GenomeNet

Database: RefSeq
Entry: NC_016458
LinkDB: NC_016458
Original site: NC_016458 
LOCUS       NC_016458            9477512 bp    DNA     linear   CON 29-NOV-2019
DEFINITION  Thermothielavioides terrestris NRRL 8126 chromosome 2, complete
            sequence.
ACCESSION   NC_016458
VERSION     NC_016458.1
DBLINK      BioProject: PRJNA79337
            BioSample: SAMN02744067
            Assembly: GCF_000226115.1
KEYWORDS    RefSeq.
SOURCE      Thermothielavioides terrestris NRRL 8126
  ORGANISM  Thermothielavioides terrestris NRRL 8126
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Chaetomiaceae;
            Thermothielavioides; Thermothielavioides terrestris.
REFERENCE   1  (bases 1 to 9477512)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D.O., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.,
            Baker,S.E., Magnuson,J., Laboissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  TITLE     Comparative genomic analysis of the thermophilic biomass-degrading
            fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Nat. Biotechnol. 29 (10), 922-927 (2011)
   PUBMED   21964414
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 9477512)
  AUTHORS   Berka,R.M., Grigoriev,I.V., Otillar,R., Salamov,A., Grimwood,J.,
            Reid,I., Ishmael,N., John,T., Darmond,C., Moisan,M.-C.,
            Henrissat,B., Coutinho,P.M., Lombard,V., Natvig,D., Lindquist,E.,
            Schmutz,J., Lucas,S., Harris,P., Powlowski,J., Bellemare,A.,
            Taylor,D., Butler,G., de Vries,R.P., Allijn,I.E., van den Brink,J.,
            Ushinsky,S., Storms,R., Powell,A.J., Paulsen,I.T., Elbourne,L.D.H.,
            Baker,S.E., Magnuson,J., LaBoissiere,S., Clutterbuck,A.J.,
            Martinez,D., Wogulis,M., de Leon,A.L., Rey,M.W. and Tsang,A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Comparative Genomic Analysis of the Thermophilic Biomass-Degrading
            Fungi Myceliophthora thermophila and Thielavia terrestris
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 9477512)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 9477512)
  AUTHORS   Otillar,R., Salamov,A., Grimwood,J., Reid,I., Ishmael,N., John,T.,
            Darmond,C., Moisan,M.-C., Henrissat,B., Coutinho,P.M., Lombard,V.,
            Natvig,D., Lindquist,E., Schmutz,J., Lucas,S., Harris,P.,
            Powlowski,J., Bellemare,A., Taylor,D., Butler,G., de Vries,R.P.,
            Allijn,I.E., van den Brink,J., Ushinsky,S., Storms,R., Powell,A.J.,
            Paulsen,I.T., Elbourne,L.D.H., Baker,S.E., Magnuson,J.,
            LaBoissiere,S., Clutterbuck,A.J., Martinez,D., Wogulis,M., de
            Leon,A.L., Rey,M.W., Tsang,A., Berka,R.M. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003010.
            URL -- http://www.jgi.doe.gov/fungi
            JGI Project ID: 4043154
            The DNA was provided by Paul Harris (paha@novozymes.com)
            The strain is available from the Northern Regional Reaearch
            Labortories (USDA) in Peoria, IL under NRRL 8126 and from the
            American Type Culture Collection under ATCC 38088
            Contacts: Randy Berka (RAMB@novozymes.com)
                      Igor Grigoriev (ivgrigoriev@lbl.gov)
            Assembly and annotation done by JGI.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##Metadata-START##
            Organism Display Name :: Thielavia terrestris NRRL 8126
            GOLD Stamp ID         :: Gi01746
            Assembly Method       :: Arachne v.20071016
            Assembly Name         :: Thielavia terrestris V2.0
            Sequencing Technology :: Sanger
            Sequencing Depth      :: 10.15x
            ##Metadata-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9477512
                     /organism="Thermothielavioides terrestris NRRL 8126"
                     /mol_type="genomic DNA"
                     /strain="NRRL 8126"
                     /db_xref="taxon:578455"
                     /chromosome="2"
     gene            complement(<14570..>16433)
                     /locus_tag="THITE_2044791"
                     /db_xref="GeneID:11517789"
     mRNA            complement(join(<14570..15085,15142..15206,15282..15645,
                     15708..>16433))
                     /locus_tag="THITE_2044791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651114.1"
                     /db_xref="GeneID:11517789"
     CDS             complement(join(14570..15085,15142..15206,15282..15645,
                     15708..16433))
                     /locus_tag="THITE_2044791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651162.1"
                     /db_xref="GeneID:11517789"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2044791"
                     /translation="MASTRGQKDQADAEHDDRGGRDDGPPLKLHGAKRDNVLEIEATR
                     AITEAEHQLGFLAALKQYPSATFWSLFFCLAVVMAGYDAQIITSFYALPAFQQKYGNL
                     VRTSVGSFDFEVSAPWQTALGMGNPIGQVLGALASGYPLERFGRRWTLAACCIWSIGF
                     VFVQFFATSIGMLCAGEILGGLAYGFYVVIAPTYSSEICPLALRGFLTTSVNLAFVIG
                     QFVAQGVAAGLESRLDSWAYKAPFALQWLWPVILLALLPFAPESPYWLVRQGRKADAR
                     QAIVKLSSSTNPPDIDQVLLGIEQTDLLEQELEVTSSYWDCFKGVHLVRTEISVMVYL
                     IQVIGGNPLIGYANYFFEQAGLNPSDAFNMGVGNTALGFVGTVTAWPLINYFGFGRRT
                     IYNAGMLFMTLLLFIIGFLSIPTDNRAAVWAMATLMDIWTFAYQMTVGPICFVIISEI
                     SATRLRTKTIAIATAVQAAATIVTTVAMPYMLNADEANWGGKAGFLFGGISFICLVWC
                     HFRLPESRGRTFEELDILFQRKVPARQFKNCDLLGEGETGTDAAKELA"
     gene            19734..21520
                     /locus_tag="THITE_2111162"
                     /db_xref="GeneID:11517788"
     mRNA            19734..21520
                     /locus_tag="THITE_2111162"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651115.1"
                     /db_xref="GeneID:11517788"
     CDS             19775..21460
                     /locus_tag="THITE_2111162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651163.1"
                     /db_xref="GeneID:11517788"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Thite2_2111162"
                     /translation="MGPSRILDEPGLAGDDYYDLGDFHMPVTASNEAQTWFNRGLVWT
                     FGFNHEEAVSCFQRAVAADPECAMAYWGIAYALGPNYNKPWGVFDPLELARNVLQARV
                     AMVKALSKAHAASAVERALIDALQHRYPQEHLTPSQGYAANHTFAGAMEQVYRRHPAD
                     PNVTAVYVDALMNLTPWQLWDIRSGKPAEKARTLDAKAALERALSEHPHHPGLLHLYI
                     HLMEMSRNPEQALQAADRLRGLVPDAGHLNHMPTHIDVLCGDYRQAVASNAAAIKADT
                     KFVSRDGAINFYSLYRCHDYHFRIYAAMFAGQSAVALETATQLEQTLPEALLRIQSPP
                     MADWLEGFLSMRVHVLVRFGRWQDITQLELPADRELYCVTTAMIHYAKAVALANMSRI
                     QDADNARQLFQEAAKNVPPSRTVFNNTCRDILAIAAAMLDGEIEYRRGDTELGFQHLR
                     RAIKLDDSLPYDEPWGWMQPTRHAYGALLLEQGRVEEALDIYTADLGFDDTLPRAQQH
                     RNNVWALHGLHECLTRLGRQNEARMIRPQLDLALAAADVPIMSSCFCRSNRRG"
     gene            complement(21452..>24039)
                     /locus_tag="THITE_2153730"
                     /db_xref="GeneID:11520470"
     mRNA            complement(join(21452..21898,21970..23695,23881..23921,
                     23998..>24039))
                     /locus_tag="THITE_2153730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651116.1"
                     /db_xref="GeneID:11520470"
     CDS             complement(join(21581..21898,21970..23695,23881..23921,
                     23998..24039))
                     /locus_tag="THITE_2153730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651164.1"
                     /db_xref="GeneID:11520470"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2153730"
                     /translation="MSGANDIRRAAAANAQIAPPTTPNLRTVPPRPRRSRASGSFHAG
                     EPFPLPSPSYGETIGSSSRSRRDAATDPRRPLRPLRRQSTAKYHTFPTPPPAGPPKRR
                     RSGREPGAWYSRLFRPAEDASEVEDDQGNLADGSRDARSIGVHAGRRRRRRKSLIAAA
                     DEDRASAEATPLPWAQLGLLALLSLAEQTALNSIGPYLPAMVASFDEIPDGQEGLYVG
                     LLASAFALAQLATNLLWGYVSDRVGRKPVILLGTSLLMLCFMCFGFCTTYAQLLVVHV
                     AMGLLNGNAAVVPTCLGEVTDRTNQSSAFTWLPAVYSLGSITGPALGGLLVGIAGDGA
                     RYPFLAPNMLAAALLLSSVVVLAVWFEETLDHLDGAAASTGSGWAKLVRSWCSARWRE
                     LRPGPRGKGRSPSAGQQNSPDMSDDDWSDEPGLSDASEGGQRDLLGPRGTVEEEDEDE
                     YSKKDEEEPKSAFRELNNRNTLAILGTYLVFQLANISFNSLYPIFASSPPPAGRDLDP
                     GTIGVSLSLAGLVTILFQLFIFQSAKAHMGNLGTYQYSLLGMAVSMALMPWIGYLDGR
                     PYLGLGTSKAWLYSELGGILVLKNICAVGGLSSVMLLITNSAPSHETLGTLNGVAQTL
                     SAAGRSVGPFLSGGLFTLSTPLRPKGEALAWGLFAGITLAGWVASLAIRGKDLESADG
                     APGGEDADDGDTSGDEELGIHKTNVR"
     gene            complement(24516..25979)
                     /locus_tag="THITE_2111163"
                     /db_xref="GeneID:11517089"
     mRNA            complement(24516..25979)
                     /locus_tag="THITE_2111163"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651117.1"
                     /db_xref="GeneID:11517089"
     CDS             complement(24780..25628)
                     /locus_tag="THITE_2111163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651165.1"
                     /db_xref="GeneID:11517089"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="JGIDB:Thite2_2111163"
                     /translation="MANDHILTLSCPDKPGIVHAVTGIFAREGHNILDLQQFSDPTSE
                     KFFMRVHFGPTPTESTEHLRAPFDALAAEYAMAYDIRPVTQKPRVLIMVSKIGHCLND
                     LLFRAKTGQLPIDIPLIVSNHPDFAPLAASYGIEFHHLPVSRETKAAQEARVLDLVRQ
                     HEIELVVLARYMQVLSPTFCEAMSGRIINIHHSFLPSFKGAKPYHQAYERGVKIIGAT
                     AHFVTADLDEGPIIEQRVARVNHSMSPKELVDEGSNIESQVLAAAVKWYAERRVFLNG
                     SKTVVF"
     gene            26788..28086
                     /locus_tag="THITE_2111165"
                     /db_xref="GeneID:11517090"
     mRNA            join(26788..27454,27514..28086)
                     /locus_tag="THITE_2111165"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651118.1"
                     /db_xref="GeneID:11517090"
     CDS             join(27019..27454,27514..27752)
                     /locus_tag="THITE_2111165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651166.1"
                     /db_xref="GeneID:11517090"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Thite2_2111165"
                     /translation="MPLKLRPATEADCFRIGCISREAFLGSTSNALFPPHLYSKSETG
                     DPALDESKWRAARTLRRMRNGSPTFVVVEIPEDGNAEGTVVGYAQWDAPAAASAHASK
                     GHWEDDRVPSPGSLNEAKLLELYVTLEAETKRVLGPEGHSNMYYLLSVAVDPAHQRRG
                     IGRMLVLHGLDLAAKAGLDAFLHATPEGEGLYRSLGFQQVGEPFDLFGTKHFSMLWKH
                     QSAASP"
     gene            complement(<28046..>30375)
                     /locus_tag="THITE_2049108"
                     /db_xref="GeneID:11516997"
     mRNA            complement(join(<28046..28357,28433..29385,29444..29722,
                     29785..30216,30273..>30375))
                     /locus_tag="THITE_2049108"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651119.1"
                     /db_xref="GeneID:11516997"
     CDS             complement(join(28046..28357,28433..29385,29444..29722,
                     29785..30216,30273..30375))
                     /locus_tag="THITE_2049108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651167.1"
                     /db_xref="GeneID:11516997"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="JGIDB:Thite2_2049108"
                     /translation="MSHSASSQEHIASAALGQGVGYGIVLGLGGAFALGMILVTSILR
                     RYNRELQTSEMFNTAGRTVKSGLVASAVVSSWTWAATLLQSTGVCYRYGVSGPFWYAS
                     GATVQILLFATLAIELKRRAPNAHTYLEIIKARYGTFAHMVFLVFGLATNILVSLMLI
                     VGGSATVNALTGMHTIAAIYLLPIGVIAYTLVGGLKATILTDWIHTFILLIIIIVFAL
                     TAYASHDVLGSPSAVYDLLVQAAARHPVDGNKDGSYLTMRSREGAIFFVINIVGNFGT
                     VFLDNGYYNKAIASSPVHALPGYILGGLCWFAIPWLTATTMGLTALSLENTPWFPTYP
                     DRMSDAEVSAGLVLPYAAVALLGKGGAVATLLIVFMAVTSATSSQLIAVSTICTYDLY
                     RTYFNPTASGRRLIYMSHVVVVGYGIFIATFSVGLWYAGISMGYLYLMMGVIISSAVL
                     PAALALIWAGQNKWAASLSPILGLACALIAWLVTAKKECGDLGVACTGSNNPMLAGNV
                     AALLSPLVLIPIFTAIFGIDKYDWKSMMDIRKGDDHDLADAAGLDIEEIPGGHSETRV
                     EFEEEQKKLQRAGKISKSTTVVMTLAFLVLWPMPMYGSGYIFSKPFFTGWVSVGIIWI
                     FCSFIGVGLFPVFEGRRTLVRTVKSIYLDLAGKSHPKTIHARVADEQKSPGDATPTEK
                     SDPKESVGAA"
     gene            32422..35916
                     /locus_tag="THITE_2111169"
                     /db_xref="GeneID:11516998"
     mRNA            join(32422..34216,34292..35916)
                     /locus_tag="THITE_2111169"
                     /product="glycoside hydrolase family 3 protein"
                     /transcript_id="XM_003651120.1"
                     /db_xref="GeneID:11516998"
     CDS             join(32592..34216,34292..35549)
                     /locus_tag="THITE_2111169"
                     /note="CAZy_ID 269835"
                     /codon_start=1
                     /product="glycoside hydrolase family 3 protein"
                     /protein_id="XP_003651168.1"
                     /db_xref="GeneID:11516998"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="JGIDB:Thite2_2111169"
                     /translation="MARDETKKGLLQDTEGRPPDSDGHESDSDLEATDYLDREPADQP
                     RSFSAPTPRKQWWIIRCLGRRSRCCIGTLAVVIAVFIFLSAGGAFVFKKYQEEPPYGQ
                     SPPWYPTPKGGIAQSWAASYEKAAKLVGKMTLAEKVNVTTGTGWQMGLAVGTNGPAVH
                     VGFPQLQLQDGPLGIRFADNITAFPAGITVGATWNRQLMFARGKAHAIEARGKGINVL
                     LGPCVGPLGRMPAGGRNWEGFGADPYLQGVAGAETIRGIQSEGVMATIKHFIANEQEH
                     FRQPWEWGLPHAISANIDDRTLHELYAWPFADAVKAGVASVMCSYNMVNNSYACGNSK
                     LLNGILKDELGFQGFVMSDWLAQRSGVSTALAGLDMTMPGDGLRWANGESLWGPQLTK
                     AVLNGSVPVDRLNDMVTRIVAAWYQLGQDDETKFPRQPPNFSSWTDDRLGVLAPGSPS
                     PQDEVVVNEFVDVQANHSIIAREVAAQGTVLLKNEGLLPISRQGLDESKLEARRRVVE
                     QSTGKRHDGKFKVGVFGEDAGPGHGPNYCKDRACNQGTLGSGWGSGAVEFPYLVSPIE
                     ALRKQFDSSKVELHEFLTNKPLIASNDKATVDDLDLCIVFANADSGEGFVKWDDVSGD
                     RPNLALQSGGDDLIVDVASKCGGGNADVIVVIHAVGPVLMERWVELPNIKAVLLANLP
                     GQESGNALADVLFGDSNPSGHLPYTIGKSLADYGPGGQVLYTPNGVVPQQTFSEGLYI
                     DYRYFDKHSIEPRFEFGFGLSYTTFTLSNLRVTPRKNKSALPAPRPSPAAEPPSYPTT
                     IPSKDEALLPAGFRKLDKYIYPYLSPEDEIETGAYPYPDGYDTVQPPSGAGGDEGGNP
                     DLWAIYVDVAVDVKNDGPVAGAVVPQLYLEYPAKEGVDFPVRVLRGFDKVYLNPGEIK
                     TVHFGLTRRDLSYWDVMEQNWVMVTEGQYTFRVGQSSRDLVLDGKW"
     gene            complement(<36027..>41152)
                     /locus_tag="THITE_2142635"
                     /db_xref="GeneID:11516999"
     mRNA            complement(join(<36027..36774,36857..37293,37356..37540,
                     37594..37709,37794..37865,37926..38124,38190..38438,
                     38534..38696,38765..39438,39510..39743,39802..40081,
                     40145..40371,40453..40819,41015..>41152))
                     /locus_tag="THITE_2142635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651121.1"
                     /db_xref="GeneID:11516999"
     CDS             complement(join(36027..36774,36857..37293,37356..37540,
                     37594..37709,37794..37865,37926..38124,38190..38438,
                     38534..38696,38765..39438,39510..39743,39802..40081,
                     40145..40371,40453..40819,41015..41152))
                     /locus_tag="THITE_2142635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651169.1"
                     /db_xref="GeneID:11516999"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_2142635"
                     /translation="MVHQKTIHLLFATNAGIFLLYLPLRLWELHNSRHRYLLGSQAWL
                     QLRRGCRPSDPATVYLLASVLCDSVALTAPSAAWRPRPARCLLHAALLFLECFTPRAK
                     PHGVPWSGQSPEDNSGILDKLFFAWIIPILLRGYKSLLLSQDLPPLSAELSAKLAREA
                     MLESWNRRARPETRMALPLTLLRSIRRLFVAPVMPRLFLILFRYSQPALIRKSIQFVS
