELAGAFSDGEDDYDGYDDGAYDGEDPGADNEARTP
                     GISLDEATGERNDDGVRDSGVDIESPSAAGRGHRSQGSLGLPSHGRGHRRKGSEYDGS
                     EYGSESDLESPGMPPKLVEKIDEVESLARRGAENNGSPADGAFKRLTDSLRDLGSQGG
                     IEGGASRLITAHSALTTHLSHQTRQLHNLTFPLLSPLVAPPEPETIDALLPMLLTLPE
                     LMPRPSTAALQSLSSLHALTADLAHTLNYLSDTLHMARQTTTTAARRLKSARDLVAEL
                     RRDEELRDEGRRWLDRGRWGERLARRECALVCGDVVGGFEAVCDSWRERLRALAEESA
                     HA"
     gene            complement(1604172..1607445)
                     /locus_tag="THITE_2106927"
                     /db_xref="GeneID:11519111"
     mRNA            complement(1604172..1607445)
                     /locus_tag="THITE_2106927"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648873.1"
                     /db_xref="GeneID:11519111"
     CDS             complement(1604318..1607407)
                     /locus_tag="THITE_2106927"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648921.1"
                     /db_xref="GeneID:11519111"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="JGIDB:Thite2_2106927"
                     /translation="MNSQNMSFPPQRPRFRKIQSFRTDYAPTTITQYESERSGMQVIV
                     ADRKGPKINGYFTLATEILDDSGAPHTLEHLIFMGSKSYRYRGLLDKLAGRAYSVTNA
                     WTAVDHTAYTLETAGWDGFAQILPVYLEHVILPTLTDDACITEVHHIDGEGNDAGVVY
                     SEMQALQYSSGELMDLRARRLLYPENVGFRYETGGMMEALRVLTSQRIREFHKAMYQP
                     QNLAIIVIGEADHDELLKILDDFEESIKDDIPPPDPHFKRPFVDSPQPPPLEKTVVET
                     VEFPEEDESTGEIVVAFFGPSCIDQVQATAMNIIMTYLCGSSVSVIENTMVEKEHLAS
                     SVAYWWDSRPNSVIWFQPTGVATEKLAFVEQRLISLLKEVAAKPLDMNYIKECLQREK
                     RQVKLEAEGSEQFYATNLITDYLFGKRDGTTLKDLQSLSEYDALDSWTEEQWRAFLKK
                     WISDAHHISILGKPSLELANSLKANEEARLAKRREELGKEGLERLRERLETATKNNDQ
                     PIPPELLDQWPVPGTSSIHFIESATARSGKARSLGVLDNAAQKTIDAAAQGLPLFVQF
                     EDVPTDFVHLTVHVGMSQTPTKLKPLLPLFAENFFNSPVLRDGKRMEFEDVVKQLEKD
                     TISYHISSSSRLGDYEGVAIQFRVDRERYTTIISWLRTLMFDIIFDPVRIKAAIVKAL
                     ADVPEAKRDGRAMAQEVDTAIHFKPESYLAAKRTLVKAVYLRRLKKLIEREPETVLSW
                     FEELRKSLFTFENIRVLVTADVAKLANPVAAWDDLTKNPSLDPTKDVLPIPQLHSMLS
                     PEGQSPGAFGSVVIPMTTLDSSYSVSTAAGLKSYADPRLPAYLVALGYLEAAEGPLRN
                     AVRGAGLAYGVFFSHEVDGGYVQFKVYRSPDASKAIEASRATVARLASGEQPLDRHLV
                     EAAVSGVVYGVAEEQATMAAAAQQNYVAGVVRGLEPGWNRKILARVRDVTDDEIRAVL
                     RDLIMPVFEPGKSNVVVTCAPIMQEVRLEPTPFPQLLHHPLLVPPFYTQYILRSPNM"
     gene            complement(1608611..1609743)
                     /locus_tag="THITE_2061803"
                     /db_xref="GeneID:11515556"
     mRNA            complement(join(1608611..1609054,1609112..1609193,
                     1609276..1609376,1609513..1609530,1609667..1609743))
                     /locus_tag="THITE_2061803"
                     /product="60S ribosomal protein L36"
                     /transcript_id="XM_003648874.1"
                     /db_xref="GeneID:11515556"
     CDS             complement(join(1608977..1609054,1609112..1609193,
                     1609276..1609376,1609513..1609530,1609667..1609714))
                     /locus_tag="THITE_2061803"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_003648922.1"
                     /db_xref="GeneID:11515556"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="JGIDB:Thite2_2061803"
                     /translation="MAATKKNETPRTGLAAGLNKGHKTTARVSKPRVSRTKGHLSKRT
                     AFVRELVKEVAGLAPYERRIIELLRNSKDKRARKLAKKKLGTFGRAKAKVEDMTRVIA
                     ESRRAH"
     gene            1609958..1612998
                     /locus_tag="THITE_2106931"
                     /db_xref="GeneID:11515452"
     mRNA            join(1609958..1610722,1610776..1610955,1611008..1611165,
                     1611218..1612468,1612602..1612998)
                     /locus_tag="THITE_2106931"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648875.1"
                     /db_xref="GeneID:11515452"
     CDS             join(1610242..1610722,1610776..1610955,1611008..1611165,
                     1611218..1612465)
                     /locus_tag="THITE_2106931"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648923.1"
                     /db_xref="GeneID:11515452"
                     /db_xref="JGIDB:Thite2_2106931"
                     /translation="MTSLHSPPAQLAQALVDFSVHGSFPEDEVSSLPLDAESLSAAIK
                     ALADAKAKLRAEIHAINEETADDVRAWQANAQSVQDDILRSKALAADIVKAAEAPVVS
                     GSAVQEIEARADFLIRELNYNAQVHEALKGIKTVNRTLDEVEQARDERRILDALHLLE
                     RSWKELDAVGASKSCRAIKLLDIRAFELKSDVHEVFDHVWNALISVDVENHRVSINST
                     REDEPMSLEDAVIGLKAYKEVDQRMSRLWQNIHQAILLPRMDFAAETLPGIHTENNTL
                     EARGSADKTVHSLFADLEQVFLFLVQRLPPDLVETISSTLLPETIHKITSVWLDSAVP
                     SSLHDMDSFQEVITAAKDFCTRLKALGFSNLGGLQEWTESAPRVWFSKCRAAALDTVR
                     AKLSQGLGASKRVERVEKQMVSRAEGEQLVANGATVSVDDHSWDAWDDEEQGGAEEAA
                     NSGADKAQEEGEDDGLDAWGWGEDEAAPEEPNEKPKDEPQESKADDEDDPSAAWGWGD
                     EGDNDEVEGPAQTQAAPRGGPQTRELVLKEMYSISSVPQPVLDLIFSVFEDGAALTQE
                     THAGSPVATQAAGLFSLPTLALALFRAVSPYHYAPEVGGNMQVSSTMPVEFRLTGTGT
                     FTTTLPIWQNGYPNLPRPGNSAKTSVREHKTCSASKTTSNPSKVSPTAPTPTSSPFKK
                     PSCATY"
     gene            1625837..1629485
                     /locus_tag="THITE_2106937"
                     /db_xref="GeneID:11521461"
     mRNA            1625837..1629485
                     /locus_tag="THITE_2106937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648876.1"
                     /db_xref="GeneID:11521461"
     CDS             1626030..1629362
                     /locus_tag="THITE_2106937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648924.1"
                     /db_xref="GeneID:11521461"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="JGIDB:Thite2_2106937"
                     /translation="MTSDSLRTRRARPSQVKTDLGPDTNVVVVSSSLMRTSSISPASQ
                     HGSPAQSVETVGTALTSGSSLQNSPEPLEPLPEKALDEIDPWAPTFQLPEPVGGKPLV
                     DPVAPQLSHKTSTSSLYQATVKSPGTTSTGEAVKMSLVRRASNSVRSKAAVLMNRRPS
                     STNSRSRDASVGPGVVRRRGSMSNPSVPLENVSPFESESEVDTGAPAEERCGSDGSLA
                     ESGPQGSATPSDGFGLIPLALRQGMTLTKVTKKKSTKRIMVYLDPDSAKIWWDRNRSS
                     KSVYIDDIKEIRTAEDIRQYRLDAALPEAVEKRFFSLIYTLPNKPGTKTLHLIADTDK
                     SFQQWVQALETITKHRQDFATSLMSFHDKAVRAYWGMEMDKQLGKLRSPEDEHIDFAG
                     VERVCRSLHIHVSTEQLRRTFDLAKGRRASSDDLPSSQSRSGRLNFDEFLEFVRLMKT
                     REDIRRVYQAHTSDAEGGMTKDEFFQFLRQVQAEDVDDDLAYWETVFARFSRKGRPRD
                     VEKQSLAGEESSTMSEAAFSSFLTSTWNDVIPKEPQNYVLDRPMNEYYISSSHNTYLL
                     GRQVASASTHEGYISALMRGCRCVEIDCWEGQDGQPVVMHGHSLTTRISFLEVIRTIN
                     KYAFVKSHFPLWISLEVRCPPAVQITMAKIMIDVFGDKLVRAPLDPSSDRLPSPSDLM
                     DRILIKVKKSDESIRTVERTGRRRGNSLPSPYQRALAMEHVPVPSPPSPLLSPALTSR
                     SNRQINTITEGLVHEPVSSSSPSECDSEGEASVVKKATSKIHPALGDLGVYCMGIHFD
                     GFDSPDAKKFNHIFSFKEKTFAEKSQPPAGKSALYRHNMRYMMRVYPNGGRINSSNFD
                     PLIYWKRGVQMAALNWQTFDTGMQLNQAMFDGGTAQSGYVLKPLEGRQIQVMPNLSPD
                     ECIGKRPRKKVAFEIVVISAQQLMRPWNLGEKRTMDPYVEVEVLMADDKRNKADAAAY
                     AAAQQMQLKQRTKVVRDNGFNPEFNQTFSFDVTTKYPDLIFVRWSVKLSDKSSPLATF
                     TAKLSNLKQGYRTIPLLNHNGERFLFSTLFCKIRRGPVTDIMVAYQEDAPKNGNKLKN
                     IGRNVFSQTNTSPKSSMESGRT"
     gene            complement(<1631529..>1633896)
                     /locus_tag="THITE_2037471"
                     /db_xref="GeneID:11517060"
     mRNA            complement(join(<1631529..1631753,1631925..1632438,
                     1632490..1633624,1633740..>1633896))
                     /locus_tag="THITE_2037471"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648877.1"
                     /db_xref="GeneID:11517060"
     CDS             complement(join(1631529..1631753,1631925..1632438,
                     1632490..1633624,1633740..1633896))
                     /locus_tag="THITE_2037471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648925.1"
                     /db_xref="GeneID:11517060"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Thite2_2037471"
                     /translation="MASSARRWARKLERSCCSSIKYFPLLFVYGLTTWAVFVLVTLSF
                     NAPRVSWLGKPTAVAGTALYLMLNWCYTAAVFTPPGSTTNDNGYSTLPTHALPVATSF
                     TVKSNGELRFCKKCQARKPDRAHHCSTCRRCVLKMDHHCPWLATCVGLRNHKAFLLFL
                     IYTSLFSLFCFAASGAWVWEEVFVANTTYVDSLMPVNYIMLCVIAGIISLVIGAFCGW
                     HIYLATKGQTTIECLEKTRYLSPLRRSMHQAYINQHTPGQGVPLPSYGQQLLDLHQNA
                     LPGITRPEEGEDVRRDPSPVARHHHHDLESGPPTSPLSNGPQLQAGSRRFTYDEMERF
                     RARKRYEEYLDEQDSTKLPNAFDLGPKRNLLHLFGHNPWLWGLPISNTTGDGWSWEPN
                     PKWLAARERLARERLEQAARERAAGWGPGADDTDGDEQPHYLRPRPRSPPQASQLNGK
                     TTMATPSLSPLPSPGVGGRKTPSKADRVLGRDPNLYADEPSPAPRAGGETVALSRLSQ
                     TGRTIEDELAEFDREEEEQQQQQQQQQQQQQQQQQQQQQQQQPQQQQQPQQQQQQQQQ
                     QQQQHHHHHHHHHHHHHHQQQQQQQQQQQQQQQHRGRKPDEAERRALNVVTNGRWRPR
                     NPASAGTLLRGPRSPGLLGGAAAGIGGGGFGGNSGGRRSAWGSSESDDDGVD"
     gene            complement(<1634561..>1635717)
                     /locus_tag="THITE_2020276"
                     /db_xref="GeneID:11521438"
     mRNA            complement(join(<1634561..1634852,1634908..1635482,
                     1635497..1635524,1635599..>1635717))
                     /locus_tag="THITE_2020276"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648878.1"
                     /db_xref="GeneID:11521438"
     CDS             complement(join(<1634561..1634852,1634908..1635482,
                     1635497..1635524,1635599..1635717))
                     /locus_tag="THITE_2020276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648926.1"
                     /db_xref="GeneID:11521438"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2020276"
                     /translation="MKVTCRDCKLEVVNQAALATHWREQRDQGNRHYHCLECMLSDFD
                     RPGLTFHQAKQDLDCPGCGERFAAAGGLIDHIEKDRCHKIKSGEYAARREEKLAFARE
                     LQRRHHGETVDLPDDDLSVASLSLAETTVSRQGPYNFTPYLSNARGVPVSTSSLSALR
                     PKATNTVRPNPVTFAMKKPDSPPDPPAAMRSAPKQLEGAQRQGQNKLKAWPQHDPRNP
                     GWNPRDYFVTYINKYKCPHDNCGRSFASPQGLRAHLMSEIHTSATKVQCPRCCRWFGS
                     AAAITQHAESQGVRCDIRETNGYRQFLDQLTAGIVDTTEKNEDGTEKYTVPEEARELF
                     GTSQ"
     gene            <1636564..>1637052
                     /locus_tag="THITE_2041986"
                     /db_xref="GeneID:11516609"
     mRNA            <1636564..>1637052
                     /locus_tag="THITE_2041986"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648879.1"
                     /db_xref="GeneID:11516609"
     CDS             1636564..1637052
                     /locus_tag="THITE_2041986"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648927.1"
                     /db_xref="GeneID:11516609"
                     /db_xref="JGIDB:Thite2_2041986"
                     /translation="MSTQPRPIFIYGTMCALPLLSWVLTGDASNVDSVSALVRQARVS
                     GYSRFSLHNRDYPAAVKQDNISSSIDGYLLTPQTASQRRKLDDFEGEAYMPTLVTVTI
                     LDSNGEPSGETVDADMYVWNGDMEAVSSEPWDLDAFIRERLADWIDLFEGMELVGGDQ
                     DQ"
     gene            1637679..1639446
                     /locus_tag="THITE_2106942"
                     /db_xref="GeneID:11519201"
     mRNA            1637679..1639446
                     /locus_tag="THITE_2106942"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648880.1"
                     /db_xref="GeneID:11519201"
     CDS             1637909..1639192
                     /locus_tag="THITE_2106942"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648928.1"
                     /db_xref="GeneID:11519201"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2106942"
                     /translation="MQHRAVTVIKLPPAPASRHLTFPTLIIPNFNSGWLLLANLHQGG
                     DFCNTICSKNRTPPTATYPPSASRAQWLPQRQHPSSTPNHPPSAASVRNPSLLSLSLS
                     LSLSLSKAAVPLSPPTNSLTNQPPFSPFPVREAHELTTSPSADYHAAPLETDLFEWHF
                     TLRGPPNSAFERGAYHGRIVLPPSYPLRPPSFRFLTPSGRFETNREICLSISGHHEET
                     WQPAWGIRTALVALRTFMETDVKGQLGGLEAGEDVRRRLAAESVGWRCGVCGGNKTNG
                     EILAECEERVRERAGEGGAGVEEEVVVPAELKMGWRDEMEGRKPGEEGKGKEREGEDE
                     ESARLAEGFVQTTPMSTSGAAAVATGSQTAGGSVAAPRTGTVQPAPSPPPVAAGPALR
                     QIDRRVADDVPAWLDLLIVAVAILLAAVVAKVMLA"
     gene            complement(1641140..1647282)
                     /locus_tag="THITE_2106944"
                     /db_xref="GeneID:11519077"
     mRNA            complement(join(1641140..1646603,1646799..1647139,
                     1647204..1647282))
                     /locus_tag="THITE_2106944"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648881.1"
                     /db_xref="GeneID:11519077"
     CDS             complement(join(1641181..1646603,1646799..1646868))
                     /locus_tag="THITE_2106944"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648929.1"
                     /db_xref="GeneID:11519077"
                     /db_xref="JGIDB:Thite2_2106944"
                     /translation="MSGVGLEVLLEGLIPEIAYSGEKGLSISELLKIVRQYHLSQGGH
                     SAAFQDGVAQMLRQPVDETNLEQSLTEAEMASARWAWDWLRSRPQILINGNRRWNRLE
                     FSEALALPEADSVDPALGSALGDAKGTGKGESKKAKKTLTVRPRIHPSEDLVWQTLTR
                     HGVDYKRVPALEWACLQGIASARAEGILQSDLRRLVDQDKRSLPKRTDSLARKGYIAK
                     RTVVVQKMKTSRLWLIDFAPPLVEEETCGLDLSPENLSKDLEPVPWHPRWTGDNIDMD
                     ALGRTAVGVVKAFNVIRYADLRLKMGVSGKRWQMKTLAKNCQRLVDVGVLKYAAASFP
                     GSRKVFLDCLKFVRDPSPEEWDKFLATGKKTSQYSDPTRLREPKPNALALYGKSEDGG
                     GGGSADRSKLKRIFSGWTPEKPLAQTVFEVIRSAGPEGASNPQVSVATVGYQHRRYLS
                     SYLAKVAETQQPPHLKKFQIVSKLVRTGKTSAYMFSAPGAAGLATPSKVDEDADEGEQ
                     AQAQAQAPHKESPDSTGTDFYGFGAVRPKAFCNGENISLSELSRIAREKKPSLKRKLL
                     PRIRLEQQVATEPVPEATTEENVAAANLNEDEQPSGSRDTRTRKRRFEETLDDAEVAE
                     NGTAGSSGAQDRDVSPTVSAANGVTEAAADTVVAVPTPTKVEDVVLDVRYNGLAGKLQ
                     VQPPDRTVTFVRSGRSSRKPLVIPIDDNLDEPAIRDVPGSDEKSLVLTTGAKDGASPW
                     TYVFIFDDESRDDAALIQQGVINIKSPTSNDEPTAAPTEPPASTEPPASTEPSASTEP
                     PPSQDIVVATQDNTIEVPPTASKAARGKGGRRGAGRGKGKKGQSLPAGAKPYVCTLCG
                     GAWKNDIGLKYHLQKALVPCNPNFDPATLLERSRKRRKPSPVPPPSLGDSEAGDEEAS
                     GRTRKSRSTRKSENKAEKKTLYLPSKVRTAMRSSLDPKHKFRGLDISDVGDEDEPDNV
                     AAQRSRPVSRGTSSHLGGPSRHLEQGQDVLGEPLPAVGQSSALKEGRPFNVEYRPSTL
                     TNTVRQVQQPPGTGDDASQVDSAVTDARALNSVLDRKQSEPLPHALPTAPATPSITRA
                     SEHAPTSNNAPDGKSSSPTAGNNFTLRPTDGTLARDQSRTEASPWESIPASRAQPPQT
                     EYPEAPSQQMEQIIERDVCAEPWNSHNERAVLKPFSSSTNYARMATDAKKRTAQAFDI
                     INYILDNNCGVFPGEKALFYALTKVFLKEFRDQMPPTWKNYVSAVRALETRKLAAVHT
                     TMVKTERGRLQTCTLLVRTGVDPNGMVPSIMKQKMREAYPGIYIPAAFSPTQEELAVL
                     QELDKKPPPTPEKNGRPNANGQKFRSRRKIEEIEVFNAPYYTQTAPPVEPTKDPLWLR
                     DTELIPEDDYIGRKRSAPHDFPAGPSQKKPKTDFEGNLLYGDIPVDPNLLGGQAAEDQ
                     PSVLEAIKAYSLLPSRVGGRSRRRLSHSTKPLTKLSPELGRVKNPGLASLPASFFGNA
                     ADDTTDQFATPAIQFLEPSTGPEDDAQEPGETQSQSQVSSRESSEDVLDEPEAKESQT
                     GNEEEVKGPKKYRFVYPSVLEPVSGSKFSWPELSAGFFERHGTSFTMNGWMPSRKWLL
                     AQNLPFSAEEMAENQQSEKIQLRDWVDKAYAKFCSTVNQCAAWEQSQAGTAVMLGGSV
                     APTYIYINVSAPVSKARPKTPALTWSDDTMYSVDTLPYEELEDDDYGDVIYVEDAPPR
                     AAAGEGEPVLKKRRVQKAGETQVRRLQGRPPKLKLLPIKTMREHTAYPRSAEDFLRTP
                     GGENEELDWSSENVRLAAFIVVTTLLGGVDRVVDWGLMMRLMPDQT"
     gene            complement(<1647365..>1648470)
                     /locus_tag="THITE_39085"
                     /db_xref="GeneID:11521420"
     mRNA            complement(join(<1647365..1648014,1648126..1648343,
                     1648430..>1648470))
                     /locus_tag="THITE_39085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648882.1"
                     /db_xref="GeneID:11521420"
     CDS             complement(join(1647365..1648014,1648126..1648343,
                     1648430..1648470))
                     /locus_tag="THITE_39085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648930.1"
                     /db_xref="GeneID:11521420"
                     /db_xref="JGIDB:Thite2_39085"
                     /translation="MPHKHTRREKDESTSFDLPPSQIAKPLPPTTISKKKKAGQKKTD
                     DVPKKSGQKRKRGGADADDAPRAFKRLMAFANGKTPRDGLDNDPSAAAPTAQDLKIRP
                     GERLSEFSRRVDAALPISGLVHKTVKNGKDPLGLKVRRTKKERKMQNMYAEWRKIDRK
                     IKERREEERELAEERELENEALGVSWKLELEAAAGQGKKKGGKKGKRRRLIGEVGGPE
                     GDPWEEIKKKRGEAKVGLNDVAQAPPELKLPRKNLLVRGAAVAVEDIPKAAGSLRQRE
                     ELQGIRQEVVASYRRMMSERRPALGT"
     gene            1649057..1651692
                     /locus_tag="THITE_2169226"
                     /db_xref="GeneID:11521412"
     mRNA            join(1649057..1649719,1649776..1650802,1650903..1651360,
                     1651458..1651692)
                     /locus_tag="THITE_2169226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648883.1"
                     /db_xref="GeneID:11521412"
     CDS             join(1649556..1649719,1649776..1650754)
                     /locus_tag="THITE_2169226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648931.1"
                     /db_xref="GeneID:11521412"
                     /db_xref="JGIDB:Thite2_2169226"
                     /translation="MASWKLGGPKSTVMVEYVPIPGDMEDVDDADLVVPQKSRARWTW
                     RSYLLLGLALLAMILLAVKVGDVIGQNFSRQHGPKDNPFGNWGKPGTGTEQLAWYPAD
                     FLRDVVPVPCHSHNDYWRDVPLFSALYAGCTGVEADVWLRRGDLLVGHDTASLQPNRT
                     FQTLYVNPLIEILTRQNPATEFYNGTTNGVFSTDPSQTLVLLVDLKTDGAETWPWVVK
                     QLSPLRERGWLSYFEDGQFHARPITVVGTGNTPFDQILGNSTPSSSSSSYRRDAFFDA
                     PLDQLENSPYDATNSYYASVNFWRAIGPVWWRGEPSAAQLRKIRRHLREAHKRGLKAR
                     YWNLPSWPIHVRNRLWQILVEEGIDMLNVDDLNAATRQDWTRPDTF"
     gene            <1653142..>1653430
                     /locus_tag="THITE_154085"
                     /db_xref="GeneID:11521388"
     mRNA            join(<1653142..1653200,1653268..>1653430)
                     /locus_tag="THITE_154085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648884.1"
                     /db_xref="GeneID:11521388"
     CDS             join(1653142..1653200,1653268..1653430)
                     /locus_tag="THITE_154085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648932.1"
                     /db_xref="GeneID:11521388"
                     /db_xref="JGIDB:Thite2_154085"
                     /translation="MPSTQAPAPQTNFNGYCVVMVLSVLFDNTHPPLSVDNMVIVTAM
                     ILQEGPPASLRTSLPTLRVDPVGDASSRS"
     gene            1654512..1656215
                     /locus_tag="THITE_2106953"
                     /db_xref="GeneID:11515405"
     mRNA            join(1654512..1655526,1655619..1656215)
                     /locus_tag="THITE_2106953"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648885.1"
                     /db_xref="GeneID:11515405"
     CDS             join(1654596..1655526,1655619..1655947)
                     /locus_tag="THITE_2106953"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648933.1"
                     /db_xref="GeneID:11515405"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="JGIDB:Thite2_2106953"
                     /translation="MAKKGAAQSLKAGSKPKSQSTGGKADKQKTDRRKSNEPAVEKAI
                     DGKEEEWEDADSDENDKQPAPQPISGKETKKRKAVGEELSEEDSDSEDSEDDEEEQGG
                     VDLAAIDDSESESELDSDGEPEKKDDEDDEEEIDVEELSAEDEEDEEQIAAGTRVRQT
                     INNKEGLLTALRRFALDTNPKTVPFAFHQSIVSSKKTEDSIPSIDDDLQRELAFLNQS
                     LEAARQGRALLRKEGVPFTRPTDYFAETVRSDETMQKVKAKLVEVATAKKAAAEARKQ
                     RDLKKFGKQVQVQKQQERAKQKRETLEKINQLKRKRQEGGSSALGATEADDIFDVAVD
                     NELASHANKAGHNSKKRSAGDHGQPNAKRQKKNAKYGFGGKKRFAKSGDAVSSGDLSG
                     FSVRRMKKGGKAPRLGKSRRKAMAAKK"
     gene            complement(1658211..1660956)
                     /locus_tag="THITE_2106957"
                     /db_xref="GeneID:11519202"
     mRNA            complement(join(1658211..1660368,1660593..1660956))
                     /locus_tag="THITE_2106957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648886.1"
                     /db_xref="GeneID:11519202"
     CDS             complement(1658379..1660232)
                     /locus_tag="THITE_2106957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648934.1"
                     /db_xref="GeneID:11519202"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Thite2_2106957"
                     /translation="MREANFSIPNVNKASVGITTALYDRRALDCTSTLPLINSLNHLA
                     YLTTSSARIRDILTVDGGIERLVCILKEGRSKDMMDMWKWNLAFQCVVNIGVRGTEAV
                     RTRVVEADMVPVIATILDNYIKVIEKVREKAEEAKQKSDHHRHRIGGSSRVHKSSSFS
                     SRSGNLDVDQRTFRRQAPPPSIDVSAALAGPSTSAVNSNADPTPTAPQFQVTPPADRT
                     PLTAHRALHHHHALVSPSPHTAPPLAPVVPSMDAADGFVRPMRDADRLGGILPFPRVA
                     MTSQPASPTTPLPPPQLRSPTVRPASILTASARSRRRPSIRPQHSTAAESDDMNADSI
                     TSEDSPDTEMAGNAEMQAEVGVQEITVEDGDSVMAGGAIELTTPTASETQDAGAFNIT
                     HQGPVDGSVATNNAPTPVPAMGLSPNRPTLVSPPQPALPNASVPRYLLDRQVSPNPQM
                     LAAMPREEDVLMSLQLLAYVSKYCNLRKYFQRSHLVPKLKIGKEIQLLDGVDPAALEG
                     ELGEENEAAEEEYCLPNDLNIFPLVEKFTVRYHSTDMQYWAGVVMRNLCRKDDTRGGI
                     RQCAYYQCGKWEEFTRQFAKCRRCRRTKYCSKECQKSAWAFHRHWCIAATQ"
     gene            complement(1667742..1669584)
                     /locus_tag="THITE_2106958"
                     /db_xref="GeneID:11521396"
     mRNA            complement(1667742..1669584)
                     /locus_tag="THITE_2106958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648887.1"
                     /db_xref="GeneID:11521396"
     CDS             complement(1668057..1668956)
                     /locus_tag="THITE_2106958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648935.1"
                     /db_xref="GeneID:11521396"
                     /db_xref="JGIDB:Thite2_2106958"
                     /translation="MAMPGDSDSDVSSLGLGISDLTPRPSMEGYNAVRSEPPARDPTT
                     PTATLATTPGPRRPTADSSPSISYSTTDDEDALHMPRPNGPHPFPRPANPSFSLSSSS
                     DSLLRPERASLSSGSESYYPSRPPPHPTTTSAASTLPSAVQRRRIAATTTTTTNATST
                     STSPTPHTASATTSSSINTRPRARSPLALTSLAASPLPPAAQPDPDWDYAETAWWGWL
                     ILAATWAVFVVGMGSCLGVWSWAWDVGTTPYAPPELEDDPTLPIVGYYPALTILTGVM
                     AWVWVVVAWVGMKYFRHAQVSGD"
     gene            1672563..1674047
                     /locus_tag="THITE_162453"
                     /db_xref="GeneID:11521306"
     mRNA            join(1672563..1672760,1672823..1672976,1673049..1674047)
                     /locus_tag="THITE_162453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648888.1"
                     /db_xref="GeneID:11521306"
     CDS             join(1672734..1672760,1672823..1672976,1673049..1673953)
                     /locus_tag="THITE_162453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648936.1"
                     /db_xref="GeneID:11521306"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_162453"
                     /translation="MSSRRIACQLCRDRKVRCPGEQPACGRCRRAGEQCVYLSAQQRP
                     TKADLSETVEALQKRLNETESLILKMSGRSGNSVTMPDSFVFDWPSNPDFSAPAPAPA
                     PSSLMEVSNTLPVAVNSLCSPLGNSFELHSSQATASPNGTAGGNYGQCDSGEQIEMDF
                     ERSPAELCLQPGLPLNNIHQDGHVQQQLRTTQLAPDTNHRSTPSTYGDSDTTVGGTAT
                     GQPPPAESSTALFDALRAYCSSVIRRECDVAGLASAVAEYMAWMRKVPSAGAPPVTNR
                     DYQQMLGNIEGRVRELVDVARKGHDGPLHDLLGAVGRASGGGAVAAARVAELEAELQR
                     LRQEQTRFFERDYDACKLLSEQTEKRP"
     gene            complement(<1677263..>1679595)
                     /locus_tag="THITE_2040898"
                     /db_xref="GeneID:11515910"
     mRNA            complement(join(<1677263..1677618,1677750..1677905,
                     1677991..1678558,1678648..1678966,1679052..1679155,
                     1679217..1679246,1679336..1679368,1679446..>1679595))
                     /locus_tag="THITE_2040898"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648889.1"
                     /db_xref="GeneID:11515910"
     CDS             complement(join(1677263..1677618,1677750..1677905,
                     1677991..1678558,1678648..1678966,1679052..1679155,
                     1679217..1679246,1679336..1679368,1679446..1679595))
                     /locus_tag="THITE_2040898"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648937.1"
                     /db_xref="GeneID:11515910"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2040898"
                     /translation="MPNRHSDQDENTSGTTGGASDVEKGNDGTNNDNAPGAPHPEPKR
                     TVTGLKWFIVFTSLMSTVLLFALDNTIVATIQPSIVETFNDQQSLAWIGVSFVLGQVV
                     ILPIGKAYGMFSMKILFVASLVLFETGSAICGAAPNMDAIIVGRVIAGVGGAGVYVGG
                     LTYISVLTTPNERPLYLAILMSVWGVGNVLGPIVGGSFATSSATWRWGFYINLPIAAV
                     FAPAFLFSLPNINAMPDTPFGRKMRMQDWFGLVVFTGFCLCFCMAGSFGGTLYAWNSG
                     SEIALWAMTLVLLVVFVFVTVYHPLVPAESRLMPLHFMRTKDLVIVPLQAFLVAGSMM
                     MSIYYTPLIFQFTRGDSPLMAGVRILPLISMIVFGCLFNGFAMPKFGYYKPWFVVGNA
                     MLVAGAALMTTVTPSISNSSLYGYTVLMGLGIGAFQSAGIGVASALAPPAEISNVVSV
                     MTVGQVLGIILSLSVSGSVFTNRAISKIAAALPDIPTGEIAALITGASGRLYARLSDA
                     ERAVVVAQIMRAISDAFYYLVAITAVGFVTSLFLSVSVYLPILSWVSFPSGCFAKYCE
                     MWCWC"
     gene            complement(<1680827..>1681982)
                     /locus_tag="THITE_2040998"
                     /db_xref="GeneID:11515688"
     mRNA            complement(join(<1680827..1681523,1681588..>1681982))
                     /locus_tag="THITE_2040998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648890.1"
                     /db_xref="GeneID:11515688"
     CDS             complement(join(1680827..1681523,1681588..>1681982))
                     /locus_tag="THITE_2040998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648938.1"
                     /db_xref="GeneID:11515688"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="JGIDB:Thite2_2040998"
                     /translation="PWSDNSLINGKNNYNCSMAPANSTCHEQACLAHFRFRPGKKHRL
                     RLMNTGAAALVHFSIDGHKMEVIANDFEPLVPYAADFVTLGVGQRTDVLVTADADPRA
                     TYWMRSTISLNCSVAHTTVGRAIVSYEGSRTISAAAAAADAKSFLCRNDDLARTVPFF
                     PQPADPHPDTVETYTIDLLTNATGNHVWTINNRTQYTDYNNPVLLQAYAQNFTFPTPP
                     PPGTTAGDPNVYNFGRNRTVRVVLNTVYQSAHPMHLHGHAFQVLAEGPGPWDGRTVVN
                     PANPLRRDRHMQRRFGHLVLQFAADNPGVWSLHCHIAWHASMGFTIVLLEQPAELART
                     QVPFVMRETCEGWDRWSKTHVVDQIDAGI"
     gene            1684763..1686003
                     /locus_tag="THITE_2106964"
                     /db_xref="GeneID:11516559"
     mRNA            join(1684763..1685203,1685295..1685567,1685690..1686003)
                     /locus_tag="THITE_2106964"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648891.1"
                     /db_xref="GeneID:11516559"
     CDS             join(1685001..1685203,1685295..1685567,1685690..1685813)
                     /locus_tag="THITE_2106964"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648939.1"
                     /db_xref="GeneID:11516559"
                     /db_xref="JGIDB:Thite2_2106964"
                     /translation="MSSYNLPAPRRITASNLPLPSQYHGDEHAEPGVEIKIDNLKVDS
                     LLNGTLMRARVATSKQIPTINDGHGDIPLDEVPGMGIVLPGGLNMYYIDLAPNTEGTM
                     HRTTSTDYLVVISGALSLLTPAPVPYQVRDGKATHGEPVETVCRPGDVVAQRGMMHAL
                     SNRTNDWVRLLAVVLSSNPNKVPVEGTGGHKELPDVWLA"
     gene            <1687446..>1688402
                     /locus_tag="THITE_120545"
                     /db_xref="GeneID:11515535"
     mRNA            <1687446..>1688402
                     /locus_tag="THITE_120545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648892.1"
                     /db_xref="GeneID:11515535"
     CDS             1687446..1688402
                     /locus_tag="THITE_120545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648940.1"
                     /db_xref="GeneID:11515535"
                     /db_xref="JGIDB:Thite2_120545"
                     /translation="MTMAVVLDVSFQTRRGQLIHGVLKLYDRRFGSSLRNILTNKPAP
                     YTQENEAAFETFVGRGMMPEFIHYLKQKSETETLPIAARQFLEEPDRTKGLAKFEATL
                     WHDCIEYFECETKAYNRLADLQGKLVPRMLAHVSLSPTKLATSIAPEAAPYFDVRGIL
                     LERIDGYCLGDVELGPLPQDLRTLQQVIQSAADAAHEINKRGIIMNDCAPRNVVVDGK
                     SNTPRIVDLAQCYFREELVEQWYKDGWQEDEDWDPDVEYWEQAENNPAAIGLVMVTRI
                     QKRTGVKLDIRYPDYKEIIAGIRRRKAEVAAAEGKGAPQKSS"
     gene            complement(1689742..1691451)
                     /locus_tag="THITE_2106967"
                     /db_xref="GeneID:11517227"
     mRNA            complement(join(1689742..1690913,1690977..1691108,
                     1691183..1691451))
                     /locus_tag="THITE_2106967"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648893.1"
                     /db_xref="GeneID:11517227"
     CDS             complement(join(1690068..1690913,1690977..1691108,
                     1691183..1691227))
                     /locus_tag="THITE_2106967"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648941.1"
                     /db_xref="GeneID:11517227"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2106967"
                     /translation="MGSFLSKNEFPVEGRTVLITGGSRGLGLSAARQLAGKGANVIIA
                     ARDVGKLEEGVAHISQGARFPDKQRFHYIRADVTTAAECARVVKEATAWNDGAPPDIV
                     WCCSGSAHPTLVIDTPVEQFQTMMDSNYFSCAYMAHAILNAWLRSPAPADADAGSSRK
                     TPAPPARHLIFTGSFVSFYSFAGFTPYAPSKAAVRSLADSLSQEMNLYAGARPDLPRV
                     RVHAVFPATMPTQSLEDENRVKTDLTKALEEGDQVLSPDECARRAIAGLEAGEELVPT
                     STIIRLVMTSVMGGSVRGGFWKGLANTLLGWVVLIVMVFIRWDMDSKVSKWGRQHGAS
                     GMLGKK"
     gene            1691514..1693592
                     /locus_tag="THITE_2106969"
                     /db_xref="GeneID:11517229"
     mRNA            join(1691514..1692140,1692215..1692686,1692762..1693592)
                     /locus_tag="THITE_2106969"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648894.1"
                     /db_xref="GeneID:11517229"
     CDS             join(1691897..1692140,1692215..1692686,1692762..1693329)
                     /locus_tag="THITE_2106969"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648942.1"
                     /db_xref="GeneID:11517229"
                     /db_xref="JGIDB:Thite2_2106969"
                     /translation="MVPLSLLIARSDYNDAAPSSTDDGSGDATLGVSGLVIALAVISV
                     ALRFYTRIFTRLGLGWDDWLIFAAVIFTLATAVLLLWGNSVDPNGTWVSENTNPNYDY
                     TPQDIFYLKLAFACSILYFLIAGTTKLGILFMYNRIFYVSRAFRFQLWVASFLVVSWW
                     FACNLTAFLNCRPLEWSWLNSLADPRYCINYNIFWMAAGACEIFLDVLILTLPISVMM
                     RMGLTLRQKFTVGGIFLLGGFVIITGLVKVILGYPPGSRVPSYSNTEVWTEVHTAMSM