                     ETSLAGSEMRGYWLVCSAVTIYLGLAVSTAAYQHRLNKLKVVAKSALVGIIHDKAISL
                     PSTAHDNYEVLTLMSTDAEGLGGVPEMFYETWAQTMEVAIGIVLLSRQVGWIWPLPLI
                     LIFLCSRVSRYVAKHLQPGQKAWNTATEHRVAATSSMLSSIKAIKMLGLQRCMANCTR
                     LLREQELKTASKVRWIMVYYNASANALGIFSPAITLMLFAVAAARRGRALNAETAFTT
                     MAILSMVTHPANMVMTIVPRAVAAFAGFERIQAYLLRPPLLDERRILPGVAGRAGLAI
                     NIRDVSLGERQPVLRDVSIRVEYGSLVIVSGPVGSGKSTLLRAILGEIRPTQGSIQLA
                     SRQVAYCAQKPWLPNGSIKQAIRGMADGQGDARWYQRVIEACCLSHDLDLLPEGDETQ
                     IGSGGLNLSGGQRQRVALARALFARCDIALLDDAFSALDGETETTIFRNLFGPTGLFR
                     ELNTAVVLVTNSTQFFPAADLNIILDGGGIKAQGSWEAIKHQASSSISKFSLQRPTDD
                     VVSPASPPTFAKLNAQLQIKQEAQADLARRTGDMGLYRYYFRFVGLFNLALLSVCTLS
                     YSVFITFPQHWLKLWTESSGQSQVFYVCGFLFLSLVSWTSTNGTMWSTVIRIAPHSGL
                     RIHHHLLNIVVNAPLSFFSENDNGSILNRFTQDIQLIDKQIPSALANLGNQIFKLLMQ
                     VILLCMAQHRLALSLPPCAGLVYFIQQVYLRTSRQLRFLELESHAAVFSSFLESVEGL
                     ETIRAFGWLGEATDLAATRLEDSQRPEFLLMCLQRWLNLVLDIIAAAVAIGMIAIAVT
                     FRGQISGGQVGVALNIMLVANTTLLRLVESWTNLEVCLGAVARLRALETVTPSESDKN
                     ATTFAAPRGWPTHGRVEFRAVTAAYHDEAVALRHLSLTINGGQKIVICGRTGSGKSSL
                     LLALLRMLELQAGCIRLDGIDISTIPLEFLRQRCFVTVSQDGFLVSNASIRFNLDPEG
                     WLGDDQIITNILKRVGLWSHFSLAGQNLKERGGDGHAILDQKLSAFPAFSAGQAQIFT
                     LCRGIIKAEALRAHGARPVVLLDEVTSALDTSTELAVHRIVDSEFSAKGHTVITISHR
                     LGQLSQFSGPRRDAVFTMRDGRLAGALSTLEGTVDGEGAGGE"
     gene            50337..51441
                     /locus_tag="THITE_2111170"
                     /db_xref="GeneID:11517000"
     mRNA            50337..51441
                     /locus_tag="THITE_2111170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651122.1"
                     /db_xref="GeneID:11517000"
     CDS             50652..51092
                     /locus_tag="THITE_2111170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651170.1"
                     /db_xref="GeneID:11517000"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="JGIDB:Thite2_2111170"
                     /translation="MSGADSPEILAAYDAVRSDKDATNWLLISYAAPTGNQLVLTKTG
                     TGGLSELAAELDDSDVQYAYVRVEYANDAESKRVKFAFVVWIGQGTKVMRKARAGLEA
                     GAVKKVLSHYSVQVDASERRDLDEADIVARLRKAGGADYNGGRG"
     gene            <51509..>52267
                     /locus_tag="THITE_2048539"
                     /db_xref="GeneID:11517001"
     mRNA            <51509..>52267
                     /locus_tag="THITE_2048539"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651123.1"
                     /db_xref="GeneID:11517001"
     CDS             51509..52267
                     /locus_tag="THITE_2048539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651171.1"
                     /db_xref="GeneID:11517001"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2048539"
                     /translation="MARFFITGSSDGLGSLTAKRLIAQGHQVVLHARNADRARDASAA
                     CPGAEAVLVGDLSSIDETKALAAEADKLGPYEAVIHNAGVYIGMERVPGKSGLPTLFT
                     VNTLAPYLLTCLMRKPRRLIFVSSGLHMGGQPNVGGARQRLLSSSYSDSKLHNVMFAK
                     AFARRWPDVGCYSANPGWVPTKMGGPSAPGRIDDGVNTYVMLALGDGQAGWSPGGYFV
                     NSQERRPSAVAGDAKLQDQLLADLADISGVSVPA"
     gene            52385..53144
                     /locus_tag="THITE_2111172"
                     /db_xref="GeneID:11517002"
     mRNA            52385..53144
                     /locus_tag="THITE_2111172"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651124.1"
                     /db_xref="GeneID:11517002"
     CDS             52800..53030
                     /locus_tag="THITE_2111172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651172.1"
                     /db_xref="GeneID:11517002"
                     /db_xref="JGIDB:Thite2_2111172"
                     /translation="MLAPIQSCTVQLVSVSIIVAPEKHKSTYLAPVALKIAFTTKRMS
                     PCKEHELTCSGMEVDGVKFRAVSGEGDGQQSS"
     gene            complement(53145..54328)
                     /locus_tag="THITE_2111173"
                     /db_xref="GeneID:11517003"
     mRNA            complement(53145..54328)
                     /locus_tag="THITE_2111173"
                     /product="carbohydrate-binding module family 18 protein"
                     /transcript_id="XM_003651125.1"
                     /db_xref="GeneID:11517003"
     CDS             complement(53259..54245)
                     /locus_tag="THITE_2111173"
                     /note="CAZy_ID 269716"
                     /codon_start=1
                     /product="carbohydrate-binding module family 18 protein"
                     /protein_id="XP_003651173.1"
                     /db_xref="GeneID:11517003"
                     /db_xref="InterPro:IPR001002"
                     /db_xref="JGIDB:Thite2_2111173"
                     /translation="MRSIYVGLAAALCWTGVLGLDANNHATDERIAELAGLAAGRRLM
                     KFGTRHRNATSNFAELGLRQANDQCGAQYGRCPGDLCCSSYGYCGDSIDYCNPLFDCQ
                     PDYGTCGWPRTTAALPPTTTTTSTPVAPPTTQPTTTTTTRPTSLPTTTTTTSSGASPT
                     AGMQTTTNGMCGNNTMCIGNPNFGPCCSQFFWCGSSIEYCGAGCQSAYGACLGVPGQP
                     GNPPTNVTTTPGFPGQTTTTTTPTPPPTTTTSRPTTTTTTTTSSSPTVSIPPGLTSST
                     DGRCGNGVTCLGSNFGRCCSQFGYCGDGDQYCPYIVGCQPQFGYCDPQTGGG"
     gene            complement(<61722..>63618)
                     /locus_tag="THITE_112021"
                     /db_xref="GeneID:11517004"
     mRNA            complement(join(<61722..61850,62016..62972,63028..>63618))
                     /locus_tag="THITE_112021"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651126.1"
                     /db_xref="GeneID:11517004"
     CDS             complement(join(61722..61850,62016..62972,63028..63618))
                     /locus_tag="THITE_112021"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651174.1"
                     /db_xref="GeneID:11517004"
                     /db_xref="JGIDB:Thite2_112021"
                     /translation="MSEGTGILALPDSVLGRICSQFCPHCVGEDCVGGLALPDRYWGP
                     EYFGTLDALTKVNVRIGRLAQQARLHVFCARRNSLRRLVRTLLEAPALAEHIRVVRLG
                     YKDSDGDERCILRELATREAVQRLGSLAAPEAGAGFDFSSILGEKRLMAKFYTLPGVE
                     DSFVWVPRIPDPLWGLPPMWIPVAGCLATQPRPVRAIDLTAKARLHAFVLFKLAKNIT
                     SVAIQSDWPLGLFPATKAPKIIVKQAITVEPGCLPNVEELRLDSGYENPNRHRHPHRH
                     GQMVIVDVRKMTGLLSRVPNLRTLRIRGAHFTFPAEKSELVRPVLTNLTTLDLTSVDQ
                     DTLTSILAYCTPANLKHFRFTIDSVGRRNLFRPGDEMRGHNIIDLLESHNFAASLESL
                     HIDTTKNILLASRDPRDFCRDGYETIESLRSFTALRHLSISAENIYFPSGYPRVLLRD
                     PYTGDEDAGQRLVSFLPRNIESVEITGVYAIHVKDVEQLAAACRNTDTTMAGTDDDAQ
                     FCFPNLKRAVGAEINAHIASLFREAGVDYHFDRPEFFFDQYAGDFDEMEI"
     gene            complement(<64749..>65231)
                     /locus_tag="THITE_2086328"
                     /db_xref="GeneID:11517005"
     mRNA            complement(<64749..>65231)
                     /locus_tag="THITE_2086328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651127.1"
                     /db_xref="GeneID:11517005"
     CDS             complement(64749..65231)
                     /locus_tag="THITE_2086328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651175.1"
                     /db_xref="GeneID:11517005"
                     /db_xref="JGIDB:Thite2_2086328"
                     /translation="MPFQNLLETLTKDVSFGEDIDLILGLTTTAFAADQLLKAMVDKK
                     HMTRHLGLAGLSGVAAAAAFTMMRREHRERHPTARPRRHRSHRHGTENDLDSDCDDGC
                     PHAQSPSRTQAQQVQGEARQEETLATTQIHGQGRLQEHWKPSLSSAPHHPHSPVRRAT
                     "
     gene            65783..65861
                     /locus_tag="THITE_t40"
                     /db_xref="GeneID:11517084"
     tRNA            65783..65861
                     /locus_tag="THITE_t40"
                     /product="tRNA-Arg"
                     /note="Anticodon: ACG"
                     /anticodon=(pos:65815..65817,aa:Arg,seq:acg)
                     /db_xref="GeneID:11517084"
     gene            complement(<106982..>107290)
                     /locus_tag="THITE_2046164"
                     /db_xref="GeneID:11517085"
     mRNA            complement(join(<106982..107163,107185..>107290))
                     /locus_tag="THITE_2046164"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651128.1"
                     /db_xref="GeneID:11517085"
     CDS             complement(join(106982..107163,107185..>107290))
                     /locus_tag="THITE_2046164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651176.1"
                     /db_xref="GeneID:11517085"
                     /db_xref="JGIDB:Thite2_2046164"
                     /translation="FFVEAYNDLIGYIKAKILLNKSSKSVKSFILQYILFVVIDGGSK
                     FKGEVKEILCKLGIKRVIISLYNFYINSVNEASYIPITTSFTKMTNSIGKR"
     gene            complement(124254..125755)
                     /locus_tag="THITE_2111175"
                     /db_xref="GeneID:11514810"
     mRNA            complement(124254..125755)
                     /locus_tag="THITE_2111175"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651129.1"
                     /db_xref="GeneID:11514810"
     CDS             complement(124600..125463)
                     /locus_tag="THITE_2111175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651177.1"
                     /db_xref="GeneID:11514810"
                     /db_xref="JGIDB:Thite2_2111175"
                     /translation="MKFQLVTAAAAAIFVASVSALPAPVVDNHGLIPDTDNWVEDGTI
                     EAIQTRDTEDAEIFEARDVDATEDLDARDSDAIEDLEFLEARDEDVTEVTEESSETLQ
                     ARDTDEVTETLDVLEARTNEVSEAAANFNFTTDFNFALDNVLSQIEGIPEDVLQQGDE
                     ALHKWLVDHGIRAGDEKLKRDTDGGEEASDEEGLSLLERGELVARASWWKIAKCVAAI
                     VQLLATTAVPAAKLLRIKKYIEELGGAKQAVELLLKATTKSEKLKAGGEALVALSAEL
                     LGISSVKNNCF"
     gene            complement(<127155..>127962)
                     /locus_tag="THITE_112018"
                     /db_xref="GeneID:11517086"
     mRNA            complement(join(<127155..127535,127858..>127962))
                     /locus_tag="THITE_112018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651130.1"
                     /db_xref="GeneID:11517086"
     CDS             complement(join(127155..127535,127858..127962))
                     /locus_tag="THITE_112018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651178.1"
                     /db_xref="GeneID:11517086"
                     /db_xref="JGIDB:Thite2_112018"
                     /translation="MLALVLARIVTWAFSGIPFGHTLDWAVIILDMQAIYINSVTSAL
                     IVFIFAFLANVQERRTDYIYRSFASIFEVDSSVELKLRVLSGDNTSNPRVVIPGPEAG
                     KFQRAIIYFADLAGIGVICSNEITAVLGGVTILGLLAGDTAMKWSTSCQLLCNIPPGR
                     C"
     gene            129212..130251
                     /locus_tag="THITE_2111176"
                     /db_xref="GeneID:11517087"
     mRNA            join(129212..129511,129607..130251)
                     /locus_tag="THITE_2111176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651131.1"
                     /db_xref="GeneID:11517087"
     CDS             join(129388..129511,129607..130013)
                     /locus_tag="THITE_2111176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651179.1"
                     /db_xref="GeneID:11517087"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="JGIDB:Thite2_2111176"
                     /translation="MPSSKRVEQALAALEKDKSKALGLALPKHASIEPGQFVPRADAR
                     SAPELFFPAGSAEKTYMVICLDLDAPFVSFPVLGPINHWCQSGLRISSAGGNGKLETT
                     DPFVVNYIGPGPPPGAAPHRYVFLLYEQPANFDVKKHAPGKHVGAGGRMRFDLESWEA
                     KIGLGEVVAANYFKSN"
     gene            complement(<130631..>136188)
                     /locus_tag="THITE_35966"
                     /db_xref="GeneID:11517088"
     mRNA            complement(join(<130631..130892,130956..131411,
                     131488..132106,132173..132288,132349..132420,
                     132483..132606,132688..132819,132874..133110,
                     133181..133343,133417..134120,134267..134503,
                     134586..134865,134940..135166,135313..135856,
                     135964..>136188))
                     /locus_tag="THITE_35966"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651132.1"
                     /db_xref="GeneID:11517088"
     CDS             complement(join(130631..130892,130956..131411,
                     131488..132106,132173..132288,132349..132420,
                     132483..132606,132688..132819,132874..133110,
                     133181..133343,133417..134120,134267..134503,
                     134586..134865,134940..135166,135313..135856,
                     135964..136188))
                     /locus_tag="THITE_35966"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651180.1"
                     /db_xref="GeneID:11517088"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_35966"
                     /translation="MAQSSLASCSRLDDSFGPHAGECRGGFDFTLLFEETILTLLPLC
                     LLLVVLPLRINFLLRRAKKLAAGRTLAAIKLSGWIVLGALQLAALALWATPSASAART
                     RATLAAAAVTVVSTLGLCLLSWVEHSRAVRPSTLINAFLFATLLFDIAQARTLCLRAE
                     GNADHAIAYVCVAAVAAKACVLVLEGLEKRRLLRAEYRAYPPEATASIYNRSFFWWLN
                     ALFRKGFNHELDVDHLFALDKQLQASYCYKRLHAAWASVTQKSTYSLLLTSYGVLKWP
                     VLQSIPPRACLIALNFCQPFLINHAIKLSQEAINDETTQRGYGLIGAYLLVYVGIAVS
                     MGQYQHRTYRSITMLRGGLVSIIYRKTGTLSLKDVDPATSMTLMSADMERIVQGWQTM
                     HEIWANAAEVGVAIYLLERQLGVACVVPVAVSLSVSLLGSMVAMNFIMSRQAMWLEAI
                     EKRISATTAMLASMKGVKMCGLKDTLLASLQQLRVDELRISKRFRRLLIWNMVFAYLT
                     QVFAPVLTFTVFSVRARNSGDTTLDTARVFTSLSLFALLSEPLASLVMSLATYLGAVG
                     SFVRIQQFLDSEERADLRRPAEPAELSEKPTVNPSAPDAIAVQGASFGWDAAKEPLLK
                     DITLTVPWDKLTMVVGPVGCGKSTLLQAVLGEVPALAGSVRLGSTSVAYCAQNPWHMN
                     GTVREAIVGCEQFDEKWYARVVHACALRRDFRELPAGDASRIGSGGIALSGGQSQRIA
                     LARAVYSRRKIVILDDVLSGLDMSTENHVFHSLLGQKGLLREMQSTVLLVSSSAKRLP
                     YADHIVCLGPNGVLTAQGSFSELNDAGGYVSSFSLPHADWSYTVDDVDDQIVEAAALD
                     KEREGITTARPKGSDSAEADTGRRTGDVQIYLYYVKSVGWWATILFVLAIVGFIFCMS
                     FPNVWVQWWAADNDSHPNERLGYWLGIYAMFGGAAIVCLFLSCWQMIITMVPQSGEKF
                     HYALLNTVLSAPMSFFDNTDSGVTLNRFSQDLQLIDMELPIAALNTFATFVLCIAQMA
                     LIGVGSIYAAISFPIVLAALYLIQMVYLRTSRQLRLMDLETKAPLYTLFEESLSGLAT
                     IRAFGWQGTLEQKNHELLDRSQRPFYLLFAVQRWLTLVLDLLVAAIAVLLIVLVVELR
                     GTVAAGGVGLALLNVIQFSQNIKLLVTFWTTLETHIGSVSRVKSFTETAVSEDQPEEK
                     QTPPPDWPSAGAIEFENLSAAYSRDDLVLRDVSLSIKAGEKIAVCGRTGSGKTSLIMT
                     LFRLVDMTRGSIRVDGVDIATLPRQEVRSRIVAVPQHPFLLKGSVRLNADPMGIASDE
                     DIAAALQCVQIKEAVDKNGGLDADIDAVNLSSGQRQLLCLARAMLRRSSILILDEATS
                     SIDAKTEETMQRLIRRKFANHTIIAVAHKLETIMDFDKVAVLDAGRLVEFDSPYALLD
                     VPDSAFSRLYHASVAEEEDLDLTLERTES"
     gene            <138796..>164185
                     /locus_tag="THITE_112015"
                     /db_xref="GeneID:11516806"
     mRNA            join(<138796..139308,139477..139956,140018..140347,
                     140385..141889,141924..148519,148589..148660,
                     149192..151564,151632..158663,158735..159126,
                     159198..161507,161582..>164185)
                     /locus_tag="THITE_112015"
                     /product="non-ribosomal peptide synthetase"
                     /transcript_id="XM_003651133.1"
                     /db_xref="GeneID:11516806"
     CDS             join(138796..139308,139477..139956,140018..140347,
                     140385..141889,141924..148519,148589..148660,
                     149192..151564,151632..158663,158735..159126,
                     159198..161507,161582..164185)
                     /locus_tag="THITE_112015"
                     /codon_start=1
                     /product="non-ribosomal peptide synthetase"