                     VCACLPIFGPLARKIKRSAFGRWVSAHCGRRKPGPPRQSEKGPQGPSWSKIKLPSWHS
                     SRFAKSRDEREDPEPGIVAVMERPSPSGQEPDDQMVQPPKAVHTRSSTSTTTDARPLA
                     DPMEWRLTIWRAQGSTDPELMPDIRQEMFQRGFVV"
     gene            <1694210..>1696033
                     /locus_tag="THITE_2041542"
                     /db_xref="GeneID:11515469"
     mRNA            join(<1694210..1694560,1694648..1695763,1695914..>1696033)
                     /locus_tag="THITE_2041542"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648895.1"
                     /db_xref="GeneID:11515469"
     CDS             join(1694210..1694560,1694648..1695763,1695914..1696033)
                     /locus_tag="THITE_2041542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648943.1"
                     /db_xref="GeneID:11515469"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="JGIDB:Thite2_2041542"
                     /translation="MAPSLHRTEPPGTPPRTAIGEPAFRFSVICDDDDDDQDQAGGGQ
                     DGRDNHGDDTEPLLSTAAFLHPHHATPLRPLTPEHTPAMATEDRLASGGISASPPKNP
                     FNFQTQFISTAPVKSSIGQRRGHRYKHSSISAQHQIFQEPPPRPPPVLPASLPIPTLK
                     EAWASMQREQRARLWWCCCHAAVAMYVFFAAEGSLAMTALSHLVFFDVGSAAVCVAVD
                     VLGNFEVWRRSSIRHPFGLQRAEVLAGFAMSVFLVFGGFDLISHNLKHFLETVGEHVP
                     HHPTAGSDQAAHAGHAHHARYVSPGTVDFASLAAVVSTLVSAYGLRNHGRIRRVMRVP
                     FPYLASLLPGAGLLANPFHFLTLCFSFLLLLLPLVSVPLFLWLDRLICAAIAASMFVL
                     GTRLAVAQGLMLLMSYSGGGLPSSSSSATAASQDPRISHSEKKKLLTTTTTTNTNNTN
                     HTISSVLREIESDPQVARVEEAQFWQVHYGLAMANLKVVLSQLRGRLARVVQNRLGEG
                     GYGRGGSLRWEVTVQFCSDG"
     gene            complement(1696359..1698296)
                     /locus_tag="THITE_2106971"
                     /db_xref="GeneID:11515620"
     mRNA            complement(join(1696359..1697146,1697201..1697945,
                     1698024..1698119,1698188..1698296))
                     /locus_tag="THITE_2106971"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648896.1"
                     /db_xref="GeneID:11515620"
     CDS             complement(join(1696482..1697146,1697201..1697945,
                     1698024..1698119,1698188..1698202))
                     /locus_tag="THITE_2106971"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648944.1"
                     /db_xref="GeneID:11515620"
                     /db_xref="JGIDB:Thite2_2106971"
                     /translation="MCRFLVYKGSDEILLSKLVLDPAHSILKQSFDSRLRLDTRRGQN
                     NADGFGIGFYTDPKLGAAPCLFTSTTPAWNCVNLHRLASKTASRLIFAHVRATTEGSL
                     SEDNCHPFCHGSLMWMHNGGLGGWKQIKRRLGERLADKWYLGVVGGTDSEWAFALFLD
                     TLERMGHDPSSQPENGFGPTVLRKAMLKTIALINELIDNIPESVIHAENVDTRSLLNF
                     AVTDGHSIICTRYVGSSSDEAASLYYSSGTLWETRAPTPDSQHYLMERSDKGADVVLV
                     ASEPLTFERENWVNVPTNSILTIHNQTVMVHPIIDRYYDRNPHHRRSTAFVRTKGLSA
                     NEKDTSRSGTPFSPPGSIPAIPSAPHFPEQPEPHKQRFRGPTIPTIPSSLSRSCTPDA
                     FSSTASTLPHSRTPLSHAETAAPDPQALQVPPPPTDIRALTDPPIARPAPQQPPAQGN
                     IKKKRASLSAVEAAAHRPGAAAMAQQYFDASPVTPEPVRTEFGNPNKIARLFPELA"
     gene            1699336..1702661
                     /locus_tag="THITE_2106972"
                     /db_xref="GeneID:11516584"
     mRNA            join(1699336..1699831,1699896..1701935,1702014..1702661)
                     /locus_tag="THITE_2106972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648897.1"
                     /db_xref="GeneID:11516584"
     CDS             join(1699522..1699831,1699896..1701935,1702014..1702489)
                     /locus_tag="THITE_2106972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648945.1"
                     /db_xref="GeneID:11516584"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="JGIDB:Thite2_2106972"
                     /translation="MSAQLRAAGAMATAPLAARHATVRAVRHFHQLPTGGIQRAELAA
                     RSFRRSLQFPANAYHNAVIVRNASFARLLPKLALKFVRIPALFGGLAIGTVGWIQYQA
                     IQVSNSAQEMYGNMKNAVTSTASSLWGGAKDIAEQTKRGWSNTKEQFEMPEWLDKIMR
                     GEGEAGSGRHGSGGQGGPGGPEPPLQSRVGAAAVAGASAAAYGYDQSDEHDDRTPEEI
                     LKDDQMMYITKRMIEIRNLLQKVGQSSTVTLPSIVVIGSQSSGKSSVLEAIVGHEFLP
                     KGSNMITRRPIELTLVNDPEARADYGEFPDLGLTRVTDFSLIQKTLTELNQSVPESLC
                     VTDDPIRLTIHSPKIPDLSLIDLPGYIQVAGENQPRELKRKISELCDKYIRGPNIILA
                     ISAADTDLANSTALQASRRVDPRGERTIGVITKMDLVEPEKGAAILNDRQYPLRLGYV
                     GVISKLPPQTGLFRREASNLLAGINRNEKSFFNSYPAQFGPESGVSTGTITLRKKLLQ
                     VLEQQMSSRLQETTDAIQRELEETTYQFKVQYNEQPMSAEAYLAASLDDFKHQFHEFT
                     SSFGRAQLNSLLKDALDQKVLDQLAARYWNRPIEDLLVAPPEPDNIADLPKADPDSPY
                     WHRQLDTATSALTRLGVGRLAATVAASAVQSNIDKLLDKSSFAKHPSARKVISEAAST
                     VLADRSYATSDGIEISLKPYKFDPDIQPDEWAQGREHVVGVLEGELKQCQAAMKSLEA
                     SVGGKKKLKEVMSFVDKARKGEIIVEGDHPSGAGGFSAALLARGREAVFLRDRADIIN
                     LRILAAKSRQCRRPENKYYCPEVFLDAVASKLARNAVLFLQVEMLHDFYVRFPREVEA
                     KLREHMSAAGGGGLERFAREDPKVRRHLDLIQRKELLELVLAKIEDLHRFGAGAGAGA
                     GVGVGGIGKDAAAGEMAKRRGRRSILF"
     gene            complement(1702880..1704561)
                     /locus_tag="THITE_2152817"
                     /db_xref="GeneID:11516590"
     mRNA            complement(join(1702880..1703687,1703773..1704230,
                     1704353..1704561))
                     /locus_tag="THITE_2152817"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648898.1"
                     /db_xref="GeneID:11516590"
     CDS             complement(join(1703417..1703687,1703773..1704230,
                     1704353..1704424))
                     /locus_tag="THITE_2152817"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648946.1"
                     /db_xref="GeneID:11516590"
                     /db_xref="JGIDB:Thite2_2152817"
                     /translation="MVNFKWSYIALLALRVATAFAQDDADAQSGTSAKVDQPDLKADI
                     ETTFPDADIFGVKIVNGRITKALIEITNHEETPIDVAFVGGMLKTTKPLPDDAPASAA
                     ILRNLTAVRYDVSIPAGAKHQLPFQFVLDMMPQDVIVELVAIISNAATSQIFQVQAHS
                     GPASIVDPPTSIFDPQIIFLYLFLTGVFGATLYFVYKTWIEALFPHAGRSKGGHKKGR
                     KAASAAEAEPLSGSESAGAASGADSKGYDESWIPDHHLNRPVARRRAK"
     gene            1707291..1708303
                     /locus_tag="THITE_2106978"
                     /db_xref="GeneID:11516721"
     mRNA            join(1707291..1707498,1707578..1708303)
                     /locus_tag="THITE_2106978"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648899.1"
                     /db_xref="GeneID:11516721"
     CDS             join(1707454..1707498,1707578..1708183)
                     /locus_tag="THITE_2106978"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648947.1"
                     /db_xref="GeneID:11516721"
                     /db_xref="JGIDB:Thite2_2106978"
                     /translation="MAAARAGEQPFQEGQAFLDGQFDIVDWYPYFQSCVRYFLKHAQY
                     NGPVQFLAAFINIQLPFQKAQAEFLLSHTPSPAAVAAAAAAGLAPPPAAPPPPPAALG
                     DGGVGVPLTYSTATTTTLQPYIRRLVATGFDFPGVLHSFFGDDWERGVRPLCELERRN
                     YMFAAKSGSWLEVKRAYDGAGADEAVPFLRPLRNVSEAEIVAAEAAWSEWLAMQDW"
     gene            1709237..1713278
                     /locus_tag="THITE_2106983"
                     /db_xref="GeneID:11521184"
     mRNA            join(1709237..1710148,1710208..1710455,1710514..1710576,
                     1710631..1711146,1711208..1711748,1711801..1713278)
                     /locus_tag="THITE_2106983"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648900.1"
                     /db_xref="GeneID:11521184"
     CDS             join(1709464..1710148,1710208..1710455,1710514..1710576,
                     1710631..1711146,1711208..1711748,1711801..1713068)
                     /locus_tag="THITE_2106983"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648948.1"
                     /db_xref="GeneID:11521184"
                     /db_xref="InterPro:IPR014801"
                     /db_xref="JGIDB:Thite2_2106983"
                     /translation="MDAGPATAGLPAAVAVWSEFIRRALNRRLDQEKFAAFVPILFSQ
                     HPIPPVILADFILRPSDVTRYSLDPRAFLYLQVLLKQRRLDIASVLRALYKYSSIHEL
                     VRPQDGASAAPGDGAAEEKKTPGKLVRWQNSYEIDEILLWRFAKAVNAGTAITTAETA
                     IHVAKVLAKWMPLFTEAAAIFSREAFSSLHGMPPRDETARARNAFALLVFAFSENPVV
                     IKTLSRPAFKGLCKTLSDSLVAFMPCIMQVMPEVAGALELFRTQTLCKFLPSEKKESE
                     LNNYMDNLIGLDSLQIPEVPVVNTRAGLYIYLSAALVGRPMLEDSALFTYLHNRYQGD
                     VQSTAVQLILASFDLLANAVFRNEGPRTGHLLKSYVVNKVPLILVSLAASSAVYPFNP
                     EMCITEALGQVDTNVFPTLSGMFEMSNTGSSFHDSVRQDFCFSCQLHGLLSQAAIENL
                     LGDITYQSLPDEGRYVKEILVQSCLQEVDRTQKLIVELDNMNGNVGAAAQAIIEVIGN
                     LCRTKETMTLKQLCSQLAAKPLSLDVLLLFDKPQKILHPLCELLDNWAGYEEDQGEYH
                     PVYEEFGSILLLLLAFVYRYNLSPADLGIRSPDSFVGKLLNAGNLCRPLEELNEREKA
                     HLNGWIHGLFDTEAGGLGDDLMASCSPQDFYLLMPTLFHQVVIALSAGRLTDDMLKCG
                     LEYLVGVLLLPSLVPAILYLSNQLWVGGPQIQTAIIKTLQPILRPSSISHEASTMLSS
                     VLNIVAKPLEHALRSYQRQDPKCQEIEPLLEAIRDNLAVSRRTGGADHTELESWSSMH
                     ATNATNGSGITHGGLTAAVRHTVQSLVQWAQQPPLNGMPAAYTHRQTLAALKMLGAKR
                     LLSILLEELKSFADSPQAGIAYDVITAIICAPDVTNDPSLANAATGPPSAADAAASST
                     NNNNTTPASTPAPQQRRISLREALKAEADDWKKTMRSDPALAETVVRLHRRVEAQMAP
                     PPPPPETTAAAAMLQPELGGLGVDVGADAAALGDAIAAAAAAAGEHHDAAAAAMALDA
                     AGLDAAAGGTVPDLGALGGGAPADLAAQVGAGGGNGGGNGGGGGGGLDLSGDDIFGGL
                     TGASDFGAEFSGWDMDLG"
     gene            1714788..1716702
                     /locus_tag="THITE_2106989"
                     /db_xref="GeneID:11515462"
     mRNA            join(1714788..1715222,1715281..1715446,1715496..1716622,
                     1716678..1716702)
                     /locus_tag="THITE_2106989"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648901.1"
                     /db_xref="GeneID:11515462"
     CDS             join(1714982..1715222,1715281..1715446,1715496..1716438)
                     /locus_tag="THITE_2106989"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648949.1"
                     /db_xref="GeneID:11515462"
                     /db_xref="JGIDB:Thite2_2106989"
                     /translation="MSKAIRFAALACALGIADSKVLKWSDNGPRWIPPRETLAYLPSL
                     GMNPPSPTPPPEVEPRDGLRARDPTQNTCAYVDGIGISSLYCDATANCVYNSINSHIG
                     CCDDGSTYCPVWTTCYDSTERSSYSTNNGFTLWCGNSTYPHCITHLYYDARFTGYTLL
                     GCAVAAGTDKVWFTSTDGTTSTSSSSSSISTTTSSSSTSSSSSSSSSSSSSSGSPSSS
                     SPTPAPATTTDSQGSSTPVGPIVGGVVGGVAALALIGLGIWALMRLNNKQKTDAAAGA
                     AAAAAAAAAQQQPPPPGPPGPHMSQMQPPQGYYGVAAAGAGFNQFDPRSSIAKPVAYS
                     TTESTLYAGGGGDHQTLGSAPSSSPPHSPNQGYPTQHTPSPPPQGQFVQQQPPPPPQQ
                     QGYVQQQFGNVPPAAAPGAGYQQQPPQQGQQYGYAPVAYTVELPTQRGDGQLRELQG"
     gene            complement(<1716674..1718573)
                     /locus_tag="THITE_2106992"
                     /db_xref="GeneID:11517072"
     mRNA            complement(<1716674..1718573)
                     /locus_tag="THITE_2106992"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648902.1"
                     /db_xref="GeneID:11517072"
     CDS             complement(<1716917..1718408)
                     /locus_tag="THITE_2106992"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648950.1"
                     /db_xref="GeneID:11517072"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="JGIDB:Thite2_2106992"
                     /translation="MPPAISPAELAQHNTADSLWLAIDGEVYDFTEFAPTHPGGIDIL
                     LQYAGNDASAAYNAVHSPSLVKAILPTSKHLGRLSSPLPPSPSATTPATAPSQPSKPP
                     LSSLISVNDFRLAAHTFLPPKTLAFISSAATDCHTHRRNSTAYSEITLRPRVLVDVSA
                     PVNLETTILGQPVPSPIFVSPTSLGKTVHPEGELEIARACKELGGVAQVVSTSASFSV
                     ADVVRAAAEHPAAATSPGSGAPPCNPPVFLQLYVDKNAANTAALLQSLTTKGLDGKTP
                     TDEPLIKGVFLTVDAPVPGKREADERIPASPSPTTTTPMATQVTPQTDARGSALGRLM
                     ASYISSSLTWSRTLPWLRSQLARGGDGLRRVRVPLVVKGVQTAADAVRALRAGAAGIV
                     VSNHGGRSLDTAPASVLVLLELQRCCPEVFERMEVFVDGGVGRGTDVFKALCLGARGV
                     GVGRGVMYGLGWGREGVRRVLESKSSSSSSFFFFFSWLWQGENRVEL"
     gene            complement(1718574..1719733)
                     /locus_tag="THITE_2106993"
                     /db_xref="GeneID:11516878"
     mRNA            complement(join(1718574..1719148,1719235..1719733))
                     /locus_tag="THITE_2106993"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648903.1"
                     /db_xref="GeneID:11516878"
     CDS             complement(join(1718740..1719148,1719235..1719461))
                     /locus_tag="THITE_2106993"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648951.1"
                     /db_xref="GeneID:11516878"
                     /db_xref="JGIDB:Thite2_2106993"
                     /translation="MESLQPLGPNYAAAIKLIDEAHAQDPNTTAAPVDGESVPIPYEL
                     HYARKMTRWLASRKPDASPALQLACRAQHFRRWELPRSSYPMTRAGYLTWRAKQKAQA
                     AAQVAELLSSSPAIQPPLTQGEIERVAALVRKENLQSDEETQVLEDVACLVFLDDQFD
                     SFEKKSEIDEEKMVGILRKTWAKMSEEGRKLALGMQLSDRAKTLIQKALDG"
     gene            <1720547..>1721206
                     /locus_tag="THITE_2084131"
                     /db_xref="GeneID:11523380"
     mRNA            join(<1720547..1720627,1720683..1720824,1720932..>1721206)
                     /locus_tag="THITE_2084131"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648904.1"
                     /db_xref="GeneID:11523380"
     CDS             join(1720547..1720627,1720683..1720824,1720932..1721206)
                     /locus_tag="THITE_2084131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648952.1"
                     /db_xref="GeneID:11523380"
                     /db_xref="JGIDB:Thite2_2084131"
                     /translation="MERSHFRTPTTDAAITGTVPAVLASAATILLRLAPVTALGSRPD
                     PPQTTFQPPLVATLTVSTATITIQLATSPLPAAAPQSLPLSHTTAYLQRAAARPNTVT
                     FAQAFPPPTSIPMSDASAALARLRLDYSAGGWREEEEEDRDGDGDWDGDADGDGDMGG
                     GYGWC"
     gene            1721244..1721667
                     /locus_tag="THITE_2106995"
                     /db_xref="GeneID:11521263"
     mRNA            1721244..1721667
                     /locus_tag="THITE_2106995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648905.1"
                     /db_xref="GeneID:11521263"
     CDS             1721379..1721633
                     /locus_tag="THITE_2106995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648953.1"
                     /db_xref="GeneID:11521263"
                     /db_xref="JGIDB:Thite2_2106995"
                     /translation="MEDKGGGDGHGGGLGSPWHDAKEKGKGKGKGRDARWGRPRYQPA
                     SVEDVSDEGEDGMGCEYPSVNGNGYGYGCHGDGGSIEEEW"
     gene            1722680..1723771
                     /locus_tag="THITE_2106996"
                     /db_xref="GeneID:11515771"
     mRNA            1722680..1723771
                     /locus_tag="THITE_2106996"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648906.1"
                     /db_xref="GeneID:11515771"
     CDS             1723049..1723675
                     /locus_tag="THITE_2106996"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648954.1"
                     /db_xref="GeneID:11515771"
                     /db_xref="JGIDB:Thite2_2106996"
                     /translation="MYDASRHYLVPARRASWDAFQQQQHQQQPPHPTGVPASSLRPSS
                     AAPQACLPALRPDSRAPQPLYRAVPQRQLFQSQGGQQQRQHQQQQYQHQQQQQPVNPF
                     RHPPLYTFPPPRSSRRRPPPPAGTPPLPARSSSTSPPTAATAAATAAATAAAAASATS
                     SSSSSSMSGISLTASEEAQLLQQLRQNEQEHEQQQQQQQQQQQQQQQQ"
     gene            complement(1724254..>1726255)
                     /locus_tag="THITE_2148749"
                     /db_xref="GeneID:11521448"
     mRNA            complement(join(1724254..1725746,1725806..1725978,
                     1726183..>1726255))
                     /locus_tag="THITE_2148749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648907.1"
                     /db_xref="GeneID:11521448"
     CDS             complement(join(1724790..1725746,1725806..1725978,
                     1726183..1726255))
                     /locus_tag="THITE_2148749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648955.1"
                     /db_xref="GeneID:11521448"
                     /db_xref="JGIDB:Thite2_2148749"
                     /translation="MLCAIIRTPTTFTSEPQSSSGPSFSQLLVLKTKAVQPIFSISHA
                     RRSRTIHAPLMQRRSKPTGIRSFTALWEELGSSRNLSASFRRETIGDHQAGAVFMASS
                     EVDQKFLGKLAKAVENDNPLLASVLFRILGLSINLSAQLIKARKQRRQDAAQAAAALD
                     LTCHIIWLSREGLVLLQQYVLPMVGNYVELKVLAYKLRASFYHIFVLFHNTPPVSTMG
                     VYTPESQASSTVPGLPPSRVDKGKGIARDDQEADQAGNPPTGGPVAPPPGFGPAPPTA
                     FLLKPGNYLPEAHQYFREAVQLAEQLLWGSHSLRLSVKTEYAAFLYECIHDAEGSRKL
                     AKDTIAEVYEATEGIDNDMFNDACELVTVLGKMMKRGLGKAQGSSSGTQGTPRAEQGE
                     GSAPPGMI"
     gene            <1727459..>1727804
                     /locus_tag="THITE_2084134"
                     /db_xref="GeneID:11517082"
     mRNA            join(<1727459..1727508,1727624..>1727804)
                     /locus_tag="THITE_2084134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648908.1"
                     /db_xref="GeneID:11517082"
     CDS             join(1727459..1727508,1727624..1727804)
                     /locus_tag="THITE_2084134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648956.1"
                     /db_xref="GeneID:11517082"
                     /db_xref="JGIDB:Thite2_2084134"
                     /translation="MSTGRGRTFNPLRLLLSPSHRHFCTTHVDHLPLVIDVLDLPTPD
                     GRAWPPMMRPSSDHPQHSASALHNMVVVVSGL"
     gene            1729011..1729417
                     /locus_tag="THITE_2107000"
                     /db_xref="GeneID:11519181"
     mRNA            1729011..1729417
                     /locus_tag="THITE_2107000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648909.1"
                     /db_xref="GeneID:11519181"
     CDS             1729213..1729389
                     /locus_tag="THITE_2107000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648957.1"
                     /db_xref="GeneID:11519181"
                     /db_xref="JGIDB:Thite2_2107000"
                     /translation="MCRYYAFQHACAHTALAFAAFCPPAALRQNPCGERHIWQTIRLD
                     EPCEDCCRHAAVVR"
     gene            complement(<1730440..>1734303)
                     /locus_tag="THITE_2040709"
                     /db_xref="GeneID:11515551"
     mRNA            complement(join(<1730440..1730721,1731112..1731731,
                     1731799..1734209,1734272..>1734303))
                     /locus_tag="THITE_2040709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648910.1"
                     /db_xref="GeneID:11515551"
     CDS             complement(join(1730440..1730721,1731112..1731731,
                     1731799..1734209,1734272..1734303))
                     /locus_tag="THITE_2040709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648958.1"
                     /db_xref="GeneID:11515551"
                     /db_xref="JGIDB:Thite2_2040709"
                     /translation="MLWYLLYPLRGTTEAPVLAPTHPLRKAFTRYGTWAARHVETILP
                     LSGAVVFFFLYLFPFLYTTDAANITSGVSYLPHHVWTNAQPLSDQAAVEPDVIMRSIW
                     VHGCYMKALRRDVLLGALELQDEILGPTTDFDPRQPPGPRMLPEPDADLDRQQRDFFH
                     ITNGLTNQSWFFHSPLQYWSGSAEKIAADEDIVATVNERKSQTTSVNTTLRHPIVFSG
                     KRFDERRLVAADALVITLFHLRDSPVGRQWVRKVEALARTSERDGKWQIIPPDGRSLS
                     NQLYQFQFQPMSAFEWVLLTLAYSLTFAYLLLSLSKLRAFKSRVGLMVTVLAQIAASI
                     FSSFTVCAIFKIDLSRIPYYAYPLVILTISLENSFRLINAVIVTSSTISTSLRIGDAF
                     GATAHIAIANRAQNFLLLLGLARITSAGVSAFCTFAAIATLFDFFYLATFFLSVLSVD
                     VRQRELCELEKASLKRAKSSHGGLPKAPWIRDLHPFRLGETALTTRIVGTIVLVGFVL
                     IAQAHYVSEGPHRWLNQLFSMSWSAAGRAPKSSLLVDIHQARSPTSWLRLQDRETARE
                     VIKVVKPWAHSYVARIYDPIIFVLKGADRTPDTQEPLFLPAVYDFLHHQIPQFMVCLS
                     TVLATLLLFTKYLIKDRLQGDGASDHPDDEPLLSVRSLSGGHVLDVAMLSASPGGKLV
                     SVGLDRAIQVWDLLSGTRNRVLSDPEVPLENPFPVLSMAIDDESKWLALVSWQRVFLW
                     NMETRQWAETREVDLGGHRPEAVFFVLKTPDTPPTLVLVRRNGVGLELQLETAKSRDF
                     VICKTPLVWAVSFTENNPAQPNARSISMLTASRKNCIHLVRQQGDEWLSTEVKLEGER
                     ERRDVHCLLPIPGLSMYLIGRSQSVDLVDLESSTIIHTFRTEMMQKRTLKHIAFTRPQ
                     QSGLESLTLSYISAETGELVVHSYLSATATDTPSSPPPPEPLASTAHGRWIPAQEAIK
                     HISNPGVWEALPSGSIVGVRRKPSPTPSPPPLSSPPLLGTLRRRTVSPSVVSVGHAYF
                     DRSPDGPLGLGGVGLAGGDGRLQRAVGLGVGVGGRRKKALSASGRGASSSLGGGGGGG
                     GGGSLGGRGSGSGSVWEGGGVGSYGC"
     gene            1735168..1736840
                     /locus_tag="THITE_2107001"
                     /db_xref="GeneID:11516736"
     mRNA            join(1735168..1735626,1735701..1736477,1736563..1736622,
                     1736679..1736840)
                     /locus_tag="THITE_2107001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648911.1"
                     /db_xref="GeneID:11516736"
     CDS             join(1735376..1735626,1735701..1736477,1736563..1736622,
                     1736679..1736790)
                     /locus_tag="THITE_2107001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648959.1"
                     /db_xref="GeneID:11516736"
                     /db_xref="JGIDB:Thite2_2107001"
                     /translation="MELPQSQDPIEELITNYNELNSPIVEELTEEPSPLEFMRFVARN
                     TPFVVRGAAADWQATRTWTVDFLTQYLGDQLVNVAVTPAGNADAPTPFTNPDGTTTLV
                     LAKPHEEYQPFSAFLSYLTAQEKATKATVPPPSPSPSSSPPSPSSSTPSAEAHHHRGE
                     PEEVRYAQTQNDNLRHEYRRLQAHVPRDIAFARVALAAGARGGGPDAVNLWIGNSRSV
                     TALHRDAYENLYVQVAGRKHFTLLPPAFQPGVNERLLRGARYRRVVGAAGDGRRGGGG
                     GGLELVLDEDLEEADQEEEEEGKKGMVPFPTWDPDRPEENATRYSRLAQPMRVTLEPG
                     DMLYLPCLWYHKVSQSCSPEGVCIAVNYWYDMDFTGPLYPLSTFVRSVSSKTDSSCKD
                     DGGTVPP"
     gene            complement(1736840..1739869)
                     /locus_tag="THITE_2107005"
                     /db_xref="GeneID:11515700"
     mRNA            complement(join(1736840..1737111,1737182..1737516,
                     1737568..1738734,1738785..1739064,1739127..1739423,
                     1739492..1739869))
                     /locus_tag="THITE_2107005"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648912.1"
                     /db_xref="GeneID:11515700"
     CDS             complement(join(1736890..1737111,1737182..1737516,
                     1737568..1738734,1738785..1739064,1739127..1739423,
                     1739492..1739659))
                     /locus_tag="THITE_2107005"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648960.1"
                     /db_xref="GeneID:11515700"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="JGIDB:Thite2_2107005"
                     /translation="MAIQKKHGKGRLDKWYKLAKEKGYRARAAFKLIQLNKKYGFLEK
                     SRVVLDLCAAPGSWCQVCAETMPKDSIIIGVDLAPIKPIPKVITFQSDITTEKCRATI
                     RTHLKTWKADCVLHDGAPNVGTAWVQDSYNQAELALHSLKLATEFLIEGGTFVTKVFR
                     SKDYNPLLWVLNQLFTKVEATKPPSSRNVSAEIFVVCRGFKAPKRIDPRLLDPRSVFE
                     DLKDPAPNNEAKVYNPQVKKRKREGYEEGDYTQFKEIAASEFIQTTDPIAILGQYNRL
                     TFEQAQNGDVALAALDRLPETNDEIRACCADLKILGRKEFKMLLKWRLRVREIFGLPT
                     KKTTKTPIAEEVAEVENMDEELKIQEELQRIKEKELSKKKRERRKENEKKRKEIVRMQ
                     MNMTAPMDIGMEQEGPRGEGAMFRLKAIDQTEALRRIAKGKMAMLTEAEARKDRDSGI
                     GSSGETDDESDDDGDRLERELDNMYDQYKERKMAADAKYRAKKARQEHADEEWEGVSA
                     SEKGDSDDEDSALEEDSSDDSDAEERGDTSKPLIRDLDNTPQDGTGLSKRARGFFSQD
                     VFQSIPGLLDVPEEEEEASEDEVPTIQEQKKKHKEKPASKDEEGSGDFEVVKRHEDDD
                     WEETEKKTKDGRPNIDIITAEAMTLAHQLARGEKSAHDIIDEGYNKYAFKDRDGLPDW
                     FLDDERKHDKPHKPITKEAAAAIKEKLRAYNARPIKKVAEARARKKLKQARRLEKLKK
                     KADLLASDEGMSEKEKATSIAKLLSAAARKKQRQPVKVVKAVGVNRGIAGRPKGVKGR
                     YKMVDPRMKKEMRALKRIAKKKKR"
     gene            <1740397..>1742794
                     /locus_tag="THITE_120558"
                     /db_xref="GeneID:11515500"
     mRNA            join(<1740397..1741054,1741120..1741230,1741287..1742416,
                     1742537..>1742794)
                     /locus_tag="THITE_120558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648913.1"
                     /db_xref="GeneID:11515500"
     CDS             join(1740397..1741054,1741120..1741230,1741287..1742416,
                     1742537..1742794)
                     /locus_tag="THITE_120558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648961.1"
                     /db_xref="GeneID:11515500"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_120558"
                     /translation="MSEIGKTPSSAAKSSGTLGTSLLSSPPRAPPSRGKERRNPSITP
                     RKFQRFFTPRSRVSSKPSAVRKALCDLTAPALNRGQTPSSPLKPPSEDLGHDSLPLPH
                     LQDAHRSKRRRVQLTTPEKQTNPLPSPLNSSPLLPTPDLRPGLSSPIQSLKSRQGLRD
                     GVFVDDDVPEDDEEEPTAATPLYKRPVPLHRRGLGAQLVQRMTGAMRYASDRPLECPV
                     ADWRTETADFYSRPEDVHFSSSHEGAPRAIPFCTATCHRNRLVAVGDEEGYVRLLDSS
                     RDFSKIHLSFQAHGNAIIDLAFSEDDYLLATASGDQTGRVIDMMTQRPISVLGHHTAS
                     LKQVRFQPGRGSGCVLATSGRDGSVQIWDLRCRGGPVQDLTVSSEAGLHHRLPKPLSP
                     GCVVNSIWDAHARTTRPSKGQSVNSAFGDVARVGEVPGRIGEVSVTALQFLPPGREHL
                     LLSACEADASIKLWDIRAVHTSRHHRASTPVSFTAPPPGHAAFRPFGICSMTLGGDGS
                     RLYALCKDNTVYAYSTAHLVLGHATELTPARPGAEPPRRRHHPHGTAHSGLGPLYGFR
                     HPLFHATSFYVKAAIRHAADGRSELLAVGSSDGVAVLFPTDERYLRDAWSSSADHAEQ
                     ELYYVGSPTAADCAVPVGRRGTPLVRGHGKEVGAVAWTSEGKLVTVGDDFLVRCWSED
                     RARAADLRLGGETGGRRWGCGWADVGDRWDGDADDW"
     gene            complement(1745016..1746738)
                     /locus_tag="THITE_2061844"
                     /db_xref="GeneID:11515744"
     mRNA            complement(join(1745016..1745416,1745471..1745512,
                     1745574..1746362,1746433..1746738))
                     /locus_tag="THITE_2061844"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648914.1"
                     /db_xref="GeneID:11515744"
     CDS             complement(join(1745144..1745416,1745471..1745512,
                     1745574..1746362,1746433..1746624))
                     /locus_tag="THITE_2061844"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648962.1"
                     /db_xref="GeneID:11515744"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="JGIDB:Thite2_2061844"
                     /translation="MVAPDPPPEPLLARSSSLATMTAGGGGSSMREQLGLAGIARRTL
                     GIALLLVVVFMWTLSNFMASYIFSDGTYNKPFFLVYVNTSCFAVSLIPLAIRYVLKHG
                     VRSVSDAALALWREWRLGMTPLRTRDQGGEHGRDEDAAAGERLLVDDEGSLEALDLPR
                     GQDKLSVGQTARLSLEFSMLWFAANYFASACLEYTSVGSVTILTSTSSIWTLIFCALT
                     KIEVFTVRKLIGVLASLAGVVLISSVDLSGANDDNRGSFPHKSTAQIAIGDAMAFFSA
                     IIYGVYVTVMKRRVGNEDRVDMPLFFGLVGLINVLLLWPGFFLLHYTGIEPFELPPTA
                     SVWTIIAVNSAASFLSDILWAYAMLLTTPLVVTVGLSLNIPLSLIGEMIQYSQYSSWL
                     YWLGAGVVFISFLFVNHESHEEDRDGKDQSVGGSIGTMV"
     gene            complement(1747267..1748833)
                     /locus_tag="THITE_2107012"
                     /db_xref="GeneID:11517532"
     mRNA            complement(join(1747267..1747655,1747705..1747807,
                     1747882..1748106,1748197..1748292,1748385..1748438,
                     1748500..1748833))
                     /locus_tag="THITE_2107012"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648915.1"
                     /db_xref="GeneID:11517532"
     CDS             complement(join(1747546..1747655,1747705..1747807,
                     1747882..1748106,1748197..1748292,1748385..1748438,
                     1748500..1748529))
                     /locus_tag="THITE_2107012"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648963.1"
                     /db_xref="GeneID:11517532"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2107012"
                     /translation="MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSASYKATIGAD
                     FLTREVMVDDRQVTMQLWDTAGQERFQSLGVAFYRGADCCVLVFDVNNSKSFDALDSW
                     RDEFLIQASPRDPDNFPFVVLGNKIDVEESKRVISTKRAMTFCQSKGGIPYFETSAKE
                     AINVEQAFEVIARNALLQEESEEFSGDFQDPINIHIENDRDGCAC"
     gene            1749196..1751093
                     /locus_tag="THITE_2107016"
                     /db_xref="GeneID:11523540"
     mRNA            1749196..1751093
                     /locus_tag="THITE_2107016"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648916.1"
                     /db_xref="GeneID:11523540"
     CDS             1749368..1750780
                     /locus_tag="THITE_2107016"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648964.1"
                     /db_xref="GeneID:11523540"
                     /db_xref="JGIDB:Thite2_2107016"
                     /translation="MADEQLLDKVHSLSDLGLAVLLCLVAREHCLISTEPDSVDELAE
                     ELRLIASKTFNLNSAIISCHAHTTLDEFATGLLVPPVRAPPSPSNTRSVSPYHPRREQ
                     SHSSMGGGGPASASGSYFPINPSPRTGVPVSPGTPSIGASGSSSQTSQPRIANVILAK
                     DLNRAPRAVQIQALELLRTRRIFTRTSVQTAPKQFLFIALVGAPSSGQARVTPHLNDF
                     LYLSHWHDPDEDGFPYLDEELGRQNPDDELDDDGASTTSSTSVVKVKRHSSLGTGLGL
                     TTAEPSWPTRNNSNNNNNNANSNTVNNSTSSSSTSTNMPTPSQPHHPTPPAPAPAFPS
                     LTEADISHLSQLSQTAYTSIDVLRYQANIITFLRLHRAVDAAGNGSGSGVTPTATRHL
                     ASLSRALAALHGLAYVTPALVALAARKVYPHRLRVVDSPARERSAQWGSEPVALAALL
                     EGVGPEQVVEDVLGMVAVPG"
     gene            complement(1751094..1753579)
                     /locus_tag="THITE_2107018"
                     /db_xref="GeneID:11515657"
     mRNA            complement(join(1751094..1751465,1751556..1752948,
                     1753018..1753579))
                     /locus_tag="THITE_2107018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648917.1"
                     /db_xref="GeneID:11515657"
     CDS             complement(join(1751408..1751465,1751556..1752948,
                     1753018..1753249))
                     /locus_tag="THITE_2107018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648965.1"
                     /db_xref="GeneID:11515657"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="JGIDB:Thite2_2107018"
                     /translation="MRRTSVSLPTKHIAYDPHEKPDRYEPRNRHASLSAKMQSAWALQ
                     SQRTRYLKAGAIIFVVLVLFYCFSPAGVDLYHGVSSDLGNKAQGPSQGQMPADSSYGT
                     DRCTRSFSKDKPIVQYVLMIDAGSTGSRIHVYKFNNCGAAPELEGEVLFKQTEKIEGR
                     SSGLSAYKDDPDAAAKSLDPLLDEALKVVPDKLKACSPIAVKATAGLRLIGEEMSAKI
                     LEAVRHRLETSYPFPVVSQQEGGVSIMDGSDEGVFAWITTNYLLGKIGGPDHSETAAV
                     FDLGGGSTQIVFQPSFEGLTSGGMPDKLADGDHKYELEFGGRKFSLYQHSHLGYGLMS