                     /protein_id="XP_003651181.1"
                     /db_xref="GeneID:11516806"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001242"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="JGIDB:Thite2_112015"
                     /translation="MATASGTISDRGTDLNGLTPCRFPRFSRPPPKHFAAAGVRPMAS
                     ARVAIERAEELLALSAADPDALGAVLRTAWAVLLRCYTGQDDVIFSFQRGGDGAAAEP
                     AVVRFCLDDGASIARLVGRAKTELAGRPGPAAPPELLRSGDPDDRPLFDTAVVLWTFS
                     QTSAPCPVLSPQHTSLRLLAKRGASSLTLFLEWSTAHLGMPPSQGALVASTLAAILSR
                     ILGSVRELLPIPSSAAADLDSSLTLGSLDCLSQANLDQVCAWNTEYEIRPVERCVHDV
                     IGDRVRETPDKEAVCAWDGRLTYRELDHVAGRLARRLVQLGVGPEVLVPLCFEKSKWT
                     LIAMLAVLRAGGAFVPLDPSHPVERLRGLCESVRAKLVLCSSHLVQMLTGVVDTVLPV
                     DDSTLAASPVAEAEESAQDAPAVASTNPAYVIFTSGSTGKPKVGIRKRKGTVIEHQAF
                     CSSARAHAPALLIDGTCRVLQFAAHTFDASLVEMLTPLMVGACVCIPSEHERLNDLAG
                     AMRRMAVDHAVLTPSFVNFLTPSAVPGLRRLVLAGEAMSRTHVATWSHIELVNGYGPA
                     ESSVAAVVNPRVGPESEPTDIGLPCGVRVWLVDPVDHDRLAPVGCVGEMLLEGPSLAR
                     GYLNDPAKTQESFIFDPAWAKDALPSSARRRFYKTGDLARYNSASGSLSYVGRKDTQI
                     KFHGQRIELGEIEHHLAADEQVQHALVLLPKHGPLAKRLTTVLSLSDPSLAVSNEQIA
                     QPGLKLAGDAALTEPIIEGIRTRLGTRLPAYMVPSTWLCVEAIPMLSSRKMDRKTVST
                     WVESVLMAEECQKILMGNHSAEQATPSTASRDNVALTEVEEKLRNIWSLVLNLPADQI
                     SPDDRSFLNLGGDSISAMACASHAKKARLGLTVQDVLKAKSLKQLAACAKPIGEQSRG
                     QDEAGDEDKSALNTPFDLTPIQQLHLSPCFCLRLSRRVDEGAVREAIQVVVKRHAMLR
                     ARFKPGGEDDRWQQFITPDVEGSYRFRAHSVPSRTEVDAGIASAQGCLNVRRGPIVAA
                     ELFAVQDKGEQILFVTAHHLVIDLVSWRGILEEMEEILERPPGDTGAITVHRSLSFRK
                     WAELQIDDCAGKPLAQVLPHAEQVPAAQFAYWGMDDRPNLYGDVVCQGFELDVATTAP
                     LLNDCHIPFRTETVDVLLAALIWSFHATFHDRAPPAIFNEGHGREPPRSPTDNAEVDI
                     ARTVGWFTTLFPVALSTPSPSTFADALIQIKDLRRRAPGNGRAYFAARFHTREGRDRW
                     AALHRRMEVSFNFLGRYQQLERVGALFRPAEGALMAGEAHPGSATADFGAACARFSLF
                     EVSAVVVRGALRFGFAWDGGMRHQERIRRWVAACRGVLAEAAATLPRAAGRMTASDFA
                     LLPDLSLADLEAFERTRLPALTGGRGWAAVEDIYPASPIQQGLLLSRTKDGSFYAVRR
                     SFEVKLGGNDNRRGVDVARLVQAWKGVVRHHALLRTVFVDALGQTRAGSCDQVVLKDV
                     EPVIIVRDCPGGEREMRRLIENLEPMQYQDQTPQHRFCVFHDSTKAGSSVFCVLEMSH
                     AVMDGASMDILLRDLGRAYDGSLAHRPKPLFSPFVARLQQRNVETDVAFWASRLAGLE
                     PCHFPVLTDGVNVPETEKQLCSLRLEFPGLAALQEFCSNKGFTLPNAFHVAWALTLAC
                     YTGTDDVCFGYLVSGRDAALEGSEDAVGPFINMATQRVKLGGGSDEDQSVSLLHLLEV
                     VQRDQLECMPYAQTSLAEVQHALGVPGGMALFNTCISYRRLEPKTDEAKGSIVCEDVG
                     TLHDPTEYPISANVEMDSDGGAAIDVDYWTDAVSSAQAQHVAATFMQALMNIAEHADT
                     PISQLDQVHETSKERIWSWNANMPSATVDCVHRMVEKQVILRRQAQAVRGWDADFSYE
                     ELNTLANRLARHLLAFGVGPETLVPVCFDKSAWTVVSMLAVLKAGGGVVPLDATHPAS
                     ALEGRVADAGAHVVVASETRAFLFEAMVPYVVAVGPALMDQLSTSAPQEEELGIESGV
                     GPENPAFIMFTSGSTGKPKGVVLCHQALVSSMLAHGAALGLGPHTRFLQFAAHTFDNS
                     IEEMFTTLIHGGCVCVPSEADRLGDLPGAIDKLDANFMDLTPTVAALLRPEQVPKIRG
                     MAVGGEALTREVLDAWGGAIPVHNQYGPSECSINAAHKLHLDAKGDVANIGTSVGSVS
                     WVVDPQDHNRLVPVGCVGELLIEGPILARGYLGRPDETAKAFIEMPRWARLDPRHSER
                     GSRRMYKTGDLVRYNSDGSLVYLGRKDTQVKLHGQRIELGEIEHHVKAHLPPNAQSSV
                     ELVAPAQSTKALAVFVCLPSPASTSPTKADEEDDIRILPMDAGFYSLAQTIAGSMAAE
                     MASYMVPRVFLPVSKMPLTSSGKLDRRRLRTMAHALADGIVAYRLGAESPSGRAPETA
                     MEKQLQELWAAVLNVEAATITADDSFFRHGGDSVGAMRLVAAARQRGVALSVASIFQA
                     PKLADMAKLVEGCSANGGAKSQNGASAAKPVAIEDERAPGPTEPFSLLSKTSEMSLQE
                     LQNQVASICRIDVGAIEDIYPCTPLQAGLVAASQRQPGAYVAVNLYQLPPDIDMPRFK
                     SAWQEVVDSEAILRTRVVFVEGMGFLQVVVRGKITWETAATADEVLGTRHRQLPPHDG
                     GILSRYTIIGEDGNQPTFAWTSHHALYDGWSLPTLLARVEARYRNPEADMAPSPHYSR
                     FVEHLAGLDASASDAFWTAKLSDSGTTAPQHFPQLPHPGYRVQATSQVSRSVRFARPR
                     DANLTLASFLRAAWALVVSVYSSSDDVVFGEILNGRDVPVAGIEDLVGPTLASVPRRV
                     RIDRAMSVRQMLADVQAQLNDVIPHQFAGLQRIRTLSPAAAAACDFQNLLAVDLADDV
                     AEDSLWSNMTGGGSAQGAEFFSYPLNVTCTVGRRSQNNNADEIQVRAFFDAGVVPQWQ
                     VARMLGLFETVLVRLAAAESQGDRVGDMELLSADDKAVLRKWNETPGPLVERCVHEMI
                     CETMSRSGSEAAAVVAWDANLSNGELDALSGALARDLKSKGVGPGGRRLVLFCFEKSA
                     FAVVAMLAVLKAGAAFAPLDPAHPVGRLREIAGDCAADVVLCSPKYQKLCADVASTVV
                     PVDTAMLRKLERATLAGSASDENGCAPSDAAYVIFTSGTTGKPKGTIISHAAFCSGAA
                     AHGPAMLMNPPFRFLQFASYTFDACLAEILTTLMMGGTVCVPREEDRTNGNIAAAMEQ
                     MGVTMALLTPSFARVLEPAEVPHLKTLILGGEAMSQSHVATWADKVNLVNAYGPSECA
                     VVATVNSHVRPSSNPANLGRGLGRCWIVDPQNHHRLAPLGSVGELLIEGPTLSTGYLR
                     NEAKTREAFVESPRWASDVSLRYPDMPPLVQRRMYKTGDLVRVCDDASGEMIYVGRKD
                     ASQAKLNGQRLELDEIVHHLSADDAVRHVLVILPRNGPCAKRLVAVLSLRTLNHVHSR
                     NAANHTDFELVISSDASTVLEKVQERLREKLPPYMVPSTWLILRSIPLLPSGKLDRNR
                     VADFVEKMSEETLDKANAAYSTTGPEKHHAGMAQPAQKLPVDERLKVIWSEVLNIAPE
                     RIGPTISFLHLGGDSITAMQVMARCRAQGIRISVPDIISSKSVHELALKVTVPKEEQH
                     AITVAEEDHHEFDPTPIQQLYFQLMRNKEPSTTSHSQFNQSLLRRLARDDISSDDFAR
                     AVHALVQTHSMLRARFRRDGTGNWRQRITSDVSGSYRFKTHVLGSASRLEKRIQSSQA
                     ALDIQKGPLLAADWFAVGKDKQIHVFITVHHLVIDVVSWGIVLQDLETFLASGRIPPP
                     SSMPFQAWSRKQSEQAQAETNGRRLLPHHETADTDLEYWGMADIPNLHGDAVMADDIE
                     LDTDTTALLLGPECHAPLQTEVLDILLAALLLSYRNTIPDRRGVPTVYNEGHGRETWD
                     DGMDLSRTVGWFTTLYPVHLPDESSSDDDIVSAVRWVKDYRNRLVGKGRPYFAYRLLT
                     AQGREDYNQRWPVEVAFNYLGQMQQLNRPDNFFRPLDDDVGRGVNAASDVGKDVARFA
                     LIEVSALVAGGRMKLSFAYNKHMKHQDSIARWVAECQSLLREAPRRLLQRVSEKTLSE
                     FPLLPLTYFGLESLDQRLHEVGVNLRDVEDVYPCTPMQRGLLLSQLREPEKYAYKMVF
                     QVEPCRGQDIGLQRLCDAWQTVVRRHSTLRTIFVDTVGDEGLMDQVVLRSAPGRVQML
                     GCDNDGDEALQKLQSIPSINYSEKKPPHRLSICTAANGNVFCQLEISHAVCDGSSAPI
                     LLDDLADAYGEGVIRKPVPLYRDYIAYIQSQPRGESIRYWKDYLACAEPCLFPSLTDG
                     DVAAQPSLGSYAVTITNVTKLNAYCLDSGITLSTLLQFAWALVVRSYTGADEVLFGYL
                     ASGRDVPVAHIEQAVGAFINMLVCRLHLPADAEVGDVLETMQADLANAMSHQNCSLAE
                     MQHELQLPGATLFNTAFTYQKRTTAAQARHSPNSALQYRVVSAEDPSEYAVALNVEAT
                     DQTIEVHFSYWKNVVSDAQIRNVAAAFEQALSSLIADGRDDCTIGEVNLVGSAGIQQI
                     RSWNDVELPRVEQCIHDVIAQHAQQRPVSTPAVCGWDASFTYRELDGAAAALARHLVN
                     SAGVGPEVFVPLCFEKSAWTVVAQLAVLKAGGAFVNLDPSHPDSRLEQLVQDVGAKTV
                     LCSAKHKAKMDKIAGVNDVFVVDAAAIAALSSKASVTEALLPSRATPSNAAYIIFTSG
                     TTGKPKGTVIEHAAFCTGALAHAKAMFMHSDSRVLQFASYTFDASIMETLSCLLVGGC
                     VCVPSDDDRMNDVSAVIRNMGVTWTLLTPSVASTVKPQSVPCLKTLVTGGEAMAAGHI
                     ARWGTQCALVNAYGPTECSVVATTSTKVDESRRVCNLDRFNVGTAVGGRVWVVDPATA
                     DRLVPIGAVGELVVEGRLVARGYLNNPEQTAKVFIQSPEWTKDPGFPKSMWLHQDTMY
                     RTGDLVRYNSDGSISYIARKDNQIKLNGRRIELGEIEFHCRGGLPDDAQSAVEVVSPA
                     NNQTATKSLAVFFCLPSNEATSQPFALLPMSEPVRNLALSMETHVSSHLPSYMVPQLF
                     IPISAMPWTSAGKLDRRQLYRAVEQLSRDDLALYRLSAAAAAARHRSSATETEKKLQS
                     LWEAVLGLPAGSVGPGDSFFRLGGDSLTAMRLVGAARVHKMVLTVLDVFEKPVLADMA
                     RACGGSEEETAVALQLKPFDMVPGPRSQLDVLLQDISAQCGLAREQICDVYPCSPLQE
                     GLVTLAAKQPGAYVAVSTLKLPDDIDLDRFKAAWQEVFNDTDTLRTRIVHAADSGFLQ
                     VVAAPGPIEWHDERTVEDAIANGQALGSQHGGALTRYSLVRETTDRGEGRLFVWAIHH
                     ALYDGWSLRLLARRVQDVYSGKSAVSDQRQNGGATRLQYANFIHYLSRRDITASERFW
                     KESLRGAAAIVHFPQLPPAVANEREMPIFRAERRKMHVRRAGALVDITLPTLVRAAWA
                     IVQSAYTGLDDVVFGETLAGRNIDVPGVTEIAGPTFTTVPTRVWLPRDMHVAEFLKDM
                     HAMASRMVPHQHLGLQHIRRLNPDCAAACDFQNLLVVQAASPIPREQHGQEPDWDFQG
                     GSAAESFFTHPLVLECSVADTDIEATFHYNEKVLSTWHAKRLVYQFEAVLKRLVRYSE
                     NKEATLADVHVISPEDQALIARWNRIDAPGGVEAAVDACIHDLFLEQAAAQPERVGIS
                     AWDAELTYGEIREHVSRLAVHLKQLGVGRETLVPVCLDRSAWIVVTLLSILLAGGAFV
                     PLDAAHPLARQKEILGSIAPPLIVCSPEHASRFAGVVETRVVVDGVMIGSLPPVPAPS
                     PLDTEPPSPDNTAYVLFTSGSTGRPKGVIVTHRNFCSSSRAIARATHIEPTSRVFHFA
                     SLTFDTSLMEVLTTLTLGACVCVPTADERLHDLGPAMARLRATWAFLTPSVANLLDPD
                     VVCPTFKTLVCGGEAMLAETVARWAHRVELMNGYGPTEASVLSVVNPHVSAEKDPSII
                     GRPIAAARAWVVEAREDCNDRLAPLGAIGELAISGPLVARGYLNEPEKTARVFIENPA
                     WAKTDLLASSATPAPTRIYRTGDLVRYRPDGIIEFIGRRDGQVKVNGQRLELGEIESR
                     LSADSHVRLALVVQPKAGACKTQLVGVVTLASTAAHITTGGDGGGECDPLGGPAEQLA
                     QARSDIADIRARLADMLPHYMVPSAWIVLTVMPVVVSGKLDRQRVAKWVESLDEATYE
                     RIAKNLGLAGDEGDNERQMTGPVKELREIWAKELNFPLERVRLNQPFMSLGGDSIRAM
                     GVVSRARNAKISVSVQDVLRAKSLAHLAQLAKRAPSTTAAKVDHEEEDEKPFALSPIQ
                     SLYLQLAGKHDGEARFNQSFTLAAPRRVTADAIKRAFDTIVQRYSMLRARFSKRDDGK
                     WEQRIAQMGPSSYAFLAHHVGSRREITPVIAEAQSSLNIEHGPVFRVDLLDVADQEEQ
                     TIVSMVAHHLCIDMVSWRIIVQDLSQLLETGSLAADAPLSFRSWCALQSAHIKTLDPR
                     TILPFKETPADLTYWGVQGPLTYGKARTETFSLSEEMTKLALTDCHKTFRSEPVDLFL
                     AAIAQAFARTFADRGVPTLHTESHGREAPAGSSVDLSRTVGWFTSICPVAIPVDGDVL
                     DTVRRTKDIRRSIPGHGRPYFAHKSLTGAADFASPQMEVLFNYLGGGMTQQGHDNETA
                     DPLIRQVDVAEDESLADVGPDAIRLALFEISAIATDNRLQFSFVYDSSLDREADVRRW
                     ISNCRSILEEMVQGLMRHPAEPTLSDYPLLPVNYDGLDTLIRARLPRAGIDRAAILSQ
                     VEDIYRCTPVQEGMLISQLRNPSAYLFHAVYNVTHTNPRQRVAPDRIANAWQKVVDRH
                     AALRTVFIESVRRGGVFDQVVLKHADCGVVLLRSSDEQAMEKLSQITIRGADTRTRQP
                     QLPHQLSICATDSGRVLMKLEVNHAAIDGGSLAIILEELASAYMGALELTPGPRYSAY
                     VQHINSLPDEEGTNYWIRHLRGLQPCYFPKSSTTSANEGMRTLRSVALKFDRYAELRQ
                     LSEQTQVTLANIMHAAWALLLRKYTARDDVCFGYLTAGRDAPVENIGRTVGTLINMLC
                     FRVQISPSQTLEDVLRTSQDQHLRSVPFQHCSLARVQHELGLAGKPLYNTSISIQNHS
                     GGMEERVGDTILFEIEEAHDPSEYAVTVNIETSRNSEGVVFRYWSDHISDGEAEEMAR
                     SMAHILDAFISRPMQYVAQFDLAPDSKPAADTTKDSMINALLGDPASPASDRILDSSP
                     VVSSPASSTFETPTQHPHEKMLSGLWSALLNLPEDSISGQDSFFDLGGDSITAMKLVG
                     EARDLGLELTVADVFRRPTFNDMLSSIQTAASEDPVNGLAKTQNGTSTTLVSRRHSYE
                     RFSLLAASNVESFLQTNIVPQVCVFRGGIDDVLPATDFQSMAVAGALLETRWMLNYFY
                     LDGDGPLNLGQLKRACFRLVQALDILRTVFVPSGGRFLQVVLRTLRPAFHVVEADDTP
                     EDYKPGEREGRQRESQAQLGESFVEFTVVKHRHSSRHRILLRISHAQYDGVCFPKILE
                     ALQAAYRGETIPRPPSFANYLRASAGELTSEHYHHWKQLLAGSSMTEVVRRKRPNYRA
                     ASTTTACLRKTVHLTPVESGHITTATVIKAAWAYVLAQVSSSDDVVFGHTISGRNAAV
                     EGVGNMIGPCLNMVPVRVQFGSGPGQTARHLLTQIQDQQLANMSHEVLGFREIVRHCT
                     TWPRWTYFSSTVQHQNVDQLDRMSVRLGDVRYRVGCASAAQEDFADLSVLSQPLGDGD
                     QYEIMLSFAEGGAVPRDFAERALDMLCDSAHLFATNPDAALPSAAELCCRPPQIPFDE
                     VSPSDSNTSSDEDILQHLSPAQLASLSALVRAAWHQVLDQPVAHTQTSTTTATTTTTG
                     SGPASTAAIDMDMDASFFALGGDIIALAQLACLFAEAQQPGRQPPPRLEELIDSPTVR
                     GHMALLARGIPTPPAAGHHKPAAAGISVDKAAAFPAEGKKRGRGVVDSGLADRALKLV
                     RKGLGKSKGAGRGAAVRVVN"
     gene            complement(164603..164694)
                     /locus_tag="THITE_t83"
                     /db_xref="GeneID:11516807"
     tRNA            complement(164603..164694)
                     /locus_tag="THITE_t83"
                     /product="tRNA-Ala"
                     /note="Anticodon: CGC"
                     /anticodon=(pos:complement(164660..164662),aa:Ala,seq:cgc)
                     /db_xref="GeneID:11516807"
     gene            complement(165818..170741)
                     /locus_tag="THITE_2111183"
                     /db_xref="GeneID:11516808"
     mRNA            complement(join(165818..166190,166265..168319,
                     168381..170741))
                     /locus_tag="THITE_2111183"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651134.1"
                     /db_xref="GeneID:11516808"
     CDS             complement(join(165873..166190,166265..168319,
                     168381..170651))
                     /locus_tag="THITE_2111183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651182.1"
                     /db_xref="GeneID:11516808"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="JGIDB:Thite2_2111183"
                     /translation="MWGQSPEEAMRRRAADAFPDSLHHRDDTQSPEINAGSGETTHVP
                     PTPDAEGVWGEREVGGPVSPRLAMQDFEELQHELTTRLSRTRSQAAASQKSTKSNRGG
                     FFQRVVSRASGRSKAAAGQLVDEEAGGRQEGRKQVEDEGEDEDVDDNSTAADEFPLEQ
                     FMRDGHLEKRTESGESAKKIGVVFKNLTVKGVATGDTFVRTLPQAILGTFGPDLYGIL
                     CHFFPALRIGRRGELRTLINDFTGVVRHGEMMLVLGRPGSGCSTFLKVIANDRAPYAA
                     VEGEVSYSGIPADEARQRYRGEVVYNAEDDQHLPTLTVGQTLKFSLLNKTRKNLRGNV
                     SVIIDALLRMFAIKHTENTLVGNAYVRGVSGGERKRVSIAETLATKSTIVCWDNSTRG
                     LDASTALDFAKSLRIMTDVSDRTTITTLYQAGEGIYELMDKVLVIDEGRMLYQGPAKE
                     ARQYFEDLGFYAPPRQTTADFLTSICDPNSRQFREGFEDRCPKTAEELEKAFRASPAY
                     QRLLADVDAFEQHLHQTGHADAQRFKESVREQKSRRVLSNSNYTIPFWKQVLACARRE
                     LWLIWGDKTELYSKYFTVVSNGLIVGSLFYNTPPDTLGAFLRGGVVFFCVVFLGWLQL
                     AELMKAVSGRAIVARHKEYAFYRPSAVTLARALTDLPLLLPQVVVFIILLYFMTGLDV
                     NAGKFFIQLLFTYTTTFCITAMYRMLASVSPSMDDAVRFSGMALNLLVIYTGYVISKP
                     VLLSQKIWFGWIAHINPIGYAFEAGLSNQFHDRMMDCAPSQLVPQGPGISPENQGCAF
                     PGAHLGSRSILGDDYIGTQFDYTRAHLWRNFGVVIAFAVLYLLVTVVAAEVMTFGGGG
                     GGALVFKRSTRTAKQLKRGAGAADEEKANPSGSASSSSTAVPSSDTAQDSSALKGLTA
                     SDRVFTWEDVSYTVPTPAGPKRLLNGINGYAKPGVMVALMGASGAGKTTLLNTLSQRQ
                     TVGVVSGSMLVDGKPLGGDFQRSTGFVEQMDLHEESATVREAIEFSALLRQSRSIPRQ
                     EKLDYVDKVLDLLELTEIQDAVISSLGVEHKKRLTIGVELAARPSLLLFLDEPTSGLD
                     AQSAMSIVRFLRKLCAAGQAIICTIHQPSSDLIQQFDKILALNPGGNVIYFGPVGPDG
                     SAVLRYFADRGVHCPPGRNVAEFLLETAIKGGRRPDGRRINWSDEWRSSPENKHVLAE
                     IQQLKAERSKAAVVVSSSSPSSTSSSSSSSAASEQDHEFAAPVAQQILLLTKRMFVRQ
                     WREPSYLYGRLFTAVVIGIFNGFTFWKLGDTAADMQNRMFTCFLIIMIPATVLNAVLP
                     KFYLNRALWEAREHPSRIYGWVAFCTAEVLSEIPGSLVAGVLYWLLWYLPTGLPYDAP
                     AAGYVFLMTLLFFLFQSSWGQWICAWTPSFTVISNILPCFLVIFCLFNGVVVPQPQLN
                     VFWKYWLYYLNPSSYWISGVLAATLTGQPVRCAPSEAAYFSPPAGQTCGDFAGAFVRE
                     AGRGYLMNPNATADCGYCPYATGDEYLATLGISPDTKWRNFGIFLVFCFTNWL"
     gene            complement(<173040..>173228)
                     /locus_tag="THITE_2024068"
                     /db_xref="GeneID:11520852"
     mRNA            complement(<173040..>173228)
                     /locus_tag="THITE_2024068"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651135.1"
                     /db_xref="GeneID:11520852"
     CDS             complement(<173040..>173228)
                     /locus_tag="THITE_2024068"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651183.1"
                     /db_xref="GeneID:11520852"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Thite2_2024068"
                     /translation="IILRRQRNNLAAKRYRQKKIDRIEELEKEVKQVTQERDELRIRL
                     ARQEAEVAALREMLKMKHS"
     gene            <174310..>174995
                     /locus_tag="THITE_120187"
                     /db_xref="GeneID:11516809"
     mRNA            join(<174310..174462,174582..174801,174844..>174995)
                     /locus_tag="THITE_120187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651136.1"
                     /db_xref="GeneID:11516809"
     CDS             join(174310..174462,174582..174801,174844..174995)
                     /locus_tag="THITE_120187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651184.1"