                     ARGAIHATLVDDLHKEHKDDLSWTHQPVIHPCFSAGMSKTIKVKLPEDHPLGPQIELN
                     MTGPATAAPTQCRRLAERILKKDAECKLAPCSFNGVHQPSIAKTFAREDIYFLSYFYD
                     RTQPLGMPESFTLREMADLAARVCAGERDRAWDVFGSVPGALAELRGRPEHCLDLNFM
                     LALTHTGYEMPLDREVRIAKKIKDKELGWCLGASLPLLSKGSGWQCKVTEVH"
     gene            1753739..1755256
                     /locus_tag="THITE_2107023"
                     /db_xref="GeneID:11515399"
     mRNA            1753739..1755256
                     /locus_tag="THITE_2107023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648918.1"
                     /db_xref="GeneID:11515399"
     CDS             1753961..1754773
                     /locus_tag="THITE_2107023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648966.1"
                     /db_xref="GeneID:11515399"
                     /db_xref="JGIDB:Thite2_2107023"
                     /translation="MPPSSPDPDGNPDGNPDGRQEPPSGTPSCATTDMLPTTFTCFWR
                     LPAELRLMVWEEALSVRTVCAVSREPVPAGEAAEHPGRFSLDFLGPATYLAGLTCREA
                     LRVMERTYVPLAGRGWSPTAAPVPWIDMDKTVVYLGESADSLVFLDRFKANEVSQLRH
                     IAMSWTGKSFVQLVRVCRSVAGACPALRDIVIVADLDRLASSTNDSANQPLTIDVAAH
                     LSFLSLAAWPELDDEYPISPFQPLLSKYVRRDSPPRMHFVSPDDLRFYLANR"
     gene            <1755865..>1757813
                     /locus_tag="THITE_2042644"
                     /db_xref="GeneID:11515386"
     mRNA            join(<1755865..1756078,1756143..1756201,1756257..1756366,
                     1756433..>1757813)
                     /locus_tag="THITE_2042644"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648919.1"
                     /db_xref="GeneID:11515386"
     CDS             join(1755865..1756078,1756143..1756201,1756257..1756366,
                     1756433..1757813)
                     /locus_tag="THITE_2042644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648967.1"
                     /db_xref="GeneID:11515386"
                     /db_xref="InterPro:IPR008580"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Thite2_2042644"
                     /translation="MDVHLLVYDLSGGLARQMSMGLLGFQLDAIYHTSIELNGLEYVY
                     DGNVVAIRPGSSHLGQPMQRLHLGKTELPLNVIEEYLDSLREIYTVEAYDLFRHNCNN
                     FSNDFATFLLGKGIPDHIINMPQAVLDSPFGQMLMPTLTQQINASKRRGGILGIEQQT
                     PGSSVKPQTQLHHPLGKVHVVSSLAQLDELLEKFRKSCAVVFFTSATCAPCKTLYPLY
                     DELAAEVGEKGALIRVDISQAFDIGSRYAVSATPTFITFLRGEQENRWSGADPSALRG
                     NTQLLVEMAWPAHPHQALNLPTFSNPNAEPVIFSKVPPLPKLLAKMGPTASDPAIQSM
                     KRFIETRSSEGPAETTLPDMDAFTAVVRASLTALPTDLLFTVVDLLRCALIDPRVSGY
                     LAEEPAQRTVTAVLAHVVHALPPAGCPYALRLVTLQMACNLFTSPLYPDRILAADSET
                     QRLRALLTQLVASSFLDAGHGSVRVAAAGLLFNVALANSRRRRDGPGDALPEADQVEL
                     AAAALEAIAQEAASAEALEGMLLALGFLAYRLPVEGELADLLRTMDAADVVLAKEKAF
                     PGLRLVREVGAELLGKGLKRA"
     gene            1758267..1760913
                     /locus_tag="THITE_2107025"
                     /db_xref="GeneID:11515385"
     mRNA            join(1758267..1758685,1758772..1760913)
                     /locus_tag="THITE_2107025"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648920.1"
                     /db_xref="GeneID:11515385"
     CDS             join(1758433..1758685,1758772..1760528)
                     /locus_tag="THITE_2107025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648968.1"
                     /db_xref="GeneID:11515385"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="JGIDB:Thite2_2107025"
                     /translation="MFSNLERRFRDVVDDINETLIGISLDPRLMPHSAGYLDVAQRPV
                     RSCASTPSLRSRDGTVPPHARADPGGNVRVVVRVRAFLPREIERNAQCLIRMDPVRQR
                     TTLLVPNDTDPANARARSRKVVEEKTFTFDKSFWSHDPNDEHYATQEDIYDSLGEEFL
                     DHNFEGYHTCIFAYGQTGSGKSYTMMGTPDQPGLIPRTCEDLFERIAAAQEETPNISY
                     NVRVSYFEVYNEHVRDLLVPVVPHQPPYYLKIRESPTEGPYVKDLTEVPVRSLQEILR
                     YMRMGDSNRTTASTKMNDTSSRSHAVFTIMLKQIHHDLETDETTERSSRIRLVDLAGS
                     ERAKSTEATGQRLREGSNINKSLTTLGRVIAALADPKQQRGRNGSRKDHNSSSSSSSS
                     SVVPYRDSILTWLLKDSLGGNSKTAMIACIAPSDYEETLSTLRYADQAKRIRTRAVVN
                     QVDSISTAERDAQIAAMAAEIRALQLVVGDSRRREKDAREAEEKLEEYQARVRTLQQA
                     MEERSLVAEGKIRSLQTENEALRRHLRLALDSLRNPIPQLPAVFASGKGAAAGGGGDD
                     DENKENERRDVADAAEKDNDNDNDDNNDDGYASADTEEDDAAAAAAAPLGYERHADDV
                     HEHMRGLLRDLDLFRRKIGDDKSRFLLDRGGGQRRPLGNMTNIIV"
     gene            complement(1761080..1763236)
                     /locus_tag="THITE_2107028"
                     /db_xref="GeneID:11515382"
     mRNA            complement(join(1761080..1762565,1762626..1763236))
                     /locus_tag="THITE_2107028"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648921.1"
                     /db_xref="GeneID:11515382"
     CDS             complement(join(1761298..1762565,1762626..1762950))
                     /locus_tag="THITE_2107028"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648969.1"
                     /db_xref="GeneID:11515382"
                     /db_xref="JGIDB:Thite2_2107028"
                     /translation="MAPIRIVVKDRALLAAGKPRPFVKPVQPVKQAYAVQPPRSKRGD
                     LAMLCQAVDIALEYFNSDDSVPLSTLTAKARIWADRYFKGYRYAAKRPTSLLRTFPNL
                     FNLEVEAPLRLVPKVMPSPSASEPDGASPRELRRAERRSMNSEAFPEFAEPTLASDAE
                     LDQIVDLRTRQRGADSAAKPRMRVDAAMLRGSGLMSVLPEFLGQLARANLETETMLAT
                     NPAAVRFELDEDEAAEQPHIEMNLFAGLVEPQRRRRQRGVVLPGEPAFKLPTDSESES
                     SESESSVSAVQRSPSQDNASDEDSGDDTDASTSTTASLHANLKKRKSAALEDADDAEA
                     ASPPNKIRIQYYYPPLKLRHYDMKRRKLVSRANPAAVPDDPFDKCRETPTAPAAPSTP
                     SRDRPAHTDSSSTSSPSPSSAPSPTSSSSSSSSGGSSPVPITKIRVPSRSPDGSRSAS
                     PDRIIVLRHPVLSPPSAERRSPSSSSESSSSSSEEPGSPGASSSASSSSSSSSSSRRP
                     RIKLLQKNRPGSAGKRLIEEVE"
     gene            1765098..1766621
                     /locus_tag="THITE_2107031"
                     /db_xref="GeneID:11515609"
     mRNA            join(1765098..1765818,1765959..1766621)
                     /locus_tag="THITE_2107031"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648922.1"
                     /db_xref="GeneID:11515609"
     CDS             join(1765299..1765818,1765959..1766386)
                     /locus_tag="THITE_2107031"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648970.1"
                     /db_xref="GeneID:11515609"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="JGIDB:Thite2_2107031"
                     /translation="MAARPPLFTRGLSGLSQSSDPNSPMSSVSSPAEQRDDAKRNFLR
                     TMRPLPTQHYWNVWFDRQQPPQQTGATKTDNSGSNNSTGEYQAHLEQVGDRIASVQDF
                     WRYNNNMPVDQIKMRESIYLFKSGFKPVWEDRRNILGGSWTFRVPKSIGPDVWTRVQL
                     LAIGEKLQSALEEGDQICGVGLSVRFNSHLVSVWHRDASRRASIDGLLRCVLEELPPE
                     LRPKPDNYFYKRHADHAGFRAPPELQAVLDSQRAREAAAAAAAAAAREAEEAKETGVK
                     KTGQQEKEKEKETAAATGGAEEGTEPGGGAVAASSGGGE"
     gene            complement(<1767049..>1768205)
                     /locus_tag="THITE_120565"
                     /db_xref="GeneID:11515907"
     mRNA            complement(join(<1767049..1767508,1767622..1767817,
                     1768127..>1768205))
                     /locus_tag="THITE_120565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648923.1"
                     /db_xref="GeneID:11515907"
     CDS             complement(join(1767049..1767508,1767622..1767817,
                     1768127..1768205))
                     /locus_tag="THITE_120565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648971.1"
                     /db_xref="GeneID:11515907"
                     /db_xref="JGIDB:Thite2_120565"
                     /translation="MSIQLLALKSAVQLLQEWTPTLRFGLSAGASSSAAASTSKATAA
                     RPSKLAKEHNLTAEEEAEIREAFSLFAEPMEGEKEGVIPIGDVRRALIALGIPASSPA
                     QLATFTATLDPDDEGFATYGAFLGICALQLQARRRDDDEEAHRAELDEAYALFAGGDA
                     DAPAITLEHLRKVAALLRLDQPAHGGSGEGGGGGGGGNKKEGDGLVTEEVLRDMILEA
                     NGGAGVGKGVAKDEFDRVMRRAGVWR"
     gene            complement(1768541..1770110)
                     /locus_tag="THITE_133791"
                     /db_xref="GeneID:11516695"
     mRNA            complement(join(1768541..1768861,1768915..1769076,
                     1769136..1769227,1769288..1769498,1769564..1769597,
                     1769669..1769740,1769797..1769884,1769954..1770110))
                     /locus_tag="THITE_133791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648924.1"
                     /db_xref="GeneID:11516695"
     CDS             complement(join(1768775..1768861,1768915..1769076,
                     1769136..1769227,1769288..1769498,1769564..1769597,
                     1769669..1769740,1769797..1769884,1769954..1769978))
                     /locus_tag="THITE_133791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648972.1"
                     /db_xref="GeneID:11516695"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="JGIDB:Thite2_133791"
                     /translation="MHIQSIPMWTGRSDNYAYLVVDDKSKEAVIVDPAHPAEVAPVLK
                     KAIKDGSIKLKAIINTHHHWDHAGGNAGLLSELGQPLEVIGGKDCQKVTKTPKHGETF
                     NLGSIAVKALHTPCHTQDSICFFMQDGDDKAVFTGDTLFHGGCGKFFEGTGEEMHKAL
                     NVTLGSLPDDTRVFPGHEYTKSNAKFALSVLPSPAVKALEAFAKDNAETQGKFTIGDE
                     KQHNVFMRPQDPEIQKATGETDPVAIMTKLREMKNNFK"
     gene            complement(1770287..1771211)
                     /locus_tag="THITE_2107044"
                     /db_xref="GeneID:11517167"
     mRNA            complement(1770287..1771211)
                     /locus_tag="THITE_2107044"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648925.1"
                     /db_xref="GeneID:11517167"
     CDS             complement(1770445..1771107)
                     /locus_tag="THITE_2107044"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648973.1"
                     /db_xref="GeneID:11517167"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="JGIDB:Thite2_2107044"
                     /translation="MSMYDVAKSVGLPATFVELRHQATHEQLPSLTRLRGAAAKALAW
                     IWDYYWQHLSEVDGASPGSGGAAAGQAKKEEEEEGELRALLGRYLEGDEAEEGLRAEI
                     GWYDEALVLRTLGSLADEARDGKVLRRVVAMEREILEGAGDPDRMEEDDKAEEQDVKD
                     LEQVRTELGKAWEVLKEVEETETAEAQADDPMEEVEMTDDRPAWTLYEEQAWVPKPIG
                     VV"
     gene            complement(1772278..1774410)
                     /locus_tag="THITE_2107047"
                     /db_xref="GeneID:11516593"
     mRNA            complement(join(1772278..1773420,1773496..1773798,
                     1773877..1773959,1774089..1774410))
                     /locus_tag="THITE_2107047"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648926.1"
                     /db_xref="GeneID:11516593"
     CDS             complement(join(1772474..1773420,1773496..1773798,
                     1773877..1773959,1774089..1774102))
                     /locus_tag="THITE_2107047"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648974.1"
                     /db_xref="GeneID:11516593"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="JGIDB:Thite2_2107047"
                     /translation="MASQHKVLMLGAGFVTRPTLDILSEAGISVTVACRTLASAQKLS
                     AGVKNAHPISLDVSDDQALDAEVAKHDLVISLIPYTFHATVIKSAIRNKKNVVTTSYV
                     SPAMLELDAEAKAAGITVMNEIGLDPGIDHLYAIKTIDEVHQAGGKILSFLSYCGGLP
                     APEDSDNPLGYKFSWSSRGVLLALRNAGKWWQDGSVVEVAGKDLMKTAKPYFIYPGFA
                     FVAYPNRDSTAYKERYRIPEAQTVIRGTLRYQGFPQFIKVLVDIGFLEDAPLDILSRA
                     VPWKEATQAVIGAPSSSAADLEATILSKATFESEEDKRRILSGLRWIGLFSDEAITPK
                     GNPLDTLCATLERKMQYEEGERDLVMLQHKFEIEHKDGSRETRTSTLCEYGDPKGYSA
                     MAKLVGVPCAVAVKQVLSGQIAGKGILAPMSAEICQPLMKELDEKYGIRMVEKTVS"
     gene            complement(1774801..1776502)
                     /locus_tag="THITE_2107049"
                     /db_xref="GeneID:11517075"
     mRNA            complement(1774801..1776502)
                     /locus_tag="THITE_2107049"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648927.1"
                     /db_xref="GeneID:11517075"
     CDS             complement(1775051..1776307)
                     /locus_tag="THITE_2107049"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648975.1"
                     /db_xref="GeneID:11517075"
                     /db_xref="JGIDB:Thite2_2107049"
                     /translation="MMPSFFNADMVGVPDHHASGGGYTVDSILNELSRQLIGNTRRYS
                     RASNGQQRAGNSMRISKPGSASNSPRASTLQSRRRTLIGNGFQGRIQTRSPAMGQPYL
                     PTPASETPSESFYERETRPARPLSWHPSSQQTHQSLFPLQDTSGNTVLYPFPAYSDAD
                     MLAGLQHFPPSPVVYSGYASPAEPFPPLSPAYSSLEVPQMCSPATQSVRVPPQQQQLQ
                     QQPALFPPLACSNCSSSSTALETPYLPRPRAAQDSPSWDAYPSSCGNALLARSTAPPT
                     PEDFACSLFPDQSLAGTRGGRQLQQQQQDTTTTRGSAAGTQPPPAPLPPSYQPLIHDD
                     ENDDESEGEILYGMGLYDAPDHSKTPSLHQSVVLSLLGGARDQEPDTGKGLGLKLEDA
                     WEPPASEDEEEGAEEDGQGQEEEHSE"
     gene            complement(1783679..1785196)
                     /locus_tag="THITE_2107054"
                     /db_xref="GeneID:11521415"
     mRNA            complement(join(1783679..1783991,1784069..1784127,
                     1784193..1784396,1784477..1784927,1785043..1785196))
                     /locus_tag="THITE_2107054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648928.1"
                     /db_xref="GeneID:11521415"
     CDS             complement(join(1783874..1783991,1784069..1784127,
                     1784193..1784396,1784477..1784927,1785043..1785092))
                     /locus_tag="THITE_2107054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648976.1"
                     /db_xref="GeneID:11521415"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="JGIDB:Thite2_2107054"
                     /translation="MKHLVLVGACYLDTILTVPRFPAEDSKLRATAVQVRRGGNCANS
                     LEVLAQLLAAGPHRLPPVKLHLVSCLPDAEAPATSRILSSFGHGAGAAAVDFGYCLYR
                     EGHQEPASSYIIRSAETGSRTIVNYNDLPEMTASEFERIVDAFAEHRDGDGGDDGDGV
                     GCWWHFEGRIPETTLRCIRYLRQALSRCTISVEVEKPGREGLVELAAEADVVFYSRSW
                     AEVSSCHSESLPNQPSKNRGYTSPEACLRAEAPSSRASFLTCTWGEQGAGALVLPSRE
                     YIHHPASPFGDKISVVE"
     gene            1785704..1788448
                     /locus_tag="THITE_2107058"
                     /db_xref="GeneID:11517392"
     mRNA            join(1785704..1786118,1786190..1787624,1787729..1788448)
                     /locus_tag="THITE_2107058"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648929.1"
                     /db_xref="GeneID:11517392"
     CDS             join(1786032..1786118,1786190..1787624,1787729..1788174)
                     /locus_tag="THITE_2107058"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648977.1"
                     /db_xref="GeneID:11517392"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="JGIDB:Thite2_2107058"
                     /translation="MTERTSSPRQVSFDDAPSSASDEDRTPVEVLFDESNRYRRKSSL
                     VATDSVPPQLRSTPPPARRRTECLVHQFLANQRRPPKHHHHRHKLPHRRHPDQSPDRD
                     AASVGRVHHPHAGTATCEAYDNSSEAGLDRSLDPKSTSHGAIPRSQPVQQDGNHDEEQ
                     GGEEEFAASHPYASIVADSRTATPTGSSGDDDDGDHDNDGSASASTTTHGQLDEKHWR
                     REMVGKPALSRTPSQLDRRSASADAPTSRLLTKKQLSEMAWGVRELSRRLGSMRLRFR
                     VKTIFLLTKIHDAELIAKTRELCRWLLDREREVRYTVYVDRELRENRKFDAAGLVEEV
                     RRDFVQSGEVTEEASWDVEKRLCFWEEGMCRARPHTFDFVITLGGDGTVLYASWLFQR
                     IVPPVLSFALGSLGFLTKFDFEEYKRTLTTAFDEGVTVSLRLRFEATVMRSQKTGSRL
                     KQDGEHAETEVDGDGQDPPRDLVEELIGEEKDDEHTHRPDGTYEVLNEVVVDRGPNPT
                     MSNIEIFGDDEHFTSVSADGICVSTPTGSTAYNLAAGGSLCHPENPVMLMTAICAHTL
                     SFRPVVLPDTIVLRLGVPYDARTSSWASFDGRERVELRPGDYVTVSASRYPFACVQPH
                     GRRSEDWINSISAKLGWNTRQRQKAFKEWGN"
     gene            complement(<1788977..>1790350)
                     /locus_tag="THITE_133795"
                     /db_xref="GeneID:11521462"
     mRNA            complement(join(<1788977..1789269,1789451..1789570,
                     1789693..1789894,1789954..1790183,1790257..>1790350))
                     /locus_tag="THITE_133795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648930.1"
                     /db_xref="GeneID:11521462"
     CDS             complement(join(1788977..1789269,1789451..1789570,
                     1789693..1789894,1789954..1790183,1790257..1790350))
                     /locus_tag="THITE_133795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648978.1"
                     /db_xref="GeneID:11521462"
                     /db_xref="JGIDB:Thite2_133795"
                     /translation="MVRYAFVTFAGLAAALPLNINLGAYSPALVVGDGEISFGGRQDV
                     SSLITALEGAAVNAAAGAANAAAGGNANTAAGGTVVAAAAATSAPTPVPTAAESAATD
                     PVLAEQAQQIASLQGLGKAIAPRIGDGKLGKRDLAGFNRALTFAEAALTKGPKVELGT
                     GAEGSGVGIIVDHNTVGGGQGDGAGAAAKRDTTAATAPRRRVKVTTMFVRRGIPASLQ
                     ARSEDVLAAAAAAATAVTARAPAPADASANSNSNTSPAVPVSAAARRAESALLDAVNL
                     NVDGDAGVTMTFVEPVEEDGEAEGDQGEGERQRVVV"
     gene            1792259..1794422
                     /locus_tag="THITE_2107061"
                     /db_xref="GeneID:11521416"
     mRNA            join(1792259..1792575,1792631..1792659,1792731..1794422)
                     /locus_tag="THITE_2107061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648931.1"
                     /db_xref="GeneID:11521416"
     CDS             join(1792407..1792575,1792631..1792659,1792731..1793864)
                     /locus_tag="THITE_2107061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648979.1"
                     /db_xref="GeneID:11521416"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Thite2_2107061"
                     /translation="MPASLRTIAPFLRTARLSLRQTQSPLVSLQRQARTPVLNFARTY
                     AVFERTKPHVNVGTIGHVDHGKTTLSAAITKRQSEKGLANFLDYGAIDKAPEERKRGI
                     TISTAHIEYSTEKRHYSHVDCPGHADYIKNMITGAASMDGAIIVVAASDGQMPQTREH
                     LLLARQVGVQRIVVFVNKVDAIEDPEMLELVEMEMRELLTSYGFDGDNTPVVLGSALC
                     ALEGKRPEIGESKIDELLNAVDEWIPTPERDTEKPFLLPIEDVFSIGGRGTVVSGRVE
                     RGVLKKDADVEIIGKGTEIIKTKVTDIETFKKSCDESRAGDNSGLLLRGIRREDVRRG
                     MVVAAPGTVTAHKKFLLSLYALTKEEGGRHTGFHQNYRPQIFIRSADEACTLTFPEGT
                     EHPHSKIVMPGDNVEMVAELHQPIAVEAGMRVTIREGGRTVATGLVTRIIE"
     gene            complement(1794404..1795312)
                     /locus_tag="THITE_2169241"
                     /db_xref="GeneID:11521442"
     mRNA            complement(join(1794404..1794825,1794929..1795028,
                     1795143..1795312))
                     /locus_tag="THITE_2169241"
                     /product="40S ribosomal protein S29"
                     /transcript_id="XM_003648932.1"
                     /db_xref="GeneID:11521442"
     CDS             complement(join(1794817..1794825,1794929..1795028,
                     1795143..1795204))
                     /locus_tag="THITE_2169241"
                     /codon_start=1
                     /product="40S ribosomal protein S29"
                     /protein_id="XP_003648980.1"
                     /db_xref="GeneID:11521442"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="JGIDB:Thite2_2169241"
                     /translation="MAHDNVWNSRPRNYGKGSRSCRVCNHTAGLIRKYGLNICRQCFR
                     EKAADIGFVKYR"
     gene            1795486..1797327
                     /locus_tag="THITE_2107066"
                     /db_xref="GeneID:11515845"
     mRNA            join(1795486..1796297,1796356..1797327)
                     /locus_tag="THITE_2107066"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648933.1"
                     /db_xref="GeneID:11515845"
     CDS             join(1795784..1796297,1796356..1796990)
                     /locus_tag="THITE_2107066"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648981.1"
                     /db_xref="GeneID:11515845"
                     /db_xref="InterPro:IPR011679"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="JGIDB:Thite2_2107066"
                     /translation="MVLIKSFVLASLAAAAAAKSAVLDLIPDNFDKVVLKSGKPTLVE
                     FFAPWCGHCKNLAPIYEELALAFEHAKDKVQIAKVDADAERDLGKRFGVQGFPTLKFF
                     DGKSDKPTEYNGGRDLESLSNFITEKTGVRARKKVAKPSSVVMLTDSTFKQHIGGDKN
                     VLVAFTAPWCGHCKNLAPTWEKLAENFANEPNVLVAKVDADAETGKATAAEYGVKGYP
                     TIKFFPAGSTTPEDYSGARSEEAFVTFLNEKAGTHRAVGGGLDAVAGTIESLDAVVAK
                     LVGGTALSEAAAEAKKTAESLTDKAQAKHAEYYLRVFEKLGKSEEYAAKELARLEGII
                     KKGGLAPTKLDELTSKTNILRKFVEKPTESEDKEEKEEKEEKAAKEEL"
     gene            1797897..1801234
                     /locus_tag="THITE_2107069"
                     /db_xref="GeneID:11521433"
     mRNA            1797897..1801234
                     /locus_tag="THITE_2107069"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648934.1"
                     /db_xref="GeneID:11521433"
     CDS             1798280..1800979
                     /locus_tag="THITE_2107069"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648982.1"
                     /db_xref="GeneID:11521433"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2107069"
                     /translation="MPSISRENARIWLLLTIFFLTILSRNDGPALITGPFMGASRLGR
                     LRDAHRVLNSTKWGDFDPHEAVEDAPPWQAPRFLNLTGFRQTDGYAWVDLPYFRDRCR
                     QWSRHAYPPKDGPDEWDHGPVPKTWQNATGTVHGKWVRRPGSVVRKASGYNLTAIAPG
                     VDWVDSHVEWGWNVTGSHGTILLRLAEDADDAPYEEETEEGQRPRSAGMAREISAVAD
                     IQDEANSAPSFAVRLHGVHWPRQGSILLTTTTEKFSGIFGLPHLAPGPDFFQSSQKLL
                     NRTLGEVLRKKERRRFADPSNPWTPVVEEEISVPLPRCEYIMYLQLHPLDPIFIGETG
                     LDDQLVPVVDQLENELRFPTGAPSRGTPDLRMSLVAWSPDCAYYLESKGPPLFPSVEG
                     QHLVGVKSEVLLSRTKAWMFGFAAVLMAQLWLLKTQMKESNTPSTLGRISFQTIAMML
                     LADGLVFACSSAWSLSATNTFLPSLILTFAAFMSMAIGAGFLSEIHKHQEPERRREQN
                     RTNEANASRTPPAAAPSPAAATSTSPGMLPAPVTAGSAARPSSPPVIIPSDQDIDAEI
                     AENAASGAAALTLPTTRTPPTTTTTTATTTTTPPRPRVSAFASITGTFVTIGIAILIL
                     TAMSMAWPPRARAALFHALAFAYLSLWLPQIRRNARRNSRRALAWRFMVGQSALRALP
                     LAYFYLRHDNILFVEPDAVAFAVLVAWLWLQLVVLAVQDVLGPRFGLPRSWAPEVWEY
                     HPVLREDDAEAGGLPIGLVSAASSSSSAGLGGGGAGDSAASSPVAVAAGRRRSWSFGD
                     GGGGEGGGEDGARRREREKELRRHGMALRSIDCAICTEVLEVPVVRANAKDPSAAGGL
                     VGVFARRVYMVTPCRHIFHTKCLEGWFRYKLQCPICREELPPL"
     gene            complement(<1801334..>1810537)
                     /locus_tag="THITE_2084158"
                     /db_xref="GeneID:11521417"
     mRNA            complement(join(<1801334..1801491,1810531..>1810537))
                     /locus_tag="THITE_2084158"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648935.1"
                     /db_xref="GeneID:11521417"
     CDS             complement(join(1801334..1801491,1810531..1810537))
                     /locus_tag="THITE_2084158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648983.1"
                     /db_xref="GeneID:11521417"
                     /db_xref="JGIDB:Thite2_2084158"
                     /translation="MVGPPFDSPPGRSGHTLKRTLTRSPAAYPIPWAPAAPTRPPSPP
                     RAPAGRTFPE"
     gene            1817149..1818464
                     /locus_tag="THITE_2073494"
                     /db_xref="GeneID:11519079"
     mRNA            join(1817149..1817410,1817499..1818464)
                     /locus_tag="THITE_2073494"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648936.1"
                     /db_xref="GeneID:11519079"
     CDS             join(1817402..1817410,1817499..1818230)
                     /locus_tag="THITE_2073494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648984.1"
                     /db_xref="GeneID:11519079"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2073494"
                     /translation="MSKINTILFDCDNTLVLSEELAFEGCADLINEIAAAKQVPLQQP
                     FTGETLIIEFVGQNFRGMMTSLQQRYGFELGADELDEYVRREEDVVIAKLREKLVACP
                     GVDDVLARLAASGRYRLAVVSSSALRRVKASVEKVGQAKYFGDDIFSAATSLPTPTSK
                     PNPAIYLYAMEKLGKKPGECVAVEDSKSGTLSATRAGIKVIGYVGPYEEDEREKMIKV
                     LREAGAVVVMEDWSQFDDCLAKIEKGEV"
     gene            complement(<1818408..>1820095)
                     /locus_tag="THITE_2140896"
                     /db_xref="GeneID:11521411"
     mRNA            complement(join(<1818408..1819492,1819574..1819608,
                     1819764..>1820095))
                     /locus_tag="THITE_2140896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648937.1"
                     /db_xref="GeneID:11521411"
     CDS             complement(join(1818408..1819492,1819574..1819608,
                     1819764..1820095))
                     /locus_tag="THITE_2140896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648985.1"
                     /db_xref="GeneID:11521411"
                     /db_xref="InterPro:IPR007306"
                     /db_xref="JGIDB:Thite2_2140896"
                     /translation="MAPPTLADVIFPEQANHNFSRILGDLKRSNLSVSNRLRSICRDA
                     AFVDDVATALGHLPLVANERCGSWYIDPARKAASAYFKSTDGHTGQWKFSTRRLNLHL
                     LALIGDAGGCIIVDSTRRGKRMPDALSKTVPIWCAVLNRALFPSPAGAASHHDHHALV
                     TPPNVVSASEASQISALLPQFAASFAALAIDPAPLRRQLRHRPLRPFWITPEDDDNHL
                     ALAAAGVARVARELDCLPVVCCTASRRVAGPGAEIGEGGGYVQGAADDTENWALGLTP
                     AVFWRHREALLGAQESELPALIAELVAGEKEERARAAGEGVGWEVKRVAAPGVFVGTL
                     AGRGKVLAEGGACVVALVSGTTERSEWVKGPAHLEVGLGKHKAASRQLRDALPLICEF
                     VLRYLRRPQTGENRVVVLCESGRDLSVGVALAIYCWCFDDAGNVRSDSDRVTFTKTSI
                     RVRLGHIVTALPEANPSRATLQSVNSFLMDWRK"
     gene            1823634..1826034
                     /locus_tag="THITE_2107076"
                     /db_xref="GeneID:11521398"
     mRNA            1823634..1826034
                     /locus_tag="THITE_2107076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648938.1"
                     /db_xref="GeneID:11521398"
     CDS             1823839..1825920
                     /locus_tag="THITE_2107076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648986.1"
                     /db_xref="GeneID:11521398"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2107076"
                     /translation="MIPWRFPRGTAPCTWAALTFAARRQRRIKCDEKRPACANCVRSK
                     RICSGYPPPPRSARPFEEIKIAPKPLVAAAPSATPLNREPVQLPPRRIVRYHQRRTTP
                     PLTPTTPVAVTMLYRPSMNLPFSDQEGQYFHLFREHTANELSGFFDSAFWTRSVLQEC
                     HSAPAIRHAVVALGALYKTLEKSNESPPASPYPDRDPRDSAVRHWEMAFRQYSHACNA
                     LVKGESAATTSNRTRLMASVLLACFDSFVGDHRQAIVQIQTGLGLLEQLRAERRRAFL
                     ASSEEPVEEELTQMFTRLAIQAKSYDMAFHFPQPWVVRLTSSQAQDPASPASDASSPI
                     GISQDPIPDRFASVMEARLSWDRLCERFLRFTEIMFAQAQNGVMGVLPTSLQHYGVSF
                     KTDIEAWSQAFDPILASRTAPGVSSQEKAAIAVLKMFQIMGKILFLMTFSDSEMHFDN
                     FVPYFKNIVDLAIEVVGDEERRAAARRCPDPAFCRHRHRYQPDIFGGHEYAARHIKPS
                     FSADLGIVPPLYVVATKCREPHIRRQAIQLLRSSARREAMWDSELTARIGMWIAEVEE
                     EGIDFFDGTGYGNTIPTPGSSPVQTSLSRPSTSNGSPLAQSRSELGSAQWDAASVTSS
                     SAGGSAYPPGRSPHRPQRPNPVPIPEEKRVMVRAVEFDLRERSAVIKLGSRNLRTGTP
                     DLKTRLSKIRW"
     gene            complement(1827059..1828894)
                     /locus_tag="THITE_2107079"
                     /db_xref="GeneID:11515487"
     mRNA            complement(join(1827059..1827457,1827558..1828275,
                     1828433..1828894))
                     /locus_tag="THITE_2107079"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648939.1"
                     /db_xref="GeneID:11515487"
     CDS             complement(join(1827164..1827457,1827558..1828275,
                     1828433..1828512))
                     /locus_tag="THITE_2107079"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648987.1"
                     /db_xref="GeneID:11515487"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="JGIDB:Thite2_2107079"
                     /translation="MVKETKLYDLLGISPSASQDDIKKAYRKAALKYHPDKNKDNPQA
                     AEKFKECSQAYEILSDPEKRKIYDQFGLEFILRGGVPQPDGAGGPNPFAGGAGGMPEG
                     FASFFANAGGPGAGAGPRFSTFNFHFTDPDELFRNTFRDSGLGGGMFDDLFGGGARSS
                     TSSTGGRSRGRGSFGESARSARAPTPEVTTVERPLPLSLEDLFQGVTKRMKIKRKMFD
                     ATGKRTTTDTVLEVPIKPGLKKGSKIRFKGVGDQEEGGQQDLVFIVEEKPHPLFVRDG
                     DDIIHTVDLDLKEALTGWQRTVTTIDGRNLNIEKSNPTQPGSQDSYPGLGMPISKKPG
                     QRGNFIVKYNVRFPITLTPTQKQRLRDIL"
     gene            complement(1829905..1831360)
                     /locus_tag="THITE_108026"
                     /db_xref="GeneID:11521400"
     mRNA            complement(1829905..1831360)
                     /locus_tag="THITE_108026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648940.1"
                     /db_xref="GeneID:11521400"
     CDS             complement(1830902..1831213)
                     /locus_tag="THITE_108026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648988.1"
                     /db_xref="GeneID:11521400"
                     /db_xref="JGIDB:Thite2_108026"
                     /translation="MGAVVSDLSPRNALTLNWESRVALLRDLSSNFQVGRTSAFTAPK
                     LTIKNHRHYIDHQDCKFLGRSQRHGFPPIMLCSGIASPGCVAHVIGGIALVNVESMVV
                     W"
     gene            <1832241..>1832755
                     /locus_tag="THITE_2038228"
                     /db_xref="GeneID:11515600"
     mRNA            join(<1832241..1832290,1832366..1832431,1832514..1832612,
                     1832677..>1832755)
                     /locus_tag="THITE_2038228"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_003648941.1"
                     /db_xref="GeneID:11515600"
     CDS             join(<1832241..1832290,1832366..1832431,1832514..1832612,
                     1832677..1832755)
                     /locus_tag="THITE_2038228"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_003648989.1"
                     /db_xref="GeneID:11515600"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="JGIDB:Thite2_2038228"
                     /translation="LTDNAAEVGISGKYGVRYGASIRKQLKRLEIRQHARYTCAFCGK
                     FSVKRVSAGIWECHRCKKTMTGGAYQLSTLAGASARSTLRRLREIHEGCMQPC"
     gene            complement(1834310..1834853)
                     /locus_tag="THITE_2107084"
                     /db_xref="GeneID:11521386"
     mRNA            complement(1834310..1834853)
                     /locus_tag="THITE_2107084"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648942.1"
                     /db_xref="GeneID:11521386"
     CDS             complement(1834572..1834751)
                     /locus_tag="THITE_2107084"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648990.1"
                     /db_xref="GeneID:11521386"
                     /db_xref="JGIDB:Thite2_2107084"
                     /translation="MGVKRYVIHGMLRPPGDRMKLLCGCWSSQTERKASEDGDLAGHT
                     GHGVTSKMLELGLVT"
     gene            1834845..1835570