                     /db_xref="GeneID:11516809"
                     /db_xref="InterPro:IPR013251"
                     /db_xref="JGIDB:Thite2_120187"
                     /translation="MSMSTPTPSPTYGDCVASLRTSLSFLESSVATLGAGVQDFPRLS
                     SVLKTVRHYELIPQPTLAAAEASLRDEIGPFVALLLDRADRHLERQARRIETLKARAE
                     LNAGRLSHYPPSSSGGGGRAGSGSGKPLDGGAALRAKVVRQRKEALKYSVERLELEVQ
                     QKERELRLRLEQQP"
     gene            complement(176061..177599)
                     /locus_tag="THITE_2111184"
                     /db_xref="GeneID:11516810"
     mRNA            complement(join(176061..176918,176989..177273,
                     177350..177599))
                     /locus_tag="THITE_2111184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651137.1"
                     /db_xref="GeneID:11516810"
     CDS             complement(join(176412..176918,176989..177273,
                     177350..177445))
                     /locus_tag="THITE_2111184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651185.1"
                     /db_xref="GeneID:11516810"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="JGIDB:Thite2_2111184"
                     /translation="MEYSRAQYGRKRMSLGNIIGDPFALATLSIATLAWIISLVATIL
                     ARIQIPEGFPTYTYWTIVFYFVLIPGVFVVVASDSAQTYHVALVGFLGCALVLSSSAV
                     NNLIYVNNSACEAASAGFILLSMVTIVWIFYFGSAPSALPRAYIDSFALTKESTSTNR
                     QTMPSGYGSRRPETSTSVQPPQMYTSQLNGLENPSPVGGMTSTMRNSTTAPAFAGSAQ
                     KTAAQPVNPDAEIVPPTEYPYRAKAIYSYEANPEDANEISFSKHEILEISDVSGRWWQ
                     ARKENGETGIAPSNYLILL"
     gene            178743..179307
                     /locus_tag="THITE_2111187"
                     /db_xref="GeneID:11516811"
     mRNA            join(178743..178878,178934..179307)
                     /locus_tag="THITE_2111187"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651138.1"
                     /db_xref="GeneID:11516811"
     CDS             179027..179296
                     /locus_tag="THITE_2111187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651186.1"
                     /db_xref="GeneID:11516811"
                     /db_xref="JGIDB:Thite2_2111187"
                     /translation="MHKNAAILNSDGPSYQVSLRGQACICSDGKTAARRKLDWLETEP
                     NSEPDAPGHGLMQGHARFDWHPRASDWQMETRRNLKTPSREACDW"
     gene            complement(180602..>181955)
                     /locus_tag="THITE_133565"
                     /db_xref="GeneID:11516812"
     mRNA            complement(join(180602..181664,181775..>181955))
                     /locus_tag="THITE_133565"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651139.1"
                     /db_xref="GeneID:11516812"
     CDS             complement(join(181225..181664,181775..181955))
                     /locus_tag="THITE_133565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651187.1"
                     /db_xref="GeneID:11516812"
                     /db_xref="JGIDB:Thite2_133565"
                     /translation="MDHSLDQTTLATISLLEARLLRIEHILYGPSTPPTEPPAESATT
                     SLAELEHRFNQLLRHFHKSHPTLFQSPSNPPSIATTPTPAATIPTQLPPEAVRATVLA
                     YASAFPTTASALTAATTDTPVPDAQQSAALAALGPRLRAVAALQRAQSAEMAALRRRS
                     ERALRAWYEGGVLRYGDVLADVEGRFEKVERAVRRAARAREEEGKV"
     gene            complement(182633..182705)
                     /locus_tag="THITE_t82"
                     /pseudo
                     /db_xref="GeneID:11516813"
     tRNA            complement(182633..182705)
                     /locus_tag="THITE_t82"
                     /product="tRNA-OTHER"
                     /note="Anticodon: TAT at 182673-182671"
                     /pseudo
                     /db_xref="GeneID:11516813"
     gene            complement(192073..192856)
                     /locus_tag="THITE_2111189"
                     /db_xref="GeneID:11516814"
     mRNA            complement(join(192073..192571,192674..192856))
                     /locus_tag="THITE_2111189"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651140.1"
                     /db_xref="GeneID:11516814"
     CDS             complement(join(192280..192571,192674..192753))
                     /locus_tag="THITE_2111189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651188.1"
                     /db_xref="GeneID:11516814"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2111189"
                     /translation="MADHENEIIKCRFWNCAKQFETAEELRDHIAEDHPGDNVCEHCG
                     QAFLDKGSQAFHKKKHDAPTAFKCFIDGCDHAYWRADSLGTHLLSKHGELIRQAVDQF
                     RKFGPHDLVTHSPPFVIEARD"
     gene            193316..195503
                     /locus_tag="THITE_2111190"
                     /db_xref="GeneID:11520851"
     mRNA            join(193316..193492,193571..193650,193709..194292,
                     194353..194512,194589..195503)
                     /locus_tag="THITE_2111190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651141.1"
                     /db_xref="GeneID:11520851"
     CDS             join(193732..194292,194353..194512,194589..195337)
                     /locus_tag="THITE_2111190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651189.1"
                     /db_xref="GeneID:11520851"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="JGIDB:Thite2_2111190"
                     /translation="MPLAMSHFGAMLGVFLILWCGLTSAFGLYLQARCARYLDRGSSS
                     FFALSQITYPNAAVVFDAAIAIKCFGVGVSYMIIIGDLMPGVAEAFGSADMGWPFLDD
                     RKFWITAFFLLFIIPLSFPRRLDSLKYTSVVALLAIGYLIILVVYHFSVDELPNKGNI
                     RVITWEGPVAALSSLPVVIFAYTCHQNMFSILNEIKDNSPGSIVAVIGTSIGTAASVY
                     ILVAITGYLTFGSDVKGNIVGMYPPSVASTIAKAAIVALVTFSIPLQIHPCRASIDAV
                     LRWRPISSQRPQSVLSAASGSQPLLPSSSAPALVDSHGAPVVAMSELRFALITSGILA
                     LSYLTALNVSSLDRVLAYVGSTGSTAISFILPGLFYYKISDPDSIYHQRLSKEDDDVD
                     LDADSDDDAGGGVLDRDDDDEPGLRGSVASLRSVRSGASAASSRSRSSRWRWRWRRKW
                     RWDLEHLETGLLRRLSLCLSVYGVCVMCVCLVMNSVFAH"
     gene            complement(196364..197063)
                     /locus_tag="THITE_2111195"
                     /db_xref="GeneID:11516815"
     mRNA            complement(join(196364..196464,196625..196805,
                     196876..197063))
                     /locus_tag="THITE_2111195"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_003651142.1"
                     /db_xref="GeneID:11516815"
     CDS             complement(join(196387..196464,196625..196805,
                     196876..196952))
                     /locus_tag="THITE_2111195"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_003651190.1"
                     /db_xref="GeneID:11516815"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="JGIDB:Thite2_2111195"
                     /translation="MVVKIRLARFGRTNAPFYNIVVAQARSARNSRPIEVIGTYDPIP
                     KKDPYDESGKLHKDIKLDTTRAKYWIGVGAQPTDPVWRLLSMLGILPPKPRPGATASP
                     KMLPQADKA"
     gene            <197408..199891
                     /locus_tag="THITE_129386"
                     /db_xref="GeneID:11516816"
     mRNA            join(<197408..197419,197579..197687,197761..197826,
                     197889..197983,198283..198379,198463..198691,
                     198820..199385,199466..199891)
                     /locus_tag="THITE_129386"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651143.1"
                     /db_xref="GeneID:11516816"
     CDS             join(197408..197419,197579..197687,197761..197826,
                     197889..197983,198283..198379,198463..198691,
                     198820..198922)
                     /locus_tag="THITE_129386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651191.1"
                     /db_xref="GeneID:11516816"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="JGIDB:Thite2_129386"
                     /translation="MALKTLSAKAAAALDKELMSTGAFSIDQLMELAGLSVSQAVSRV
                     HPLSKGRRILVAVGPGNNGGDGLVAARHLRHYGYQPAVYYPKRPKNDLYQRLAKQLED
                     LDVPFVDDFPAALQSADHVIDAIFGFSFSGEVREPFPAVIQAMAETQVPVTSVDAPSS
                     WDIEEGPPKSGVGSNFHPAVLVSLTAPKPLVKHFRGRHFIGGRFVTPAIAKKYDFEVP
                     AYEGIDQIVEVGPDGLKL"
     gene            complement(204038..206161)
                     /locus_tag="THITE_2111204"
                     /db_xref="GeneID:11516817"
     mRNA            complement(join(204038..205152,205243..206161))
                     /locus_tag="THITE_2111204"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003651144.1"
                     /db_xref="GeneID:11516817"
     CDS             complement(join(204204..205152,205243..206063))
                     /locus_tag="THITE_2111204"
                     /note="CAZy_ID 269685"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003651192.1"
                     /db_xref="GeneID:11516817"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Thite2_2111204"
                     /translation="MCLPRPFHAPAVALLAWSALVRHAAAQVTTDCFPMNKTCPPDIA
                     FGTDYNFNFTSQPNVDVWETTVNPVEWDPDAGAIFRITKQGDSPTIRTKFYYFWGRTE
                     IHMKAAKGTGVISSMMMLSDNLDEIDWEFFGGNDTIAQSNYFGKGVPDFHNAGLHTVP
                     GGVHDDYHNYTTVWTKDSLLFYIDDQLVRTLLPKDANNSYYYPQTPMRLSIGIWAGGD
                     PRLPNGTREWAGGTTDYSQGPFEMYVKSAHITDFSSGKEYEYTDRSGSWESIKIIAGN
                     STIKDEVNAPPAMTLSQRWNALPTGAKIAIYACAGGFGGLLIIAALYYCIRQRRRGAR
                     EAKAAEARAEAERLELERFKKAGVDPDSFVSSASEYNAKEMQRDHLAGKDGYSVPPSP
                     TMTAIDPASPLDNRWNPPAAMSPLAMGEAAAAMRSPGPQSPHAASANNYPDRPGSSHS
                     NMSSRRSPAPPGGGFNPHERGTRSPAPSSPRHAPSPAPSMRQQQQFAQSPPNRSYTAP
                     SAQMRRGTPAPPAQPQHDFDAGAGIHRSASPAQLAHPQPQRSFTTGGFGGGPDNNRGY
                     DGGGGGGGGGGNQGYWGDGARYR"
     gene            <207790..>209025
                     /locus_tag="THITE_37317"
                     /db_xref="GeneID:11516818"
     mRNA            join(<207790..208888,208916..>209025)
                     /locus_tag="THITE_37317"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651145.1"
                     /db_xref="GeneID:11516818"
     CDS             join(207790..208888,208916..209025)
                     /locus_tag="THITE_37317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651193.1"
                     /db_xref="GeneID:11516818"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="JGIDB:Thite2_37317"
                     /translation="MPSKTSADRSKRLHVNRRCYPCHQCNRCFGTAEARSQHQRDSPV
                     HNNPGAQTIPLNPMLTPAQHLAPRAAAKQLEPTLATPPPTATPLCYRGNEYTSLRPSL
                     HNPLYALLLAHCLTPSRLALEKYPLPSPTTPSPPPAKPPSSSTSTTTTLPKPRAIVLD
                     CEMAGTGPSRAREEVIVLSAIDFFTGATLLHTLVCPARPVTDWRTAITGVTARAMAAA
                     VARGEALAGREAAVAALWTVVDSETVVVGHALWHDLRALGVSCARVVDSAVLTAQAAG
                     VVAEGERVRQPAGLQKLCRELVGLEIREGGRGKHDSLEDVLATREVVLWCLRHPEELG
                     AWAAENWGDKGKGLDRKGGTGRGQGGRWGRGRNVYGNGSDDDDGDEVLLWEDVVDWDM
                     WPKSPPDWSD"
     gene            complement(<209257..>210951)
                     /locus_tag="THITE_2016321"
                     /db_xref="GeneID:11516819"
     mRNA            complement(join(<209257..209527,209615..210012,
                     210088..210313,210394..210614,210694..>210951))
                     /locus_tag="THITE_2016321"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651146.1"
                     /db_xref="GeneID:11516819"
     CDS             complement(join(<209257..209527,209615..210012,
                     210088..210313,210394..210614,210694..>210951))
                     /locus_tag="THITE_2016321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651194.1"
                     /db_xref="GeneID:11516819"
                     /db_xref="JGIDB:Thite2_2016321"
                     /translation="NNNTSDITGWVSSNTSRGSIDILWSCSVTMVLCCWVSTYPSVPS
                     PRDKWYHPLIDKFNLACLGLLGPELLFGMALGQLSSARKSVRLFRSLPRAPQGRKWTL
                     THAFYADMGGFHLISPDYPAFPVSAAQLYYLVKHGHVDFPELSKVDIKAINKADSLSK
                     LIIIWQAFWFCVLELQRVKQGLPMTPFELTALSFSATMFLSSLCWYAKPSVSRPTMLY
                     TRDGRSIEDIRAAARATTHPGLPSEWYRTPLDFLTPYRRFRVAVHWAYYNQLSYMVHL
                     PIMSRQITARPWDRLPSDAVYIIADRDLQALGLVFCLAFSATPLIAWNFFFPTQGEQI
                     AWRVCSVYNTSFSLYCSMYYAVTGLYELNAASKNQPIPDAEAGVVASSEKAPSRFRRM
                     VRSTTAWLRSWRNISPDGNPDMEMKLREAFPPLIPTFLFLCCRVFFYLENFVAIRQQP
                     IGVYQGVN"
     gene            <211584..>212228
                     /locus_tag="THITE_2086349"
                     /db_xref="GeneID:11516820"
     mRNA            join(<211584..211605,211830..212068,212127..>212228)
                     /locus_tag="THITE_2086349"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651147.1"
                     /db_xref="GeneID:11516820"
     CDS             join(211584..211605,211830..212068,212127..212228)
                     /locus_tag="THITE_2086349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651195.1"
                     /db_xref="GeneID:11516820"
                     /db_xref="JGIDB:Thite2_2086349"
                     /translation="MSPPVDRDPGNTRVSECGSVGCSGPQISQYDHTLLVEEHVSPSV
                     AEQMQFVNKHASMRWETEFLDVKVKDYSPSTSCRCCGCSSSAIVADAGAFLHQKHWRY
                     VAVTANKPGPRTEAAKTE"
     gene            complement(212566..212644)
                     /locus_tag="THITE_t81"
                     /db_xref="GeneID:11516821"
     tRNA            complement(212566..212644)
                     /locus_tag="THITE_t81"
                     /product="tRNA-Thr"
                     /note="Anticodon: CGT"
                     /anticodon=(pos:complement(212610..212612),aa:Thr,seq:cgt)
                     /db_xref="GeneID:11516821"
     gene            complement(213511..214456)
                     /locus_tag="THITE_2111207"
                     /db_xref="GeneID:11516822"
     mRNA            complement(213511..214456)
                     /locus_tag="THITE_2111207"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651148.1"
                     /db_xref="GeneID:11516822"
     CDS             complement(213735..214427)
                     /locus_tag="THITE_2111207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651196.1"
                     /db_xref="GeneID:11516822"
                     /db_xref="JGIDB:Thite2_2111207"
                     /translation="MSACSILRLPDEVLEEVIHGAAAWSDDAENYGFYELYAGRAALA
                     RVCRRFHVLAQPILYSCIALGPVHPRVEGERGDAAAIQLGNSIARLLRTVQENPRLAR
                     LCVELVIDVEACFEHLNVLCTLIASLSRTRSLRIRHGFKEVEFTATWACLSAALANMR
                     DLEHLAFTAGRRPMNMQHVVAMLRTTLTVERYPGIKELELVGVNRSVLPVRIELWVLL
                     LIPVMQAKKTTQ"
     gene            216031..216976
                     /locus_tag="THITE_2111208"
                     /db_xref="GeneID:11520850"
     mRNA            join(216031..216136,216243..216976)
                     /locus_tag="THITE_2111208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651149.1"
                     /db_xref="GeneID:11520850"
     CDS             join(216135..216136,216243..216549)
                     /locus_tag="THITE_2111208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651197.1"
                     /db_xref="GeneID:11520850"
                     /db_xref="JGIDB:Thite2_2111208"
                     /translation="MKMPANPGCLRWPGCLRWPGCPRWPGCPRTQDARVGQDAREPRK
                     MPANPGRCPRTQDACVGQDARVGQDAREPRKMPALARRMPASPGYPRSSSLQAIFYTL
                     "
     gene            <218690..>219531
                     /locus_tag="THITE_2020004"
                     /db_xref="GeneID:11517091"
     mRNA            join(<218690..218859,218925..>219531)
                     /locus_tag="THITE_2020004"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651150.1"
                     /db_xref="GeneID:11517091"
     CDS             join(<218690..218859,218925..>219531)
                     /locus_tag="THITE_2020004"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651198.1"
                     /db_xref="GeneID:11517091"