                     /locus_tag="THITE_2107085"
                     /db_xref="GeneID:11519173"
     mRNA            join(1834845..1835063,1835125..1835570)
                     /locus_tag="THITE_2107085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648943.1"
                     /db_xref="GeneID:11519173"
     CDS             join(1834942..1835063,1835125..1835218)
                     /locus_tag="THITE_2107085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648991.1"
                     /db_xref="GeneID:11519173"
                     /db_xref="JGIDB:Thite2_2107085"
                     /translation="MDTIKNAGNYVSDKLQSTTHGASKEANKDVAKDENAGIGTRLQA
                     AGDAISDKTKEKKHDASAEANKQATTH"
     gene            1835571..1837015
                     /locus_tag="THITE_2107087"
                     /db_xref="GeneID:11519036"
     mRNA            join(1835571..1836335,1836517..1836652,1836728..1837015)
                     /locus_tag="THITE_2107087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648944.1"
                     /db_xref="GeneID:11519036"
     CDS             join(1835838..1836335,1836517..1836652,1836728..1836930)
                     /locus_tag="THITE_2107087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648992.1"
                     /db_xref="GeneID:11519036"
                     /db_xref="InterPro:IPR007905"
                     /db_xref="JGIDB:Thite2_2107087"
                     /translation="MSSTAPPPPPTTTPSLFDTTTLTSLASTVAILLAALALSRRVLD
                     PRATPARLRALFVWHAFDALIHFLLEGSFVYHCLFSAAPVGSILAASAAAGGAAGGGD
                     GVTGTGMGTGTGYWPDPVNYLGGGLKGGGAVAVAHGPQAGGENPLAKLWMVYARADFR
                     WAGVDLTVLSLEILTVLFAGPMACLVCYDIARKSPRANLVMIILATAELYGGYMTFMP
                     EWLTASANLDTSNFMYKWVFLVFFNGLWVVIPLYAIYVAADDIFDAFRVRATALGEKK
                     AK"
     gene            <1839927..>1842150
                     /locus_tag="THITE_120585"
                     /db_xref="GeneID:11521350"
     mRNA            join(<1839927..1840237,1840307..1840467,1840531..1840906,
                     1840959..>1842150)
                     /locus_tag="THITE_120585"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648945.1"
                     /db_xref="GeneID:11521350"
     CDS             join(1839927..1840237,1840307..1840467,1840531..1840906,
                     1840959..1842150)
                     /locus_tag="THITE_120585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648993.1"
                     /db_xref="GeneID:11521350"
                     /db_xref="JGIDB:Thite2_120585"
                     /translation="MSPTYIGALGGVDWLESRDDTRRVLANFDHFNRSGSGIFQSETN
                     RTISRQRFLNEVTWNTTRSIRTSTIVLASLNIIAAFATAVGILCDSYFRKRRNDRNFR
                     FRRNGFTFVPEAEVYPLVLSVGIFIQSFIFAGAQSTGLDSLFGPGCTWLAELMLPAVF
                     IVPYTQLVLGIDVAIRALRKQPFAPRGKYNVPVCLSIIGLLLLANFLVADFDHSPNFC
                     LSSLFWFVSHYSIACFALFIAITGIILVCVVIICVRLHRSIKVEITARVAASRMVYYL
                     ALAVVSKAFLIPFFFVQGFMDGRGQLSNALTLGMIAAVVANVSGLMTGGLYLFLKSSP
                     ATTIGPRDKAGEYENRRAFYKMARYDSNDSDDNAGGSVGHMNDQVAGSRTLRRVDSEV
                     TLLSGENEAEASDSKSTKSASTHNGRRSPNPVRSSKFTSAVASVLMPKAPEPARIPTM
                     PAAGHLRKRSYSLFPRSTVASKTSMVLLPATTYSPADALKPPPSMANLANMRHRRDSS
                     LVSSATVQIGIRLSSVDDIPPLAQDRTAASDDVAHTLDCPSVVKPVGLENPKRPGPLD
                     ASAAISVPPPEPADATSKRDPVKDAKMKTLPPVPKINSQVPKAEPPPQEEVTLSPSVY
                     SPQTPTKVKLPSPKGVGFSMPVPKTTNGVPPRSPPRRRGTGDATPPSADAKGAWI"
     gene            complement(1842831..1847038)
                     /locus_tag="THITE_2107090"
                     /db_xref="GeneID:11521308"
     mRNA            complement(join(1842831..1844031,1844093..1844511,
                     1844566..1845399,1845449..1845537,1845588..1845718,
                     1845807..1847038))
                     /locus_tag="THITE_2107090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648946.1"
                     /db_xref="GeneID:11521308"
     CDS             complement(join(1843086..1844031,1844093..1844511,
                     1844566..1845399,1845449..1845537,1845588..1845718,
                     1845807..1846864))
                     /locus_tag="THITE_2107090"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648994.1"
                     /db_xref="GeneID:11521308"
                     /db_xref="InterPro:IPR012486"
                     /db_xref="JGIDB:Thite2_2107090"
                     /translation="MNALWSSRASGDGAAAGEPPAADPSTDGTTAAATENTEPGPAAP
                     SSIPASHSPKGPVLQRNQQPSAPLPPAVPSVPAPPIPQPHASATDIDPDTTDANTNND
                     NHVSALGAPGPAQGQLPAQPFPRTPVQPQGQPRPHSPPQQQQQQQQQQPQGQGQGQGQ
                     PQPQDSLSLAQLRRIVADFPRAAPEPTAYDYVYTDTSPLDEEIDEWFMYNFWQWVRLN
                     AANRAFHSAWGRFAPPSSSASTAAGSAGQTVVSWEEAGDEHRRAFVRRLLDGVGSADR
                     IARAEAVGALVYLVLGRWTETVKAAGALSAAVLAGKARSAATPVQLAAMKEGVRVVAE
                     CGGIEVVWKALRGVFELFWADELPQNVQMAAEELIHLMTVVYMAILEALDDPEGMDEV
                     RQRLVGLNPSLVSFMLRVTAKLRWDETGILPQTQILLLFWKSILLVFGGSKEIAETKQ
                     ATSEMEGCEDKETITASPLDYHIFRQEITSKYPAYVPPQPLLPLDADQTSIIPPLPNH
                     PSRNSGQNGGLSGPSGHGGGASILHQPVHIATPAPSPPPSPGVGGKAGKKQNYQTNQN
                     FPFMYPPLDATSNSAGGKGGAALQDLLVGRKWEGSDVPASILEAGELFSKRVRMTRAT
                     RQLWNEREEFLKFERGYAADEDIIDELDLSSLTLEEKEELGLNKAADDRPPKPPTTGA
                     DYGPRGVDQRTKERLDAVEEFYKEALPHLQSVVIVLLKQIMAIASNLASPATANGPQG
                     PPSARPNGGQQDAPNGMNGASKGDPSSPLDADVDELRNREIAAKAVTGILILLLKWLK
                     LSHVLKFEYLTQLLLDSNYLPMALKIFAMYDVQQVVESRTDRLEHSFFYFCGSRAGVI
                     PPQNTVPNPTATEFEDVSDDDAAPPPIKRRRSPPNAPSEPDASSSTTSSLPDQSVPAG
                     TEQPQQQSQPQPPQQQQQPPPRPEVDELGCPLNPLPAEPITDFSRRNFFSLINYLRIM
                     QKVCKRRGHRNMMMVQYKSSNILRKALRVPQHELRLYTLKLYKNQVPYCGRKWRQSNM
                     RVITAVYLHCRPELRDGWLAGVDLDAEVEESLPQEQALRSLTHWFNLRRYPEHVVASA
                     AGEGAAGGGGGASMALVREAMREEHDFFAKELEKANLSWLLAEQQMAGEEGGPGGPGD
                     GSMAGWEQEGWG"
     gene            complement(1847354..1848615)
                     /locus_tag="THITE_2107093"
                     /db_xref="GeneID:11521307"
     mRNA            complement(join(1847354..1848325,1848387..1848615))
                     /locus_tag="THITE_2107093"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648947.1"
                     /db_xref="GeneID:11521307"
     CDS             complement(join(1847458..1848325,1848387..1848412))
                     /locus_tag="THITE_2107093"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648995.1"
                     /db_xref="GeneID:11521307"
                     /db_xref="JGIDB:Thite2_2107093"
                     /translation="MFELPDAKRVRRDELYESSSDRHSSPERDDAEDAELRAKLNARL
                     SGLLSVDLGPPGPAPATTNIGSQSPDGANQAGVDSEPKAAAKPEFEFRLFSTSAPSQK
                     VVLVPDDEEFKYDGPAISQRPLSHYIRGELTPREREQFRFAAVTAHDVRAWAQQRAWG
                     LEVPWRVTKLTVTAVGGKGATGPAAAAPAAADGLLRQQSIEGSQGMEKTKTKKKTRPG
                     KKSRIVLRKRKKAKEEAAAALEKQRMSKEEHLREKKKRLNREKKLKRRRKEKEKKLAA
                     KGAAGEGDGARGSGSEAGSAG"
     gene            complement(1851851..1852919)
                     /locus_tag="THITE_2107095"
                     /db_xref="GeneID:11515368"
     mRNA            complement(1851851..1852919)
                     /locus_tag="THITE_2107095"
                     /product="transcription factor-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648948.1"
                     /db_xref="GeneID:11515368"
     CDS             complement(1851901..1852743)
                     /locus_tag="THITE_2107095"
                     /note="1|VIB1_NEUCR RecName: Full=Transcription factor
                     vib-1. AltName: Full=Vegetative incompatibility blocked
                     protein 1. Contains conserved domain
                     NDT80_PhoG[pfam05224], This family includes the
                     DNA-binding region of NDT80 as well as PhoG"
                     /codon_start=1
                     /product="transcription factor-like protein"
                     /protein_id="XP_003648996.1"
                     /db_xref="GeneID:11515368"
                     /db_xref="InterPro:IPR007888"
                     /db_xref="JGIDB:Thite2_2107095"
                     /translation="MAELRGETQHGSLWSGYGNPVQMAGRFNPQDPSVSVPPPASSQL
                     VRPRSHTMDYPPQYQPGRPGQEEAEPYDRYGHPSMSIPSINSLKRPYSQVDQAPYTEM
                     VQDLRDDYKPPNHDQKLLSFRKVGDKHTIVDAKGRIHEMEIDAQLHGMFFLSEFPSTT
                     SDGTVLNAELTCYRRNLFQISGSLCFPQIPLSVLLDSGETSQIKNMEVSISAIESVDG
                     HPVRLIVIPWKTPPPNAPEVNQAPDQEPPTLPLIPPSEEEEETGGDHYAIYPIGWRRL
                     QFRM"
     gene            complement(<1859535..>1860822)
                     /locus_tag="THITE_2125290"
                     /db_xref="GeneID:11517338"
     mRNA            complement(join(<1859535..1859589,1859630..1859728,
                     1859789..1859925,1860195..1860250,1860327..1860574,
                     1860619..1860675,1860737..>1860822))
                     /locus_tag="THITE_2125290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648949.1"
                     /db_xref="GeneID:11517338"
     CDS             complement(join(1859535..1859589,1859630..1859728,
                     1859789..1859925,1860195..1860250,1860327..1860574,
                     1860619..1860675,1860737..1860822))
                     /locus_tag="THITE_2125290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648997.1"
                     /db_xref="GeneID:11517338"
                     /db_xref="JGIDB:Thite2_2125290"
                     /translation="MAHVRGSVETLSLLLDLRETSQLTWYTCAYARTICKQSPVSAAG
                     GKLLYQFKAGIVNGALLPAPEWFGLLAWKGSGVQFGSGSSEARQGRCLADLGKAQGVA
                     EARSTPVTYLVYTVMSVFHRQTSSLVDAMYSRNRRRASVRCPKKLPERHDPRSRTLFS
                     QLGNWMMRLAGKLQVPPNRPFQAKVAGAVITAPLFLRQAPPDSIGRVSSREAVLHGAD
                     GFPHPLAACNLLDSGVGSCAHSLQSEV"
     gene            complement(1864537..1867581)
                     /locus_tag="THITE_2107099"
                     /db_xref="GeneID:11515354"
     mRNA            complement(1864537..1867581)
                     /locus_tag="THITE_2107099"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648950.1"
                     /db_xref="GeneID:11515354"
     CDS             complement(1864810..1867089)
                     /locus_tag="THITE_2107099"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648998.1"
                     /db_xref="GeneID:11515354"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="JGIDB:Thite2_2107099"
                     /translation="MADDLDDPRDVELGSLCAIYPEIQQLRPEDPYTITLDIPVTPSK
                     AVTVFFPAAANDAVPPGASGATNGTGTSGPGQQGPVDSHEVAHLPPVQLEIVLGPRYP
                     AEQPPEISISTTPPWLPEDTVKQLKDDAPRLWEEMGRDIMGFTYIDHVQQAAHNVFGL
                     VNEKGSLEVDPRHKIAILDYDIKARRAAFEKETFDCGVCLGTSCWLGAVGSGGVEICL
                     LQVSLSKSAETCTNRCAEPKKGAVCHRMLDCGHVFCVACLQDFYNNAIKEGDIAAVRC
                     LAPNCAKERSKATSPSGKRRKKPRTFINPSELLQIPLDEETVKRYVTLKYKMELESDK
                     NTVYCPRPWCNGAARSKKHKKPQGLELAEVSDESDTEDEDEADHPDGEGTSKPYKPAE
                     ELLAICEECSFAFCSRCYQSWHGEFFRCTPRRDKQELTAEELASLEYMKLHTTPCPTC
                     GVPAQKTHGCNHMICYRCQSHFCYLCSAWLDPGNPYQHFNAAPDGRVTGCYMRLWELE
                     MGDGDDVGIGFEGGPGGGAGRGAPAVVVLAQELVPEIEEPEEEDLANQAIGNEAAAQP
                     EEAHHLDGGQVGIAREGPLVLRIAANQPAAPGRGGPRGRQPGAAAAAPQPAAAPVPAA
                     GRGGARAARNQQPAAARGGGPQQQHAGRDAGPGAAVPRGGRAGAGVGAVAGPRGRGRG
                     GGAGAGGAGPAAAARRQNNHNNPANHPAERVQRRNANNGGGEGLGDDELAPQHQEWVR
                     QFVLAALNDEEDIFIDMGF"
     gene            1867583..1869167
                     /locus_tag="THITE_2107100"
                     /db_xref="GeneID:11516547"
     mRNA            join(1867583..1868022,1868127..1869167)
                     /locus_tag="THITE_2107100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648951.1"
                     /db_xref="GeneID:11516547"
     CDS             join(1867969..1868022,1868127..1869020)
                     /locus_tag="THITE_2107100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003648999.1"
                     /db_xref="GeneID:11516547"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="JGIDB:Thite2_2107100"
                     /translation="MADDVTPLASLSLTHVYYNPEDPISYLCAFLSLLPQALCVAYAT
                     LLWATREAEVLLLFAGQLACEAVNFALKRLIKEERPPRRVAAAGSSPAGIGSPVGKGY
                     GMPSSHAQFVVFWAVALSLFLLVRHRPQRPMPVVPVGERGGGGGSGSGNGNGSGNGNG
                     RNGPPSTSSPPSSSLLTDVPRAYRAGGFPALGASIEAYSHAPWTLAERAVVSAGALLV
                     AAAVAWSRVYLGYHTVRQVLAGCAAGAGCAAAWFAVTYALRETGTLAWALELPIARWF
                     RVRDLVVMEDLCQAGWEKWEERRRIAFERERERGEKKTK"
     gene            complement(1869139..1870341)
                     /locus_tag="THITE_2107101"
                     /db_xref="GeneID:11519133"
     mRNA            complement(join(1869139..1869662,1869737..1870341))
                     /locus_tag="THITE_2107101"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648952.1"
                     /db_xref="GeneID:11519133"
     CDS             complement(join(1869257..1869662,1869737..1870206))
                     /locus_tag="THITE_2107101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649000.1"
                     /db_xref="GeneID:11519133"
                     /db_xref="JGIDB:Thite2_2107101"
                     /translation="MGAASGIALRGTQLFIRTIQFCCAAIVLAIFSYFLATLNIHNLP
                     IGVWVRAVEGISGAAVLYTVLALLLLCCVAGHSFPSFVGTVFDVAFIAGFIYIAFENR
                     GGASSCTGEVDTPYGRGNADTNVVDNGSGGLTTLPSLRQACKMETACLSVSIVAIFFF
                     ALSPFVSHALVRHRRKEKRFGPSPANNYTEGSGAAPKRFNFFGLGRKRTAATDAGPDP
                     NALPKHTTPNDIRESYATEQTRVGSSGGGYGGLGDGTDKYESPWANRGNDIPLAHYPN
                     ASTGYRYENNGDVYR"
     gene            <1881999..>1882250
                     /locus_tag="THITE_2042291"
                     /db_xref="GeneID:11516585"
     mRNA            <1881999..>1882250
                     /locus_tag="THITE_2042291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648953.1"
                     /db_xref="GeneID:11516585"
     CDS             <1881999..1882250
                     /locus_tag="THITE_2042291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649001.1"
                     /db_xref="GeneID:11516585"
                     /db_xref="JGIDB:Thite2_2042291"
                     /translation="VYTYIDNIIIVSKNIEEYLKYVKTVLNILDKVYIYILVEKSFIA
                     YLSVRLFSYIVNGERVAKIDNRIIVFKKLKFLNTFKTLE"
     gene            1889321..1889401
                     /locus_tag="THITE_t3"
                     /db_xref="GeneID:11516925"
     tRNA            1889321..1889401
                     /locus_tag="THITE_t3"
                     /product="tRNA-Glu"
                     /note="Anticodon: CTC"
                     /anticodon=(pos:1889354..1889356,aa:Glu,seq:ctc)
                     /db_xref="GeneID:11516925"
     gene            1891432..1894312
                     /locus_tag="THITE_2107105"
                     /db_xref="GeneID:11519048"
     mRNA            join(1891432..1891830,1891907..1892816,1892883..1893077,
                     1893139..1894312)
                     /locus_tag="THITE_2107105"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648954.1"
                     /db_xref="GeneID:11519048"
     CDS             join(1891607..1891830,1891907..1892816,1892883..1893077,
                     1893139..1894074)
                     /locus_tag="THITE_2107105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649002.1"
                     /db_xref="GeneID:11519048"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Thite2_2107105"
                     /translation="MRARAPVLAGLLSLAAQTGRADPTWPAATDHMEEIVYQLQGFRG
                     SLFNDIITPCDNEAAGPGRITASEWLRVGFHDMAPHNKYFGTNGVDGSLQFELNDGEN
                     TGPGHATTLKFLANYLSSRSSLADLIAAGVYASVRSCGGPVVPLRLGRVDATEGGNGV
                     PQPQNSIGTFISQFDRMGFNATEMIQLVACGHTLGSVHSPEFPEIVPAATGQISFDSS
                     NAVYDNKVVTEYVAGNTTNPLVVGASIAVGRNSDGRIFGSDGNVTIRAMADPTVYRNT
                     CQALLQRMIEVVPAGVTLTPDPIAPYAVKPVGMQLTLNDGAATLLLSGYIRVRTTELP
                     ASSITNVVLTWKDRNGGNSCGSSATCSVTATLQGVANGFDDTFGFFPIQATIPVASGI
                     SSFTLVLNFNDGTSKSYDNNGNSYPMSDAVILQKPQSCLLQGSGALTVSALVRNDIVG
                     LPVNLGVSYLVPRNTTDGNPVPALTQANITMTAGDCVGQYTFYTASFTIYGGLSYNAR
                     LSVTAGSGATAYSDDFIKASDLSGTCGTFSGSATCANVTVSSTSSLPTSTTSSSTSVS
                     ATTTTTTTSSTAAPTPTIKTNVGGYVFVSCWTEGTGVRALSEASFAYDSMTLESCMAN
                     CTGFDYWATEYGRECYCGNSLASSSAQAPNGDCSMLCAGDPSEFCGAGNRLELYSTTA
                     TRTTSATPTPTATLAVKPTVGDYVFVGCQTEATSQRALSEKTYADDSMTLESCAAFCA
                     GFTYFGTEYGRECE"
     gene            complement(1897681..1898379)
                     /locus_tag="THITE_2107108"
                     /db_xref="GeneID:11515491"
     mRNA            complement(1897681..1898379)
                     /locus_tag="THITE_2107108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648955.1"
                     /db_xref="GeneID:11515491"
     CDS             complement(1897694..1898371)
                     /locus_tag="THITE_2107108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649003.1"
                     /db_xref="GeneID:11515491"
                     /db_xref="JGIDB:Thite2_2107108"
                     /translation="MASPTRRSAGSPSPQLHVQIFPLSRPGAPVFFCLRGRARKARIG
                     QDAAPVRASPGAHLGSEPWPEAFARKRETDGVRFASRWIGRLSRKGHLDGQEFRAVSS
                     ARHATTFKRRVTLIWKGTQARSVIGLGNLKPHMPKDQEALSTGPCSEALPVPGNIMYL
                     TWVEQKRARQIVVGALWLPSHPWRRKGESCAGRWSGRVSKRRCLSDPLAREQQQLAEH
                     PRTRFSP"
     gene            1899539..1903055
                     /locus_tag="THITE_2107109"
                     /db_xref="GeneID:11515893"
     mRNA            join(1899539..1899910,1900091..1900296,1900462..1900949,
                     1901024..1903055)
                     /locus_tag="THITE_2107109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648956.1"
                     /db_xref="GeneID:11515893"
     CDS             join(1899621..1899910,1900091..1900296,1900462..1900949,
                     1901024..1902904)
                     /locus_tag="THITE_2107109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649004.1"
                     /db_xref="GeneID:11515893"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2107109"
                     /translation="MSDHGDTPSPRSRSESAPASSQSPPPEQPPPAAATQPSPKKRTS
                     VNPEGKVTKRRAARACVSCRARKVRCDVVEGAPCGNCRWDDVECIVQESRRRKKNLPY
                     NCGPAGVGARAGTAEALRAKSLGAAPPFIAANLAKQPFNPDGTFTLPLNRVNVNGQQG
                     ATQLLFQQSAAGFGPGVPDPASAALAGFPPSTPVMPGTSPTLVHPLFRTTFELSNEWP
                     AFIKPIPDKILAEDRQYLAQKQVFALPSLRLQNALLAAYVEYVHPYMPLMELHDFLRI
                     VNDRTGAAGKVSLFLYHAVMFAATAFVEESLLKDAGYDSRRDARRAFFSKTRLLYDFD
                     YETDRLILVQGLLLMTYWYETPDDQKDTWHWMGVAISLAHTIGLHRDPSKTPMIPRKQ
                     KLWKRVWWSCLMRDRLVALGMRRPTRIKSEDFDVPPLNEADFEIEALSEENQLLGPEC
                     ALMRDVEMQRELAIMCIEKAKLCMFIGDMLKVQYSVLSRSGVRPEQTVNSTHMLLPNK
                     NPENMQEVERVDKDLRDWFASLPECCQYRPLDSITVTDANKVLGVQRNLLHMIYHTTV
                     SALHRPLFLPASPTEGPSTPVEVQEMARKRVREAAEQITAMAAEMRQRGLERYLPTTG
                     VTVILPAMIVHMLDTKSLDPATRAKAMLGLKECLIVMNNLRNIYAAADFATGFLDALL
                     RRGMLGGPPQQPPQPQPQPQPAAARSAKMLNRVLAPALNLAPQGMGGIGGMGMNNTGM
                     SMGMGMGTGLGINVLPPTLPVRPSTPPPDTGAAAFLNPTSTPTTTATLGALFSSSASS
                     NPFNVPADANGGSDDLPILPDAAAAAATPPHTDSEDVPSPPPGDMDVDADAGVDAAMA
                     DQITLEYTTAAAAAAAAAASASAGGGGGGGNAAGIGGANFDFDQWLQFPAEGGLGTEG
                     DGFMGGMFGGAAGGGGAGEVDGTDHGGIDWMGNLPEGISH"
     gene            1904307..1907715
                     /locus_tag="THITE_2107113"
                     /db_xref="GeneID:11515615"
     mRNA            1904307..1907715
                     /locus_tag="THITE_2107113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648957.1"
                     /db_xref="GeneID:11515615"
     CDS             1904588..1907557
                     /locus_tag="THITE_2107113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649005.1"
                     /db_xref="GeneID:11515615"
                     /db_xref="InterPro:IPR003108"
                     /db_xref="JGIDB:Thite2_2107113"
                     /translation="MNESPPTRSPALLATARGRQLRSTSDTSPTRQRKTDDILSNLTP
                     RTVVDAFRNPSGSLKACMQAATPAEQAFALRVAIASNSIYEWLEELSAWPWPAGGTSA
                     GFEIPTAKTGRLFHSGSEPSADEAPRPDQEYIGSLPAADVARYERRLDEIAQGLEELD
                     IEEIKRQVLNNHIMPLSRPGTPVMDSSRSATSALSSVAMLDDLAALITATTVQALPNI
                     SKLAKLMNTWNFRLLVLRKIPVFLASLTDAEVALRSGWNAIGLDTTPDRAAGNLPNGT
                     AGTGPATLSREDFDVMKTVLGRKVAKAGRDLDSMLDILEGQPDTLPEEWIDRLDALEL
                     GYSEWSVAGERKVKEADLARSASQAALEQNSSEQPAPLEPNLSAGASSATSGSLTSAS
                     PKAQAPEAATPLNGSSTRALGHAEVLPPLIKIHPTAEEHELQPEDDCPDTDDEELAPG
                     AYDRVSSVQQSGSRGSSPADTAHDYRGEDAAGADGSPSNSEIELSGISEHQAPPSESR
                     GRRDSDVSQSSTVMQEASSIFTDSFSSDLDHGTPERPRQQATVRDGDISGFPSFRSST
                     RSMSVSFNDQPSVAELPSFPSPPSTPTKSVILEDDVATEPDSPSEISMPRSDDQLQQQ
                     ISEILESVPAKIRLTAEPPPVNLNPPDFKMPTARKSSRPDAIPRSQSSLSMRSAYSRS
                     GTPSFTLAPAYGRSSRPRHQRTNQDIKLYHLSRSNGEAPIKLFIRCVGEHGERVMVRV
                     GGGWADLGEYLKEYASHHLRRSAGGGVDDDKVEVKDIPRTGAVRADSPPSRPASALDV
                     SHHHAHYHNSPESPLRVRKTRRPTQHSHEDANASNNSNNDTDEPSTSTACPKTPLAPA
                     GRRDATPPSDGSSRSRSSSRFNWLDDDGDLSALGMAGPRAKHIEMSEERRAWVESVKE
                     KVRIASGERKVSLPLAGGAPPSLPGSMVAAGGGGGGPGQGQPQGLEASLMDRDKGGAV
                     FGEMGKVGSTKRLFRRG"
     gene            complement(<1909133..>1910251)
                     /locus_tag="THITE_120596"
                     /db_xref="GeneID:11515716"
     mRNA            complement(join(<1909133..1909718,1909798..1909902,
                     1909959..1910121,1910179..>1910251))
                     /locus_tag="THITE_120596"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648958.1"
                     /db_xref="GeneID:11515716"
     CDS             complement(join(1909133..1909718,1909798..1909902,
                     1909959..1910121,1910179..1910251))
                     /locus_tag="THITE_120596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649006.1"
                     /db_xref="GeneID:11515716"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="JGIDB:Thite2_120596"
                     /translation="MKGLLLACLSLGCCVSGAPTSRRQDAVTTQQLDNLKLFVQWSVA
                     ATCNSEKSAGQPVTCPPGQCSLFESHNATVVASFIGTLLDTRGFVGVDPVSQQIVVSF
                     RGTTSVQNWIADLTFVQVPCDLTPGCLVHTGFWGSWGEVAARTLAAVRDAKAAHPAYS
                     VIVTGHSLGGAVATLAAAYLRRAGFAADLYTYGSPRIGNAAFVEFVTAQPGGEYRVTH
                     TDDPVPRLPPLVANYRHTSPEYWISSTSQGPVTPADVQYCPGYANVQCNGGTEGLDID
                     AHNWYFQPLDGCSARGHAAQEGGRGIITSAGS"
     gene            complement(1911495..1911838)
                     /locus_tag="THITE_2107116"
                     /db_xref="GeneID:11515884"
     mRNA            complement(1911495..1911838)
                     /locus_tag="THITE_2107116"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648959.1"
                     /db_xref="GeneID:11515884"
     CDS             complement(1911502..1911756)
                     /locus_tag="THITE_2107116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649007.1"
                     /db_xref="GeneID:11515884"
                     /db_xref="JGIDB:Thite2_2107116"
                     /translation="MLRRPPRFSMFHKRDQPRRPGMHLMSMCFTEARWTNPPHREPKR
                     ASRKCCRLAKVGCLGEASSKFLRAGCAGCRVGKEDGGAGP"
     gene            1912248..1912915
                     /locus_tag="THITE_2107118"
                     /db_xref="GeneID:11515437"
     mRNA            1912248..1912915
                     /locus_tag="THITE_2107118"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003648960.1"
                     /db_xref="GeneID:11515437"
     CDS             1912622..1912909
                     /locus_tag="THITE_2107118"
                     /note="CAZy_ID 270166"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003649008.1"
                     /db_xref="GeneID:11515437"
                     /db_xref="JGIDB:Thite2_2107118"
                     /translation="MVYRAGAVWLSLVASPFASFSLARSVGPRDAVPEGYHAAPYYPT
                     PHGGWLPSWSDAYAKAQALVSQMTLAEKTNITSGVGYLMGRTPLSETAASS"
     gene            1912920..1915544
                     /locus_tag="THITE_2107120"
                     /db_xref="GeneID:11516558"
     mRNA            join(1912920..1912938,1912992..1913419,1913473..1915544)
                     /locus_tag="THITE_2107120"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003648961.1"
                     /db_xref="GeneID:11516558"
     CDS             join(1913140..1913419,1913473..1915448)
                     /locus_tag="THITE_2107120"
                     /note="CAZy_ID 270167"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003649009.1"
                     /db_xref="GeneID:11516558"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="JGIDB:Thite2_2107120"
                     /translation="MYARGVAIGKEFRGKGTNVYLGPTVGPLGRKPLGGRNWEGFGAD
                     PVLQAKAAALTIQGVQEQGIIATVKHYIGNEQEMYRMYNLFQPGYSSNIDDRTLHELY
                     LWPFAEAVHAGVGAVMTAYNAVNGSACSQNSYLINGILKDELGFQGMVMSDWLSQISG
                     VGSALAGLDMNMPGDTNIPLLGLSLWQYELTRSVLNGSVPLDRLNDMATRIVAAWYKM
                     GQDKDHPRPNFSSNTHDKDGPLYPAALFSPTGQVNWFVNVQDDHYLLARQVAQDAITL
                     LKNDGGVLPLSNASKISVFGTDAQVNPAGPNACASRACNIGTLGMGWGSGVADYPYFD
                     DPISAIKRRVPSVKFYNTDSFPAIDTPSSDEIAVVFVTSDSGENSFTVENNHGDRDSS
                     KLAAWHGGDQLVQQAAAKFSNVVVVIHTVGPLILESWIDLPSVKAVLFAHLPGQEAGE
                     SLTNVLFGDVSPSGHLPYSITKAATDYPDSIANLKGFALGQVQDTYSEGLYIDYRSLN
                     KQAIKPRFAFGHGLSYTTFALTNATIRAVTPLSLVPPARPAKGATPSYPSTIPPASEA
                     YYPPGFSPIWRYLYSWLQPSEADAAYAIGAAGTPKYAYPDGYSTVQRPGPAAGGGDGG
                     NAALWDVAWEVTVTVRNAGASFAGKASVQAYVQYPPDAPYDVPVVQLRDFEKTAALRP
                     GESETVTLRLTRKDVSVWDVELQNWVVPGVRGGGGMGRYTVWIGEASDRLFLACYTDM
                     LVCEEGLSPPV"
     gene            complement(1916092..1917248)
                     /locus_tag="THITE_2107125"
                     /db_xref="GeneID:11515414"
     mRNA            complement(join(1916092..1916838,1916916..1917248))
                     /locus_tag="THITE_2107125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648962.1"
                     /db_xref="GeneID:11515414"
     CDS             complement(join(1916451..1916838,1916916..1917013))
                     /locus_tag="THITE_2107125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649010.1"
                     /db_xref="GeneID:11515414"
                     /db_xref="InterPro:IPR000271"
                     /db_xref="JGIDB:Thite2_2107125"
                     /translation="MQSPLLQAALRRPTAQLLPRCALPTSSCPAAARPFSNLPTLRPT
                     LLHPSTTTTVFRAPNQTLLSSPTLTTTAATTTTTTTAAEAGCQTTLLLDLLPKRAITS
                     HPALAGCASQIRCGPRPTMARATRLIQKRRHGFLSRVKTQSGRKTLARRKAKGRKRLS
                     A"
     gene            complement(1917250..1919338)
                     /locus_tag="THITE_2107126"
                     /db_xref="GeneID:11515335"
     mRNA            complement(join(1917250..1918059,1918121..1919050,
                     1919116..1919338))
                     /locus_tag="THITE_2107126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648963.1"
                     /db_xref="GeneID:11515335"
     CDS             complement(join(1917619..1918059,1918121..1919050,
                     1919116..1919130))
                     /locus_tag="THITE_2107126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649011.1"
                     /db_xref="GeneID:11515335"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="JGIDB:Thite2_2107126"
                     /translation="MDFLQRLARFLDRPLFPWKKLIIGFSIGQYIFEAFLGFRQYRVL
                     QRTKPPKVLEHEVSQEVFDKSQAYGRAKAKFQAFSGLYGQLQNLAFYQFDVLPKLWSW
                     TGDLLLRFAPARFTGEISHSIVFILAIIVIQQILSLPTSIYNTFVLEEKFGFNKQTPK
                     LFVTDMIKTITLAFVLAPPILSGFLSIIKKTGSQFFYYLWLFGAGLQVFMITIYPIAI
                     LPLFNKLSPLEKGKLKTDVEDLAKKLKFPLHELYVIDGSKRSAHSNAYFFGLPWKKHI
                     VIYDTLIEKSEIDEVVAVLAHELGHWSLGHTTKLFGISQAHFFYIFALFSVFVNNNSL
                     YADFGFTNEHPIIIGFLLFSDILGPMDNVIKLLMNVLSRRFEFQADAFANKLGYSTEL
                     CRSLIKLQIQNLSTMDADWMFASYHFSHPILSERLKALNWQPTQKVEAKAAEKADGKE
                     DVATATGRDEL"
     gene            complement(<1919729..>1920168)
                     /locus_tag="THITE_2040300"
                     /db_xref="GeneID:11515882"
     mRNA            complement(join(<1919729..1919812,1919866..1919996,
                     1920117..>1920168))
                     /locus_tag="THITE_2040300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648964.1"
                     /db_xref="GeneID:11515882"
     CDS             complement(join(1919729..1919812,1919866..1919996,
                     1920117..1920168))
                     /locus_tag="THITE_2040300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649012.1"
                     /db_xref="GeneID:11515882"
                     /db_xref="JGIDB:Thite2_2040300"
                     /translation="MPTPLDRAMKSKVSISFSFAGLVTGVAVWAIWGGEMFPSEADPK
                     GDPETWTREELRRWLAARNLHPQDADTREQLLDRVRANMRIPRR"
     gene            1920514..1921295
                     /locus_tag="THITE_2169250"
                     /db_xref="GeneID:11515768"
     mRNA            join(1920514..1920608,1920669..1920702,1920787..1920915,
                     1920995..1921295)
                     /locus_tag="THITE_2169250"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_003648965.1"
                     /db_xref="GeneID:11515768"
     CDS             join(1920579..1920608,1920669..1920702,1920787..1920915,
                     1920995..1921050)
                     /locus_tag="THITE_2169250"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_003649013.1"
                     /db_xref="GeneID:11515768"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="JGIDB:Thite2_2169250"
                     /translation="MPQEIGDIKKFIEICRRKDASSARIKKNKKTQQIKFKVRCRRFL
                     YTLVLKDSEKAEKLKQSLPPNLQIKDVPKRNKPGKASS"
     gene            1922212..1924551
                     /locus_tag="THITE_57831"
                     /db_xref="GeneID:11517228"
     mRNA            join(1922212..1922884,1922954..1924551)
                     /locus_tag="THITE_57831"
                     /product="mevalonate kinase"
                     /transcript_id="XM_003648966.1"
                     /db_xref="GeneID:11517228"
     CDS             join(1922630..1922884,1922954..1924234)
                     /locus_tag="THITE_57831"
                     /note="orthologue of Saccharomyces cerevisiae Erg12"
                     /codon_start=1
                     /product="mevalonate kinase"
                     /protein_id="XP_003649014.1"
                     /db_xref="GeneID:11517228"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="JGIDB:Thite2_57831"
                     /translation="MTTQRTANGLPNGRNGFRGEGELETSSSKEADAGVNGISNGTGT
                     LKLNSRRKVDRKKSSPMLPAFMVSAPGKVILCGEHGVVHGKAAIAAAIALRSYLLVTT
                     LSKSKRTVTLRFPDIDFNHTWNIDELPWATFQQPSKKKYYYDLVTELDPDLVSAIQPL
                     VADVSPHKPADIRKIHQNSAGAFLYMFLSLGSPSFPACQYTLRSTIPIGAGLGSSATI
                     AVCLSAALLLQLRTLSGPHPDQPPEEARVQIERINRWAFVYEMFIHGNPSGVDNTVST
                     QGNAVIFQRTDYGKPPSVKPLWDFPKLPLLLVNTKVPKSTSHEVAKVGKLKKMHPVLV
                     GSILDAVDQVTQTAAGILTEESFDAESEECLTRVGELMTINHGLLVSLGVSHPRLERV
                     RELVDHQGIGWTKLTGAGGGGCSITLLRPDVPREKLDRLEEQLDREGYQKFRTTLGGD
                     GVGVLWPAVLKNGMDEDDRGGMEIDLERFLSAEGNEGVERLVGVHGGGGEREGWNFWR
                     VEG"
     gene            <1925569..>1926859
                     /locus_tag="THITE_39903"
                     /db_xref="GeneID:11515291"
     mRNA            join(<1925569..1925905,1925973..>1926859)
                     /locus_tag="THITE_39903"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648967.1"
                     /db_xref="GeneID:11515291"
     CDS             join(<1925569..1925905,1925973..1926859)
                     /locus_tag="THITE_39903"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649015.1"
                     /db_xref="GeneID:11515291"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="JGIDB:Thite2_39903"
                     /translation="TVREFEARWERKLWLSCLAVESWAFRERRARQQRGEVERTTGEG
                     VVVTEQEVFAEGRRRREMAALKRELYGGGVGVEGKLAGDPEWDDVVPVVLEEPEGALA
                     AIAYPAEYAEAMAYLRAVMQAKEYSPRCLRLTEHIIAMNPAHYTVWLYRASIVFALQL
                     PIPDEIAWLNGVALANLKNYQIWHHRHLLVENYFPTIAGDPDAIAAFAASERDFLRQI
                     LAEDTKNYHVWSYRSYLVGKLGLFGSAEELQAIEAMIDDDVRNNSAWSHRFFLVFSNP
                     AHATPGVAATEPDPKVPQAVVDREVAYAEDKIRLAPQNQSGWNYLRGVLVKGGRKLAT
                     VEEFASEFVTGLGQGDGGEDVLSTHALDLLAEIYAEKGDKEMADLSLRRLGQKWDRIR
                     VGYWEWRRKCLETPA"
     gene            complement(1927137..1928347)
                     /locus_tag="THITE_108034"
                     /db_xref="GeneID:11516591"
     mRNA            complement(join(1927137..1927880,1928014..1928347))
                     /locus_tag="THITE_108034"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648968.1"
                     /db_xref="GeneID:11516591"
     CDS             complement(join(1927363..1927880,1928014..1928059))
                     /locus_tag="THITE_108034"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649016.1"
                     /db_xref="GeneID:11516591"
                     /db_xref="JGIDB:Thite2_108034"
                     /translation="MAASAHETNIRCSAEAAKNFVDWYYRQVNEAKPIAQGYVNGNAT
                     YDRAGHAPADICINGLVVATPQEWEKLLEQQRQCPKQTDPNQKLVRYDVEVFNCHVIN
                     PDYRFAAPQKMLDLHAPTDGVRMMMMLTVGGTVYFGTGRNKGDGYFAKERFQDVFILV
                     PNWDVLGKPGAKVGRKYLVASQIYRTF"
     gene            complement(<1928662..>1929163)
                     /locus_tag="THITE_2140923"
                     /db_xref="GeneID:11515856"
     mRNA            complement(join(<1928662..1928984,1929043..>1929163))
                     /locus_tag="THITE_2140923"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648969.1"
                     /db_xref="GeneID:11515856"
     CDS             complement(join(1928662..1928984,1929043..1929163))
                     /locus_tag="THITE_2140923"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649017.1"
                     /db_xref="GeneID:11515856"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="JGIDB:Thite2_2140923"
                     /translation="MDNLANLASTVGDRFVTNLKGSFTDLTLEKFIRIVIVAGGYLLL
                     RPYLLKLGGRAQMRAHEEEAARADAVAKAKISPNELRGRVQIPDDTDDEDERAAEASG
                     PEWGKKARRRQREMIRKLLDAEEQRLRESQEELEDKDIEEFLVKE"
     gene            <1929822..>1930518
                     /locus_tag="THITE_2028140"
                     /db_xref="GeneID:11515517"
     mRNA            join(<1929822..1929854,1930033..1930156,1930361..>1930518)
                     /locus_tag="THITE_2028140"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003648970.1"
                     /db_xref="GeneID:11515517"
     CDS             join(1929822..1929854,1930033..1930156,1930361..>1930518)
                     /locus_tag="THITE_2028140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649018.1"
                     /db_xref="GeneID:11515517"
                     /db_xref="JGIDB:Thite2_2028140"
                     /translation="MAEAQDDEVRERLKAALWYAVGKIVDEESLARNRNATPQFIGAL
                     TDMVWHQIGTVATDLESFSRHAGRSTITTDDVLLLARRNQDLYSVIKDTVDKEKAAKA
                     KGK"
     gene            complement(<1930869..>1932748)
                     /locus_tag="THITE_2041768"
                     /db_xref="GeneID:11523424"
     mRNA            complement(join(<1930869..1931975,1932122..1932253,
                     1932322..1932642,1932713..>1932748))
                     /locus_tag="THITE_2041768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648971.1"
                     /db_xref="GeneID:11523424"
     CDS             complement(join(1930869..1931975,1932122..1932253,
                     1932322..1932642,1932713..1932748))
                     /locus_tag="THITE_2041768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649019.1"
                     /db_xref="GeneID:11523424"
                     /db_xref="JGIDB:Thite2_2041768"
                     /translation="MGRLGPVTSQGLGRSPYDDVVPGEGPDNPRGHQQLYDERGRPIN
                     PETKRINRDVIRSHNEVMMVIGVAEPENGFVEAQAEAARRHRQYEDRVGRRLLLAGGV
                     FETAAIWGVNGMRQRILLYKPYSHTSFYGMFQLARSQQSLSSYFFGGLPSFLASTVLE
                     QLARSRIIPFSEILPNWRFFVPGTSISPIPLPPLPSSLRPRSLLQWLGAFALGAAPFA
                     GFYLYTKFYSFLIRTLRYKIHRLLPRPHNATKRRSFRDGASLPPGTDAIPIEIRTSEP
                     IQTPDPPTNEPSPGGPSRRQSTPSLRGNGPSGAAQQDDFASDDEEAEIISATLISFDV
                     EASDPTPDPTNHSPATAAANGDAATANTNTPTPGVWSAELRPNLTDGAAGRAAGAGPD
                     SGGPPEPLYRETVLTRLPAVLATDVLAVTPARLLMTPLATLVWLPLARAYMARRGLPL
                     DDVVRGAGWWWGLHSRRALVNLLGLELLLAVVHGEAWALVTLVAGSLRYSEEEWNERE
                     GVRREGDGDGDGEGEGEGGGELI"
     gene            1933046..1936021
                     /locus_tag="THITE_2107137"
                     /db_xref="GeneID:11523406"
     mRNA            1933046..1936021
                     /locus_tag="THITE_2107137"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648972.1"
                     /db_xref="GeneID:11523406"
     CDS             1933117..1935891
                     /locus_tag="THITE_2107137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649020.1"
                     /db_xref="GeneID:11523406"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="JGIDB:Thite2_2107137"
                     /translation="MATRQPTKTTFEVSNVIQPIFTGGSVALENGARILASTLGEAAV
                     LTELNTGRRLAEIEGDGEPISTLTITPSASHLVVCSRSLTMRIYALKLSPDSDSVEAT
                     LVRTSKPHATPVVVLAVDRTSTLLATGAADGAIKIWDIAGGYVTHTVSGPSVLVSALH
                     FFEIAATAENAASERKPKKGPRKSHGDQSQLDGAGSKFRLAWGTQDGRVRIFDLHKRA
                     AVPVYADPKRRKEAHESNVQSIDYSPEQHALLTGSRDKTMTLWLWRDNAWHGTPMLRH
                     ELVESVGFLNEGKWMYSAGSSGLLRIWDTTTHQEITAKQDSKSEAESILSVVSLPHQS
                     LILCAQSDFTLALYRIPSPGDITSMGKLSMEPFRRISGTHDEILDLAFVLPDQSMMAL
                     ATNSEDIRLVSVADTATQADGEQGGAYFGHDVALLKGHEDIVMSLDVDWSGHWVASGA
                     KDNTARLWRVDPANNSYTCYAVFTGHLESVGAVALPKVVPSQDSDAFKNPLDHPPAFL
                     ISGSQDRFVQKRDIPRQSQKAKVSSSLKRLAHDKDINALDVSPSGRLFASASQDKTVK
                     IWDVERLEVQGILRGHKRGVWTVRFAPLHTPAIHGEQGSVSGKGVILTGSGDKTIKLW
                     NLSDYTCLRTFEGHSHNVLKVVWLHIPTDDAAAKKRIQFASAGADSLVKVWDANTGET
                     ECTLDNHEDRLWTLAVHPKTNTLASGGSDSKVTFWKDTTAETQAAATEAALKLVEQEQ
                     ELENYIHAGAYRDAIVLALQLNHPGRLLNLFTNVVTNSTPEPGSLSGLKAVDDVLAGL
                     SDEQIFLLLLRLRDWNTNARTAPVAQRILWALVKSYPADKFSNLSVKGARGQRSLREV
                     LNALRVYTERHYKRMEELVDESYLVEYTLQEMDSLAPSAPEGVEEDGDAEDGDAVNPN
                     LRVSSTLGLV"
     gene            complement(1936022..1936476)
                     /locus_tag="THITE_2107138"
                     /db_xref="GeneID:11519166"
     mRNA            complement(1936022..1936476)
                     /locus_tag="THITE_2107138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648973.1"
                     /db_xref="GeneID:11519166"
     CDS             complement(1936120..1936347)
                     /locus_tag="THITE_2107138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649021.1"
                     /db_xref="GeneID:11519166"
                     /db_xref="JGIDB:Thite2_2107138"
                     /translation="MYVLLGEVFRSMGLSLTKKMCAMTILAVPLLLLPPLWYPDRSAP
                     SKVRFQVCTNCRNNRSRDSSRIKIAGSKGSS"
     gene            1936817..1938867
                     /locus_tag="THITE_2107139"
                     /db_xref="GeneID:11517198"
     mRNA            1936817..1938867
                     /locus_tag="THITE_2107139"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648974.1"
                     /db_xref="GeneID:11517198"
     CDS             1937095..1938774
                     /locus_tag="THITE_2107139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649022.1"
                     /db_xref="GeneID:11517198"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Thite2_2107139"
                     /translation="MSKRQASEALDELSGLDSPASKKSRFDDYNKSLTPLSTIENGDD
                     QQREPAPENGAGNGDRVEAEDYSEEEDEVEERAPIRQSAPTAGYDDLYLDTIDRNVLD
                     FDFEKLCSVTLSNINVYACLVCGKYFQGRGPKSHAYFHALDEDHHVFINMSTQKVYVL
                     PEGYEVKSKSLDDIKYVSDPRYTRQEVAEFDRKPRTSWTLAGKEYTPGFVGMNNIKEN
                     DYLNVVVQALSHVSPLRNYFLLEDFSAAPELVKRTSILFRKIWNPRAFKAHVSPHELL
                     QEISLQSNKRFTLTTQSDPVDFLSWFLNHLHLGLGGSKTKPGSSVIQRIFQGKLKVES
                     QAITARTDTQQDRLRFEEAADVKVDIARFLLLTLDLPPTPLFQDEQERNIIPQVPLTT
                     LLAKYNGVTAQELNAQRRRYRLMHPLPPFLLLHIKRFSHNRFVAERNPTIVTFDARSS
                     LDLAPFVEPPAEGGGQGAGGPIWYDLVANVVHEAVRAREDVADSAVGEERKTWKVQLR
                     DKATGEWVVAQDLFVEKIRSELLYLGESYLQVWERRRGPGPGESEKGKGRG"
     gene            complement(1939702..1941657)
                     /locus_tag="THITE_2107141"
                     /db_xref="GeneID:11515565"
     mRNA            complement(join(1939702..1940054,1940129..1940966,
                     1941042..1941257,1941507..1941657))
                     /locus_tag="THITE_2107141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648975.1"
                     /db_xref="GeneID:11515565"
     CDS             complement(join(1939829..1940054,1940129..1940966,
                     1941042..1941066))
                     /locus_tag="THITE_2107141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649023.1"
                     /db_xref="GeneID:11515565"
                     /db_xref="InterPro:IPR001040"
                     /db_xref="JGIDB:Thite2_2107141"
                     /translation="MDNLWSRRASSSKLSLSTSSTGQDSPSGRNSSFKRFGGDSSALG
                     KSSFGAITPGSGLASPIGGASSAFGLGSGAFASFGSAKTPKSPANPFDSAVGAAVKTP
                     TAEKSAKDGAPGDKAISKPASTASLKDEGKAAAQPTAGPAAPSAHPLRNSWVFWFRPP
                     ISKANGFIEYEKTLHRIATVETVEHFFSVYKHLKRPSALPLVSDYHLFKKGIRPIWED
                     EENKNGGKWVVRLRKGVADRYWEDLLLAIIGDQFCEASDEVCGAVLSVRNGEDILSIW
                     ARESGQRVLKIRETMRRILSFPPDTKLEWKSHDSSIQQRNAIEESRREKANNHHHGDK
                     RSSNKQQQQQHHHQNQQQGDDQKNPSSS"
     gene            1943306..1945694
                     /locus_tag="THITE_2107143"
                     /db_xref="GeneID:11519127"
     mRNA            1943306..1945694
                     /locus_tag="THITE_2107143"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648976.1"
                     /db_xref="GeneID:11519127"
     CDS             1943455..1945560
                     /locus_tag="THITE_2107143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649024.1"
                     /db_xref="GeneID:11519127"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="JGIDB:Thite2_2107143"
                     /translation="MGEFLPSLELPPEAVKNHGMEKITDKIAALPAGTDYFSLEFFPP
                     KTAMGFSNLRGRLDRMARALRPLFVNVTWGAGGSTAIKSLELAEICQRELGLTTCLHL
                     TCTNMSRRLIDKALDDAKALGIRNILALRGDPPRRAEYRDFNEPEPTDEEEEFAWAVD
                     LVRYIRKTHGDYFCIGVAAYPEGHADGSHPLGQSLEHDLPYLVEKTQAGADFIMTQLF
                     FDIKAYKHFEKTLREHPSGAFKDIPIIPGLMPIQSYQMIRRTTKLSHAKIPDALLARL
                     DAVKNDDEKVKEVGVDIISEIVEQIREIKSRTDAPRGFHFYTLNLEKAVSFIVERTGL
                     ISPTTPEPEQAIDDQQNPLPDIGLLRVNGSDQSSQEPPRRRQPSIGSDPRDRVIVPGR
                     SASYPDWEATALEASVPAGPINSRANTLAISEGEGVLGREATWDDFPNGRWGDARSPA
                     YGQIDGYGVSLHVTVAQARELWGTPRTPQDVSAIFIRHLRGELSTIPWSEESFSAETD
                     QIRDRLVALNSKGWWTLASQPAVNGLPSSDPTFGWGPENGFVFQKAFVEFFLPSEDWK
                     ALEQKLTRPEMKDVVCFYATNAAGDYVSSDTAFPRAPAAARGGAAAGEQQEASTNAVT
                     WGVFPGKEIVTPTIIEEVSFRAWSEEAFGIWGEWAKIYAKGSDSSRFLESLRADLWLV
                     NIIHHDFVDSEALWELLLD"
     gene            complement(1946267..1946835)
                     /locus_tag="THITE_2107144"
                     /db_xref="GeneID:11523461"
     mRNA            complement(1946267..1946835)
                     /locus_tag="THITE_2107144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648977.1"
                     /db_xref="GeneID:11523461"
     CDS             complement(1946293..1946475)
                     /locus_tag="THITE_2107144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649025.1"
                     /db_xref="GeneID:11523461"
                     /db_xref="JGIDB:Thite2_2107144"
                     /translation="MALFVALSVCFVSLFFSALRMGAHTNQIDSRLSTLRFGAAPAIL
                     ISKIRSRLDLTRRFLL"
     gene            complement(1946835..1949619)
                     /locus_tag="THITE_2107147"
                     /db_xref="GeneID:11521099"
     mRNA            complement(join(1946835..1948144,1948404..1948556,
                     1948827..1949003,1949436..1949619))
                     /locus_tag="THITE_2107147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648978.1"
                     /db_xref="GeneID:11521099"
     CDS             complement(join(1946991..1948144,1948404..1948556,
                     1948827..1948935))
                     /locus_tag="THITE_2107147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649026.1"
                     /db_xref="GeneID:11521099"
                     /db_xref="JGIDB:Thite2_2107147"
                     /translation="MPPKEKTTNFKTWETQARLLAAVVASLGENFRFDYKTIAKYFAR
                     DTTESAIEHRFRAIKVQAAAAKEAVEKNVDPMEVNLTSIKTRDEIRDLFGASTEGGIG
                     FQFREIKQGAKVLTKAVQSGEDPVAAFSSHLSGGTGATTTAPTTPSTTKRARSTKRTA
                     SGSGATPATKRRKAAVKPEPEFDDDEDSPEVDYEELDLTPTKEKKKWRPHAGQLLPPE
                     AWRKPPPGTKGPRSSFSQVRTQVRIAPAPPRPATPAYTLAPIPGTTNQPIAGGYANYP
                     AFATGSSVPSVANSPAVDMDTARRDSAAFSVGSGSSFAGSPPPEAFMSHANPHQTSGM
                     MMTTSQYSPVPGSSATIGMGNVQSFHGFDAASPSASVSEAHTPQSTTSSYTMMAAGPA
                     TTAHPSFYAAQEQYSPTAQTYTDSGLEPQGDYVYPSPPKPRDDAKSQTYGSDQAPPFA
                     GDFDDFSNWGNLHGYDDAGDC"
     gene            complement(1950751..1952201)
                     /locus_tag="THITE_2107150"
                     /db_xref="GeneID:11517050"
     mRNA            complement(join(1950751..1951488,1951561..1951767,
                     1951856..1952201))
                     /locus_tag="THITE_2107150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648979.1"
                     /db_xref="GeneID:11517050"
     CDS             complement(join(1951017..1951488,1951561..1951767,
                     1951856..1952019))
                     /locus_tag="THITE_2107150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649027.1"
                     /db_xref="GeneID:11517050"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Thite2_2107150"
                     /translation="MGWFTTLSGYLTPAFLILSPLLSYSDQAYSMYRTRSSAGFSLDI
                     PLIMLVASLLRIFYYPGAKYDNALLIQSFVMVAMQVVLLKIALDHRPAPYSKGGDAAV
                     PFARVNESQRPFNFWQWRSPKPYWQFLLSLFAGLLVCEFLLAPIPLVYQSYSSLLGYV
                     GLSVEATLPIPQLLANARSRSCKGFRLSVLASWLVGDAMKMFWFFTSTTSIPWAFKIC
                     GMFQAACDALLGVQYLLYGDGETVTKAHQSPIYELQPNGFATASGHGGHSPGRRTSTT
                     EKST"
     gene            complement(<1956601..>1957771)
                     /locus_tag="THITE_2125310"
                     /db_xref="GeneID:11519148"
     mRNA            complement(join(<1956601..1956890,1957058..1957128,
                     1957162..1957166,1957254..1957442,1957712..>1957771))
                     /locus_tag="THITE_2125310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648980.1"
                     /db_xref="GeneID:11519148"
     CDS             complement(join(1956601..1956890,1957058..1957128,
                     1957162..1957166,1957254..1957442,1957712..1957771))
                     /locus_tag="THITE_2125310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649028.1"
                     /db_xref="GeneID:11519148"
                     /db_xref="JGIDB:Thite2_2125310"
                     /translation="MQWEIAAASAVVLASFIGGKFLKLSSAGSQDGASNPQAVCTLPR
                     VTTAVIGLPVGGSTITSRLGAIVASQTATRLDMSKAAVESVVGELARYVSNPRRMGGA
                     RDLVNASEDWQLLLWCSALRYQIMRSPPSPGSCACQHPGCLSGNIEAAISLFTWNGRN
                     LVSPREGRDNDHWMDCAASCTDSAFRSVKVKACPQPTGVQLEQR"
     gene            1966621..1968046
                     /locus_tag="THITE_2107154"
                     /db_xref="GeneID:11523499"
     mRNA            1966621..1968046
                     /locus_tag="THITE_2107154"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648981.1"
                     /db_xref="GeneID:11523499"
     CDS             1966976..1967923
                     /locus_tag="THITE_2107154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649029.1"
                     /db_xref="GeneID:11523499"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2107154"
                     /translation="MSNYDPTVKASDMSSGKGSEETSSRRESALEQSAPRQQLPSLSS
                     LFGPPSQMHPFPSAFPDRPAATYTSSSPLDHSLRPPVGSSSYFPSPASAASQPRSLLD
                     SRFQDRAQVPSLPRVFPGPLSPLPRQEQRQDGRAESSSGSKWSLQQDAGREYSLGSRE
                     QTYQSSVERYPLQLSGTPRDDSRRTDFREQLAPQIPAHNPPATPTSSVGSEVPPAKDG
                     LGPRIWTGTHFLPRFVRAAEVPGEGMCYFYDDGSHCKTVIDGEAVNAHWGVTKAGKPR
                     KRLAIACVTCREKKIKCDPDYPRCLQCEKFGRVCKFKNA"
     gene            1970594..1972405
                     /locus_tag="THITE_2107156"
                     /db_xref="GeneID:11523452"
     mRNA            join(1970594..1970684,1970772..1970881,1971213..1972405)
                     /locus_tag="THITE_2107156"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648982.1"
                     /db_xref="GeneID:11523452"
     CDS             join(1970821..1970881,1971213..1972312)
                     /locus_tag="THITE_2107156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649030.1"
                     /db_xref="GeneID:11523452"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2107156"
                     /translation="MSQRTAKFPTRPVAQLLGSNGPVHAVAYSASPGTYILTGSSDRS
                     IRLYNPSSTTTTSANTASSTNTITKPHHAAPPQPAAPPTGRLIQTYASHAYEVLALSV
                     SASNAHFASAGGDRAVLLWDVATAQTVRRFGAASTAHSHSGRVNAVCFAGADDSLVVS
                     GGLDCTVRVWDVRAGGGSGGGGGKPVQVLSEARDAVSALAVCGPEIVAGSVDGRVRTY
                     DVRAGRCVTDVLPASVTSVCLARDGRTVLVGSLDSKIRLMDRANGACLRTYGDAGWRN
                     AELRVQSVLGGGERFVVAGDEMAATSGGGSEAAASEGRVWAWDLLTGRLVATVPVPWG
                     NSNEHRKKIIGRDGKEKERKNVVSCIAWKDGGFGNQFCVGGTSGVVTVFGEG"
     gene            complement(1972465..1974055)
                     /locus_tag="THITE_2107159"
                     /db_xref="GeneID:11519105"
     mRNA            complement(join(1972465..1972773,1972828..1973446,
                     1973509..1973769,1973822..1974055))
                     /locus_tag="THITE_2107159"
                     /product="glycosyltransferase family 15 protein"
                     /transcript_id="XM_003648983.1"
                     /db_xref="GeneID:11519105"
     CDS             complement(join(1972617..1972773,1972828..1973446,
                     1973509..1973769,1973822..1973972))
                     /locus_tag="THITE_2107159"
                     /note="CAZy_ID 269722"
                     /codon_start=1
                     /product="glycosyltransferase family 15 protein"
                     /protein_id="XP_003649031.1"
                     /db_xref="GeneID:11519105"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="JGIDB:Thite2_2107159"
                     /translation="MAIARPVRALGLAAIVMWCFFVWQLLKPTASLSSIGDSRLLPTE
                     RDPNLDPTGEPEGILTYSSDEYAPGPAGTARINATLLALVRNEELDGMLQAMHDLERT
                     WNHKFNYPWTFFNDVPFTAEFKKRTQAATKAECRYELIPKEHWEVPSWINHDLFIEST
                     KILEEQDVQYATKVSYHQMCRWNSGLFYKHPALANMQYYWRVEPKVHFFCDVDYDVFR
                     YMQDNNKTYGFTINLYDAPQSIPSLWPETLKFIAEHPEYVHENNAMKWLTDNIRRPDH
                     NTKAQGYSTCHFWSNFEIADLSFWRSKAYEDYFNHLDRAGGFFYERWGDAPVHSIALG
                     LFEDSSRIHWFRDIGYQHIPFFNCPNSPKCKGCVTGRFTDGQAWLNKEDCRPNWFKYV
                     GMG"
     gene            1974400..1977626
                     /locus_tag="THITE_2107161"
                     /db_xref="GeneID:11515364"
     mRNA            join(1974400..1974763,1974828..1977626)
                     /locus_tag="THITE_2107161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648984.1"
                     /db_xref="GeneID:11515364"
     CDS             join(1974695..1974763,1974828..1977449)
                     /locus_tag="THITE_2107161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649032.1"
                     /db_xref="GeneID:11515364"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="JGIDB:Thite2_2107161"
                     /translation="MAYLAQLGALADELVAALTSIPEAQRERRDAYREFVLRSLRHHT
                     FTRTNQFEVQDRLDGLEERFCVVGRDALARALRIRLDALESHRSQTTPEVLHLLLELA
                     DQPAQKSNLSDLDALVEPEEDAPPPLTWRDIAREDGWKQERDIWRFVDYSLGSSDEDE
                     VDVLSEASLESLTTTSSAEGKSQPTVEALASIEPLGGEVLKQVQAAQAWRHDSAAAAD
                     GRPKRIPISTTQLLREVLFMLADLETNLFDAGCNPMPKYQLRGVSLDSYKALLTSFAE
                     CGRKLAPLRAFAKQREKIPLLQVFQDCVQKALHSLDLELSQIQARMIANKDDVVISLT
                     GVLEELGPTLTPLYSLADIVRQLQEERNSHAFRCLELLYDAVGMAQLQGSRSVYQLLG
                     TIFFDCFQVYLKPIRLWMEEGKLLPGDRTFFVSESPTKLPLPQIWKSQFNLLRTPEGS
                     LHAPRFLKPAIHRIFTAGKSIVVLKHMKQHESTRKYRPGAEPKMDFATVCPDEAELAP
                     FSELFSAAFHAWIRSKHHSAAAMLRELLFRSYGLSEDLDALQRIYLMSDGARFDTFAS
                     SVFRHLDSYSSSWKDRFTLTEIAQEAFSGCIDGDRLSAEVEPRGLAHSGLASRSSVRL
                     SLPAIRLRYRLSWPVQIVVPDDGIQGYQTIFTFLLQARRAISVLQHPILTPQPAGPAD
                     RASYPYYLLRSKLLWFGNTVTTYLATLVLAPNAARLRADLREAADVDDMVAAHAAFVA
                     RLVAESCQGAKLQPIRDCILDVFDLAIRLEDAQRAETARREEEDAEISRLSVMSSPYR
                     SPAPGRDRAKRRRVESEDDEGEEEDGAAQVVGEWMVKRHGVKDSKKPYALVLRELHGD
                     FERHLRFIASGLRGVARASREEAAAKWDLLAEMLEVGIKD"
     gene            1977627..1979065
                     /locus_tag="THITE_2107164"
                     /db_xref="GeneID:11516608"
     mRNA            join(1977627..1977825,1977893..1978896,1978963..1979065)
                     /locus_tag="THITE_2107164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648985.1"
                     /db_xref="GeneID:11516608"
     CDS             join(1977803..1977825,1977893..1978811)
                     /locus_tag="THITE_2107164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649033.1"
                     /db_xref="GeneID:11516608"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="JGIDB:Thite2_2107164"
                     /translation="MSERKVLTKYYPPDFDPSLVGRARKPKGSQAQGPKVQTVRLMAP
                     FSLRCVSCGEYMYRGRKFNARKETPPGERYLGIQLYRFYIRCTRCSAEIVFRTDPKNQ
                     DYVVERGAKRNTDPWKRGLDGGAADETDEQRLDRLEREMAEAEGEEERNAMAELEAKT
                     EEAKREMAVADALDEIRSRNERLKNAQREAGDLFGNGVLSAEEEERRRQDEEDAEAAR
                     RAFAFARRQDLLEEVVEEDGVDGDGVLSGNVNGGAVGSGPGSGSSSAAAASTSGSKPS
                     SAAATPDIPPPPSFKRVVKKKKDHAALLGIKKKQPLV"
     gene            complement(1979061..1979960)
                     /locus_tag="THITE_2107167"
                     /db_xref="GeneID:11516905"
     mRNA            complement(join(1979061..1979098,1979159..1979685,
                     1979753..1979960))
                     /locus_tag="THITE_2107167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648986.1"
                     /db_xref="GeneID:11516905"
     CDS             complement(1979387..1979617)
                     /locus_tag="THITE_2107167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649034.1"
                     /db_xref="GeneID:11516905"
                     /db_xref="JGIDB:Thite2_2107167"
                     /translation="MPATGESSSVSMPLSPAPPTDKGTYARSMQQHTKRQIEAISQSQ
                     PRSAQHSHDSPTFVADGVSGRSRDSNQHSHQT"
     gene            complement(<1981569..>1982597)
                     /locus_tag="THITE_2041478"
                     /db_xref="GeneID:11515670"
     mRNA            complement(<1981569..>1982597)
                     /locus_tag="THITE_2041478"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003648987.1"
                     /db_xref="GeneID:11515670"
     CDS             complement(1981569..1982597)
                     /locus_tag="THITE_2041478"
                     /note="CAZy_ID 269759"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003649035.1"
                     /db_xref="GeneID:11515670"
                     /db_xref="JGIDB:Thite2_2041478"
                     /translation="MPPLPRPALPRLITYYQTHHTPSGSPISVLPLLQQPGIALTHLI
                     LAAIHINEDPAALTLNDHPPSDPRFTTLWAELRVLQASGIQVLGMLGGAAPGTFARLD
                     AADEATFERYYGPLARLVRERGLDGLDLDVEEPMSLAGIVRLIDRLRADFGPAFVITL
                     APVAAALLRADHNLSGFDYEALEVLRGAEIAWYNAQFYCGWGDCSNPAMYEMLLAKGW
                     KPEKIVVGLVTNPKNGSGWVPWNLLGNVLPLLAGRHPRFGGVMGWEYFNSLPGGEQRP
                     WEWAQAMTALLRGRRTTASYAPEVVDGLKPAETALSEADPDEAGKGVAAPVPQDFEYY
                     SDGGGQSD"
     gene            complement(<1982980..>1986576)
                     /locus_tag="THITE_2140937"
                     /db_xref="GeneID:11515463"
     mRNA            complement(join(<1982980..1983402,1983523..1983650,
                     1983687..1985859,1985908..1986003,1986052..>1986576))
                     /locus_tag="THITE_2140937"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648988.1"
                     /db_xref="GeneID:11515463"
     CDS             complement(join(1982980..1983402,1983523..1983650,
                     1983687..1985859,1985908..1986003,1986052..1986576))
                     /locus_tag="THITE_2140937"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649036.1"
                     /db_xref="GeneID:11515463"
                     /db_xref="JGIDB:Thite2_2140937"
                     /translation="MPIPDQDQPPRAPPSATEGPPPPSPPSPTSTAAGGGSGSAQDSF
                     PTLFGIVLGAAALLGLALALLIICVARRRARQARQRRRRQGGLLRPHDDDAAEEDADA
                     DVVITTTSGSSSSSSGGGSVHVRDAGGGSGASRVWGEGEDKEVRGGLRSKLRKAWSIG
                     GGGRGGSGGWPTKLEHRSMPLIPMVCTKGHFHFGFSRSESCRWPDAAMEVVRVSRRNP
                     SWIDEDALHGPKLAGQRSDAAVAGSKKKSRRSWPLRHKTPTLPRVHHTIHGYPHSARG
                     RLNGSSDALLSGEQMMAAAGGLENAQLRTCSRALPAPPTPALVASRDRRVLKPSVSMG
                     YVYGASRIPKLVTSPPVSPVRSLPTTPLKHRARQQSTDSALSEILRSTEKRLREGSIS
                     GTSQSNTDTASPTRAPHPREYAAPLSRARTPSPKKHVPSQHNTPGHQPQDSQNSISSE
                     ADSLVGGDCSAPDAPSGLTSSSRSQKKQEAEAPQTRSVRTSLSSDLSTLYSEDEMPDE
                     VKKAIMPLEGLVVQPQQAARVGPPSMNDPFVTAPLLPWVSRSQSIGHGCQAKHSKSQD
                     LFRATLHRSQCLRSMTAGQNLAQPQGLILAPGPVMHGAIQTSLPAIPPSRQASVTIPR
                     CIQPYIASRASEPPPSPTKVSPTGQSPSGPLFLRVTKTSTLSTIPSLPPPAVPSFSVP
                     REREQRITPHSPIRTSQTAGGEALVRRSPALRLPSTERSSAPPSPTRPAGDEVRLSLV
                     PPPEQLQDLHRENRTSASSSVYSQATSPLIAAAAGAIELNRAHFRANASLYPAPLSPH
                     GRGPSPPSKLSSSQVPGNDNDDNHSADASAAEEGQNAEHEGHDDNDGGGGGEDDEDED
                     TPLAIGYTIASLRRMNSGISTASSLRSITDRDPSPSPSPSPSPSPDRPVVPALAPGAA
                     AAGSSPAGVGGGDGTGSAGAGGDGQAHRKSIGARNYFTMGAGGQRQSRRVSRAVSGAG
                     FARRASTVLRMSLPELGTEAGEGGKENNAGGATADGGFKVAAGEFTFEVSNPSVAEKG
                     GLGLREGSAANVKAALQQHQQHPQQSQGQMLSLAWKPVPSELRGSQSPARASMRSVDS
                     LGLYDRQGFLISASPARGVSPSGLRV"
     gene            complement(1987239..1989624)
                     /locus_tag="THITE_2107170"
                     /db_xref="GeneID:11517475"
     mRNA            complement(join(1987239..1988445,1988504..1989018,
                     1989080..1989236,1989337..1989624))
                     /locus_tag="THITE_2107170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648989.1"
                     /db_xref="GeneID:11517475"
     CDS             complement(join(1987775..1988445,1988504..1989018,
                     1989080..1989236,1989337..1989496))
                     /locus_tag="THITE_2107170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649037.1"
                     /db_xref="GeneID:11517475"
                     /db_xref="JGIDB:Thite2_2107170"
                     /translation="MRINISLAILVLLNGVAAFWRMECRGRLGVARLDPLISPGTVSQ
                     HAHAIHGSSGFSNDATHADLVNGECTSCIVTQDKSAYWAPNLYFKHANGTYEDVEQVG
                     GMLAYYFLNPDAKNPNGKIQAFPNDFRMIAGDSTRRNYSLGDPQKPDPEKSRWAQLGQ
                     TTQYDLAQRALGFNCLDYSKAPEGSLQRHYLPNKTYLDANCPDGVRFELSFPSCWNGK
                     DITSPDFKSHVAYPDLVLNGNCPDGFNVKLPGLFYETIWATNAFKGVDGEFVISNGDV
                     QGYGYHGDFMSGWDANFLQEAVDQCTNLSGRVQDCPIFTLQTEDQQRQCKLTVPSALA
                     NEKVTGMIGNSLPGGVAIQLGPGPAIGNNPQTESASIPVPTVGYTPGTSVTGSSYLPG
                     GVFAFGKTSTTNAAASSATPGVNALAEQHSSLTPSPTPTPSEPPVPAGYQLVRTDYVT
                     NGNVVSKIVVIETVEYVMVATETVTVTATGGAEKSRRQLLHLHQHRHGSH"
     gene            1990073..>1990848
                     /locus_tag="THITE_2148785"
                     /db_xref="GeneID:11521429"
     mRNA            join(1990073..1990192,1990226..1990244,1990333..1990380,
                     1990426..1990581,1990724..>1990848)
                     /locus_tag="THITE_2148785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648990.1"
                     /db_xref="GeneID:11521429"
     CDS             join(1990091..1990192,1990226..1990244,1990333..1990380,
                     1990426..1990581,1990724..1990848)
                     /locus_tag="THITE_2148785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649038.1"