                     /db_xref="JGIDB:Thite2_2020004"
                     /translation="EDAASATEPAPERPMVPTSAADWESKKPIIRKLYMDQNLILNEV
                     IEIMLKKHKFKATARMYKGQFAKWKWTKYNKTGKHSAIKPSKSRSTKGKSARSRLETP
                     DRRVYIPGRSGIGARMLQLAPLSQHHHLQYFGDEDCQVESTLSAYAALILHWSERETP
                     WKTDDAGHLLRPQRQSVLQHVRAAQEHFVHGRAQLGGELLRRAFLGIEAAVESALEVE
                     ALWDCCLAVPQLVLTLGWSDMLTIFARYLHQFTSIKLPGHP"
     gene            <221927..>222673
                     /locus_tag="THITE_120177"
                     /db_xref="GeneID:11517092"
     mRNA            join(<221927..222187,222317..>222673)
                     /locus_tag="THITE_120177"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651151.1"
                     /db_xref="GeneID:11517092"
     CDS             join(221927..222187,222317..222673)
                     /locus_tag="THITE_120177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651199.1"
                     /db_xref="GeneID:11517092"
                     /db_xref="JGIDB:Thite2_120177"
                     /translation="MSERGPGKEQLSDIAQQAERDLNTYQSKTGTGKGRVPGLEDYGV
                     NETVERKFPGATVKVGENLVTNRSYDRPIPADEGGDVDERGRSHSSGKIDEATVKGWG
                     KDPRQLEGETVRADRPDLLPADQALGGRGREPAKQGDVSEQGRLAAKANVGLPAESGR
                     EVPAQGSRGSQFKGEYYESPESVPDQGADQNLVPPESATETSRNT"
     gene            complement(<222807..>224010)
                     /locus_tag="THITE_37820"
                     /db_xref="GeneID:11517093"
     mRNA            complement(join(<222807..223238,223299..223624,
                     223878..>224010))
                     /locus_tag="THITE_37820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651152.1"
                     /db_xref="GeneID:11517093"
     CDS             complement(join(222807..223238,223299..223624,
                     223878..224010))
                     /locus_tag="THITE_37820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651200.1"
                     /db_xref="GeneID:11517093"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="JGIDB:Thite2_37820"
                     /translation="MGDNAAASDPPSGTDSPAQRATPRMTPKSSAANNKRVVRILMLH
                     GFTQSGPLFRAKTRALEKLLAKALAPAGLVPALLYPTAPNRLSPRDVPGYQPPPLGPS
                     TGAVAGEEGDGGDGDEGEMDAWAWFRRDDASGRYRFLEEGMVRVAEAVRDGSGGIDGV
                     IGFSQGGCMAAMLASAMEEGRAVGAPEHERWVSAVRAANGGRPLKFAVIYSGFYAVPE
                     DLAWLYKPPIRTPTLHFLGSLDTVVDESRSQGLVERCQDPVVLTHPGGHYVPISKEWA
                     MPLAGFIKKCVESAGDGTKL"
     gene            complement(224219..225588)
                     /locus_tag="THITE_2111216"
                     /db_xref="GeneID:11517094"
     mRNA            complement(join(224219..225026,225084..225134,
                     225241..225270,225342..225588))
                     /locus_tag="THITE_2111216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651153.1"
                     /db_xref="GeneID:11517094"
     CDS             complement(join(224974..225026,225084..225134,
                     225241..225270,225342..225390))
                     /locus_tag="THITE_2111216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651201.1"
                     /db_xref="GeneID:11517094"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="JGIDB:Thite2_2111216"
                     /translation="MSWFGVTPLKKFPTPVLRPMAPFLAAAVVIAYGVNAAQNAMMQS
                     EEFKNDPRNPNLKAAH"
     gene            226143..227571
                     /locus_tag="THITE_2111218"
                     /db_xref="GeneID:11517095"
     mRNA            join(226143..226891,226965..227571)
                     /locus_tag="THITE_2111218"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651154.1"
                     /db_xref="GeneID:11517095"
     CDS             join(226282..226891,226965..227449)
                     /locus_tag="THITE_2111218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651202.1"
                     /db_xref="GeneID:11517095"
                     /db_xref="InterPro:IPR012577"
                     /db_xref="JGIDB:Thite2_2111218"
                     /translation="MLSQRVSRTALGAARQAQAPTIRTFTASAASRSDRTPSLGDIQP
                     DQHETFNSRQKTFRAQLVEAQKQREASGFASSSSPSFSSSYSSSTAQGLGSLSTATAG
                     TGNAARAAEKEPPRKAGPLTNLIYGTKEGRELDAQIEASFSQVLARGKYVHSIEFHEV
                     KPDCVDEYVDLVGNWYPRVASSPENKVHLVGSWRTEVGDCDTFVHIWEYQRYQGFHAS
                     LNTISRNPQFPDFDKKLRSLIRSKRTSLMQEFSFWPTTPPRKLGGLFELRSYTLHPGN
                     LLEWETHWRRGLKARREVMEGVGAWFVQIGDLNTVHHLWQFADLEERKIRREKSWSIE
                     GWAETVHKTVPLIQEMKSRILVPMPWSPVA"
     gene            complement(228056..229715)
                     /locus_tag="THITE_2111221"
                     /db_xref="GeneID:11517096"
     mRNA            complement(join(228056..229006,229082..229715))
                     /locus_tag="THITE_2111221"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651155.1"
                     /db_xref="GeneID:11517096"
     CDS             complement(join(228068..229006,229082..229318))
                     /locus_tag="THITE_2111221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651203.1"
                     /db_xref="GeneID:11517096"
                     /db_xref="JGIDB:Thite2_2111221"
                     /translation="MDASWVLIGSSPAPPEQKRELDWLIEELHETLTNVRHGLEDCYA
                     LLAPVDPGSTLVLSTPRNEIVKGHITRVGTRIVKGTIHLRLRTLPHQTLTINPDHPIH
                     LAPLTALHALLTHSIDLLNLTFSYAYPDSDAPATPSSLLGSLPPPQFLSAQLRLLSQT
                     LAEASSLLKGAPLPTADPTWTTRSAAPSHFLPPLAHPTPSSSNPSLSFHLSIQDSCLV
                     LWLRTLEPASAPVNFGTKLALAIGTARRLEHDETEKVFGYCCDGDDGGDDHHTTTSTA
                     SGSVTAQPGPAHSPGPAPSLFPPAQAPALAPTIPLSGTRDSNNKNNKNTSSSRKNIIE
                     VFVREKVRVETADPSLLSLSAKLTALGHTLAVARRNLAAVMGEEWGEPGEDGEQPMD"
     gene            230008..230901
                     /locus_tag="THITE_2111223"
                     /db_xref="GeneID:11517097"
     mRNA            230008..230901
                     /locus_tag="THITE_2111223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651156.1"
                     /db_xref="GeneID:11517097"
     CDS             230225..230620
                     /locus_tag="THITE_2111223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651204.1"
                     /db_xref="GeneID:11517097"
                     /db_xref="JGIDB:Thite2_2111223"
                     /translation="MSLVRRVRKALEKRTQAQASTKRLPLAARVAAVKAAASAPGAGT
                     GGGAGGNGAAAEDALDDVVLVATGKAIARAVEVGGFFTRERDLLVLVRTRTLQAVDDV
                     VAGDEDGDGEDQVRVRNVSCVEVGIRWAS"
     gene            233676..234939
                     /locus_tag="THITE_2169795"
                     /db_xref="GeneID:11517098"
     mRNA            join(233676..234863,234880..234939)
                     /locus_tag="THITE_2169795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651157.1"
                     /db_xref="GeneID:11517098"
     CDS             234091..234411
                     /locus_tag="THITE_2169795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651205.1"
                     /db_xref="GeneID:11517098"
                     /db_xref="JGIDB:Thite2_2169795"
                     /translation="MHLPTIFTALLLPLAAVAQEVTTTSTSTVTITKTLTLQRAVVTV
                     PSNTTSFHPTAPSAPSTTLTQPSATGAGASISPTPNAAGPALGAAAHVAAAAVAGVIA
                     AALL"
     gene            complement(<237030..>239625)
                     /locus_tag="THITE_120170"
                     /db_xref="GeneID:11517099"
     mRNA            complement(join(<237030..237080,237129..238433,
                     238485..239086,239160..239399,239466..>239625))
                     /locus_tag="THITE_120170"
                     /product="glycoside hydrolase family 55 protein"
                     /transcript_id="XM_003651158.1"
                     /db_xref="GeneID:11517099"
     CDS             complement(join(237030..237080,237129..238433,
                     238485..239086,239160..239399,239466..239625))
                     /locus_tag="THITE_120170"
                     /note="CAZy_ID 269753"
                     /codon_start=1
                     /product="glycoside hydrolase family 55 protein"
                     /protein_id="XP_003651206.1"
                     /db_xref="GeneID:11517099"
                     /db_xref="JGIDB:Thite2_120170"
                     /translation="MKCAFALLWAMALVATATYWMEEIRHQGVAPFNPENGYQVFRNV
                     KEWGAKGDGAINAAISSGRCGGPRCIGSTTTPAVVYFPPGTYLITTPIVGFYYTQIIG
                     DPTDMPVIKGAPSFPTEAIGLLDADPYMDNGKLNFQATNVFFRQLRNLVFDTRAIRGT
                     AIAVHWPSSQATLIQNCAFRLSSHPEDNHVGIFMEEGSGGMMTDLVFYGGKRGALFGN
                     QQYTMRNLTFYGSDTAIEQIWNWGWTYKSLNVVGCRVGINMSSQDVGSVTLLDSSFVN
                     VGTALVTGKTPGNATGLGSLVIQNVAYTNVPIVLQASDGQPLLLGDANGTVYDAGYAR
                     GNIYTPHGPALLEGRGFPFSQPSTLKLGDRYYERSKPQYEHCPASSFLSSRDYHAAGN
                     GKADDTTPLNNLFRTAADSSYIAFLDAGYYLVTDTVFIPPNTRVVGEALAAVIMGVGS
                     KFSDPRNPRPVVQVGRPGDVGLVEISDIIVSTQGPAAGAILIEYNLNTPAAENMCNPN
                     SPPSGLWDVHVRVGGFAGSQLQVAECPVTPDRPNYVNPACIAGYMSMHITPSARNVYM
                     ENNWVWVADHDIDDRESTKISVFVPRGLLVEGARVWLVGSSVEHHTLYQYQLVNAADV
                     WMGQIQTETPYYQPNPPAPFPFALLNPALHDPDFGLDCQPGPFHSSPSTLAGGPPCAM
                     AWGLRILNSRNVVVFGAGLYSFFNNYATNCSTARAGETCQARILWIGPEGPPSGSAAH
                     ANGIGTGGGRGSGGAPLGVELYNLNTIGSNRATFASTLAAFRCGL"
     gene            <240067..>242634
                     /locus_tag="THITE_2086360"
                     /db_xref="GeneID:11517100"
     mRNA            join(<240067..240131,242334..>242634)
                     /locus_tag="THITE_2086360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651159.1"
                     /db_xref="GeneID:11517100"
     CDS             join(240067..240131,242334..242634)
                     /locus_tag="THITE_2086360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651207.1"
                     /db_xref="GeneID:11517100"
                     /db_xref="JGIDB:Thite2_2086360"
                     /translation="MPTVRNVPVSHSGASQPELFHNPTILAKMVHALNTAVTALAGTS
                     IATAAQGSQQHEPAKNIAAPFSPTTASNSTTSTSIQTPPASASVVEHKYHEICHPCHC
                     AGKNASEIAALNSQRQQHG"
     gene            complement(<243150..>244147)
                     /locus_tag="THITE_2142658"
                     /db_xref="GeneID:11517101"
     mRNA            complement(join(<243150..243396,243459..243815,
                     243906..>244147))
                     /locus_tag="THITE_2142658"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651160.1"
                     /db_xref="GeneID:11517101"
     CDS             complement(join(243150..243396,243459..243815,
                     243906..244147))
                     /locus_tag="THITE_2142658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651208.1"
                     /db_xref="GeneID:11517101"
                     /db_xref="JGIDB:Thite2_2142658"
                     /translation="MVHLQYYSVAVSLLLPSWVAAQNCTLQFDGRVPSDLVAADFDSP
                     NKFFSEKFVLGQGLKFDQALRVLPVAGGSLVRSAHPNDSSIFNSQVGFRRAELIPASN
                     DGTDPSTQGVKTLHFSVKKDAARPLNLSHEYQLVFLESNDFSTNQFVLKTGTILGQNT
                     ADPDTLQVFGNVNQGQLLFSTPFVDGVFHNFALKLDFDQSTTQVFFSAGEDPLKAVTD
                     VLKNDLSGQGQFHFGVLKKPVGGQGDITKNGFQEAGINEGIIFGGIFEEDSADGCITL
                     AGQKA"
     gene            244877..246369
                     /locus_tag="THITE_2111226"
                     /db_xref="GeneID:11517102"
     mRNA            244877..246369
                     /locus_tag="THITE_2111226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651161.1"
                     /db_xref="GeneID:11517102"
     CDS             244990..246213
                     /locus_tag="THITE_2111226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651209.1"
                     /db_xref="GeneID:11517102"
                     /db_xref="InterPro:IPR001466"
                     /db_xref="JGIDB:Thite2_2111226"
                     /translation="MAGPTDFGESIETAFGAAIAAGKIRGAVICATDAAGNFVYDRAL
                     GERTLLSGEKRPQQLDDILYLASATKLITTVIALQCVEDGLLTLAGDLSALAPELARK
                     QVLPPEGSGASELEPAARPITLEMLLTHTAGTAYGFLVPRLAAWREAHKDAADDGAAR
                     DPLAFQPGTGWMYGSGLDWAALVVERATGTTVDELVRRRVCAPLGIAPEDAQFYPVQG
                     DAARARMVDLNPDDPEGLGRAVIGGAGLVKNSTGPFGGHGLFMTGAAYVKVLRSLLAN
                     DGKLLRPETVEDMFRDHVGAEAAANFRAAMEGPGSEFFRVGTAPGSRVGYGLGGLLTL
                     ENVEGWYGERTLTWGGGFTFTWFIDRKNDLCGLGAVQAALPLDFDLVAELKQTFRYDI
                     YRKHAAWKKERQQAA"
     gene            complement(<246526..>247255)
                     /locus_tag="THITE_2086363"
                     /db_xref="GeneID:11517103"
     mRNA            complement(join(<246526..246539,246607..>247255))
                     /locus_tag="THITE_2086363"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651162.1"
                     /db_xref="GeneID:11517103"
     CDS             complement(join(246526..246539,246607..247255))
                     /locus_tag="THITE_2086363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651210.1"
                     /db_xref="GeneID:11517103"
                     /db_xref="JGIDB:Thite2_2086363"
                     /translation="MPLFSRHAEPAQQPATQPQPQTQPGYEERPKKHGLFRSHHQTAP
                     QPQPQAQAQAQPAYEEQPKRHGLFGSRRHAPAQTTPNGINGAYAAAPAATSPDRAAGG
                     GGGGGGVFRRPTDASTINSQRGSSVLRRSLGNGNGNGTIDELDDPTIAQARERVMSAE
                     AAKAEADRALMAARQSVCEAREHVRRLELEAREEARRAKIKQLQAKEVSKRGKALGRH
                     DP"
     gene            <248577..>248867
                     /locus_tag="THITE_2030109"
                     /db_xref="GeneID:11517104"
     mRNA            join(<248577..248682,248752..>248867)
                     /locus_tag="THITE_2030109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651163.1"
                     /db_xref="GeneID:11517104"
     CDS             join(<248577..248682,248752..>248867)
                     /locus_tag="THITE_2030109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651211.1"
                     /db_xref="GeneID:11517104"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2030109"
                     /translation="IVVERLTKNVNEDHLYEIFGQYGEIDDLDLPVNRQSGLNRGTAY
                     ILYFNEADAQSAITHMHEAQLDGSIIHVSI"
     gene            <251330..>252092
                     /locus_tag="THITE_153619"
                     /db_xref="GeneID:11517105"
     mRNA            join(<251330..251390,251737..>252092)
                     /locus_tag="THITE_153619"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651164.1"
                     /db_xref="GeneID:11517105"
     CDS             join(251330..251390,251737..252092)
                     /locus_tag="THITE_153619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651212.1"
                     /db_xref="GeneID:11517105"
                     /db_xref="JGIDB:Thite2_153619"
                     /translation="MAATALRGLAATSFVTAHLPDTHHTGSIYPASLAQPQQPPTHRP
                     SDRYQLTIPPPKMPNPATPRRRGHDRHARHANPNTNANSDLTNAIRMSGRPPTPNPQP
                     RPGPLGPAPRPDNPTPPPSPGPTPPPTPPNPPAPQN"
     gene            254203..258335
                     /locus_tag="THITE_2111231"
                     /db_xref="GeneID:11517106"
     mRNA            join(254203..257086,257154..258335)
                     /locus_tag="THITE_2111231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651165.1"
                     /db_xref="GeneID:11517106"
     CDS             join(254436..257086,257154..257910)
                     /locus_tag="THITE_2111231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651213.1"
                     /db_xref="GeneID:11517106"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Thite2_2111231"
                     /translation="MPHPVSPPTAVAAVPPATATVTVPIKAPDGTVPPPTQADVDSLL
                     TTIFTAKTSSASIDACYDLCELLLASVGFRGLHQYGILAEVKKAAADKKSGLRRESAQ
                     NLLGALFERFPPRQPVSEIVFLLQDGGMLGCALDALADKGSIVRDAAQYGIDALFANL
                     SPEAMVVGLLPALTEYIKKAGGKWQGVVGAFKLMQKMADKAQITIGGTKEEAQEKEFL
                     REAMGAKLAGLIPIVENGMLDMKSEVEKQAVKTMTSLTSLLSNDDVAPRIPLLIDSMH
                     HPSPETLQKAIHALSQTTFVAVVTSPVLALLTPFLERSLNNPTTPQEVLRQTVVITEN
                     LTKLVHDPIEARTFLPKLQPGVKSVVGRASLPEVRELATRALAVMDKAMGDEKTAVVE
                     RTTAHDVTKVLDAEFKSNDLKAFDQGTYELVLPYVCEMVSEDVNHRQLDRIPARIAPY
                     LQSIITPASAETVAAAVHKLYVEEDRRKYGVPEKEDDGEVEIVNADFSLGYGGRLLLS
                     HTNLRLLKGHRYGLCGRNGAGKSTLMKSIAAGKLEGFPPQDVLRTCYVEHNQGEDADI
                     SILEYVSKDPTIAKEGKERISAVLEEFGFTSGPEGRQSQKVGSLSGGWKMKLALARAM
                     LQRADVLLLDEPTNHLDVANIKWLENYLKTHTEITSLIVSHDSGFLDEVTTDIYHYEP
                     NKKLSHYKGNLAAFVKVRPEAKSYYTLSASNVQFKFPPPGILSGVKSQTRAIIRMTNV
                     SYTYPNAPKPSLIDVSCQLSLSSRVAIIGPNGAGKSTLIKLLTGEVIPTSGKVEKHPN
                     LRIGYIKQHALEHVEMHLEKTPNQYLQWRYAHGDDREVHMKQTRILSDKDREQMDKFI
                     DVGDGKGKRQIEALVGRQKYKKTFQYEVKWRGFLPKHNTQISRETLLDLGFAKLVQEF
                     DDHEASREGLGYRELQPSVIAKHFEDLGLDPEIANHSEIGSLSGGQKVKVVIAGAMWN
                     NPHLLVLDEPTNFLDRDSLGGLAVAIRDFKGGVVMISHNEEFVGALATEQWHVLDGRV
                     THRGHAALALDRFEDSGLSTPVPSSSAVSSAVNSGAEDNGSAAASTAAAAPGVTGESM
                     AFRAKKKKKMTKKELKEREVRRRLRHIDWLNSPKGTPRPPDTDDEAE"
     gene            complement(258727..262156)
                     /locus_tag="THITE_2111232"
                     /db_xref="GeneID:11517107"
     mRNA            complement(join(258727..258766,258832..259169,
                     259266..261314,261386..261956,262076..262156))
                     /locus_tag="THITE_2111232"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651166.1"
                     /db_xref="GeneID:11517107"
     CDS             complement(join(258981..259169,259266..261314,
                     261386..261826))
                     /locus_tag="THITE_2111232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651214.1"
                     /db_xref="GeneID:11517107"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="JGIDB:Thite2_2111232"
                     /translation="MGIGSYFKAEKPEPKSQSQATPSSPSRNSNNARHHQQPSMSENP
                     TSAPSLRPDSELHPPTPRYSSRPQSISGRSVKSTGSSLFLDDIKHEVMVNYLYQQQCS
                     HLWVSDGSGEIEGVLLRKSRGQYMACPPQLGNSPFAAACAALNVQCAMTVNSRVIKTF
                     LAWSPDAVDVPLMNGLRVQILPTVDDLPRARKHQFAAFVASEGLLVVWDDDALHLVQR
                     AKAIESELMELVWKAGAEEDGDEKAGSVVEEPEVDEESGELKPEKRPVHLLNTYLVSL
                     TLILVTVSLGAAFRQLAIEISVDGSYVRLALVALFPVQIFFTLFFAQVIVGCLAQIFG
                     PIRQLTVNSKFYSARPPPRLRSAVLPHVTVQCPVYKEGLAAVIAPTVKSIKQAMSTYE
                     LQGGSANMFINDDGLQLISEEDRRARIEFYADHSIGWVARPKHGENGFKRRGKFKKAS
                     NMNFALMISCRVEDKLAAIQRPPDWTQHDEALAYERALKEVLEEDGRAWADGNIRVGD
                     YILLIDSDTRVPPDCLLDAVSEMELSPDVGIMQFSSGVMQVVHTYFENGITFFTNLIY
                     SAIRYTVSNGDVAPFVGHNAILRWSAIQQVSYTDEDGYEKFWSESHVSEDFDMSLRLQ
                     CNGYIIRLAAWAGDGFKEGVSLTVYDELARWEKYAYGCNELLFHPIRQWLWKGPFTPL
                     FRRFLFSNIRFTSKITVISYIGTYYAIGAAWIMTSVNYFLMGWFNGYLDKYYVDSWQV
                     WFSIILVFNGLGNIALAVMRYRVGERNILYALYENFKWTFLLAIFLGGLSLHVSQALL
                     AHMFEIDMTWGATAKEAEFSNFFIEVPKVLKKFKFSMLFATIFIVGMIILAVGPFIPY
                     SWQIRDFVAILPMATVAASHLLLPLALNPALMTFSW"
     gene            complement(266124..267896)
                     /locus_tag="THITE_2111236"
                     /db_xref="GeneID:11517108"
     mRNA            complement(join(266124..267204,267286..267896))
                     /locus_tag="THITE_2111236"
                     /product="glycoside hydrolase family 16 protein"
                     /transcript_id="XM_003651167.1"
                     /db_xref="GeneID:11517108"
     CDS             complement(join(266268..267204,267286..267800))
                     /locus_tag="THITE_2111236"
                     /note="CAZy_ID 269863"
                     /codon_start=1
                     /product="glycoside hydrolase family 16 protein"
                     /protein_id="XP_003651215.1"
                     /db_xref="GeneID:11517108"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="JGIDB:Thite2_2111236"
                     /translation="MDHTEHFYGRSAAGMPSVASTAAPTPQRPGTPSESVGRNPFGDG
                     VESQASHRSSGNPANPFASPDASRPASSLDSASALGRYDGGQRYFHSRRVRKGEIEKP
                     WTKQADPKEKWVTILPLLGIFIGLAISGVLVWDGIRSVVKHKYCLVLEEDWSNGFNEK
                     IWQKEVQVGGFGNGEFEQTTGGDQNVYIENGNLIIKATPQDDALMQQDYTINLLKDGT
                     CTSKLPADCIAVTNITTGNSSIVPPVLSGRINTRPGATIKYGRVEVTAKLPAGDWLWP
                     AIWMMPRDSVYGPWPQSGEIDLMESRGNNYTYPQGGNNIMSSALHWGPNPANDGWWRT
                     NVKRQALHTTYSAGFNTFGLEWSQKYLFTYVNSRLLQVLYVNFDTPMWSRGNFPTQDA
                     NGTRIVDIWSSTGRDQTPFDQPFYLILNLAVGGTNGWFEDNVNGKPWLDASPNAKKDF
                     WQAKDKWFPTWTQPQMEVSKVMMWQQCDGDEDL"
     gene            269558..269645
                     /locus_tag="THITE_t41"
                     /db_xref="GeneID:11517109"
     tRNA            269558..269645
                     /locus_tag="THITE_t41"
                     /product="tRNA-Tyr"
                     /note="Anticodon: GTA"
                     /anticodon=(pos:269592..269594,aa:Tyr,seq:gta)
                     /db_xref="GeneID:11517109"
     gene            complement(<270193..>271821)
                     /locus_tag="THITE_2049272"
                     /db_xref="GeneID:11517110"
     mRNA            complement(join(<270193..270916,271148..>271821))
                     /locus_tag="THITE_2049272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651168.1"
                     /db_xref="GeneID:11517110"
     CDS             complement(join(270193..270916,271148..271821))
                     /locus_tag="THITE_2049272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651216.1"
                     /db_xref="GeneID:11517110"
                     /db_xref="JGIDB:Thite2_2049272"
                     /translation="MASSKPEQPDSPPKHLHVGAINPFALVEAILGRKVDWDEAATPL
                     LLSSILQTDYEELFDMRFNSVLYAGSRLNERGDAAELIPTKDMHTLTEHDLVTPDFSR
                     VEKLGDLTDVGLKDLQDIKVKHAIMSNGNLRLTLEPRTLGKTLRSSQVTTTLRELCTP
                     YRMHKKEEWTPPNGSWVDISACYRQDATMFTNPVQGAVANSWLIAALMSVAWSDPATI
                     EHCSRRSHKAGECSLSVKLYSKGGDMDAPTSTVTVNCELPTNNSSSLLMYCRPSSMDV
                     MRPAWLRVWGGDIWPALYEKAFAKWLTSSSSSSSEQQHQHPDLTQTSYGDPVKAMAQL
                     TDKEPQYFFTARRRAQDLLGLVRTHSFNLRTIYPTVAWTRPTDATFRGCTLVGNMAYS
                     VLGWAAPQERKQYVILRHPWGVTEPEGVTSYPGLVAAVDAKFWPPIELVDRNGVFAIE
                     KAVFKEYFAGMGVAK"
     gene            complement(273928..275481)
                     /locus_tag="THITE_2111241"
                     /db_xref="GeneID:11514811"
     mRNA            complement(join(273928..274041,274106..274419,
                     274478..275044,275413..275481))
                     /locus_tag="THITE_2111241"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651169.1"
                     /db_xref="GeneID:11514811"
     CDS             complement(join(273971..274041,274106..274419,
                     274478..275028))
                     /locus_tag="THITE_2111241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651217.1"
                     /db_xref="GeneID:11514811"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="JGIDB:Thite2_2111241"
                     /translation="MKSSALLAACSALLAAASPILQGRRLYISTDVVTEWVTVTVTEG
                     DASTAFSRPVPHTKATTTTSIPEPSTTSVAPPPPPPPPTSTSAPVIQAAPQPTQQPSP
                     SPQAADPQVQAAQPSSDTPAPAPAPSTTTQASAAQPSDYTSTALYHHNVHRFNHSANA
                     LVWSDEHAQYAQTLAERCVFEHDTSIGGGGYGQNIAMWGSTGDPEAFGATGSIARAAS
                     NGWYNGELNDFPASSYGASTPDMTNFEKWGHFSQLVWKDTQKVGCATVFCQPGTLSSM
                     GSWFSVCNYYPPGNVGGAYGDNVAPPEGQPIVTAA"
     gene            complement(279786..280824)
                     /locus_tag="THITE_2111246"
                     /db_xref="GeneID:11517111"
     mRNA            complement(join(279786..280037,280109..280241,
                     280377..280604,280707..280824))
                     /locus_tag="THITE_2111246"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651170.1"
                     /db_xref="GeneID:11517111"
     CDS             complement(join(279894..280037,280109..280241,
                     280377..280604,280707..280726))
                     /locus_tag="THITE_2111246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651218.1"
                     /db_xref="GeneID:11517111"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="JGIDB:Thite2_2111246"
                     /translation="MAARKPVFNQHVLYDTTPLPDSIPKVKEIGASSAPLLSASFFIG
                     ARCKDYNDDYMQCKTENPGRGEFECLKEGRRVTRCARSVLEDINKSCLEQFRAHWQCL
                     DNNNQQLWQCRPAEWKLNKCVYENLKLEKVIPDQPKQSTPVHLRQKQIFAHKWIQRWE
                     KPFIPGQSEASESS"
     gene            281011..283593
                     /locus_tag="THITE_2169800"
                     /db_xref="GeneID:11517112"
     mRNA            join(281011..281302,281376..281514,281624..282267,
                     282344..283204,283284..283385,283459..283593)
                     /locus_tag="THITE_2169800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651171.1"
                     /db_xref="GeneID:11517112"
     CDS             join(281222..281302,281376..281514,281624..282267,
                     282344..282475)
                     /locus_tag="THITE_2169800"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651219.1"
                     /db_xref="GeneID:11517112"
                     /db_xref="JGIDB:Thite2_2169800"
                     /translation="MFSTTSRPAGQSLFGGGGTSIFGQSTNTQQQQQQQQQQQQQQQQ
                     QQQPAPASGQQQPTPQLTGSLWQPGSLSSYQRPIPEQIKLIMEKWDPTNPNCAFKTYL
                     YNKVDEHTVPLYGPGPNEDPKEWEEALRQKPAPNFIPVLCAGFPSIIARLTLQRRVMV
                     EFNNKLHAINASLDAILSRHDLEHTVRAFNARRRHAELSKRCLVLASRVQVLRNRGYA
                     MSGDEDELRQKLQKIDKSMQDPALSARMEELWSRLIILRGYAESLKDEINRPGFAEGN
                     GLDEEIEAKAKKILEDYEKQLQHLKKQVEEAKADFEAWEKQHNPAPAPKPAAPAQ"
     gene            284409..288297
                     /locus_tag="THITE_2111253"
                     /db_xref="GeneID:11517113"
     mRNA            join(284409..287157,287228..287752,287836..288297)
                     /locus_tag="THITE_2111253"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651172.1"
                     /db_xref="GeneID:11517113"
     CDS             join(284505..287157,287228..287752,287836..287921)
                     /locus_tag="THITE_2111253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651220.1"
                     /db_xref="GeneID:11517113"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="JGIDB:Thite2_2111253"
                     /translation="MAGPRRIGRLGRTLGASVLASRAGAPLRRPWLCTPFSHTPSAAW
                     SSLDEGAANPPRFVRLPELFPTHENFTNRHIGPDDESTEQMLKALDPPAESLESFVRQ
                     VIPPDILSHRELFPVPRREFASAAFGATHEGHQEWEVLRVARTAAERNKYRVKNFIGA
                     GYYGTITPEVIKRNVLENPAWYTSYTPYQPEISQGRLESLLNFQTMVSDLTGLPIANA
                     SLLDEGTAAAEAMTMSLNALPASKAKRPGRTYVVDETVLPQTVNVLRSRAEGFGVDVK
                     VMDLSGPDFSELENLGDDLVGVLVQYPDRYGQIYHWEALANTVHNQGAMLSAATDLLA
                     LTLLTPPGEWGADIAFGSAQRFGVPLGFGGPHAAFFAVQEKHKRKMPGRLIGVSKDRL
                     GGRALRLSLQTREQHIRREKATSNVCTAQALLANISAFYAVYHGPVGLRKIAERCNLG
                     ARVVQAAARRFGFHVDHKPVAFDTVVIGCPDKAQLIYGLARLEHINIRLEGPDRVVIS
                     IDETAEESDLLCLIKALDQASREDRAHDLNSGSGSAATANPAAAPADYISLLAELLAQ
                     CRSEDPLADDREPLRRQSAYLTHPIFNTHHSETELLRYIHHLQSKDLSLVHSMIPLGS
                     CTMKLNGSTQMALITLPGFADVHPAAPPSDTKGYSLIIAALEDQLKQITAMDGVSLQP
                     NSGAQGEFAGLRTIRKYHRSRGQPQRDICLIPVSAHGTNPASAAMAGMRVVPVKCDTK
                     TGNLDLADLKAKCAQHANEIAAMMITYPSTYGVFEPEIKQVCQIVHAHGGQVYMDGAN
                     MNAQIGLCSPGEIGADVCHLNLHKTFCIPHGGGGPGVGPICVKKHLIEHLPTPAVASD
                     SPRNYPVSSAPYGSAGILPISWAYNALMGAEGLKKATQITLLNANYLLSKLKPHYPIL
                     YTNEHGRCAHEFILDVRPFRDSAGIEAIDIAKRLQDYGFHAPTMSWPVANTLMIEPTE
                     SESKEELDRFVEALVSIRGEIRDIEEGRAPRQGNVLKMAPHPMADIIAGDGDGGAKWD
                     RPYTREQAAYPLPWLKEKKFWPSVARVDDTYGDLNLFCTCPPVEDTTGGHMSSVQEV"
     gene            complement(288214..290379)
                     /locus_tag="THITE_2111254"
                     /db_xref="GeneID:11517114"
     mRNA            complement(288214..290379)
                     /locus_tag="THITE_2111254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651173.1"
                     /db_xref="GeneID:11517114"
     CDS             complement(288674..290191)
                     /locus_tag="THITE_2111254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651221.1"
                     /db_xref="GeneID:11517114"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2111254"
                     /translation="MSSSDPHRNPAEEGDDLEPELLAEDDVQEILDGEDAEGDVAMGS
                     DDEREEILLENDSIAYFDGHKDSVFAIAQHPLYPSLIATGGSEGEDEDAPGKGYVIDT
                     SAAVSRPVLPPSYNSDPSSAQSPQTIALQSLFSIDGHSDSVNAIAFTLPRGEFLVSGG
                     MDGRVRVHAVTATPTPSGAVSAQFKFLAESRETEEVIWLAPCPSPDYPNTIAYGASDG
                     SVWVLTLDAADPSNPIQIVQTYFLHTAPCTAGAWTPDGQLLATVSEDSSLHVYDVWGA
                     AAAKSLVLDNGQTVVSLTGADQRFAVEGGLYSLAISPSGGILAAGGAAGAIRIISLPR
                     LSPPATSSSAQTQAGGTILASLAVQSDSVESLAFSPSPATPLLAAGSVDGSIAVFDAA
                     RSFAVRRHIRGAHDGESVVKVDFVRAATAPGTAGWLLTSCGLDGVVRRWDLRGATAGG
                     GQAAAAAAATAGLVKEWRGHRGGGAGGGVLGFVQGETGERIVTAGDDGLVLVFEA"
     gene            complement(290510..293061)
                     /locus_tag="THITE_2111255"
                     /db_xref="GeneID:11517115"
     mRNA            complement(join(290510..292595,292670..293061))
                     /locus_tag="THITE_2111255"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651174.1"
                     /db_xref="GeneID:11517115"
     CDS             complement(join(290818..292595,292670..292850))
                     /locus_tag="THITE_2111255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651222.1"
                     /db_xref="GeneID:11517115"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2111255"
                     /translation="MASSSGAVAYAGSPAGSLPYKNTFAFAFSQPFQLVSDFVPPEHR
                     LRRTEPERPIFVDNKSDRTLTFGRISKDALAVAAGLLALGLDPKDTVKLPPTPTCPAG
                     PEIAPIVLIQLPNCLSFAPVLFGALAAGLTATLVSPALTSAEIAWILQNARPRAIITA
                     TACLPAMKDALAQQQDAAYFSAIPIFTVDAAADTYPDPQPAQPPASSAPGSSSDWKAL
                     LTTKSAPPSTATVFPPSAAATRTAVILWSSGTSGRSKGVLLSHHALNFSVASLWHDAD
                     YHRATPRPGQGQSSNQVWLGYVPFYHVFGLCNVFLLAVAAGATVYTMPSFHLETMVRA
                     VQQRRVTYLHMAPPVAVMLAKAAVVEPYARGGAFASVVAGVTGGAPLGHEVVEEVYRR
                     CGFRVRLGYGLSETCSTAMQRGIGEKEMREQAGDTGRPHYGVELMIADGRRYAKKAGE
                     QTTAAPVDVEGEVLVRAPCLLLAYLPVGVFSSGSKQPDMSVTEEALTADGWFRTGDVG
                     ALNADGRLRITDRLKELIKVRAYQVAPAELEAVLCSSEAVADAGVIGVYDQSEATEWP
                     RAFVVPRAGRKNMSTAELERLAGQLKALVEQRTAKYKWLVGGIVFVDQIPKSPSGKIL
                     RRVLKNGGEETKGVEVKLYEKKRRDAKL"
     gene            complement(294147..294878)
                     /locus_tag="THITE_2111257"
                     /db_xref="GeneID:11517116"
     mRNA            complement(join(294147..294477,294582..294878))
                     /locus_tag="THITE_2111257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651175.1"
                     /db_xref="GeneID:11517116"
     CDS             complement(join(294371..294477,294582..294873))
                     /locus_tag="THITE_2111257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651223.1"
                     /db_xref="GeneID:11517116"
                     /db_xref="JGIDB:Thite2_2111257"
                     /translation="MLMAAEGRRAGPEPRALEPGGREWAHVEALRDELRELRDELAGL