                     /db_xref="GeneID:11521429"
                     /db_xref="JGIDB:Thite2_2148785"
                     /translation="MGGEVVVLKPAEKVAQAHSEFNQNSRSAVGAETKSSRALRSKRG
                     AKGEREVEVEGGGIAETKRCSSSAAGAGAMKQKPPPGTPLLVWGRLLLPEAALSEEKH
                     AFNWLARARCWRAALSKKPRMEIEMGNVTLMIWEDGYACWLKMKMSA"
     gene            1992228..1995432
                     /locus_tag="THITE_2107172"
                     /db_xref="GeneID:11521419"
     mRNA            join(1992228..1995139,1995199..1995432)
                     /locus_tag="THITE_2107172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648991.1"
                     /db_xref="GeneID:11521419"
     CDS             join(1992440..1995139,1995199..1995300)
                     /locus_tag="THITE_2107172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649039.1"
                     /db_xref="GeneID:11521419"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="JGIDB:Thite2_2107172"
                     /translation="MDDLAGLNWSVPNRSQAQLAQSRSTPPNPAVPAYPSLRPTPSPF
                     ASGRSTPLSAQGSGNIAPKPPAATTAPDSFGNLLSFGAGKTNAKLSLRERQDQLEAEK
                     RRKEEEQRKQAQAQYGDGSFFDSLGQTQSGSRSTPSSGALAPPPAAEPGFGMQSGKAA
                     AESDDDLFAAFNADTKVDNSSYYPPPTHSSNPSPANAPGLDLTNPQSWNNAAVSSSGG
                     GFGDDDDDPFGLGQLKATSSAPAPAPAAADLDEDDLLGDLGKPVDQIRKKSAPTFARG
                     PEPGKPIEDSSSDSEVDQTAASDDPFDKAVAQLVDYGFTPENARRGLTESGGGLDVQA
                     AVNWLLDDAHRQAKEQAKGRGGVSEQPGGGDERISSRSRDAAPSWMRDGPSGGGPRSR
                     DNRSPAPTEGDFAKTAAAVGSSFLKTANSLWKTGQKKVQKAVAEFQQDSDPNQPKWMR
                     STAQGHASGAPVRETAEVTDEALMLESGRRPEGRSRNLAPERRNPSESRARERSPALP
                     PRPGQGGQVPRWQQGSQPTLDPRSRLNRQAAQEESFQAYVSPARRKKATPQPQPEVEA
                     TPPAQREPDLLFDSTTPSTSRSTPPVRSSQPSPAPRPSARPSPAPAPAPPRPSRQIPA
                     ISPIALQNSTKHRVEGTAHFKRGDFAAAHASYTASLTAVPQDHPLTILLLCNRALTAL
                     KIGEPRQAVEDADTAIRLIGPGKGEGEHVELQGTGDSPAEKRDMRDLYGKALSRKAEA
                     LEQMEKWADAAAVWQLCVEAGLGGATAAAGRQRCQKALAPKPAPAPRPASTSPAALPT
                     RPKATATPTSQKSSEAVQRLRAAHKAAEKEGDERIALTDKVDARIAAWRDGKRDNLRA
                     LLSSLDSVLWEGSGWKKVGLHELVVPNKVKVVYMKAIAKTHPDKIGQDATTEVRMIAA
                     TVFSTLNEAWDKFKAENNM"
     gene            complement(1995450..1996379)
                     /locus_tag="THITE_2107173"
                     /db_xref="GeneID:11521387"
     mRNA            complement(join(1995450..1995853,1995984..1996379))
                     /locus_tag="THITE_2107173"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648992.1"
                     /db_xref="GeneID:11521387"
     CDS             complement(join(1995600..1995853,1995984..1996230))
                     /locus_tag="THITE_2107173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649040.1"
                     /db_xref="GeneID:11521387"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2107173"
                     /translation="MAQSTAHRRLLQEYRALTNNPPEGITAGPVSEDDLLHWEALIQG
                     PEGTPFEGGVFPAELRFPKDYPLAPPTMKFLGEIWHPNVYPSGLVCISILHPPGDDPN
                     HYEHASERWSPIQSVEKILISVMSMLAEPNDESPANVEAAKMWRERRDEYEKKVRDGV
                     RRMLGL"
     gene            1997104..1998871
                     /locus_tag="THITE_2107175"
                     /db_xref="GeneID:11519081"
     mRNA            join(1997104..1998756,1998823..1998871)
                     /locus_tag="THITE_2107175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648993.1"
                     /db_xref="GeneID:11519081"
     CDS             1997487..1998671
                     /locus_tag="THITE_2107175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649041.1"
                     /db_xref="GeneID:11519081"
                     /db_xref="JGIDB:Thite2_2107175"
                     /translation="MALLVGDGVLGAASILSLPLLEGPDVIAGAVNFAKIGKEDLAQC
                     PLVAVNVDAGGEGLALFRADVRNALKYEALWTEANVGRISEWLRRGALPAGEAGMKAP
                     VRNLICSLLRNARAAVQDEESRDLSSNLKAKVAPGTAARLDQALSEWAQKAHAELQQQ
                     LDAAFATRPWSKLGWWKLFWRADDVGMVTSELVALRFLPEAEKAMIYLAGRIQEAGAM
                     EGQQGQPIYTGPALPPPLAGARSAHTVAPESVSKWPTHIPFTRNYLQEKTVPALQALA
                     QKLVVQSASLAGLSTALAGLSYLSGLGAYECGAIAALGIVLSFRRLQQKWDAAREYWE
                     SEVREEGRKAIRATEASVAEVLDKAGKALDSRADRTAQLEELRNIEKVIARAEEALAR
                     IK"
     gene            complement(<1999103..1999807)
                     /locus_tag="THITE_57872"
                     /db_xref="GeneID:11521334"
     mRNA            complement(join(<1999103..1999205,1999299..1999428,
                     1999540..1999600,1999665..1999807))
                     /locus_tag="THITE_57872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648994.1"
                     /db_xref="GeneID:11521334"
     CDS             complement(join(<1999103..1999205,1999299..1999428,
                     1999540..1999600,1999665..1999712))
                     /locus_tag="THITE_57872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649042.1"
                     /db_xref="GeneID:11521334"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Thite2_57872"
                     /translation="MTSSIGIPIKLLNEAQGHIVTLEITSGQTYRGKLIEAEDNMNVQ
                     LKDITVTARDGRVSHLEQVYIRGSHVRFFIVPDMLRNAPMFRSRNVRGRGVGLARGRA
                     TVSRARASGRGG"
     gene            2000935..2002092
                     /locus_tag="THITE_2107180"
                     /db_xref="GeneID:11516596"
     mRNA            2000935..2002092
                     /locus_tag="THITE_2107180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648995.1"
                     /db_xref="GeneID:11516596"
     CDS             2001133..2001918
                     /locus_tag="THITE_2107180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649043.1"
                     /db_xref="GeneID:11516596"
                     /db_xref="JGIDB:Thite2_2107180"
                     /translation="MRAETWDYQFAPGIQEAARPQDSSSPPMSASELTVSRSPPPATD
                     TPPSPGRYLSPSQDPTSPKSSWPTIPTTSTGQPTQGLSASSRSTLTALPQEVDEGSPP
                     DATTTPATAALTPLLVPIRDYGASQNLKSNYSNSRRQVGPVMRLFQEGRSRKSQTKTE
                     VARSKTQNKTTTKPGTTTKPGNSGGGDGISRAKPLDGSGGGVAPRKTDPKASVLAKKL
                     HAKVKSEKELKVDPKRRVKAWLKGVELDMAPIPLDAQGFPIYR"
     gene            complement(2002093..2004277)
                     /locus_tag="THITE_2107182"
                     /db_xref="GeneID:11515410"
     mRNA            complement(join(2002093..2003767,2003839..2004277))
                     /locus_tag="THITE_2107182"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648996.1"
                     /db_xref="GeneID:11515410"
     CDS             complement(join(2002267..2003767,2003839..2004128))
                     /locus_tag="THITE_2107182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649044.1"
                     /db_xref="GeneID:11515410"
                     /db_xref="InterPro:IPR005065"
                     /db_xref="JGIDB:Thite2_2107182"
                     /translation="MAGLVSSLNLVPSFPDYTGPYKVGTVDVEIPVSELESPSPAPEG
                     AAHIHTILFRIFYPAEAESYGKRVTWLPAPQRLHIAAYAQFLGAGPTLASILSFLPRH
                     LHWTTIPAHKNATLLAPRGDRPGARWPTMIFSHGLGGNRNAYSHLAGSLASYGVVVIC
                     PEHRDGSAALSLIRDPESQDRGRTRHIVPYCPIPHNQTNEVWEARNKQLRIRLWELGL
                     VFEAVSALDRGDEPTLRSNLNHSTSPSALHQFTNTLDIHEPGKVIFSGHSFGAATIVQ
                     LLKSTFYANHPSVAAMPAPLFTPDRTSALRHQVTPHTPTILLDMWCFPLLSASTAALY
                     NLPLPCYSPTRASGPAPGGAALLAVESQAFYTWSNHLHCKARILSPSPSFTQPIPPSM
                     FGGDDDDDGDHSDDGKDNAGAGRGSGGGGGGGVAKPHFFYVASSAHLSQSDFGVLFPR
                     LTKRVFKADRPARVLRLNLRAQLQFLRQNGVAVAGTARADLVDGPVSVSGGADSADGA
                     RGSGSAGPGGGGGKWVDDDKVILEKGGGKDGEGRVDAWRWIDIVGLGGEAYPSELDMS
                     EGRREEQQMSAEQGEREMQAEIEPAMATTA"
     gene            2004833..2006834
                     /locus_tag="THITE_2061958"
                     /db_xref="GeneID:11515369"
     mRNA            join(2004833..2005188,2005284..2005626,2005686..2006834)
                     /locus_tag="THITE_2061958"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648997.1"
                     /db_xref="GeneID:11515369"
     CDS             join(2004940..2005188,2005284..2005626,2005686..2006668)
                     /locus_tag="THITE_2061958"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649045.1"
                     /db_xref="GeneID:11515369"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="JGIDB:Thite2_2061958"
                     /translation="MTRHTPDLLRARSSNLTLRSLAMEQQPVADHGRDRIVDDRVDAK
                     DLRPEAFTKPYCDFMTENPTVFHVVDYFKQKLLKVGYTELSSRDSWVGKLEPGGKYFT
                     TRNGSSIIAFAVGKAYKPGNGIAMIAGHIDALTARLKPTSTKPNRDGYVQLGVAQYAG
                     ALNETWWDRDLSIGGRVIVRDPETGKTTVKLVKLDWPIARIPTLAPHFGIGMTGRNNR
                     ETEMVPIIGLDNSDLSSATEPEAPLGGQGSFASTQPPKLVKLIAKQLGISDYSTILNW
                     ELELFDLQPATVGGLDKELIFACRIDDKLCSWAAFMALLHAKSDPSDGVIKLVALFDD
                     EEIGSLLRQGARGNFLPLTVERAVESLTAHANSSRSTNSKPTVFGPGLLGQTYASSFL
                     VSSDVTHAAHPNFPQTNLAGHSPRLNVGVALCVDASAHMTTDSVSMAILDRVAALAGC
                     VNQRHMVRNDSRSGGTVGPMLSAAMGVKAADVGIPQLSMHSIRATTGSLDPGLGVKFY
                     KGFLDHWEAVDREWRA"
     gene            complement(<2007106..>2010746)
                     /locus_tag="THITE_40647"
                     /db_xref="GeneID:11516549"
     mRNA            complement(join(<2007106..2007825,2007865..2008120,
                     2008588..2008622,2008685..2010531,2010707..>2010746))
                     /locus_tag="THITE_40647"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648998.1"
                     /db_xref="GeneID:11516549"
     CDS             complement(join(2007106..2007825,2007865..2008120,
                     2008588..2008622,2008685..2010531,2010707..>2010746))
                     /locus_tag="THITE_40647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649046.1"
                     /db_xref="GeneID:11516549"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="JGIDB:Thite2_40647"
                     /translation="PRFAKELDQDAVPEWRVKYLNYKAGKKHIKAVTRAINRANATPT
                     LTRRAEVLPTGTTPARVFGINHSFTPPRRTNDPLPRDLLDESGRRRSASGTGTGTGTA
                     KPGSGAASGHERLGLARSPGSRVEYGSIGPTPSRASDRHDFELPAPAMGSPSTTGYSV
                     AAHSPPLSRAALQRSASMVAAGRLDHHSPPLLTLPTAGMGSTPRLRVPRLFTTGSASS
                     RQAAAKFDIGMQNLDYVRSAERDFFAFLDEELDKIESFYKEKEDQATERLAALRAQLH
                     EMRNRRTAEIAEAKRRRELSRDRSRSRSRGTGVGEGRAKDSNHDWINPLKDRLFKPGP
                     NSKALLKMTRTPVMAAQTIDQGRDYVRRPEDDDVPYRTAKRKLKLALQEFYRSLELLK
                     SYALLNRTAFRKLNKKYDKAVNARPPYRYMNEKVNKSWFVNSDVLDGHIRTVEDLYAR
                     YFEKGNRKIAAGKLRNLQKRSGDSSDSAFRSGLLIGVGAVFALQGLIYGSDILLHSED
                     PVLAEQTSYLMQLYGGYFLALLLFTLFTLDCRMWVKNKVNYPFIFEFDPRNFLNWKEL
                     AEFPSFFFALFGVFIWLNFARLGDWEQMYLYYPVILICITLVILFLPAPVLHYKARRW
                     FLYSHYRLLLSGLYPVDGRSAVWDLFMDFSLLQANAHRRLLRDITAIRPVWVYYLIMI
                     VDPILRFSWIFYAIFTHDTQHSTLVSFMVSFAEVVRRGMWTLLRASRDTPLPYHLEQY
                     VQRPSLEAAAAAAAAAAANAIGTPSTTTAPAAARPPTSISTPLRRGGTPAPGPTPEPQ
                     TPGTAQSQRPAAPLPTPLLEAGAGAQPASAAPSPSPATISGAAAGTAAASVSVEDSAG
                     AGTGAAWPGALGRRRADTLGRRSIRQAMAEAHRQDFEKKRVPVEAKERDCALEEEEYD
                     EEEEEGGGEEEEEEEEVELKSEGGEEEVGRGHREEEEKDEEEGMRIGNGGW"
     gene            2013771..2015439
                     /locus_tag="THITE_2107187"
                     /db_xref="GeneID:11515794"
     mRNA            2013771..2015439
                     /locus_tag="THITE_2107187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003648999.1"
                     /db_xref="GeneID:11515794"
     CDS             2013876..2015024
                     /locus_tag="THITE_2107187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649047.1"
                     /db_xref="GeneID:11515794"
                     /db_xref="JGIDB:Thite2_2107187"
                     /translation="MSHAWPVEPAMDPQYARRRAPPMEPASNAAYTHSRSRTTSSNTF
                     PTDMQAPFPANPYPPQMHLAQPNVSHQRRSPSVNTFSTVSSGGMAPPAAYRTSPTLDI
                     RRSTSSRSGGASSAPQSGSYVALLRKQKATVWCDRAQYEDPRLLAQQRAAKMRANLEI
                     VESGSGLGIGLGGSGRTATGLSSTGGKVAAKIRHHGKPTVIGYSPGSNFNGIGGVPLR
                     LSATEVEGEESEEDDAAMQRLHHRRTGSSGRNSIASGKRAMPHRPSGGLGPANSQQGG
                     AARWSPGDTPERTGSLVGEKQSEQALPGDDAGSGRARSIGSGSSERLDNVPELSGNSA
                     HLASNSRKNAAVTREKSVKSVDDLKRRGSVDERTMTLTTGRLFIANPD"
     gene            2016463..2018760
                     /locus_tag="THITE_2107188"
                     /db_xref="GeneID:11521216"
     mRNA            join(2016463..2016861,2016931..2018238,2018300..2018760)
                     /locus_tag="THITE_2107188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649000.1"
                     /db_xref="GeneID:11521216"
     CDS             join(2016726..2016861,2016931..2018238,2018300..2018724)
                     /locus_tag="THITE_2107188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649048.1"
                     /db_xref="GeneID:11521216"
                     /db_xref="JGIDB:Thite2_2107188"
                     /translation="MSSNIQDRDTVNRKRSHGEFLDQEACGPVASNEPEHARVDASLS
                     DKENDTPCISREVSASPLAKNTPGSTDPACCGLDGTAESPSPTPAQLSASSISTPPTS
                     TMTKTTAQKVTGGPPKKKRLTAEEKAAKEAMAEAEKRKKQEEREKKRREKEEAEKLKA
                     EQKAAKAAEKAEKEQEKKQRADERERRKREKEEEEARKARSQLKLTSMFNRAPTTPKK
                     DSDASKKEEAHQTGTATNGEARTTSLYHQLFKPFFIKEHVRLAPNPYQLDDETREAKT
                     RILDEYIKGDREKPAVAFDPLEILQIPYKIRRGRVYPSVRKIMAELEGLSSDSPADAT
                     TESQNAQVRHTLDALKLVPLKSIKFMEDVRPPYIGTISGLPPGVKSLRKLARNPVSKT
                     ILPLNYDYDSEAEWQEEEGEDVDDLDDEEEEGDMDEDMADFLDDSEDVGPTRMVFSGG
                     MEPESIGPYWEDRTRRTAEPKLYKYRLEFILESLKHHHSIDPFSGAYWESAKPKAGTG
                     SEASAASASTSATGPHLAASGSTQDARPSPMAPPPAPSDAFKALNPGTKKPQQPLPLE
                     MQQELKDLVRSMPTLSKVGVIELFAAKHPGCPRAQIKTSFDALFEKSGKVFKVKGE"
     gene            complement(<2019579..>2020640)
                     /locus_tag="THITE_2084217"
                     /db_xref="GeneID:11515874"
     mRNA            complement(join(<2019579..2019791,2019878..2020285,
                     2020413..>2020640))
                     /locus_tag="THITE_2084217"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649001.1"
                     /db_xref="GeneID:11515874"
     CDS             complement(join(2019579..2019791,2019878..2020285,
                     2020413..2020640))
                     /locus_tag="THITE_2084217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649049.1"
                     /db_xref="GeneID:11515874"
                     /db_xref="JGIDB:Thite2_2084217"
                     /translation="MAPTILVPTQARSWLSAAPHVARLSATTSSAVLLSRRDLSVNDA
                     QKVTLGIIAAYIVAIALLWNLPYVRWVLWPFKMLVIAFHEFGHAITCVLTGGHVKSIS
                     LDPREGGVTHMQGGRNAVTLPAGYLGSSLIGALLTFAGFNINASKIASIAVGACFLLT
                     LWWGRRDWLTIGTVLAAVGLLVACWFIAHAEALRFVVLFIGVMSSLYSVWDICDDLIL
                     RKVNSSDASVFAQRYGGSSQCWGVIWSIISLGFMACGMVAGIAAFPQSAAQQREDSQH
                     FIPTKF"
     gene            2021051..2022117
                     /locus_tag="THITE_2107193"
                     /db_xref="GeneID:11523539"
     mRNA            2021051..2022117
                     /locus_tag="THITE_2107193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649002.1"
                     /db_xref="GeneID:11523539"
     CDS             2021228..2021638
                     /locus_tag="THITE_2107193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649050.1"
                     /db_xref="GeneID:11523539"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="JGIDB:Thite2_2107193"
                     /translation="MALSAAHVRIARPTDDIDRLLPFYRDGLGFEVLMRFADHEGFSG
                     IMLGHKTAAYHLEFTQHETHRAGRAPTQDNLIIFYLPDSENYAQAVARMEEHGFPAVV
                     SFNPYWDRCGKTFEDPDGYRVVLANMTAPHLRDV"
     gene            2022276..2024006
                     /locus_tag="THITE_2107194"
                     /db_xref="GeneID:11519055"
     mRNA            2022276..2024006
                     /locus_tag="THITE_2107194"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649003.1"
                     /db_xref="GeneID:11519055"
     CDS             2022297..2023901
                     /locus_tag="THITE_2107194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649051.1"
                     /db_xref="GeneID:11519055"
                     /db_xref="JGIDB:Thite2_2107194"
                     /translation="MCNLPADFPRYPSFDPGGQTLPPPVPGGPLLQVLVQPRYSLYLD
                     SEQYGEFVVNAELSQFQGTPWPNTTSTSKWANRLIFSINLVEDDEPLVENTVAVNSTG
                     NLFRFELSRLKPSLDPIQVVLYGAPEEGTPTWTATTSLFYLPDKTDGSITRIDNLHGG
                     LWFRNAATNHQFTPFFPFGFYASYDGFLRTNDTAPIDHYSSLGLTAMTPLTTFADSAA
                     VLTYISAHTPVRLMYDLREGYKNLSYVRANVLAARASPALFAYWTADEPDGWQDPFAA
                     PEQARDLIRALDPYHPVAVTLNCADYYFGPYSAAADLLMADVYPIGINSTFSKWGTVC
                     NATYGDCGCDRCEGVVGDVVTRLEDWARFERYLGRWPKTKLFNPQAFHGEDYWLRDPS
                     TEETWVMIALAVNHGAKGSIAWVWPPSDVLAEAHGKMATVLTGEDVVGFIVGGDGPRR
                     IEVDVPGTEVVDVACWVAGGKMLVSVVNGGYVPVEGGVEVPVPNATVIESTPWGSVQW
                     KLEGGKLSVPLLPALATSMVILNLRG"
     gene            complement(2024006..2026109)
                     /locus_tag="THITE_2107196"
                     /db_xref="GeneID:11519195"
     mRNA            complement(join(2024006..2024804,2024880..2025281,
                     2025354..2025518,2025595..2026109))
                     /locus_tag="THITE_2107196"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649004.1"
                     /db_xref="GeneID:11519195"
     CDS             complement(join(2024111..2024804,2024880..2025281,
                     2025354..2025518,2025595..2025851))
                     /locus_tag="THITE_2107196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649052.1"
                     /db_xref="GeneID:11519195"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="JGIDB:Thite2_2107196"
                     /translation="MAPEKGLEEKPPPGNGPETEVDHDAVSPAPAPGGRWARTWDLLR
                     KAAAFGRVEVRGITPIPVKERTVERTVNVFTLWWSMNTNILGITFGMLGPGYGLNLRD
                     SSLIILFFTLLTTLLPAFLATLGPKLGMRQMLQARYSFGRYLVSIPVLLNLATLTGFC
                     VIMAVVGGQCLSAVADGNLSVTVGIVITAVLTLGISFCGFTVLHNYERFAWIPAIISI
                     VVAVGTGGKELRNQTTYDAPPPASSVLSFGMIVASYMVPWACLSSDFTTYLKPDTSSL
                     KIFTYSYLGLAVPTVLLMVLGAAIGNAIPNVPAWQAAYDETSVGGVLAAMLAPAGGFG
                     KFLVVVLSFSLLGNLAATSYSVTLNLQLLLPFLVRVPRYLFSLVFAAIVIPVAIRAAA
                     DFFANLENFVSLIAYWSSAFLAIVLVEHFVFRKGDCRAYDPEAWNDAHRLPWGVAALA
                     AGVLSFGLVVPSMAQVWWTGPIAETTGDIGFEVAFVVSGLLYVPFRWVERKWTGR"
     gene            complement(2027020..2030735)
                     /locus_tag="THITE_2107200"
                     /db_xref="GeneID:11517645"
     mRNA            complement(join(2027020..2029142,2029217..2029299,
                     2029358..2029451,2029502..2030100,2030160..2030735))
                     /locus_tag="THITE_2107200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649005.1"
                     /db_xref="GeneID:11517645"
     CDS             complement(join(2027132..2029142,2029217..2029299,
                     2029358..2029451,2029502..2030100,2030160..2030504))
                     /locus_tag="THITE_2107200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649053.1"
                     /db_xref="GeneID:11517645"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="JGIDB:Thite2_2107200"
                     /translation="MPFLFSYVCDLLQRLEDNQHARSGLRSNAAIIQEWFRAHQGLLH
                     RDDHNSAALLSALLPEKRTDRVYFIREKKLQIIIGRALGLGRSRIAQLGRWSNPDARI
                     DLAGCVEGILNETPNPISPAHRPVTVDEIDQLLHGVAANCRFSSPAVRSSAPENCPAH
                     KELALGELYKRLSARDAKWLTRLILKNYAPVILNEHVVYTSCHPLLPLILKVQDDFTV
                     AGRILDTQRRERTVTGSNDLAGYLKPTLGVKIGRQMWLKGRSIKHCLSMVQGRVSCEE
                     KIDGEYCQVHIDLSKGYDCIQIFSKSGKDSTKDRQALHDSIRKSLQLGQPSCPLKRGC
                     ILEGELVVYSDKHSKVLDFHKIRKHVSRSGSFLGTDKDSQPHPWEHLMIVYYDLLMVD
                     DESLLAVKHSERFQRLKKLITPVPGRSALVKREIIDCTRPSAVSDLRRAFAKCITARG
                     EGLVLKADDPYFDFGTLRRPYSCCPIKLKKEYIGNFGDIGDFAVVGARFDATKARTYT
                     NIPRLKWTHFYVGCLDNKEEVQRFGKRPRFVVTNVVELNAIQLETFTTSVNPDSVRPE
                     DNTAIDLRIEPGVDNGKRPSVIFPTPPVVDLRCFSFGKEGNTGFWSPRFPSVSKIHCD
                     RTYHDAISFAELQEMAAKEKEAPPPEDSQELLGWIAALEKSERKTAVDTTSQSTTSTN
                     TASMTPTPRDLDPSCRRDSPTPSPARRRSGQLTPPTSSAAQLSESTTGDGVNKQAGTA
                     PGRQRPFESSQQNSIPERSKIRRFSDDQDDDTLRGATSNPASFSSTQRRISLSRRNTE
                     AHMPMPTLASSDSMHQPGAENSQPGTTGPARPPIQSSVSFHEGPTCSFPAQSPPDSTN
                     SGPPTQVNTSQSPEESPAPSAGKCRYLGDACAFSTYSILLSPCIANFPWVTEDLLSCH
                     GVTEFLRDPKEWLADQAATSTTTPASSSSGIPGASLSAPAGQKGRRKRKIVLVDARRR
                     EATVAFLQLVEAAQLKRRSGEREYVPVYDWRVLEAVREEEQKLARSRERPRSRLDIIS
                     SSGVGRRFWVGLA"
     gene            2030934..2031689
                     /locus_tag="THITE_2107202"
                     /db_xref="GeneID:11521160"
     mRNA            join(2030934..2031399,2031459..2031689)
                     /locus_tag="THITE_2107202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649006.1"
                     /db_xref="GeneID:11521160"
     CDS             join(2031211..2031399,2031459..2031635)
                     /locus_tag="THITE_2107202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649054.1"
                     /db_xref="GeneID:11521160"
                     /db_xref="JGIDB:Thite2_2107202"
                     /translation="MPMSLFHALIRTHHITSRKKVALLRKAADKYECYALLRSGGCPG
                     IMYCKGSEEGVRDWVATVQRLRYKDFQLALKPAPIDPETSPLRERTGLFEVESVKEFA
                     AAMEKRGISEWWKRGMGFA"
     gene            complement(<2031774..>2032301)
                     /locus_tag="THITE_2035420"
                     /db_xref="GeneID:11517519"
     mRNA            complement(<2031774..>2032301)
                     /locus_tag="THITE_2035420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649007.1"
                     /db_xref="GeneID:11517519"
     CDS             complement(<2031774..>2032301)
                     /locus_tag="THITE_2035420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649055.1"
                     /db_xref="GeneID:11517519"
                     /db_xref="JGIDB:Thite2_2035420"
                     /translation="AAATTRVERIIARLPRPLQRYTARLRGAPLTHVAAFLVLHEITA
                     VVPLLGLFGLFHYTEHVPVAYMLAHYGAYVRDGLARFERYFRRKGWFGFGGAEGEEEE
                     EGGHGDGLGVTGRVERGREEGDGEKAVLERWEADPKYRVVVEVALAYALTKVLLPVRI
                     VASVWATPWFAGVLLR"
     gene            complement(<2033279..>2034637)
                     /locus_tag="THITE_2084224"
                     /db_xref="GeneID:11521183"
     mRNA            complement(join(<2033279..2033454,2033560..2033627,
                     2033706..2033789,2033863..2034101,2034257..2034355,
                     2034443..>2034637))
                     /locus_tag="THITE_2084224"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649008.1"
                     /db_xref="GeneID:11521183"
     CDS             complement(join(2033279..2033454,2033560..2033627,
                     2033706..2033789,2033863..2034101,2034257..2034355,
                     2034443..2034637))
                     /locus_tag="THITE_2084224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649056.1"
                     /db_xref="GeneID:11521183"
                     /db_xref="JGIDB:Thite2_2084224"
                     /translation="MPILPNLDQVAYMLEHIDDDLTPSIHISSAVTMAGATAAVILRF
                     LARRATESGFGKDDYCLFLGYFFYMSYMIALEYDTHWGFGRHVIVVTDARALVITSIL
                     LLYHRIFPSKTFRRALMVLGAFIFAWAMAAFFPSIFTCFPIESTWDFSIQGFCIDYGK
                     VTLVIGVFNIVIDFVILGYPMPMLWRLQMPKRRKTLLSLAFAAGSIACIVSIARLFYA
                     REVESTYDATWDSIYGAVLSGVEMCTAIVACCTVTYRPLIERVFDTGSTAKGSKASSG
                     RHGGKHARQG"
     gene            <2035503..>2036567
                     /locus_tag="THITE_2038437"
                     /db_xref="GeneID:11517218"
     mRNA            join(<2035503..2035771,2035895..>2036567)
                     /locus_tag="THITE_2038437"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649009.1"
                     /db_xref="GeneID:11517218"
     CDS             join(2035503..2035771,2035895..2036567)
                     /locus_tag="THITE_2038437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649057.1"
                     /db_xref="GeneID:11517218"
                     /db_xref="JGIDB:Thite2_2038437"
                     /translation="MRQYPLRVLGSDNKISWDGGSITIFPQFYPLRILDDMWRGVTVV
                     FAIPSLGIDSLGWWQNLSFLTDLGPVYAVWILESCRPASRWTLACLATTATFAAQFIG
                     IGTVGPIFYFLCFVLGPRARDLAHRPNRQLDPSKFALLLPLILSLHTLEIFGAYFSPD
                     PITRHYWVWAWQMSPLWIGVANFLSARAIGSWFRNSRLASPALLLQVLCIISAVVWLS
                     TLLFSPYPLADIFLPTRARQTDDFMHIRRAFQFDQVSSFTASFLWLAYLLLDMYSAGL
                     VGLSGFWPIAVLPIVLVSFGPGVAFALCWSWREAMFA"
     gene            complement(2039538..2040319)
                     /locus_tag="THITE_2107205"
                     /db_xref="GeneID:11515513"
     mRNA            complement(2039538..2040319)
                     /locus_tag="THITE_2107205"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649010.1"
                     /db_xref="GeneID:11515513"
     CDS             complement(2039623..2040114)
                     /locus_tag="THITE_2107205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649058.1"
                     /db_xref="GeneID:11515513"
                     /db_xref="JGIDB:Thite2_2107205"
                     /translation="MGESETAEATAPSAVREIQIRQDLAINKFGWAIRIPAGIDTSTA
                     ITLVTRVPTKVKSWRHEAEKLKEEGLAPWRTSLSLTPEERGENMSGVLASRCLLVGFA
                     LPELDKLYKSTSAPALQALAGTRPDHEPADIIPQSETMTPVMVVAPLPNLKETATGMC
                     HVR"
     gene            complement(2040413..2041670)
                     /locus_tag="THITE_126586"
                     /db_xref="GeneID:11523445"
     mRNA            complement(join(2040413..2040637,2040717..2040770,
                     2040885..2040950,2041005..2041049,2041113..2041171,
                     2041277..2041320,2041382..2041412,2041562..2041670))
                     /locus_tag="THITE_126586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649011.1"
                     /db_xref="GeneID:11523445"
     CDS             complement(join(2040498..2040637,2040717..2040770,
                     2040885..2040950,2041005..2041049,2041113..2041171,
                     2041277..2041320,2041382..2041412,2041562..2041581))
                     /locus_tag="THITE_126586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649059.1"
                     /db_xref="GeneID:11523445"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="JGIDB:Thite2_126586"
                     /translation="MSTTERTFIAVKPDGVQRGLVGNIIGRFEARGFKLVALKLVTPG
                     KEHLEKHYSDLSDKPFFKGLVEYMNSGPIVAMVWEGYDAVKTGRAMLGATNPLASAPG
                     TIRGDFALAVGRNVCHGSDSVESAKKEIALWFKEEELINWDIATKAWIYE"
     gene            2042421..2045815
                     /locus_tag="THITE_2107217"
                     /db_xref="GeneID:11517661"
     mRNA            join(2042421..2042784,2042846..2045815)
                     /locus_tag="THITE_2107217"
                     /product="glycoside hydrolase family 31 protein"
                     /transcript_id="XM_003649012.1"
                     /db_xref="GeneID:11517661"
     CDS             join(2042700..2042784,2042846..2045739)
                     /locus_tag="THITE_2107217"
                     /note="CAZy_ID 269689"
                     /codon_start=1
                     /product="glycoside hydrolase family 31 protein"
                     /protein_id="XP_003649060.1"
                     /db_xref="GeneID:11517661"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="JGIDB:Thite2_2107217"
                     /translation="MLAPAPLGSRWTAYLGLLSALSAAFVPAVAVKEHDFKKCHQSGF
                     CARNRAFADHALASSSWQSPYNIAPESGSFKDGQYQAVILKTINDSGETVRLPITVSF
                     LESGTARVTVDEEKRQKGEIELRHNSKARKERYNEAEKWVIVGGTALDKAAKVDYEDK
                     TQLTVKYGPAAKFEATIKFSPFAIDFKRDGHSQIKFNDQGLLNIEHWRPKIEKAEPEK
                     KEGETATEETKAEETKAEPQGEDESTWWDESFGGNTDTKPRGPESVALDISFVGYEHV
                     YGIPSHAGPLSLKQTRGGEGNYQEPYRLYNADVFEYILDSPMTLYGAIPFMQAHRKDS
                     SVGVFWLNAAETWIDITKSKDSTNPLALGAKSKTSTRTHWISESGLLDVFVFLGPTPK
                     DLTANYGELTGTTAMPQEFSLGYHQCRWNYISEEDVKDVDRKMDKFKMPYDVIWLDIE
                     YTDEKKYFTWDKHSFTDPIGMGKHLDSHGRKLVTIIDPHIKNVGDYPVVAELKSKDLA
                     VKNKEGSIFEGWCWPGSSHWIDAFNPAAREWWASLFKYDSFKGTMENTWIWNDMNEPS
                     VFNGPETTMPKDNLHFGNWEHRDVHNLNGMTFQNATYHALKSRKPGELRRPFVLTRAF
                     FAGSQRVGAMWTGDNQAAWDHLQASIPMILSQGISGFPFSGADVGGFFGNPEKELLTR
                     WYQAGAFYPFFRGHAHIDARRREPYLTGEPYNTIITAALRLRYSLLPSWYTAFRHAHL
                     DGTPIIKPMFYTHPSEEAGFAIDDQFFIGNTGLLAKPVTEKDKDTADIWIPDAEVYYD
                     YFTYDVIPTAKGKHVTLSAPLHKIPLLMRGGHVFARRDIPRRSSALMRWDNYTIIVTV
                     PKDGKRAEGDLYVDDGDSYDFQRGQYIHRRFVFDGAAKTLTSADAEGRESGAAAAAAQ
                     EGGEGEWMKKMRAVGVDKIVVVGAPAAWAGKKSVKVHSEGKTWEAHVEFTPATQGRAA
                     FAVVRKVGARIGADWTVDFA"
     gene            2046417..2047954
                     /locus_tag="THITE_2107221"
                     /db_xref="GeneID:11521181"
     mRNA            join(2046417..2046710,2046770..2047954)
                     /locus_tag="THITE_2107221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649013.1"
                     /db_xref="GeneID:11521181"
     CDS             2046816..2047847
                     /locus_tag="THITE_2107221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649061.1"
                     /db_xref="GeneID:11521181"
                     /db_xref="JGIDB:Thite2_2107221"
                     /translation="MKPTTLLTHLLTTTAASAATLPRALHPTHPRDAPQYRLLHTFSS
                     SAPSSSNAHLLSATNTESTKGGAILTLPSSSSSSNNNTSSARITSVQTTFRIPHAQPP
                     ATGPTANNPVGVYAASFWVGIDAAGAAASSSCSGGGAALRAGVDIFWDGTVGGEQTPF
                     AWYQFATAAAAAGQQGQQGSGTGFGQDGFAVAAGDVVRFTLSAGGTGGADGEQVVAVV
                     LAENFGANVSHADVVGRSASGGGGAKPVRSVKQVVTAPAGLCGQQAAWVVEDFPLEGR
                     PDVPVAFANFTSVTFDGAGVALADGSKKGVTEAAVLDVRLQAQGGKLTSCEVVDGQEV
                     KCTRVVGGN"
     gene            complement(<2048143..>2048786)
                     /locus_tag="THITE_2084231"
                     /db_xref="GeneID:11521201"
     mRNA            complement(join(<2048143..2048359,2048425..2048616,
                     2048680..>2048786))
                     /locus_tag="THITE_2084231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649014.1"