                     VRGVNVGLVDGSARDGYRVSRRELVAVNEKVKSVLGIELRLAEGLKAELEAQSGDYLK
                     IDGAEASRLGLPLTVNSGAQEWRATVGILL"
     gene            complement(296690..298596)
                     /locus_tag="THITE_2111259"
                     /db_xref="GeneID:11517117"
     mRNA            complement(join(296690..296736,296819..297812,
                     297886..298596))
                     /locus_tag="THITE_2111259"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651176.1"
                     /db_xref="GeneID:11517117"
     CDS             complement(join(296706..296736,296819..297812,
                     297886..298300))
                     /locus_tag="THITE_2111259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651224.1"
                     /db_xref="GeneID:11517117"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="JGIDB:Thite2_2111259"
                     /translation="MEITAEDLPALLADDTAVKLAGVDVDGMLRGKLVSKKKFLSIAE
                     AGFGFCSVVFGWDMHDMTYIRELKVSNKENGYRDIIAVPDLSSFRRIPWENNVPFFLV
                     SFFDPDTKAPVSACPRGLLKTQVEKFAAKGYAAMAGAEYEFYQFKTPSTASGGTPSTA
                     AYLRENTPQSLPPLTEGMFGYSLTRPVHNKDYYYDVFNTCQAFRCDLEGWHTESGPGV
                     YEAALEFGEISQMADRASLFKYVVKSVATRHGITPCFMAKPRQGLPGNSGHMHVSLVD
                     ASSGNNLLYRGEPDPDPPYPDVAYLSDLGRHFLAGILDGLPDVMPMVAPTINSYKRLV
                     ENFWAPVTVSWGLEHRAASIRLIAPPTAKPGATRFEIRVPGADANPYYVLAAVLALGW
                     RGVERKLQIPCPPLGKGEDVGGTADKGVRLARSLREANDRFMRPGSIAREVFGDEFVD
                     HFGGTREHEIRLWDEAVTDWEMRRYIETV"
     gene            complement(<299662..>300443)
                     /locus_tag="THITE_2086378"
                     /db_xref="GeneID:11517118"
     mRNA            complement(join(<299662..299901,299970..300049,
                     300191..>300443))
                     /locus_tag="THITE_2086378"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651177.1"
                     /db_xref="GeneID:11517118"
     CDS             complement(join(299662..299901,299970..300049,
                     300191..300443))
                     /locus_tag="THITE_2086378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651225.1"
                     /db_xref="GeneID:11517118"
                     /db_xref="JGIDB:Thite2_2086378"
                     /translation="MADTTFQDTIAAMADEFNAANEAAERLAASFKAAGEEYPTPGRS
                     DASQPAASHPNEEEAVVDAAKGAICDVKDLYQSQKSTCSCCTERVEVNPFKEKKTAEK
                     AENKFAAFALAHPDDDDGVQELAEHPLNGRQIKSAIKTAAVLANSQGSPVMLRHLRVV
                     LNLWAKAVKSLKRDSTPPSFKLVKPGGDEA"
     gene            302463..304542
                     /locus_tag="THITE_2111261"
                     /db_xref="GeneID:11517119"
     mRNA            join(302463..302872,302941..303824,303920..304542)
                     /locus_tag="THITE_2111261"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651178.1"
                     /db_xref="GeneID:11517119"
     CDS             join(302822..302872,302941..303824,303920..304415)
                     /locus_tag="THITE_2111261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651226.1"
                     /db_xref="GeneID:11517119"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="JGIDB:Thite2_2111261"
                     /translation="MALNLRAGRRAVSGALRPVVAAPTSRASPRRAYATAEPDLKATL
                     KEVIPAKRELLKKVKAHGSKVIGELKVENTIGGMRGLKAMVWEGSVLDANEGIRFHGR
                     TIKDCQKELPKGTTGTEMLPEAMFWLLLTGKVPSVAQVRQLSRELAAQGQLPELVNKM
                     LDDFPRDMHPMTQFAIAVAALNYTSKFAKAYEAGLSKADYWEPTFDDCISLLAKLPTI
                     AAKIYHNTYRGGGPLPGEIDPEQDWAYNFAAMLGKGGKENESFQDLLRLYLALHGDHE
                     GGNASAHTTHLVGSTLSDPFLSYSAGLQALAGPLHGLAAQENLRWILQMKEAIPESYT
                     DEDVRGYIWATLNAGRVVPGYGHAVLRKPDPRFEALMDFAAARPEIARDPVFRLVQAN
                     SRVAPDVLRQHGKTKNPYPNVDSSSGVLFHHYGFRETLYYTATFGVSRGLGPLAQLIW
                     DRALGLPIERPKSINLEGILKQVEAQ"
     gene            <308004..>308763
                     /locus_tag="THITE_2142691"
                     /db_xref="GeneID:11517120"
     mRNA            join(<308004..308189,308293..>308763)
                     /locus_tag="THITE_2142691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651179.1"
                     /db_xref="GeneID:11517120"
     CDS             join(308004..308189,308293..308763)
                     /locus_tag="THITE_2142691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651227.1"
                     /db_xref="GeneID:11517120"
                     /db_xref="JGIDB:Thite2_2142691"
                     /translation="MRPVAFLLPALAAANPIALAQVGGDGWADGPDPNDIQIVSASFS
                     GNGCPQGSVSTTISPDKTVITFGFDSFQTYIGPGISPTEKSKNCQLHLSLKYPGGFQF
                     AVLSSTYHGYAQLDPGVTGTFYSTYYFSQDAAATTTTQTSISGGGIWQDGQVYTKSDQ
                     IPTASYIYSPCGANGILNINNRIALTSSNSSASGEITDDDATVAFTQQINIQWRACKN
                     "
     gene            complement(308824..309404)
                     /locus_tag="THITE_2111263"
                     /db_xref="GeneID:11518906"
     mRNA            complement(308824..309404)
                     /locus_tag="THITE_2111263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651180.1"
                     /db_xref="GeneID:11518906"
     CDS             complement(308978..309262)
                     /locus_tag="THITE_2111263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651228.1"
                     /db_xref="GeneID:11518906"
                     /db_xref="JGIDB:Thite2_2111263"
                     /translation="MKKKLDGSRVRNAEETNARGPINRPVPPLSVSSAPEFPVPHPFW
                     SCIGRLREREGEENNQCSQPDSLNPPPPGPRVQWSLGVRQKKKRKKVRAR"
     gene            <309793..>310904
                     /locus_tag="THITE_111974"
                     /db_xref="GeneID:11518907"
     mRNA            join(<309793..309823,309857..310009,310141..310308,
                     310488..310609,310794..>310904)
                     /locus_tag="THITE_111974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651181.1"
                     /db_xref="GeneID:11518907"
     CDS             join(309793..309823,309857..310009,310141..310308,
                     310488..310609,310794..310904)
                     /locus_tag="THITE_111974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651229.1"
                     /db_xref="GeneID:11518907"
                     /db_xref="JGIDB:Thite2_111974"
                     /translation="MAGAAVTSWTGVLSPAGTICRRGSARRRDPGSRHEKEVVPEQQQ
                     AYNEAAQSEKQLSHAVLFRTLDRTHLADLTVYCKYFGRLPARVGIRRLAGRLHSQSGA
                     DTPGPPPMPPVGRGNAQCRGASQDGKASGGGIMAASCQHAAASRLPQCQFWQFRVHSN
                     PREFPRGFGKPTEQGMRTRDPGNLQAAYRGTLAG"
     gene            312453..313694
                     /locus_tag="THITE_2075198"
                     /db_xref="GeneID:11518908"
     mRNA            join(312453..313047,313193..313694)
                     /locus_tag="THITE_2075198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651182.1"
                     /db_xref="GeneID:11518908"
     CDS             join(312926..313047,313193..313307)
                     /locus_tag="THITE_2075198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651230.1"
                     /db_xref="GeneID:11518908"
                     /db_xref="JGIDB:Thite2_2075198"
                     /translation="MCNFIQREYGCGHFRFIASKWCRSYTTSHKRCPPDVTHFEYVEH
                     LCGDCKDRNRPPVPWADLIKGYRERGGAAAAVSL"
     gene            314064..317548
                     /locus_tag="THITE_2153752"
                     /db_xref="GeneID:11518909"
     mRNA            join(314064..314767,314870..316543,316655..317548)
                     /locus_tag="THITE_2153752"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651183.1"
                     /db_xref="GeneID:11518909"
     CDS             join(314527..314767,314870..316543,316655..317295)
                     /locus_tag="THITE_2153752"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651231.1"
                     /db_xref="GeneID:11518909"
                     /db_xref="InterPro:IPR004879"
                     /db_xref="JGIDB:Thite2_2153752"
                     /translation="MMRSPLEQRPQRHHVGRGAAGAPGSALPALQNRAGESDSPYVRR
                     HADTPVAWQMLDADTLERAAVENKPIFMHIGFLADHLCHLTTQDSFSNPAVADFLNES
                     FIPILIDREERPDLDAIYQNYSEAVNATGGWPLNLFLTPDLYPIFGGTYWPGPGTEHS
                     AAAARSGGGGGGASGDESYHDFLAIAKKIHKFWVEQEERCRREAFEMLHKLQDFAQEG
                     TFGAGSGGGSSGAGGEATVASAGAAAAAAGGANAAADASDLDLDQLDEALARIAKMFD
                     PVDYGFGTPKFPNPARLSFLLRLAHFPAEVREFIGEEEVERATAMATKTLRRIRDGGL
                     RDHLGAGFMRFSVTSDWSMPHFEKMVGENALLLGVFLDAWLGHSRAREGELALDDEFA
                     DVVLELADYLTSPVVRAERGGFITSEAADSFYRRGDRHMREGAYYLWTRREFDQVVGG
                     GSTDDHASTVAAAYWNVQEDGNVPQDQDPFDEFINQNVLSVNADATELSKQLGVPPAE
                     IKALVSAAREKLRAHREKERVRPARDEKIVVATNGMVIAALARTAAAVRWLDPDRAAR
                     YLQAARDSATFIKENLWHGPESKTNPLRRFFWDRPSQTPAFADDYAFLIDGLLDLYTA
                     TFEQQWLDWARQLQDVQTRLFYDSPSPPTSETGSAPPAPSPRHAYSGGFYSTEAEALS
                     PTILRLKSGMDKSQPSTNAVAASNLFRLGTLLQHLPGGGVSGSSQGGSGQGGQKADVY
                     LRQASETVAAFEAEILQYPWLFVSLLTGVVTARLGVRKKAVVVAGPGKGKGAEGADQV
                     ALRAWYTQPRAEARVLVPLAGDAGAAAEGAGEKKEDALAKEVEGLTISRSSRA"
     gene            complement(318103..320097)
                     /locus_tag="THITE_2111267"
                     /db_xref="GeneID:11518910"
     mRNA            complement(join(318103..318305,318422..319083,
                     319142..319235,319292..320097))
                     /locus_tag="THITE_2111267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651184.1"
                     /db_xref="GeneID:11518910"
     CDS             complement(join(318162..318305,318422..319083,
                     319142..319235,319292..320002))
                     /locus_tag="THITE_2111267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651232.1"
                     /db_xref="GeneID:11518910"
                     /db_xref="JGIDB:Thite2_2111267"
                     /translation="MAGNTNRYSTYTAASTNTGAGSDSKNGDAAEKKELWNSMLSSVA
                     SGRRLPEKNIILLGGSVDSQREFFESLANNELRRSLDRNASRTPPVANSFALGYAYYD
                     VLDADQEDTLARISLYTLTSPSPAFASLLQPLLTPQSIPNTLIVVLLDWSEPWKWLRQ
                     LREWILLLRTVLVSLSDECKETMEEVMLSWRDRGRGGSVNLDGSAAVPTADGENAVPV
                     GPGEWEDALGLPLAVVCQNAEKMEYLEKTQGWKEEEFDVVLQFMRTVLLKHGASMIYT
                     TPSVPSQLPTLIHSSLGIHSLLKKQPLKHNVIDRDKIVVPPNWDSWGKIRVLRDGFGV
                     DQVSNGWSIDLDQPFPRPHTNGAAAESEHADGHDDRAAPDPEGSAVTLYENAVQDPTM
                     DALQLAGRNTHSTELEVETIDTQTFLAQQLKVLEAFKQKSDEASRESARHKASKKVDD
                     DHMMVGSETEAKVLEHIGPVQFNMGGIQVDADDMVQRLKERQACGSGDELGSPTAEDI
                     MDSTPHMDTENLQAFFHGLMNRRGATTK"
     gene            320463..321784
                     /locus_tag="THITE_2111270"
                     /db_xref="GeneID:11518911"
     mRNA            join(320463..320907,320974..321147,321250..321784)
                     /locus_tag="THITE_2111270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651185.1"
                     /db_xref="GeneID:11518911"
     CDS             join(320737..320907,320974..321147,321250..321741)
                     /locus_tag="THITE_2111270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651233.1"
                     /db_xref="GeneID:11518911"
                     /db_xref="InterPro:IPR006214"
                     /db_xref="JGIDB:Thite2_2111270"
                     /translation="MSANTKYTPAPQEDPDAHLNYTQPPPSYQAESSSAQDQERLFGG
                     PRSSEDNIPDDFKFGGSVAEATIEIRNQFIRKVYTILTVQLVATGAVSALSFLSESYK
                     SWIQSHPAVVWISLFGAMAFMFLTYWKRQSYPTNLLFLSGFTLLEAYTISVIVSFYRA
                     SVVLNAVVLTAGIFVFLTAFACQSKYDFTSWMPYLFGALWGLLLFGFMSVFLPYSSTG
                     ELIYGLLAALIFSGYILVDTHLVLRKHHVEEEIAAAISLYLDVINLFLAILRILNSQN
                     NN"
     gene            complement(322701..324843)
                     /locus_tag="THITE_2111273"
                     /db_xref="GeneID:11518912"
     mRNA            complement(join(322701..323144,323205..323672,
                     323726..323863,323931..324018,324081..324197,
                     324267..324339,324515..324843))
                     /locus_tag="THITE_2111273"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651186.1"
                     /db_xref="GeneID:11518912"
     CDS             complement(join(322880..323144,323205..323672,
                     323726..323863,323931..324018,324081..324197,
                     324267..324339))
                     /locus_tag="THITE_2111273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651234.1"
                     /db_xref="GeneID:11518912"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="JGIDB:Thite2_2111273"
                     /translation="MIRRKKNVKKGIQFCLMVCGASGTGRTTFVNTLCGKTVLAHKDC
                     DDATTAHVEEGVKIKPVTVELELDEEGTRISLTIVDTPGFGDQIDNEASFSEIVGYLE
                     RQYDDILAEESRIKRNPRFRDNRVHALLYFIAPTGHGLRELDIELMKRLAPRVNVIPV
                     IGRADSLTPSELAESKKLVMEDIEHYRIPVYNFPYDIEEDDEDTVEENAELRGLMPFA
                     IVGSEDVVEIGGRKVRARQYPWGVVEVDNPRHSDFLAIRSALLHSHLADLKEITHDFL
                     YENYRTEKLSKSVEGGAGVDSSMNPEDLASQSVRLKEEQLRREEEKLREIEVKVQREI
                     NEKRQELLARESQLREIEARMQREAAAAAAAAAQQAAAANHGEPNGAE"
     gene            <325614..>327168
                     /locus_tag="THITE_38073"
                     /db_xref="GeneID:11518913"
     mRNA            join(<325614..325722,325849..325887,325951..326087,
                     326110..326466,326542..326717,326835..>327168)
                     /locus_tag="THITE_38073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651187.1"
                     /db_xref="GeneID:11518913"
     CDS             join(325614..325722,325849..325887,325951..326087,
                     326110..326466,326542..326717,326835..327168)
                     /locus_tag="THITE_38073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651235.1"
                     /db_xref="GeneID:11518913"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_38073"
                     /translation="MNTRSPLESPLGAVVLSIAFNDDCSCFAVGLNTGFCIFHSETCS
                     LRTTRDFNAGVGLVQMMGKANYVGLVGGGRQPKFAANKACLSTSALNNACDLILWDDL
                     KSKAALEISALTPVRGVQLSKERILVVLQNSVRVYKFAKPPQLLSAYETANNPWGLCC
                     LSAKRIAFPGRSVGHVQLVETATGNVSIIPAHSSAIKAIQLSRDGELLATASETGTLI
                     RVFATSNCARLVELRRGIDPATIFSLAFSPSGTMLACTSDKSTLHIFDVPHPNRRGGE
                     GKGKWGFLSKIPMMPRVFSDVYSFASAPFEADDDEAALVGGALPVSESTTLGTSRPPK
                     GVVGWVSESTLLVIGAGRDARWERFVLQEGLDGRRHCVREGWKRYLPGH"
     gene            complement(327346..328762)
                     /locus_tag="THITE_2111279"
                     /db_xref="GeneID:11518914"
     mRNA            complement(327346..328762)
                     /locus_tag="THITE_2111279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651188.1"
                     /db_xref="GeneID:11518914"
     CDS             complement(327527..328618)
                     /locus_tag="THITE_2111279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651236.1"
                     /db_xref="GeneID:11518914"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2111279"
                     /translation="MNQIRAIQALNKREIENGVPPEASWHADYRDTAFIYFGGLPYEL
                     SEGDIITIFSQFGEPVFLKLVRDKETGKSKGFGWLKYEDQRSTDLAVDNLGGAEIGGR
                     LIRVDHARYKMRDDEDLEEYKVGWEDMLRRERAEKGLPSESEDETDEEEEHARRARPM
                     LKEERELQLLIQNHDDDDPMKQFLIDEKKKEVEEALRREKRREEKERRRHKDRDEDRH
                     RHRSHRSSRRDDSEDESRRRDKHRYRDRDERGADREGRPRRDTTPVEDRLGGSSDEGR
                     RKRRDASRDRDRRREDGHDGGDRERKHDRHRRDDRDDGESRSERDGHRRRAREGSRDR
                     SERRHRDSEDRRRRDRDRSRSRSPRWDRG"
     gene            329403..331595
                     /locus_tag="THITE_2111280"
                     /db_xref="GeneID:11518915"