                     /db_xref="GeneID:11521201"
     CDS             complement(join(2048143..2048359,2048425..2048616,
                     2048680..2048786))
                     /locus_tag="THITE_2084231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649062.1"
                     /db_xref="GeneID:11521201"
                     /db_xref="JGIDB:Thite2_2084231"
                     /translation="MPLSPEEAREAANRLHDIELLRAERVVSHQEHDAARPPATVAVT
                     PLETTWLAKLRRRLTFPRILRYLVYTIPPGLLILIPVFLASVPMAARGTRLEAPAAVT
                     SIMPPVVTFAADTVGLCETQKGEGRWSPARVPHRFLFWLLAVFVSYHPILGSHRVLGD
                     HKSTDNSRSIQ"
     gene            <2049933..>2054240
                     /locus_tag="THITE_112492"
                     /db_xref="GeneID:11517054"
     mRNA            <2049933..>2054240
                     /locus_tag="THITE_112492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649015.1"
                     /db_xref="GeneID:11517054"
     CDS             2049933..>2054240
                     /locus_tag="THITE_112492"
                     /note="Contains conserved domain PRK05648[PRK05648], DNA
                     polymerase III subunits gamma and tau"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649063.1"
                     /db_xref="GeneID:11517054"
                     /db_xref="JGIDB:Thite2_112492"
                     /translation="MAALPENWEWDYDGTRWFYRYKPTGLIQYTFPKPGDEFPEFVDD
                     NAAPLDLAPEERLVSQQQIKRRSTLGGSWRGQPARAKQRERAVSNVSSDQDDGSEPFW
                     LQPDGLMYMGPGAYNDISPLQEEDEDERGQATNDADDGGDKKDSASAAAQHVADGPAA
                     AGSPSKGAAVAVPSQISPSTSTETTPQVPNSHPATATPQIDRAIIVESVDAAPAPVVA
                     APVDPPAPEIPLLDSREVPYDPLGFVAELPSELTAQCHVEINPAPVELPGNELMVDTS
                     EPAPYANAFHLEPAELPSDEIPAGRRVARNTAEQKSLSSQTTRSQQEQQQQRPHQTTR
                     ELLSRPYGAARQNSTPQVASTVAHMPGGGVAEPPPSGKYQPYNPARQGAFGAAAANRH
                     SIAEIRPLVPADDNNKRHSLAGPALSRVPPSDVPAALLPPHIPPKLPLDSPDSSRQSS
                     LPGAEARHESISGLTTKASGGLTHFPSVLQPARGRPVMRAQSPPQSKGASPARAYQAY
                     KPYHDLQRDIEDTVQLLSNAGFGQGTTTSAQASSVAARPQASRTNTLPAHLPSLPYMG
                     GYPHLPPSSASVPAPLTHLHSHQTPPAECGGCVATGGAAGSVMPLQYSAPLPPSSPDL
                     PPPLNISRKSPPLPSSVPTGFSAFRPEVTAKADAIFSGATAAPVHTTAASAPAPASLG
                     AEANPDRETMLAAPNSAGPAGQAGAASYPNQAGSSGPPPSAAAKVEGTASFNSLAASS
                     EKLQPSGHPSPAKPASFAVEAVGAAPVMPLPSEAAPVSDSGSSPAPLPADVLVTVTDQ
                     QPLAPSASDVGYQETRQSIPAQSDLVGPDNVHIPPHVVSEVHHKPPANPNMPLPTDGT
                     VQSASAVLYASPAPAATVASQVPFNSHTGGRGANPEMTPPRSVASPRAPTPSPRTPSP
                     LSRASSPPTQQNNIQKRIPSVSPPAIAMAGSAQQGSFTGQQTLLHKTGIHAPVVGLGP
                     APMPSSSSALPNASLAAPSTGPGHTFQTDHNSLGSYQVGVSQLSAPGAVSAAEHGYLP
                     THESGDCQRPAAQVHADNIEAAAAPNQQSQQPPQGVVAPVVSQSAMPNANPGLSTPLP
                     APAPTQEEAPSSPVSVADQEHKRTQPPMPSPMQAIGQTQLPLHSGGQLPSNVAAHGQP
                     SVAPTGRPFSPPATTQLGPLPHPGAPGTAPPQPPVMLASPTIPAGMVPQGVHPGMFLQ
                     QQYAYHPSVFPQPGMQVAQHQPVPPHLLQPGQMPMGAPLTQAPQPPQQPVKQEKSWFG
                     RLWRSESVKKPTKSGAAAQPGTPPQQLFPVFPPSVPPNQPAPPHQFALAAVQPHMAMM
                     TMNNQNYPSQPQFRAPNHNPNQPVMPPPQVRPAIQQQAQLLHHPAQRPSSIGPGQGQT
                     AQQEQSPVQPPAPAQAQGQTQPQGGTPVPVALPVQGQGQGQGQEQATGERHEGGGGYP
                     "
     gene            complement(2054575..2055879)
                     /locus_tag="THITE_2107226"
                     /db_xref="GeneID:11517666"
     mRNA            complement(2054575..2055879)
                     /locus_tag="THITE_2107226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649016.1"
                     /db_xref="GeneID:11517666"
     CDS             complement(2054734..2055855)
                     /locus_tag="THITE_2107226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649064.1"
                     /db_xref="GeneID:11517666"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="JGIDB:Thite2_2107226"
                     /translation="MPFSLTKDQYMVCINRACGHPPPGILDELPNLRTASFTDHPPSG
                     MAVPSRQAFQILGHFSEPLRWTFVAQEITEKRARPPASPRLTLSILRPLIELWIAFVA
                     FICSRAPAALRVATYLHLARIGNYLYGPTCGLGVQRLPFGLYLKKRSLEDYGTLKNEY
                     RALELVRRHTDVPVPRPLDLVSDDKRSYLLTSAVPGCHVGLRINNMSDEEVSSLVRDL
                     RRWLEHIRSIPKRVAPEYEISNAAGEGCYDFRILAGVDCPDTRGVIFGPYKNEDDFNS
                     ILQCGALPDVAHRAGHKIVFTHGDINMHNVMVKDGKLSGIVDWECAGWYPEYWEYTKA
                     HYVTKHHWHWRKMVDEAFRELGDYRDELATEKKLWEYCF"
     gene            2056754..2058560
                     /locus_tag="THITE_2107227"
                     /db_xref="GeneID:11515807"
     mRNA            2056754..2058560
                     /locus_tag="THITE_2107227"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649017.1"
                     /db_xref="GeneID:11515807"
     CDS             2056842..2058410
                     /locus_tag="THITE_2107227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649065.1"
                     /db_xref="GeneID:11515807"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="JGIDB:Thite2_2107227"
                     /translation="MAPTTRTCVSPFLDPGPRTKANSLAIVQLSRDNLLPVYLQVPNG
                     EHDGYAEGAVVNTRYGSFPHSTMLDVPWGSQIRASKVDTGSRGRKRKREADDQACREA
                     TAVSEKDEEPSAAGADRDGAAAVKQAVADSSGFVHILPPTPELWTTSLPHRTQVVYTP
                     DYSYILHRIRARPGSTLIEAGAGSGSFTHAAVRAVYNGYPAEGQRKGKVFSFEFHEQR
                     YQKMKKELSDHGLEGLVQLTHRDVYSGGFLVDGKSPEADAVFLDLPAPWEALPHLSRR
                     RPQDMADTDGAAAGNGQQSWVSPLNPRKSVYICTFSPCIEQVTRTVSAMRRLGWVDID
                     MVEIANRKLHASRDRVGLNLNFDRGVNNSPRDVEEALARLAEIEARSREQAAKPRDAD
                     ADEDMDLADEVGAPAKGNEARNGEHAPSTEETSTATAPWMEGRLITRGEPEIKSHTSY
                     LVFAVLPMEWTEQDEAAAAAKYPVGKEQKVIGAIDKAARKQERRELLQKQQGGASRKA
                     RRKERDEKLGEISG"
     gene            complement(<2059300..>2060862)
                     /locus_tag="THITE_120638"
                     /db_xref="GeneID:11515677"
     mRNA            complement(join(<2059300..2059342,2059422..2060050,
                     2060143..2060293,2060351..2060367,2060423..2060467,
                     2060534..2060602,2060698..>2060862))
                     /locus_tag="THITE_120638"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649018.1"
                     /db_xref="GeneID:11515677"
     CDS             complement(join(2059300..2059342,2059422..2060050,
                     2060143..2060293,2060351..2060367,2060423..2060467,
                     2060534..2060602,2060698..2060862))
                     /locus_tag="THITE_120638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649066.1"
                     /db_xref="GeneID:11515677"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="JGIDB:Thite2_120638"
                     /translation="MAHVAKIPVIDVSGDGDQAQVARELVDAAVEHGFVYIRNTGKDI
                     PVEAIDAAFEMSRRLFDAPLSEKQACTIQQNNRGWSAMNYETLDPANQRVGDFKEAFN
                     FGEFVDGKAQQPIPPTIAADEPQISAFRDLCYNLSLKLNTLLGIGLEVTPPDFFTAAH
                     LRARGPSGTILRFLRYPPRSDLSDTTAADVRAGAHSDYGSLTLLFRLRGQPGLEVLAR
                     DGVTWMPVPVVPPGTEHDPAPPILMNIGDLLSYWTNGLLRSTVHRVVFPGPAAGAAAS
                     SGGANGGEGEEGGAAGGGIGVRVEGEVDDGPRYSIAYFCHPFGGAELGPVPSERVKGY
                     KGGLAEGNPYAERRVLTADEHLQMRLRASYAQLYKGKE"
     gene            2061736..2064426
                     /locus_tag="THITE_2107232"
                     /db_xref="GeneID:11523471"
     mRNA            join(2061736..2062322,2062387..2064426)
                     /locus_tag="THITE_2107232"
                     /product="INO80 chromatin remodeling complex Ies1-like
                     protein"
                     /note="Has EST support"
                     /transcript_id="XM_003649019.1"
                     /db_xref="GeneID:11523471"
     CDS             join(2061824..2062322,2062387..2064062)
                     /locus_tag="THITE_2107232"
                     /note="1| INO80 chromatin remodeling complex Ies1
                     [Glomerella graminicola M1. 001]"
                     /codon_start=1
                     /product="INO80 chromatin remodeling complex Ies1-like
                     protein"
                     /protein_id="XP_003649067.1"
                     /db_xref="GeneID:11523471"
                     /db_xref="JGIDB:Thite2_2107232"
                     /translation="MAATPSSALMSDVEMPSSPFHAEKSFMTVHTEDDVSRAGVVTPE
                     PSGRQPRGKKRGRDDGQGTNGTTIGKIRHLKKEDGEPLWRKDIQYDFLKAIFDNEDKV
                     FTNSYEKDRLGKQCFADLYIDTMSRSSKTSKVLRDKLLSDRDAAKGMAMVCLLVNIGR
                     MNTTLNFFPEMRAQLRTYHAIPSLQARQDPHAYKQLQDAPRLKSILKGGCDDRPEPAS
                     LDEVKALNVPRTNPVNLLFLICHSAAKIAELHFPPGYEFYDLLMKTNFSSKSRARAFL
                     WLMWFYLESDFTEEGCEENPFGPGVDYGVDVANQGIPRLEFLTEEEEEQENVDTQEEI
                     EFGYAKQKMRAKIIEADQQFMAESQTKRGGGRGRGFPAGDEIGPTTGILPRIRPSKNE
                     SDLDSVRSTPPPRAFGRQSGVFGSTSRRGPHSLKYQVFDGSSPGGDRAIEGIVPRKPR
                     PPTAHQLAVERNRSQRVEYILDRGMRRTHHRARKLRRAEGAIIRALPRLAQMQNPFDD
                     SEEDEAVVHGNGKHSSSVANGDAKRLRERGYGGLAQLKDEADDFGEQVSSYAAAFRRA
                     ERRLARWESHNGPPLGVIAPVKRPRMRNGTGRGDEDDGEGDGEGEGEGEGSPSKEPID
                     PAETEDETEVMLHARRLQSSQPARRETNGVRHVDTNEDTPMDDADDLDDVDRELLGLG
                     DGDGDEVEGEGENEGEGDGEGEDELDEVDKTLLGMDGDSDSE"
     gene            complement(2064306..2067620)
                     /locus_tag="THITE_2107235"
                     /db_xref="GeneID:11523520"
     mRNA            complement(join(2064306..2065752,2065804..2065960,
                     2066007..2067620))
                     /locus_tag="THITE_2107235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649020.1"
                     /db_xref="GeneID:11523520"
     CDS             complement(join(2064549..2065752,2065804..2065960,
                     2066007..2067516))
                     /locus_tag="THITE_2107235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649068.1"
                     /db_xref="GeneID:11523520"
                     /db_xref="InterPro:IPR013244"
                     /db_xref="JGIDB:Thite2_2107235"
                     /translation="MSLLLSPAKLVLLAVHLAVNGDVASLATLAARHSTILRKDLLLR
                     ILLTYLPETLPSTQYVNFVQQLEQGVFSDTAGQEVDCSSVANLEEDEAARKVKKLRLL
                     PLALPDLPVEAAEDVLTQFLLHRAYKVDEEAGLLDELPALLLPFLEHSPCIRNLLVSA
                     ILPLLRRNCEYYPHDPIPYTLHAFQQLPDRVAVSLLLSQTGKWDADLPSVGRDLRGLI
                     GPWLSEERRWKQGNDAAEPPGESLSGAADGALCPGWEEVLHWLITHASKNWKVAVHAV
                     QQWDGPTDVDLGGWSSLGLGDPQIDQLRQSYARAALASAYLIPEASLEALEGAYSVVA
                     KVANLRGLEPVSTLASALAVLPPLAEQIPDEIMTAKTATYMRNDLLIPSNILTTPTDA
                     SVAFLQALALSAHILTRVGCPCTLRRAGELALLQDEREQKAEATKLIHILSNNGPKTD
                     DKFWVKARNEILWLRDWGAEDGWSTDAVPRGVFSQVKRDFLELEILKALLSNTRYPLA
                     RSIYEDAPDRPLDKKLLQDTIYATALAAYDNASNPNRTRGGLKKCDDIIKAFPKTVRA
                     SDSQAKRIEALLQATHSLSDHRLVLKQGEPFTPVVLRVHSDPISIIAKILEQNPKSYT
                     QLHDLLRLGALMVEAGLTTREKGHITAEQETSERASTEHRITAICINAALAEDDFETA
                     YSYVVNRLSPRSSTTVAPRDDFAWRAALQAGKYRRTARTLPPTHLGTASANADVRHLE
                     QRIECLATALRIAPPATLHEIVNAFRRAEEELEAALREEALREDEWDARGDAIRATGI
                     GASAKTATVPGAAFATAAATTQAAPPQRHQRQRDADEDAAPMSLFDLSRATVLSAQRN
                     LSALSGLQRSAGFGRLGGGGRSSGGGGDAGGRSSLDQRPLSAAGSAASAGSGGGGGGD
                     GEDTTKRVRKRDQLREAAMGTLVSGVGWLVGAPPPSSMQSRE"
     gene            2069774..2070377
                     /locus_tag="THITE_2107238"
                     /db_xref="GeneID:11515811"
     mRNA            join(2069774..2069903,2070003..2070142,2070222..2070377)
                     /locus_tag="THITE_2107238"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649021.1"
                     /db_xref="GeneID:11515811"
     CDS             join(2069876..2069903,2070003..2070142,2070222..2070368)
                     /locus_tag="THITE_2107238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649069.1"
                     /db_xref="GeneID:11515811"
                     /db_xref="JGIDB:Thite2_2107238"
                     /translation="MASGYGLNGGPSRCFPFWQELLSCYVVNSSDDDDSGKKKCVPAM
                     EDYYECLHHRKEAARVKVLQAAYRQAEAKKLQENPPTAGQIRNLGLLDKEDDTKKVLG
                     TS"
     gene            2070420..2072809
                     /locus_tag="THITE_2107242"
                     /db_xref="GeneID:11515602"
     mRNA            join(2070420..2070458,2070728..2071023,2071090..2071435,
                     2071510..2072809)
                     /locus_tag="THITE_2107242"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649022.1"
                     /db_xref="GeneID:11515602"
     CDS             join(2070852..2071023,2071090..2071435,2071510..2072671)
                     /locus_tag="THITE_2107242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649070.1"
                     /db_xref="GeneID:11515602"
                     /db_xref="JGIDB:Thite2_2107242"
                     /translation="MPCLRGIEVFLTTKPDDERIPEYPHHDGAYARILENTRGSPNRR
                     TGPTVSVYIPSIPATPFAVNYNVNNAPLAPCKYIFFRLYMNGRPIAAWGIDPKARPSG
                     KVVKSLWAPCALYDDQVGFEGRNFVFLPGQEHKSVAEDGGLIEIQVFRAKERRARAPR
                     VEEFRFQDNYGIAAPSIGLLDQPQDACFYDWHLLDAKDAPFASFRLHYRSLKNLQELN
                     LIPATELELLCSLSPKALRSIAEANHSSKGSDNGSEPPSYRSRTSDEAVFHDCGENLA
                     AGEQGRDGATQYSLKTPPELFPAVPASFRVPQPSKALRDASGESYLQRPLPELPVEEP
                     RRFSRPSSVGSAGSATFSITPSLLQEVEEGRLYSGDVEVGIARLVQLPPSNSTLSTNP
                     DDEPHPADYSISDYDASSNSATDSFSDAKLSPGRYLPTTGSVLERGIALFSSPKKTTS
                     PEASISRQSSPCDFYSKQDLFPLERMTLSESEWINRSPSPARMRAATLAARRDDSPGT
                     DRGGGGSLFARLRKKSFKGSPRKLLGEVLGHDVPKSGERGNAVQRGMGDRN"
     gene            complement(<2072947..>2074158)
                     /locus_tag="THITE_2038515"
                     /db_xref="GeneID:11523542"
     mRNA            complement(join(<2072947..2073297,2073364..2073843,
                     2074096..>2074158))
                     /locus_tag="THITE_2038515"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649023.1"
                     /db_xref="GeneID:11523542"
     CDS             complement(join(2072947..2073297,2073364..2073843,
                     2074096..2074158))
                     /locus_tag="THITE_2038515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649071.1"
                     /db_xref="GeneID:11523542"
                     /db_xref="JGIDB:Thite2_2038515"
                     /translation="MSKQKQSHIERTANEPRDEVGFLPGQWVDLYPPPHTGIKKPGGF
                     TITSSPSLAVARRPPAATHRHSPDDEAQPEPTTAASPSPAYLELAIQSSPTNPPAAYL
                     FQPAAELLRNEVRVRIGGSFVFPPPAAALAPPPLRKAVFVAGGMGINPLMSMLSFIGE
                     QRDRWAGLEVRVLYSVRDPRHASEILFLERIVGLFESGSVKGGLRLFLTGGTAPSSVQ
                     DGNTRGEKDVVRCNNGAKVPFLRRRMSVSDVEQAVGEDKEAAVVYICGVPLMTDQFVE
                     ALVSPAGLGMQQKRVLFEKWW"
     gene            2075088..2078969
                     /locus_tag="THITE_2107246"
                     /db_xref="GeneID:11515403"
     mRNA            join(2075088..2075308,2075365..2075544,2075603..2076720,
                     2076780..2078969)
                     /locus_tag="THITE_2107246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649024.1"
                     /db_xref="GeneID:11515403"
     CDS             join(2075524..2075544,2075603..2076720,2076780..2078838)
                     /locus_tag="THITE_2107246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649072.1"
                     /db_xref="GeneID:11515403"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="JGIDB:Thite2_2107246"
                     /translation="MPPPFPRKPFAPRTHLDTLNSGPSSSPAVQQTGTTDAPTQPSPP
                     KRQKLYTSARLIVPDEEIIDIDQDVTSRTERHESQSSLVHSGSPGVSEFQTVEALSQS
                     NPGRSNRRSRRSQAGRPANMTELTRQAGRFDTPELIESFDELAPAQKPAPGRQRTARL
                     VSAAGTRPSTLVRDPADEFILGKSTQTGKQSHGLTQGKKRPRCEIADDRDELGEESNS
                     KGASQASTRPSNEDSPRHGAPSLSRRGDINATRWENKQGTRAAAMGVRVEAAVCQPNL
                     RYAASEGQGSCFLRQAEGAELLAFTEDGKLAEPHRWLKITGKAKTLTYHPQSNYIKVT
                     QSMDQASSTPIGGLMILQLSSNADASWVAGRAGKSLGIQVLQERESRKLGVMFEKANQ
                     DVARARMASSGTKLSDDAPDPAPQTIEKFETANIVRSNSRPLIRHQMQASAKDQNSSS
                     SRVEPMDARISSGSHSLRTRQIAGSVQRAMTPLEPVIRRWSQENPQWSENWKIPLVFN
                     RTTVNKEDIPRLDEGECLNDNLIGFGLRYLFDKFGSRHQDLNKRVYLHNSFFYEKLKA
                     GRGAINYDGVKSWTAKVDLLSYDYIVVPVNEHFHWWVAIICNPGKLDPDWRGTSDKTE
                     GGASSGIASRADRESSDEEMTDGFEKRPTDAPSEAAPTEEPILVTSDIVDLDSRDMNS
                     GKNSSSNAGENQTRKPKAGTRTYRLEDPRIITLDSLGSSHPQAIAHLKKYLLAEFEHK
                     RNKVISNTPPQLGMRANNIPEQNNFCDCGVYLLGYIQEFVKDPDRFIQTLLQKERPDW
                     EFSPSALRALWRDTILFDQKMYQKEQLKEKRKRREASAAKSTPKGSAEPSSNPSREAS
                     EIANSSTSMQTARDDSPERPASTTTAAACGTEIEPAPRDQRDTVSAHSPSTASAPIRV
                     SPKQSPRQDGCVDDVVPNPPKEDIAILPSIESPEVEAVPRSSPERRDDPHFIEQLSSS
                     SSAESDEDGDHIAEVDAKSFYKSTPARSTNQGRKRTTLSSPAVGRQQPRGQLVKTRAA
                     HTGSLFVLDGTRKLSSSPVVAKAELVRHSDHIDLT"
     gene            complement(2079431..>2081411)
                     /locus_tag="THITE_2073591"
                     /db_xref="GeneID:11521377"
     mRNA            complement(join(2079431..2080859,2080983..>2081411))
                     /locus_tag="THITE_2073591"
                     /product="rRNA processing protein RRP9"
                     /transcript_id="XM_003649025.1"
                     /db_xref="GeneID:11521377"
     CDS             complement(join(2079582..2080859,2080983..2081411))
                     /locus_tag="THITE_2073591"
                     /codon_start=1
                     /product="rRNA processing protein RRP9"
                     /protein_id="XP_003649073.1"
                     /db_xref="GeneID:11521377"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2073591"
                     /translation="MSSFFTAPGAQKKRKRPSAAETPKKRLATSKSASQSASKPSAKP
                     AAASKKKAVERDESISGSDLESDESGDDVRDIERSEGDSDESDNEGETAAEKRLRLAQ
                     RYLEKTRKEVELDEYAFDAEEIDRDLLAERLQEDVAEAKGKDGYLTKWRLQDLPKDQW
                     PQTTRRKPKKPPAPPKRRPERVCSAKANPGKTKDKTYQGHTGAPITVKASQDGKYVVT
                     GGVDRRLVVYNASDLKPIRAFTQHRDAVTGLAFRRGTNQLFSCSKDRTVKLWSLDELA
                     YVETLYGHQDEVLDVDALAQERCVSVGARDRTARYWKVADQTHLIFRGGGEGGSSGGS
                     SSKKHKLPPGVDPASAAHQGSMDRVSMIDDDMFVTGSDNGDLALWSLQRKKPLHTVPR
                     AHGIEPPLKPSEASADEVPDPKIIPAPQPRGITALRTIPYSDVILTGSWDGCIRVWRL
                     SEDKKKIEPVGVLGGSSSTSTMPNGTHVQVGQGQVQNRDIVRGIVNDIAMFERGDRGR
                     DGLCVVAVTGKEMRHGRWKYMKEGRCGAVIFEVPKLDSRKQQQDGGDRVNGRSPETEA
                     DD"
     gene            2081752..2083038
                     /locus_tag="THITE_2107253"
                     /db_xref="GeneID:11521177"
     mRNA            join(2081752..2081876,2081931..2082088,2082150..2082399,
                     2082464..2083038)
                     /locus_tag="THITE_2107253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649026.1"
                     /db_xref="GeneID:11521177"
     CDS             join(2081875..2081876,2081931..2082088,2082150..2082399,
                     2082464..2082665)
                     /locus_tag="THITE_2107253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649074.1"
                     /db_xref="GeneID:11521177"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="JGIDB:Thite2_2107253"
                     /translation="MEVLLGITGKDFTLIAASKAAMRGATILKASDDKTRQLNKHTLM
                     AFSGEAGDTVQFAEYIQANAQLYSMRNETDLSPSALAHFVRGELASSLRSRKPYNVNL
                     LLGGVDPITHKPSLYWLDYLAALAPVPYAAHGYAQYYCLSILDKHHHPDITLVQGMKI
                     LTLCTDELKRRLPIDFKGMVVKAVTKDGIIDMGFDDDKVVKSA"
     gene            2084255..2086931
                     /locus_tag="THITE_2107255"
                     /db_xref="GeneID:11515402"
     mRNA            join(2084255..2084682,2084762..2086628,2086719..2086931)
                     /locus_tag="THITE_2107255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649027.1"
                     /db_xref="GeneID:11515402"
     CDS             join(2084456..2084682,2084762..2086535)
                     /locus_tag="THITE_2107255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649075.1"
                     /db_xref="GeneID:11515402"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2107255"
                     /translation="MADQLSGSMGNLSLDSAPPAAQLSNQQPVTRSYIPPHLRAKMAA
                     ANAPPANGPPMGPGPMNGPGPVNGLNNSAWAGNNNFDVRAGGGNWGAYDQSPHPWGGR
                     QGGFNRNAYRGPASGGGGAMGGGAGRGEGRWIDGKHVIGSGDPRLERELFGTADDPSK
                     QHTGINFEKYDDIPVTPSGRDVPEPILTFSNPPLDPHLLSNIELARYKIPTPVQKYSI
                     PIVINGRDLMACAQTGSGKTGGFLFPILHQSFTQGPSPVPAQGGGYGRQRKAYPTALI
                     LAPTRELVSQIYDEARKFAYRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVD
                     LIERGRISLCNIKYLVLDEADRMLDMGFEPQIRRIVQGEDMPPTGQRQTLMFSATFPR
                     DIQMLAQDFLSDYVFLSVGRVGSTSENITQKIEYVEDIDKRSVLLDILHTHAGGLTLI
                     FVETKRMADSLSDFLINQNFPATSIHGDRTQRERERALELFRNGKCPILVATAVAARG
                     LDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGIATAFFNRGNRGIVRELIDLLKE
                     ANQEIPSFLETIARESSYGGGRGGRGGGRGRGRGGNTDFRKYGGGGGGFGGGFGGPQH
                     SSGGGGGYGGYGGPQSGGYGGGYGGYGGGYGNPGGAGGQSWW"
     gene            complement(2088115..2090011)
                     /locus_tag="THITE_2107259"
                     /db_xref="GeneID:11521143"
     mRNA            complement(2088115..2090011)
                     /locus_tag="THITE_2107259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649028.1"
                     /db_xref="GeneID:11521143"
     CDS             complement(2088284..2089894)
                     /locus_tag="THITE_2107259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649076.1"
                     /db_xref="GeneID:11521143"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="JGIDB:Thite2_2107259"
                     /translation="MVRRKLAIEAPEPRVSRKRELPNDPYEVPDEADTPKRRRRRLEP
                     KSTVHSGINGEIDWDNDDVGERSAVVQESPTKRRGRPPKSAATATPNGQTATPSTRGQ
                     RIFAETPLKPRPDGIDTPSRRTIADRSARKKSARALIDRVIGGAVSDDEVEEDIAREI
                     YESSANEEEDAEEDEQGDQDEGQHPTTPSKSPGRKRRAHPRKRSPTPPRELPPHEQYF
                     YQNKPGLAKTSNNTLSTLDLLTHDEYFSVLRQLQDPHAADVDFLQSLHAQSFPQWAFE
                     LSQGFSTCLYGYGSKRRLLHNFATYLSSQHPTHRIVIINGYVRTLTARDILSTLATAL
                     PSSPASSNSTNSGGGGAPHPSSTVGALLTHLSSTPITLTILINSIDGPPLRKPALQSL
                     LSHLAAHPQIRLACTADTPDFPLLWDAGQRAAFNFLFHDCTTFAAFAPCELEVVDEVH
                     ELLGRRARRAGGKEGVVFVLRSLPENARALFRLLAGEVLVAMDEQGGAAAAAGGEEVG
                     VEYRMVYNRAVEEFICSSEMAFRTLLKE"
     gene            2090048..2091410
                     /locus_tag="THITE_2107261"
                     /db_xref="GeneID:11517504"
     mRNA            join(2090048..2090530,2090710..2091048,2091111..2091410)
                     /locus_tag="THITE_2107261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649029.1"
                     /db_xref="GeneID:11517504"
     CDS             join(2090309..2090530,2090710..2091048,2091111..2091194)
                     /locus_tag="THITE_2107261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649077.1"
                     /db_xref="GeneID:11517504"
                     /db_xref="JGIDB:Thite2_2107261"
                     /translation="MNLNLSASLNVFKLLAKPSLCLPHATVSTFDDLPIPLDKAFATK
                     GRLVDIRAVVLDKDDCFALPDHSEVYEPYKVRFEALRAAYPGHRLLIVSNTAGARSYD
                     VDGRLASEVKESTGVEVLPHAVKKPGCGNEILSYFRDHPETGVTGPHQIAIVGDRLAT
                     DMMLANMMGSWGVWVKDGVVPLQRKSIFSKIERRLGPFLLSRGYLPREPTSPFE"
     gene            2091411..2092746
                     /locus_tag="THITE_2107265"
                     /db_xref="GeneID:11523469"
     mRNA            join(2091411..2092028,2092092..2092172,2092240..2092746)
                     /locus_tag="THITE_2107265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649030.1"
                     /db_xref="GeneID:11523469"
     CDS             join(2091842..2092028,2092092..2092172,2092240..2092652)
                     /locus_tag="THITE_2107265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649078.1"
                     /db_xref="GeneID:11523469"
                     /db_xref="JGIDB:Thite2_2107265"
                     /translation="MGGTNWTREEEIIFWLKLIPRSPKRLGQDITKNEEHSWGWVAQQ
                     MTKMMAGKTTREYTEQCVLEHYFQNCCGARFSPNAGKLPKKYWLHERDRRAAKAKAQA
                     EAAAVKRNKASKKDPVAAANRDGPNAQTATGSQQAPIKIDDDCQYPNPRSHHAQLPSG
                     RFTVPPSPSSRFASRGSLPAQYYPDRSLANHGRAENAEAVEDGLFVAQPAASWVDTEA
                     FRASNHRQ"
     gene            complement(2094456..2096475)
                     /locus_tag="THITE_2107269"
                     /db_xref="GeneID:11515308"
     mRNA            complement(join(2094456..2094847,2094911..2095330,
                     2095401..2095576,2095642..2095679,2095738..2095890,
                     2095957..2096042,2096105..2096139,2096221..2096475))
                     /locus_tag="THITE_2107269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649031.1"
                     /db_xref="GeneID:11515308"
     CDS             complement(join(2094811..2094847,2094911..2095330,
                     2095401..2095576,2095642..2095679,2095738..2095890,
                     2095957..2096042,2096105..2096139,2096221..2096259))
                     /locus_tag="THITE_2107269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649079.1"
                     /db_xref="GeneID:11515308"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_2107269"
                     /translation="MTELAEPHIEVDTANDHDSVISDDISAFTTSITSSILDYPVENG
                     RRYHAFRAGVYCLPNDELEQDRLDLSHALMTKGIGNKLFLAPIDTDKMHRVLDIGTGT
                     GIWSMAMGDEYPNAQILGNDLSAIQPPWVPPNVKFEIDDVECPWVYEAPFDFIFCRYM
                     AACIKDWPTLVRSVHDNLTPGGWAEFQDFDLQYYSEDGSLKEGSHTLTWINTLLEAAR
                     KTGREPSPGPRLEGWVRDAGFTNVTHQRFRFPIGPWAKDPHLKEVGLYNIQQVLSGLE
                     AFSLRLFCHVLGWPKDEVLVLLSKVRNELKNPNLHAQFDFHVVYGQKKQAE"
     gene            <2098385..>2100460
                     /locus_tag="THITE_2040054"
                     /db_xref="GeneID:11521109"
     mRNA            join(<2098385..2098502,2098584..>2100460)
                     /locus_tag="THITE_2040054"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649032.1"
                     /db_xref="GeneID:11521109"
     CDS             join(2098385..2098502,2098584..2100460)
                     /locus_tag="THITE_2040054"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649080.1"
                     /db_xref="GeneID:11521109"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011717"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="JGIDB:Thite2_2040054"
                     /translation="MASSQPNMERFLRDWRQDALNKAQYDAAIFIGDKLLALTKDDKD
                     AFWLAQVHFNAGNYTRSHDLLISHNLIGSNPSCRYLAAHCLIRQNNFAEALALLGEAT
                     PTHLFTTNANANAKRKTSRTTTRGTRAGSKAPERQPDEVSEEEWSIRRYEAGMCYLRG
                     LCYAKENAFDRAKEAYKNALRIDVQCYEAFTQLVRNSLMSPDEEDEFMQSLDFGSVRA
                     PKGGDDPELQTEPGDYVHMLYQTQLSKYRNPRAFNVAVDSLSTHYGLADNPDILLARA
                     EQLYTQCRFKDALAITTMILKEDRSNFPAYPVHLACLYELKQTNELFLVAHDLADNYP
                     DKACTWLAVGTYYLATSKIADARRYFSKSSMMDATFGPAWIGFAHTFAAEGEHDQAIT
                     AYSTAARLFTGTHLPHLFLGMQNHAMNNMTAAEEFLKSAFSLCRTDPLLLNEMGIVLY
                     HQDRLKEATRLFRQALRVADDTGADPHAWLGVRTNLAHAYRRLRLFDEALAEFDAVLR
                     DGGKDAAVLCAKALIRLDQGRPDDAARVLHEALAVNPQDPIATELLNKALEESSAGGL
                     MGALRAGLDPADGGEEVEDVGIAEMERFELELEEKKAAARARLERRTRGRAAATSSSS
                     SGDKGKGVMRGNARGGGRRGGGGYGADEKAESMMEMSDDG"
     gene            complement(2100655..2103530)
                     /locus_tag="THITE_2107278"
                     /db_xref="GeneID:11517053"
     mRNA            complement(join(2100655..2101008,2101076..2102413,
                     2102484..2103005,2103087..2103165,2103275..2103530))
                     /locus_tag="THITE_2107278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649033.1"
                     /db_xref="GeneID:11517053"
     CDS             complement(join(2100850..2101008,2101076..2102413,
                     2102484..2103005,2103087..2103165,2103275..2103321))
                     /locus_tag="THITE_2107278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649081.1"
                     /db_xref="GeneID:11517053"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2107278"
                     /translation="MAVNAQQAASLPRKLWEHPHPESTLMYRFMQDLNRKHGLHLKTF
                     ADLHNFSLTNRTAFWSHLFEAARFIHEGTYSTVVDESAPIDAVPRWFDGVRLNFAENV
                     LFSRPDTGADTSTAARGVKDKEDGRVAITEVREGASEVRTVTYGELRATVGALARAMK
                     ARGVGKGDRVVIVGANSVETAAVWFATTWLGAVFSSSSTDMGVKGILQRVVQVNPKLL
                     FMDDAALYNGKVVDLRGKMAEVVEGLRECSEFSGVVAIRRFAEARDVSRVPLAETWES
                     FITAAGGNTSLPQVVRIGFHEPFLICYSSGTTGTPKAIVHSVGGVLINYYKEGRLHEG
                     LGPHTVALQYTTTGWIMYLAAIGALLYGGRTVLYDGSPFQPDASILIRIAAEQRVTKL
                     GVSPRWMFEVAKAGLRPREMAGLSSLETVTCTGMVLSNQLFEWFYDVGFPSHVHLANI
                     SGGTDIAGCFGIMNPLTPVYVGGTQGPSLGVHVAIYDSLLPDGVEGKEVPHGTPGELV
                     ATAPFPNIPCFLWGDKTPAGGGSPAAPGTKYHAAYFARFKHVWAHGDFCVVHPVTGNI
                     TFLGRADGVLNPSGVRFGSAEIYSVIERHFADRVQDSLCVGQRRPQDNDEAVMLFLLM
                     KPGARFDRALVNDVREAIARDLSKRHVPKYIFETPEIPTTINLKKVELPVKQIVSGHV
                     IKPSGTLANPQSLEYYYQFAKVEELVGPREKL"
     gene            complement(2104039..2115868)
                     /locus_tag="THITE_2107280"
                     /db_xref="GeneID:11515391"
     mRNA            complement(join(2104039..2104905,2104973..2106128,
                     2106195..2115868))
                     /locus_tag="THITE_2107280"
                     /product="TRA1-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003649034.1"
                     /db_xref="GeneID:11515391"
     CDS             complement(join(2104219..2104905,2104973..2106128,
                     2106195..2115832))
                     /locus_tag="THITE_2107280"
                     /codon_start=1
                     /product="TRA1-like protein"
                     /protein_id="XP_003649082.1"
                     /db_xref="GeneID:11515391"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="JGIDB:Thite2_2107280"
                     /translation="MVLIAELRLKVEAACALRDSLDHYTTGAGYPVFLKRVMPTFVNI
                     LRQPCVLQTTTAEQINAQKLRNCVLEIFHRLPTSQVSPEPFEPYAEEVVDLLMHLVRN
                     DNEDNAVLCIKVISDIMRHQHKIMGNKVQPFLSLIQELFEQLERIVREQLDSTSVPGP
                     LGAPSTPSSTQTTFMPHQQSPKPGSPVATGAPDFNVNVEGGQQTNRTLLKGMQSFKVL
                     AECPIIVVSIFQVYRSTVAQNVKAFVPLIKSALLCQAKAQDQAHKDAAARHTIHIGVS
                     PNIKNRAAFGDFITAQVKTMSFLAYLLRQYSGQLTDFLPSLPEITVRLLRDCPREKSG
                     ARKELLVAIRHIINFNFRKIFLPKIDDLLDERTLIGDGLTVHETMRPLAYSMLADLIH
                     HVRESLSPEQIRKTVEVYTRNLQDNFPGTSFQTMSAKLLLNMAEFIARMPNKVDARHY
                     LIMILHAIADKFAAMNRQYPNAVKLSKLYAQQAADKSPETYLPDKEHPPEWDEVDIFN
                     AMPIKASNPRDRVADPVVDNKFLFRNLMNGLKNTFYQLKSCNQPGAVDLTGAPAHWTD
                     VAYGFTAEEVKVIIKLFREGAYVFRYYEMEKPASESPYSSPVEYMANFYMVSSSKEEK
                     ELLETFATVFHCIDPATFHEVFLQEIPRLYEMIHEHTALLHIPQFFLASEATSPSFCG
                     MLLRFLMEHIEDVGSADIKRSSILLRLFKLAFMAVTLFASQNEQVLLPHVVDIVTKSI
                     ELSAKAEEPLNYFLLLRSLFRSIGGGKFEHLYKQILPLLEMLLDVLNNLLLAARKPAE
                     RDLYVELCLTVPARLSNLLPHLSFLMRPLVVALRANTDLVGQGLRTLELCVDNLTADY
                     LDPIMAPVIDELMTALFDHLKPHPYNHFHAHTTLRILGKLGGRNRKFMTDALPVTFEQ
                     YADDRSSFDVRLIGSKRDRAFPAHLGIDLAIQKLMEVPKPSKGPTPPPSKQYDAYYKR
                     QALNLIMSQVKLRVGFDTLPDDLPRLVRLQVQDLIAGNTDADIAPFEASDRERSIAKK
                     NDEERLLKRLIKALLFAQSIPDFKAEVDALLLNLARHFTIIEVGRALVDMKKLKAPFD
                     TKAGEGPLFVDNRVLSEAILESMASENPDVRDAAERLIKEMYDSAVTIFGSPTHVARL
                     SLFDSLASTFCHGCYEEEWFTKAGGTLGIKALLQNFELGDSWLAGQHIEFVRALMYVI
                     KDMPQDLPEKTRRSAQVTLELLLTRLAKNTQKSDWLPPPAPGPAQAPGPAPPPTEKEF
                     RRPQIVVMLNGELSHMNRHVRNTAKRSLELIAKSAGAEVWELLEPHRKHVLQPIYAKP
                     LRALPFAIQIGFIDAVTYYMSLKRDFVAFDENLNRLLMESLALADASDESLAGKTLEF
                     RTHDFIVNLRVSCIRILSCAMGFDEFGSGPNNPTRIKVVSVFFKCLYSDSRPTIEAAN
                     DALKAVLQHTSKLPKDLLQSGLRPVLGSLQDPKRLTVQSLENLGRLLRLLTTYFKVEI
                     GTRLLDHVKSIAEPNFLQQVSFTFFEQHNSLKVIAAVFNIFHLLPEAAKQFKERVIDN
                     VLDLERQLRRTHHSPFRLPLYKYLNKFPSDVWAFILGKLEELRYGRFMAQVLRHQDSQ
                     VLRDYGAANVEVIIKTCNNLVSRGEEAKYIAVINTINMLDALCQFPNTLSWLDNKEHI
                     DWLKQVGKELERNLRMNTLAPSLRLPAYQASEQLMNILVEALARNPQDLEPLFGLVES
                     VTADEFRETPVLLSHIYKHIICSDSIEFWRTVVLRCLEIYAGKSASQRTKWYLLHNIV
                     NPIVAMDVMRHWNRGEQNKGQRFLDKTVIDSINTKIWKVNLPDPQEDLLQPRIDHTRM
                     EVLQLSAMLVKYHHAILQDARKDFIKFGWTYIRLDDVINKHAAYVVIGYFIAHYETPA
                     KIVTQIYFSLLKTNQNEGRSLVTQALELMAPVMPKRCNAPLTDRNPIWAVAPRRILAE
                     ESQNVQQMTCIFHFLVRHPDLFYHTRDKFAMLIIQCLRKVASPPNPSNESRKLALNMM
                     WLIWQWEQRRVEGKVSEPLRAPSESPNTKKRKLEETPQGSSPAAVRQPEKPEFQIPPM
                     GRHKMIKYLVEFIAQLNERYPLPSAKPRDPATPMLPMTSPELCKKALTLLYNLLQPQY
                     WGDLDVDLFPNVTDVVLASEKSAALLTADPSDTDKYDDKFITNIINTLQVVRIILNFK
                     SDEWILKNMGQIQKILEKCLRSENPEIQDCLHMADRKYDGDRDIKPIVKRILDAVPED
                     LPMEDADADGEAEAQTSEIIMFLSSIATESMAASNYVSGINILWSLGRRKPSTIDQHI
                     PAIMKSLQSKLARDHVSHYAALAHQASGVRPQQDPNAPTEMNAYDLEIQTGLILKAIE
                     VTVMRMEILGDNRRPFLSVLATIVEKSLHLTLGEKILEIVEGWVFRSEGTWPTLKEKT
                     AVLHKMISFEHRQDPAMLMKFLDLVLRIYEDPKIMRTELTVRMEHAFLIGTRAQDVEM
                     RNKFMAIFDRSLPKTASARLAYVLLSQNWDTLADSYWLAQASQLLLGGVDMHPIIQLH
                     PEDFRVPQISQLFGIYSKDTREPANMSDDKYESFMANHRRFVAELGDIRVRDILEPLT
                     QLQHIDPSFAHELWVALFPMFWSATAKEDRPELERGMVTLLTKDYHSRQMDKRPNVVQ
                     SLVTGAVKTWPHCKIPPHVLKFEAKIYDVWYPALCQLENAALKPEIDSAAVRESNLDA
                     LVDLYASLGEDDLFYGTWRRRCQFVETNAALSYEQHGMWEKAQRMYETAQIKARTGVI
                     PFSESEYMLWEDHWVLCAQKLQQWEILQDFAKHENFQDLLLECAWRNPEYWQNQDNRE
                     QLDTLIKGVMDAPTPRRCFFQAFMSLLKLHNKQETMQDFNRVVDEAIQLSIRKWHQLP
                     KRLTSAHVPLLQNFQQLVELHDASVICQSLASTNASNLDVKSGELKLLLGSWRDRLPN
                     MWDDIVSWQDLVTWRQHIFGLINGTYLQLLPQQPQNTGGASFAYRGYHETAWIINRFA
                     HVARKHALPDVCISQLSRIYTLPNIEIQEAFLKLREQARCHYQNPEELSSGLDVINNT
                     NLNYFSAPQKAEFYTLKGMFLEKLGQKDEADSAYGTALYFDITAAKAWAEWGYFNDRK
                     FKENPADLGAAKQALTSYLQAASSYKNHKSRKLIARILWLLSLDDANGTIAAGFDDFK
                     GEIAVWWWITYIPQLLVGLGYKEGPRVQNILLKIAKTQEKERGRRAQAAAANKPNGSP
                     HLPKKESAAGGADSRPATANGEASGQAKPEPKAEGENAGAPVTNAAAQGEQSRGATAQ
                     KKPPWELTEEIMSVLKTAFPLLALSMETMVDQIQKHFKCPPDEDAYRLIVALLNDGLA
                     YVSRMPTSYAKDVKLPAATENNITRFAETILPSHIRGTFEADFVEVKPTMYEYIHNLR
                     KWRDKFEEKLDRRPSPVPLESFAHFSPHLSEFRYQKFDDVEIPGQYLQHKDKNQDFVR
                     IDRFLPNVDLVRTIGASHRRLRIRGHDGSVHAFAVQHPAARHCRREERILQLFRQLNQ
                     TLAHKKESRRRDLQFTLPLMVPLAPHIRIVQDDPSYITLQGVYEDHCRRHGVSKDEPV
                     LYTMEKLRGLADVKVAKPAEHAVTTRLEVLRAIQEKFVDNTVVLEYFQLVFPDFSEFW
                     LFRRRFSYQLAALTFMTYILHIDKRYPHKMNIARRSGNIWGSELISFMAANRPYFHNQ
                     EPVPFRLTPNLQTLMGPLATEGIFACSVMAIARCLAEPEQQLEHALTLFVRDEMMYWF
                     TSSSRAMTLTENQLRETVQANSDMIVKKAVSLAQAPAGNLPAHQTVIDLVAKAVNPMN
                     LALCDALWMPYL"
     gene            complement(<2117021..>2117758)
                     /locus_tag="THITE_120654"
                     /db_xref="GeneID:11516696"
     mRNA            complement(join(<2117021..2117407,2117455..2117600,
                     2117668..>2117758))
                     /locus_tag="THITE_120654"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649035.1"
                     /db_xref="GeneID:11516696"
     CDS             complement(join(2117021..2117407,2117455..2117600,
                     2117668..2117758))
                     /locus_tag="THITE_120654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649083.1"
                     /db_xref="GeneID:11516696"
                     /db_xref="JGIDB:Thite2_120654"
                     /translation="MIFANSFIAACGLATIGHAHMLLRNSAPYTSARCSGTLTEMAKG
                     SKQKMGFTGSAVHGGGSCQVSLTYGNRPTAKSAFTHWLAMTPPPWPWVHTYNLTIPRD
                     VPAGNATLAWPWVNKVGNRELYMNCAPVGIPGDGGSKAALDALPDMFIANMAPRADCK
                     TTEGVDVQYPNPGKSVDTPGSKFNPPVGNCGADAAPAIRGRCATFRG"
     gene            complement(2118989..2120644)
                     /locus_tag="THITE_2107286"
                     /db_xref="GeneID:11515844"
     mRNA            complement(join(2118989..2119477,2119552..2119616,
                     2119738..2120108,2120191..2120198,2120299..2120644))
                     /locus_tag="THITE_2107286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649036.1"
                     /db_xref="GeneID:11515844"
     CDS             complement(join(2119431..2119477,2119552..2119616,
                     2119738..2120108,2120191..2120198,2120299..2120356))
                     /locus_tag="THITE_2107286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649084.1"
                     /db_xref="GeneID:11515844"
                     /db_xref="InterPro:IPR009288"
                     /db_xref="JGIDB:Thite2_2107286"
                     /translation="MAAQASESSDDGTHCAFFYGTLMVPEVFYSVCYGSKDVPEAIAK
                     LHTFQPAILHGYCRRRVQFADYPGITKDEAHQVFGTYVTGLTRANMAKLDYFEGGQYE
                     RRTVTVKLLDKVGNLQGEGNVEGEERTAEVYVFRDESDLEDREWDLEEFRREKLKFWT
                     RAGYVFEDCDPDDPAVVEGSQG"
     gene            2121163..2122452
                     /locus_tag="THITE_2107289"
                     /db_xref="GeneID:11515381"
     mRNA            2121163..2122452
                     /locus_tag="THITE_2107289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649037.1"
                     /db_xref="GeneID:11515381"
     CDS             2121274..2122188
                     /locus_tag="THITE_2107289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649085.1"
                     /db_xref="GeneID:11515381"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="JGIDB:Thite2_2107289"
                     /translation="MSEALLDEIEAINSIYGDTTLSRSAPDQDPTLFVLTLPGDTASL
                     RLQFPPTYPDVPPVVLGTQSSGSAGKRGDAARDLALFRTAVSEVYEPGQVCLFDAIEK
                     VQELLAAVKDREVADEVDHEHETGAGGTGSVLSSSGAATTNGTAAPATHQEAESDPLL
                     GPPPPWTLSLPFTESKSTFLARCAPVASPQQASSYVAHLLASDKRVRAATHNITAWRI
                     RGANGTSFQDCDDDGETAAGGRLLHLMQLMDLWDVMVVVTRWYGGQKLGPRRFALINQ
                     AARDAFVRAGLVREEGTTARGEKKKGGK"
     gene            complement(2122461..2124065)
                     /locus_tag="THITE_2107290"
                     /db_xref="GeneID:11521104"
     mRNA            complement(join(2122461..2123345,2123431..2123821,
                     2123955..2124065))
                     /locus_tag="THITE_2107290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649038.1"
                     /db_xref="GeneID:11521104"
     CDS             complement(join(2122522..2123345,2123431..2123821,
                     2123955..2123978))
                     /locus_tag="THITE_2107290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649086.1"
                     /db_xref="GeneID:11521104"
                     /db_xref="JGIDB:Thite2_2107290"
                     /translation="MNAQVSFLEGTLSLIHIPVDLYPNLLQPILQVLLPPSQDTRQSI
                     TDGITVDNHKHGFLNISVTPIECSIVCNSAWAKSVFEPAIQRLPKDRAKTVAIAKDTY
                     AALSVSGAGVDAGSRVADLTSPLAMANIPIFFITTYYSDFILVPDKDRQAVITTLLAK
                     GFVFVEDDQSQLVSRDPSPTTTSHPHGFDFDPSHSRAPSQGGEPPSPHPSSVDDLQER
                     TFALLRRRNVTPHIEPDLVLVHCTGIRGAGTQHPHHHPSASSITRSRGPNGSRRGSAK
                     TIAGPAWVDTVDTKLYTGIVAALVAQPRFLSVSLAPDDNPPSLLLDRALLPLFGDTLV
                     GPVDGALVPIFLDLADLPFEATGIVSGVAGRLVRQLRMEDGAELSYLSTARAGAVILS
                     SEHAGVALGILGPLLGGGGV"
     gene            complement(2126285..2128219)
                     /locus_tag="THITE_2107293"
                     /db_xref="GeneID:11521247"
     mRNA            complement(2126285..2128219)
                     /locus_tag="THITE_2107293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649039.1"
                     /db_xref="GeneID:11521247"
     CDS             complement(2126312..2128099)
                     /locus_tag="THITE_2107293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649087.1"
                     /db_xref="GeneID:11521247"
                     /db_xref="JGIDB:Thite2_2107293"
                     /translation="MRDLRTKPDRPLPYSDEFHSAEEYVESLLHFAANSDLFRFLCGG
                     VHILDFYTAEPGLFKSAVPKEWQDYLLRTEPMALLDFLMRDDLTSLTPETGGAGAPPE
                     TLLRYVKDIRKFSLQRSFRPSKPKLPVLPRHVALGMKTKKVHEVTHFAGYIDRLAEDV
                     AHASGHEITHFVDFGSGQNYLGRTLASPPYNKHIVAVESNEVNMAGAKDLDILSGLAE
                     REKRVRNKKLYHRILEAVDPSLHNDEEALKRAARELGIADEDIATIDLRSRKELQATY
                     AAEEGKGTIEYVVGRLEHADLTGVLSQLRGHEDGIREERLRMMAISIHSCGNLSHYGI
                     RSIVLNPCIRAVAIVGCCYNLLTEKLGPPTYKPPFSRPSLQPINARVARESARRDPQG
                     FPMSERVSTYGGDGIRLNITARMMACQAPQNWTAEESESFFTRHFYRAILQKIFLDKG
                     VISRVYHGQEADPESPFNSSTNPVIIGSLRKQCYTSFKAYVRGAITKLTTNPDFSQYS
                     EVMREKMGNITDEEIAHYEEAFRHRRRELSAVWSLMAFSACVVESLIVTDRWLFLREH
                     PDIVQDCWVETVFDYRESPRNLVVVGIKR"
     gene            2128238..2129003
                     /locus_tag="THITE_2107294"
                     /db_xref="GeneID:11523458"
     mRNA            join(2128238..2128396,2128458..2128502,2128560..2129003)
                     /locus_tag="THITE_2107294"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_003649040.1"
                     /db_xref="GeneID:11523458"
     CDS             join(2128394..2128396,2128458..2128502,2128560..2128871)
                     /locus_tag="THITE_2107294"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_003649088.1"
                     /db_xref="GeneID:11523458"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="JGIDB:Thite2_2107294"
                     /translation="MVFIFGVNFHEQKLVKKALESFYALGPQTSARILAKYSIHPRAK
                     MGSLQPKTLTALTAELSTMTIENDARKIVRDNISRLRDMGTYRGRRHAMNLPVRGQRT
                     RNQIATARKLNKIQRAG"
     gene            complement(2129056..>2131127)
                     /locus_tag="THITE_2148801"
                     /db_xref="GeneID:11521105"
     mRNA            complement(join(2129056..2130111,2130180..2130392,
                     2130446..2130516,2130592..2130714,2131102..>2131127))
                     /locus_tag="THITE_2148801"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649041.1"
                     /db_xref="GeneID:11521105"
     CDS             complement(join(2129135..2130111,2130180..2130392,
                     2130446..2130516,2130592..2130714,2131102..2131127))
                     /locus_tag="THITE_2148801"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649089.1"
                     /db_xref="GeneID:11521105"
                     /db_xref="InterPro:IPR008257"
                     /db_xref="JGIDB:Thite2_2148801"
                     /translation="MTEKGKVPRLWSMKSGTDLPGPAGWAGPPAGDSGPVPRLHRRSR
                     AVKAALIRPGKPRSIEERVRRILHHTPLIDGHNDLAIFIRAVHNNHIYNDSFSKPFSE
                     GGFPGHVDLPRLQAGLNGGAFWSVFWPCPQNGTDYSDANYHSTVQETMRQIDVLSRLH
                     QAYPSVFSPPTLSSTAALHHFRHHGRLISPLGIEGLHQIGNSAAVLRQFYALGVRYAT
                     LTHNCGNRFADAALWEHPLRKAPPVWGGVSPEGRRLVREMNRLGMIVDLSHTSVDTML
                     DVLGAREDAGEGSGSWEGSRAPVIFSHSSAYALCPHPRNVPDEVLDWVGKKGGLVMVN
                     FSPDFVSCVEAPDRGDGLPEFYPANSTLRQVVRHILHIGERIGFDHVGLGSDFDGIQA
                     TPEGLDDVSQFPSLVAELLRQGVSDEDASKVVGGNLLRVWREVEVVAEEMQKSGEPVL
                     EDDLPDLFSAGLRNTDRGL"
     gene            2131888..2134866
                     /locus_tag="THITE_2107298"
                     /db_xref="GeneID:11516711"
     mRNA            join(2131888..2132059,2132135..2133751,2133817..2134866)
                     /locus_tag="THITE_2107298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649042.1"
                     /db_xref="GeneID:11516711"
     CDS             join(2132014..2132059,2132135..2133751,2133817..2134808)
                     /locus_tag="THITE_2107298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649090.1"
                     /db_xref="GeneID:11516711"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="JGIDB:Thite2_2107298"
                     /translation="MPGFADSFWSTDYAAGLGVLFGKLQQGVIENRQVLTIARMRAEA
                     EEIYGQRLSEIAPAVDKIQGGFGRDDGASVRKAYEGVRSEMEDAARNHKKIAQNIRDL
                     VVNPFSRWCDAHEARIQDSQEELQARIKAHDKQAEAVKKLRSNYFSKCRLVEDLEEEN
                     KLAFQDPETSPKQKQNVPQIKVEQEPVQEDEPLEIGDQMYTPEQIKKLLAHMLTTVKM
                     GETKVPILGTYQNTSAGTDIVDYIQQHMGSTSVSYAERIGQDLVTHGFLRLVGNVGNT
                     FANSSKLFYQWRPRAFEVAGLPEKKTLGRTFSIPVSGSDAADSPVVGTVTEYLAKWDV
                     LNTSRPNETPAERMRREAREADERYKAGVQKLDEMRCELEEAIFLHLKFLERCELDRL
                     KAIKTVILDFSGTISNVIPSLQATVDNMMLYQETVQPLGDLRYLLENYRTGSFVPKVV
                     VYENYYNKVDDQTFGVDLEARARADRKRVPIIITTLLTYLDHHYPDLEGDEARRGVWL
                     HEVPLSQTHKLRALVNNGKPPALETFAQFDIPTVASLLKLYLLELPDSLVSSHVYEII
                     RTIYTTPPGDGGDAARIPVLQQTLSQLRLTNIASLDACMNHFTRLIDLTSADEEYVSK
                     LATMLAPCILRPRTETSLTMEEKHAYRLVRDLFAHKDAIFNELKRLSTMTSSGSIKGQ
                     SRPRAISTDESNRKAHMEERNRAILEKASGSRSRATSPAPSSRATHRRDRSVGGPETR
                     FPISTNISSPTSEHRKRTSLGPVLPKRTSLEVPAETDGATGLSHPADGNFIMNGIASV
                     TGAVPAAEPQEGMVEKRNSLSRSGARFSAGRRVTPASTAAAAATGTTGTPPPSRHQHT
                     GSGQLEAQQQSPKPAQHGVTLVDAPMDY"
     gene            2135578..2138736
                     /locus_tag="THITE_2107302"
                     /db_xref="GeneID:11515387"
     mRNA            2135578..2138736
                     /locus_tag="THITE_2107302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649043.1"
                     /db_xref="GeneID:11515387"
     CDS             2135937..2138552
                     /locus_tag="THITE_2107302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649091.1"
                     /db_xref="GeneID:11515387"
                     /db_xref="JGIDB:Thite2_2107302"
                     /translation="MASTDILSQTLSSITAIKLDQLHAQKDAYESKKRSLCENVVSEV
                     NTAERVKKLLQGAEALRSVGLKKSAALSSMGEFLDQARYDPSVTEPLLKEYEAELRGH
                     LDAQTNKYEFASLYGKLVEEWIALGNSDATSAAEGSGFVLVGREEMHQQRATWEEYVF
                     KAKETDRNAIQRYLEGVFSSKEAKRGLEAIREKFKTFQKDWKSQRHFDQTALETVIKG
                     MLRSDILTEEKRTTLRDFLGNRVVLSEIADVLNMRMSAIASWSWGAPLIVEQRRNLNG
                     RYRFYTDEDLLHAIFIYYVGLQWACYLRKVLVEFVKTEGVWKSDSKPISKSDARRRRF
                     FLNDAVTLHKASVQKDRDNHFGAILLNQLPISFHEVRDSYDGVGCKNGDTRPSHVRVV
                     QGLLQRLQTEILMQTKLGKEITVIRSDFKWFGPSLPHSTIFAVLEFFGVQAGWLDFFK
                     RVLEATMRFKHDSPDTPAQARKRGTPISTPIADFFAESILFCLDYAVNQKAGGTRLYR
                     LHDDMWLWGGFETCSKAWKVITEFTDTMGLELNPDKTGSVRIARDRESAMATDPRVGL
                     PKGDVKWGFLRLDPATGRFLINEEEVDKHIEELRLQLSACRSVLDYIQAWNIYGNRFF
                     ANNFGRPANCYGLAHIDSMLATFRRIQDKLFPDHAGGVGEHLKQMIASRFGVAPTDIP
                     DGYLYWPTSLGGLGLQNPFITLLLSRRQVTKNPEKLIDKYLEEEEFAYARAKARFAEH
                     SDSGSGSVGPGWVDEHEFEDLRDEPFMSLAEFTRYRERTESALGKLYRKLIGTPDTAV
                     VVASGEVKAALAAGGGGDADAVWSELSDYDKWVVQLYHKDMVARFGGVEVVDKGLLPT
                     GLMAMLWQSRFRWQG"
     gene            2140187..2141719
                     /locus_tag="THITE_2169269"
                     /db_xref="GeneID:11521113"
     mRNA            join(2140187..2140648,2140713..2140933,2141010..2141719)
                     /locus_tag="THITE_2169269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649044.1"
                     /db_xref="GeneID:11521113"
     CDS             join(2140487..2140648,2140713..2140933,2141010..2141502)
                     /locus_tag="THITE_2169269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649092.1"
                     /db_xref="GeneID:11521113"
                     /db_xref="JGIDB:Thite2_2169269"
                     /translation="MWELELDPELIPTLKLVFHSAQILFAFISWCLEIAVFRADGSQI
                     VGNNGWTFAVFFLSVPAWIYLTMAPRFPRTRHIANPNAMLAVDALYTVIWLSAFATQA
                     AYNTANLCGSACGVSKAVVGLAFFVFLFFCITTFLSIWTLRYYRWNNRLPGYDRAQLN
                     SQNIDPDKAAFSLAPHDEEAYAPVNTNDNDEQHHGSHYGGDGAHSDYSDHFAGSASHV
                     SGGASTVSAYQDNPFREHEHEHAANPFESDTEYHSGRVSAAGSRYTPPTAADTYEDDS
                     RPVRFPAANYDRIEG"
     gene            complement(<2142079..>2142864)
                     /locus_tag="THITE_2039864"
                     /db_xref="GeneID:11517051"
     mRNA            complement(join(<2142079..2142664,2142749..>2142864))
                     /locus_tag="THITE_2039864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649045.1"
                     /db_xref="GeneID:11517051"
     CDS             complement(join(2142079..2142664,2142749..2142864))
                     /locus_tag="THITE_2039864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649093.1"
                     /db_xref="GeneID:11517051"
                     /db_xref="JGIDB:Thite2_2039864"
                     /translation="MGRERQNRKRRSSRPKITMPNRRKKVLNPLGNGIIAKNWNKKET
                     LSQNYSRFGLVAKLGKQTGGKAPSNRSIISAAGQDALAVRSGDQGLLQVREVKVERDA
                     SGRITRVLRDSNPLGDPLNELDSDPDSDSEERRKEKQRQRNYEEWSGFHEEKEGGEGD
                     KPAVLRALEREASRPTEKKVRHQSEREVDWLRRLVERHGDDTAAMAKDMKLNPMQQTA
                     ADIRRRLKKAGLLDS"
     gene            complement(2144578..2147665)
                     /locus_tag="THITE_2107310"
                     /db_xref="GeneID:11516697"
     mRNA            complement(join(2144578..2146577,2146643..2147665))
                     /locus_tag="THITE_2107310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649046.1"
                     /db_xref="GeneID:11516697"
     CDS             complement(join(2144785..2146577,2146643..2147585))
                     /locus_tag="THITE_2107310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649094.1"
                     /db_xref="GeneID:11516697"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2107310"
                     /translation="MTAPITTPPTSTAKDAASARKRRRRAPAGGAADDCFTCAKRNVK
                     CDRRRPYCSQCLEIGNECSGYKTQLTWGVGVASRGKLRGLSLPIAKAPPVSSAKSVKS
                     PTPERARTGSIASTGHWTTEQQEDQAVNEEVEGGIKTETGHRRNPSVSVATPFHAYDM
                     SHMSPTGSAPPGWTHIPFSSSMPTNDASRFPPRPLHIPVSAPGDMMQRDMIQTPIDSM
                     SDVDYMSPLVHSFPREEVPSFIHSPVVYESFPSHASPVPQSPVAAMMIEQSRAPAPCP
                     SLVYAPSEPASSLQSHVSHVDSLEAQLSRKLRHDCDMLGPGTPELDTYSSSAHSHSAF
                     WTSSSADDESVSQSVPDRNPAPWPGSIPSQPPSPVLQVSPDLITKMPFFMDYYEKTMC
                     PSMVYIDGVNNPFREHILRLGTSSRSLQHAICALAACNLRMKRKLSLGQHGRDAGERR
                     FDMSLIDSGSDVQPSDQSLAEEYQHRNLAVRLLNEQLHDPEKSTHDSVLATILVLCHY
                     RMAESGVAKFQTQFAGVKKILGMRRMSPYPASRDSAWMEALFTYFDAISASVNDREPQ
                     LTTSFYGLPPDAHLLPPGAENWVGCDRELFKTISKLGRLNLLSQHRPVQPLVASSSLP
                     RMTASPRPASPLAGPFKSPPLLGGPEHPPHHHSIFGGPPHPIDSGVRFDGNGFGTPTL
                     EDEDMLNQAHVQATATYDDPRSMFWREWKEARQALQSWQFDSTRTRASLTAPCSTASP
                     SSPSPLGPMPPAPVPTSAQVRDLNSLSEAFRYAALLYTERLASPNVPSNHNNFRNLVS
                     QVVYYATSLEAGSAAEKFLLWPLFVAGSECVNELQQNIVRSKCREIMARSGYMNNLSA
                     LEVLERLWAGEGWKEDAARAHHQQHGRMAGSGKGGPFNWTRCIGGPGVEVEWIMF"
     gene            <2159171..>2159422
                     /locus_tag="THITE_2037479"
                     /db_xref="GeneID:11519193"
     mRNA            <2159171..>2159422
                     /locus_tag="THITE_2037479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649047.1"
                     /db_xref="GeneID:11519193"
     CDS             <2159171..2159422
                     /locus_tag="THITE_2037479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649095.1"
                     /db_xref="GeneID:11519193"
                     /db_xref="JGIDB:Thite2_2037479"
                     /translation="VYAYIDNIIIASRNIEEYLKYIEIVLNIFNKVYVYISVEKSFIA
                     YPLIRLLSYIVNSEGVAKIDDRITIFKKLKFPNILKTLE"
     gene            complement(<2166848..>2167156)
                     /locus_tag="THITE_2042658"
                     /db_xref="GeneID:11521378"
     mRNA            complement(join(<2166848..2167029,2167051..>2167156))
                     /locus_tag="THITE_2042658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649048.1"
                     /db_xref="GeneID:11521378"
     CDS             complement(join(2166848..2167029,2167051..>2167156))
                     /locus_tag="THITE_2042658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649096.1"
                     /db_xref="GeneID:11521378"
                     /db_xref="JGIDB:Thite2_2042658"
                     /translation="FLVEAYNDLIEYIKAKILLNKSSKSVKSFISRYILFVVVDKGSK
                     FKGEVKEILYKLGIKRVIISLYNLYINDINEASYILIATSFIKIIDIIGKK"
     gene            complement(2184662..2185544)
                     /locus_tag="THITE_2107313"
                     /db_xref="GeneID:11521158"
     mRNA            complement(join(2184662..2185205,2185269..2185366,
                     2185438..2185544))
                     /locus_tag="THITE_2107313"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649049.1"
                     /db_xref="GeneID:11521158"
     CDS             complement(join(2184745..2185205,2185269..2185311))
                     /locus_tag="THITE_2107313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649097.1"
                     /db_xref="GeneID:11521158"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="JGIDB:Thite2_2107313"
                     /translation="MASATTFYDFKPLDKRGNEVPLSDYKGKVVLVVNTASKCGFTPQ
                     YAGLEKLYKSVREKHGDNFVILGFPCNQFGNQEPGSNEEIQQFCQVNYGVTFPIMAKV
                     DVNGDNASPLFQWLKAQQPGILGLKRVKWNFEKFLVGKDGTVKGRWASTTKPESLEST
                     ILEELAK"
     gene            2186278..2188110
                     /locus_tag="THITE_2107316"
                     /db_xref="GeneID:11521265"
     mRNA            join(2186278..2186400,2186496..2187440,2187531..2188110)
                     /locus_tag="THITE_2107316"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649050.1"
                     /db_xref="GeneID:11521265"
     CDS             join(2186364..2186400,2186496..2187440,2187531..2187880)
                     /locus_tag="THITE_2107316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649098.1"
                     /db_xref="GeneID:11521265"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2107316"
                     /translation="MDAQTKRNIVIVGGGIIGCTTAYYLTRHPKFNPALHSVTLLEAT
                     SIAAGASGKAGGLLALWAYPSCLVPLSYRLHKELAAEHNGAQRWGYRRVGCGSLAATV
                     TTSDIRARAQKPSSAPTDNAQLSELPIQSTAPDETTKEWEKLPKQDDKAAGLLRESPL
                     PPDLDWIDGRLVQYYEEMGAPGAAETAQVHPFHFTNSMADLARERGANIKLRAKVTKI
                     NDTKTSGVHSVEYEDRDTGETHAIDGVTDVVVAAGPWTGKLLPRTRVEGLRAHSVVFE
                     ADVSPYAVFTDIQLPVDYIPEHRISQGQKRRHKGNVDPEIYARPFGEVYACGEPDTST
                     PLPATADEVITDQSQCDDLVAYIGTISPTLAAAPVKTRQACYLPRHMRFGEQRGPLVG
                     PTSVPGLWVAAGHTCWGIQNGPGTGYLMAAMLFGDEVGEEVGKLDPRRFKV"
     gene            complement(2188111..2190208)
                     /locus_tag="THITE_2107318"
                     /db_xref="GeneID:11517698"
     mRNA            complement(2188111..2190208)
                     /locus_tag="THITE_2107318"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649051.1"
                     /db_xref="GeneID:11517698"
     CDS             complement(2188340..2189323)
                     /locus_tag="THITE_2107318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649099.1"
                     /db_xref="GeneID:11517698"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="JGIDB:Thite2_2107318"
                     /translation="MTVTNGAANGSRATRRPLPCGIYAPTMTFFDPDTEDLDIPTIKK
                     HAERLVRDGLVGLVTMGSNGEAVHCTREEKLEVTRATREALDAAGFTETPIIIGATEG
                     SVRGTIELCKLAEAAGADYALLLPPSYFRFLMDEQAVYDYFVAVADESPLPLILYNYP
                     GAVAGIDMDSDLLIRLAAHPNIVGTKFTCGNTGKLTRVALATNAKTPWSEGSGYMAFG
                     GMCDFTVQTLASGGSGIIAGGANVMPKVCVRVWNLYAEGKKEEAIALQKTLSKGDWVL
                     TKTAIAGTKQAIQSYFGYGGYPRRPLKRLDKARVAAVEEGVKEVLELEKSL"
     gene            2191615..2193322
                     /locus_tag="THITE_2152890"
                     /db_xref="GeneID:11516693"
     mRNA            join(2191615..2191774,2191843..2192005,2192074..2193322)
                     /locus_tag="THITE_2152890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649052.1"
                     /db_xref="GeneID:11516693"
     CDS             join(2191751..2191774,2191843..2192005,2192074..2193137)
                     /locus_tag="THITE_2152890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649100.1"
                     /db_xref="GeneID:11516693"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="JGIDB:Thite2_2152890"
                     /translation="MQPLNVLMVGTGEYTTGFVGGGASGSDKKVGVVGLTLFDLRRRG
                     KVGKLSMVGVNGTKFPAIREHLYKNITLAYNNLDTSFESYPADDAKDPEAYKTAIDAL
                     SPGDAITIFTPDTTHYPIALYAIERGIHVMITKPAVKLLEHHIALLEAAEKHGVFVYI
                     EHHKRFDPAYWDARARARQLGDFNYFYSYMSQPKSQLETFKAWAGIDSDISYYLNSHH
                     VDICDSMVSQLGYVPVKVSASASKGVATSLGCHESTEDTISLLVRWQKKDDPSKQATG
                     VYTASWTAPQKAGVHSNQYFHYLAKGGEININQAKRGYEVAEDAAGQLMWYNPFYMRY
                     APDEDGNFNGQSGYGYVSFEKFVDACRAVNAGELKPADLDAKGLPTLRNTIATTAILE
                     AGRRSIDEDREIRIESKDGVWKLV"
     gene            2195003..2196688
                     /locus_tag="THITE_2107320"
                     /db_xref="GeneID:11523462"
     mRNA            join(2195003..2195183,2195273..2195683,2195744..2196688)
                     /locus_tag="THITE_2107320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649053.1"
                     /db_xref="GeneID:11523462"
     CDS             join(2195053..2195183,2195273..2195683,2195744..2196425)
                     /locus_tag="THITE_2107320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649101.1"
                     /db_xref="GeneID:11523462"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2107320"
                     /translation="MILGRVVAGIGGGGLMSISTFLASDLVPLKKRGVVQGVGNIAYG
                     SGAMLGGVLGGFISDTSSWGWRLVFLIQVPVVAASGLLVWYLVDVPPKTSSKSVLARI
                     DFGGSFLTVGFLVLLLLGLNAGGNVVPWTDPLVLTTIPLGIVMLVVLVWWESRAKQPI
                     IPVRLLLDRTVLTACITNFLGTMVVMMTTFYVPLYVQVLGFTATQAGLRVLASSFGVS
                     VSSIGCGLIMKRTGKYVGLGVAVLLIYTFAMCLVATLDEDAPNWVPFVAMALVGGGYG
                     GMLTVTLLACIAAVDHAHQAVITSATYAFRSVGGTLGITVASAVYQNILKARLWDRFG
                     GLPGAAEEIERIRDDLGEIARLPQGWRDGVIASFMEAFRGVWIMALGLIVAGLVSVSL
                     MRQHKLHSNLARQEE"
     gene            complement(2196675..2200845)
                     /locus_tag="THITE_2107323"
                     /db_xref="GeneID:11521672"
     mRNA            complement(join(2196675..2200520,2200589..2200845))
                     /locus_tag="THITE_2107323"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003649054.1"
                     /db_xref="GeneID:11521672"
     CDS             complement(join(2196951..2200520,2200589..2200663))
                     /locus_tag="THITE_2107323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003649102.1"
                     /db_xref="GeneID:11521672"
                     /db_xref="InterPro:IPR006906"
                     /db_xref="InterPro:IPR007725"
                     /db_xref="JGIDB:Thite2_2107323"
                     /translation="MEDPELSSDTVDPQVRAHINSLVSALGGYSIDDDDGYKLGDDAL
                     EVLRDLKKWIRFYDEKLNRMDVARCLAEANLVGTDLLQILATWRPNDSASKYKARIAL
                     ACFEIMVPLTWPIEKDRETMTVNHHRHLPVLQLAQLGYKRAILNFDAAPILGTAVRVA
                     LPSMALASGDRSARDQGIIKLILYFLRNIAMISPPPGVKGDGDETYVSRSALVDAFSY
                     QDVLLTLLTMASNMGDDFRTEDVVVMEIIFHLVKRVDSSKLFVSEKQLHRIKAEELTA
                     AMKKEAAMLRSYNKNAPTRHSRFGTMIWVRRESGKLSTVSGQDALLDAATRERKMDSS
                     KSFKPPRRARKEDIESKDLGPPVNLDERARKQLQDFVSEFLDSGFNPLFGHVRRSLDR
                     DAPHVLQYHHSQFFYLVAWFLEAERARRNAQKESKQPSTGDEVGSFNLVAEVLSQEMF
                     ISISRALDRAYGDKDWRLLTTVMRCLTQILLTVQEMSQSGNEEDEEIADNILSRLFYE
                     ETTHDTIANIVRTYKDQGFEYLDACTELTHTFVRILEAYSKQNVDLHVRSRKRRRRKK
                     KAARAEGQQAADDDHGDSEDDSADDARQAEKTSQERKFDFKRFALRFIPQGVVDTFVT
                     FTQYYRDLNDAQLKRAHRYFYRVAFKQEMSAMLFRLDIIHLFYNMIKGPEPLDRNSSM
                     FKEWEELAKQIIRKCVRKLEERPALFVELLFSKTNSTAHYLEYGYEKQTVSANPRPAA
                     ELEFKREVERDRQIAIVVGVLLDRNQTDHLEWIKKQISEAEAERRAWENAEQALATER
                     PDGEAAREPKMAPHSTLRPDNDARRTAMFKNAHLRLLMKLVGAERLAPTLDETPDSIW
                     IIPGTVTADALKETLSLINQAEFTPPTFEDGTLAEDQLRRKSAARKRAAYDDDDDRGD
                     IHDFVNDNSEDDDTGILFPAGGPTVRRRTAEDEPPAQKRLRRGRRRREGSEEPAPLTD
                     EQLAERARARRKKELERARKIKSAVYVDPRDDMSDDERDREFFAKELARQEAKNASFG
                     LSSKPSGVEMSTWEELLGVDGSGVDDDHEGKDGGSKTGRERARQTRKRKSDAGPAESS
                     EDEDAGTSSTASDSGLESEERPARRARKRRKSARPVGSGSEEEDRAGEDGMDVDVRST
                     QSSKDEVVTNDTPLSSSPSRTAMATAEKVAADGERREDEDDDVPVAKVTARARPRARA
                     GFIVESSDEE"
     gene            2201027..2202507
                     /locus_tag="THITE_2107325"
                     /db_xref="GeneID:11523895"
     mRNA            join(2201027..2201311,2201407..2201506,2201571..2202507)
                     /locus_tag="THITE_2107325"
                     /product="uncharacterized protein"