     mRNA            join(329403..330072,330137..330447,330513..330800,
                     330885..331595)
                     /locus_tag="THITE_2111280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651189.1"
                     /db_xref="GeneID:11518915"
     CDS             join(329865..330072,330137..330447,330513..330800,
                     330885..331502)
                     /locus_tag="THITE_2111280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651237.1"
                     /db_xref="GeneID:11518915"
                     /db_xref="InterPro:IPR005547"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="JGIDB:Thite2_2111280"
                     /translation="MSSPPATTASHDGTAKSSSLPPRRTGKPQHINGPLYRQANSNVV
                     LIRRPKRKNEGPMKQLARWFVDNQIGLSFNLLALLFLAHGMPRARDYTAKYFTLSYYN
                     PSTGKYGLGWADGHFILFCVVVLTGLRAATMENILAPLAKSQGMSKRKDITRFSEQAW
                     MVLYYSVFWPLGLYVYRQSPAYLDLRELWTGWPDREVTALVKGYFLAQLAFWLQQLIV
                     INIEERRKDHWQMFTHHVITSSLMYAAYRYGHTRVGNLILVLMDVSDLALGLAKCLKY
                     LGHQTMCDIMFGVFMFSWLIARHVLYLCVCYSVWAHTPEIMPTGCFKSAQGSLTGPLE
                     PPTDKGLRYLLEPLWDSEGLFCYNDSVKWAFLAMLLFLQVLTLIWFTMIIRVAIKVLN
                     GSSAEDVRSDDEAGEDDDEDEFVYEEAQPLEQEVGVEEIDLKHWERRTGIKRQTSVTT
                     GVSLPGHSDRKELLGRIGCEKQVE"
     gene            <332628..>333506
                     /locus_tag="THITE_2142693"
                     /db_xref="GeneID:11518916"
     mRNA            join(<332628..332772,332860..>333506)
                     /locus_tag="THITE_2142693"
                     /product="carbohydrate esterase family 12 protein"
                     /transcript_id="XM_003651190.1"
                     /db_xref="GeneID:11518916"
     CDS             join(332628..332772,332860..333506)
                     /locus_tag="THITE_2142693"
                     /note="CAZy_ID 269782"
                     /codon_start=1
                     /product="carbohydrate esterase family 12 protein"
                     /protein_id="XP_003651238.1"
                     /db_xref="GeneID:11518916"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Thite2_2142693"
                     /translation="MVYWSTLLLAGLAASGAHGTPVEVARRATPTVYLAGDSTMAKTG
                     NGLMGWGEYLAQYITLPVVNKAIAGRSARSYTEEGRFSEIEQLVQADDIVVIEFGHND
                     GGSPSSASDNGRSDCPGAGDETCTSGKTGATVYTFNHYVEAAARSFVAKGARVVVSSQ
                     TPNNLWETGTFVYSVPRFVGYAAAAAEHVGAGASFVDHFQAVADMFLKLGSAKTNALY
                     PQDHTHTSPEGADLVAQAFVEAVGKRFNGTTALDSYVKSPLPAVF"
     gene            335737..337716
                     /locus_tag="THITE_2111287"
                     /db_xref="GeneID:11518917"
     mRNA            join(335737..336299,336368..336767,336839..337130,
                     337200..337716)
                     /locus_tag="THITE_2111287"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651191.1"
                     /db_xref="GeneID:11518917"
     CDS             join(336039..336299,336368..336767,336839..337130,
                     337200..337668)
                     /locus_tag="THITE_2111287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651239.1"
                     /db_xref="GeneID:11518917"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2111287"
                     /translation="MVATDNFAERCSKVYFATEDYSILTWGIVNAGLYFLFLERASVA
                     EGAQKAQLLQYQSVCRDNLETALTNLPLLLPARKESVEILLLGAFYAIEISKFSLARD
                     LNSIAATLCQTLGYHRLRSPTPESEAKVVLFWAAYILDKALSLRSGRAPVIQDYDITV
                     HRGLGPGINLPDASWRVVLNLWISYANFLGRAYEQLYSPAALARPQEQRVESARQLVQ
                     TMVNLAKEQEPLMRHTREKIRGTKFDANKPFTMDLAILSDELLHWSALTLIYRAIPSP
                     PGSPSTFNQECIHAARRAFALHQEYMEMAGDNVAAKAGCIQWNLICVPFTPVIILFCH
                     IVETSDEDDLRRLADFVESLQPACAVSEAVAKLHRICQVLHNVASLYVKAKAQRQQDP
                     QQRDQDMAMVGDNIDMYLSQLGFMPQVDPAFGGEGDLPAAGFAAGQASELGNWFSGNT
                     HILGLLEEDLSEFEPRMWSMGGQ"
     gene            complement(337765..338750)
                     /locus_tag="THITE_2111291"
                     /db_xref="GeneID:11518918"
     mRNA            complement(join(337765..338481,338580..338750))
                     /locus_tag="THITE_2111291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651192.1"
                     /db_xref="GeneID:11518918"
     CDS             complement(join(337930..338481,338580..338588))
                     /locus_tag="THITE_2111291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651240.1"
                     /db_xref="GeneID:11518918"
                     /db_xref="JGIDB:Thite2_2111291"
                     /translation="MPPRGSTLPPAQTASARSALQALYCQLCQKGYTRTHEYEAHLGS
                     YDHAHKQRLKDMKAMVRDPGAAARARRQEMRAQEGGGVVSIKLGEAAAAAAAAPSGGA
                     NASASTGAGGGGFKKGGFKKTGFTASGFVSVAGGNGNGNGGEPAKVEKKADDSRTAGP
                     AVGSELVESDTEDEGYEVYDPRKPTD"
     gene            <366774..>367025
                     /locus_tag="THITE_2046104"
                     /db_xref="GeneID:11518919"
     mRNA            <366774..>367025
                     /locus_tag="THITE_2046104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651193.1"
                     /db_xref="GeneID:11518919"
     CDS             <366774..367025
                     /locus_tag="THITE_2046104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651241.1"
                     /db_xref="GeneID:11518919"
                     /db_xref="JGIDB:Thite2_2046104"
                     /translation="VYVYIDDIIIVNKNIEEYLKYVKTILNILDKVYIYILIEKSFIA
                     YLLVRLLSYIVNGEGVAKIDDRITIFKKLKFPNTFETLE"
     gene            376704..378755
                     /locus_tag="THITE_2111293"
                     /db_xref="GeneID:11518920"
     mRNA            join(376704..377177,377242..378755)
                     /locus_tag="THITE_2111293"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651194.1"
                     /db_xref="GeneID:11518920"
     CDS             join(376952..377177,377242..378068)
                     /locus_tag="THITE_2111293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651242.1"
                     /db_xref="GeneID:11518920"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="JGIDB:Thite2_2111293"
                     /translation="MDDQSLRSKASQATLVSLLELDPAPMESPNVDKDLPPLPVQHDG
                     EPASESTASLKSSSTSASLGLSGSGHGAIYYLTRIQRYSSYTFTFFGALHLATTSLIP
                     LAAQSVASSESYLLLAREIYQTPLSEPLLVGLPVLAHVGAGVALRLLRRAHNLRRYYG
                     DAHPARHHDVPHTAASASATTGLTAPPRPAPSYRGWPALSWIAVSGYAFGGALAAHVF
                     MNRGLPLLVEGDSANIGLAYVAHGFARHGAVSWLAYAGLLAAGCGHMVWGWARWLGAA
                     QGAGWRLERLTGHAAVDREARRRRRRRLLVINGVAAAVAAAWAAGGLGVVARGGETLG
                     WVGKLYDGLYERVPGF"
     gene            <379119..>381035
                     /locus_tag="THITE_2047631"
                     /db_xref="GeneID:11518921"
     mRNA            join(<379119..379955,380133..380419,380522..>381035)
                     /locus_tag="THITE_2047631"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651195.1"
                     /db_xref="GeneID:11518921"
     CDS             join(379119..379955,380133..380419,380522..381035)
                     /locus_tag="THITE_2047631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651243.1"
                     /db_xref="GeneID:11518921"
                     /db_xref="JGIDB:Thite2_2047631"
                     /translation="MGSVAARNGASVKLPRIKLDTTFTELYKRASPKDASTRLGWISC
                     GVSTGIDLTAGFPRNTKFVYQDQAFVKAAGPELNNGNAGLQWSLAQKYLSLIPQRDAF
                     VSGSTPVIFFNLDRTPEQLEHDRREAEATISVLEPSQRPELIFCPGPAEIPVKEHRID
                     KLEYKVIADALERYPLTHDLEAHWFLNSKAALARSGLPTPRADIIETEGCPPAADACC
                     GVCAAAAKDTSRLPTIPPGCTGPRGAWLSAQAERILAAVRRRPVPFVFKTQQAFGGAG
                     TWLQEEEEQKQQVHRPPGNNADGLLRRLLSLLTPHNAALRPTTVLLTELVRHEPPGGT
                     DFGLTFVVTAAGEAVFLAAAEQMLATTTTNATTTTAVTTTAGAAWVGSTINYARQGAL
                     RRRFAGLIAQIAAWVRERGYVGPVGADVLTTGTLAEAESGAGQDSEDGGGCFVVDLNV
                     RTCGSLALPLLRGHFLERRGMACAGSLSVAYRGGRGEFMERWRAPLEKGRMVILSWYE
                     DPRGGGSIGDVVVGGEDEGRLKELMQAVRESTEELTL"
     gene            382487..384229
                     /locus_tag="THITE_2111295"
                     /db_xref="GeneID:11518922"
     mRNA            382487..384229
                     /locus_tag="THITE_2111295"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651196.1"
                     /db_xref="GeneID:11518922"
     CDS             383329..383853
                     /locus_tag="THITE_2111295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651244.1"
                     /db_xref="GeneID:11518922"
                     /db_xref="JGIDB:Thite2_2111295"
                     /translation="MVFEWIMGNFFPMMVMGLFAVFWLSFGLLQVPTLQLGSPYATSA
                     DPTGLASPEYNAVVALYLIVWGFALFTFFIFTCKINVVFAAIFLLVSTAAWVLSGAYW
                     KVSTGDFDAATKLQKAGGALLFVVAALGWYMCFIIMAGEMRITLKLPVGDLSHFWPKT
                     DVALAAAEQRERTD"
     gene            384925..386629
                     /locus_tag="THITE_2111296"
                     /db_xref="GeneID:11518923"
     mRNA            384925..386629
                     /locus_tag="THITE_2111296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651197.1"
                     /db_xref="GeneID:11518923"
     CDS             385342..386238
                     /locus_tag="THITE_2111296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651245.1"
                     /db_xref="GeneID:11518923"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2111296"
                     /translation="MSKSVAAATHADFHRSSLFDLKGRVALVTGGGSGIGLMITQALA
                     VNGAKVYIVGRTGEKLDTVVQTYNRDIEGEIVALTGDVTKKDDVARLVREVEAREPCL
                     CILVNNAGVASETVQPESGSAAEMRRNLFDTSGATARDWTATYEADVVSVYFATAAFL
                     PLLQRSSKRHPHWSGTAINVTSISGLVKAAQHHFAYNAAKAAAGHLTRMLAAEIAAAG
                     HKIRVNALAPGVFPSEMTAGESDEFQKSHLDKEKYERKVPAGRPGRDIDMAQAVLALA
                     CNQYIDGQTLVVDGGYTLAMGQ"
     gene            complement(387668..389272)
                     /locus_tag="THITE_2111298"
                     /db_xref="GeneID:11518924"
     mRNA            complement(387668..389272)
                     /locus_tag="THITE_2111298"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651198.1"
                     /db_xref="GeneID:11518924"
     CDS             complement(387754..388893)
                     /locus_tag="THITE_2111298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651246.1"
                     /db_xref="GeneID:11518924"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="JGIDB:Thite2_2111298"
                     /translation="MPPKIRKPCDISNLMSPPEPAPLETFKAAGLPSEKAAPSPAEQV
                     PREPLSPPVSPFSHPSSTISPAPPLGLSDGKDPILYPAGEPRASAPTGPLFSLIPESV
                     VNYKEATERLVNEHIASRPAGLFRDSTPPKPEDYELALFFKSNCFRMFRDNPQEWLRK
                     ERALLRADRRRTAPSFQPHKLPHILPAAKPAVSGPQPSKTPSARVQKPSPQKPRPPKV
                     RVQNPRPIRATPAPARETIHVGTPEPRVRTVAPNREDKDFASLQDLSPPLSTLPAKGN
                     SLKVDWKGNALDLTNDPYRDLLHPDELILASNLRLDCATYLTSKRRIFLRRLECAEKG
                     KEFRKTDAQQACKIDVNKASKLWQAYEKVGWLDIEWMRQYMKRKD"
     gene            complement(<395327..>396664)
                     /locus_tag="THITE_37982"
                     /db_xref="GeneID:11518925"
     mRNA            complement(join(<395327..396189,396262..>396664))
                     /locus_tag="THITE_37982"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651199.1"
                     /db_xref="GeneID:11518925"
     CDS             complement(join(395327..396189,396262..396664))
                     /locus_tag="THITE_37982"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651247.1"
                     /db_xref="GeneID:11518925"
                     /db_xref="JGIDB:Thite2_37982"
                     /translation="MLVKVVEGIAVTADRVEGLRAWDLKSRSLIAQIATGDHGSDAAP
                     SCIAVDEAELERGILDIALGFSDGSFGLWRLFANKKRLERRYLHEKSSNGELIAVALS
                     YPYLLTATGEVLVSLYTFDVPNAAETGQVTRQKPSKSVPGSQAADKLPPPYLLTSLDS
                     RTSRPPLALSIRRVGKTTTIASVAYTFSTRRGWSIGIQDLHIRQPTTDSLLAAPDIST
                     TRIAYTTPVETAGPSHSPRTPPATPRPRRGLAAPASSPTSSHADPEAIEPGPTTLCYT
                     HPYLLATLPDNTLVLHMCTSNASSLSISDGIRLWGHTSGISDAEITARGKAVSVSTRG
                     EEMRVWELEGRLASSGAGSRSVEIRPWQSPGRGGAPGGGPAGDGLHAGDPARDWDERR
                     NWVGFDDEMVIVLKEREGARESLMVYDFT"
     gene            <397985..>399201
                     /locus_tag="THITE_120135"
                     /db_xref="GeneID:11518926"
     mRNA            join(<397985..398003,398058..398157,398220..398387,
                     398475..>399201)
                     /locus_tag="THITE_120135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651200.1"
                     /db_xref="GeneID:11518926"
     CDS             join(397985..398003,398058..398157,398220..398387,
                     398475..399201)
                     /locus_tag="THITE_120135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651248.1"
                     /db_xref="GeneID:11518926"
                     /db_xref="JGIDB:Thite2_120135"
                     /translation="MASGEPILYSLYVYAPDKGVPIFFMTSYALSAVFHIWQCYRYNA
                     FRLIGLHPVCAVLFTAGYALREYGAYNYLYSPTTKLPLIICILSQVCIYVCPPLLELA
                     NYHVLGRVFYYVPYCSPLPPGRVLRTFGGLMLLVEALNSIGVALSSNSSSSPSQQTLG
                     GNLTLAALSIQLIVIFTFVCLAGVFHWRCAKTKIPAAAVKTVLLTLYASMALIFVRCI
                     YRLVEHTGDTKVNIADLDALRALSPLLRYEVFFYIFEASLMLVNSVLWNVWHPGRFLP
                     RDNHVYLARDGTHAQREEEADSRPLLAKTAHVLTFGILFGRKAQTDRFQELAEFHGAA
                     QAK"
     gene            complement(<399407..>401089)
                     /locus_tag="THITE_2046492"
                     /db_xref="GeneID:11518927"
     mRNA            complement(join(<399407..399606,399829..399932,
                     400044..400166,400302..400622,400854..>401089))
                     /locus_tag="THITE_2046492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651201.1"
                     /db_xref="GeneID:11518927"
     CDS             complement(join(399407..399606,399829..399932,
                     400044..400166,400302..400622,400854..401089))
                     /locus_tag="THITE_2046492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651249.1"
                     /db_xref="GeneID:11518927"
                     /db_xref="JGIDB:Thite2_2046492"
                     /translation="MVCVALGHRINRLGSEEQQSRTALSERFYRFWGLAVRSLNEHLD
                     REDARTCDMVIAGVLTLLLTDVSRHCPGIKKEERPLTVFGNTTSPASDLLLPDAALSA
                     LPFLEQQYGAAAFLFQLCPLPLFAELIRINHLRAQAAAAAAAGAGAAASSPSSTPDRL
                     SHAAAQTLSRIQHAFSPSAWADAKANSRQTWLLIARIYQTATALYCTHALQSLSPSLS
                     PSLSPSPSPALLEEGLALASAKRFLVWPVVVLGAACGAREGTAVDEIRAFVVQALLAL
                     AHHSGSCVPLTAKQVLEAFWASGQTGWDACFARPYVFTGQIAVDTRRLYGL"
     gene            complement(<401342..>401542)
                     /locus_tag="THITE_2012454"
                     /db_xref="GeneID:11518928"
     mRNA            complement(<401342..>401542)
                     /locus_tag="THITE_2012454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651202.1"
                     /db_xref="GeneID:11518928"
     CDS             complement(<401342..>401542)
                     /locus_tag="THITE_2012454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651250.1"
                     /db_xref="GeneID:11518928"
                     /db_xref="JGIDB:Thite2_2012454"
                     /translation="RALAMKAVHKRHCWECRRRCLVCDFTEPACRRCSAAGVQCPGYG
                     HVKPTRLKWLSPGRVVARADRKR"
     gene            complement(<401945..>403608)
                     /locus_tag="THITE_2046186"
                     /db_xref="GeneID:11518929"
     mRNA            complement(join(<401945..402242,402316..402412,
                     402481..402690,402762..402869,402925..403121,
                     403180..403334,403408..>403608))
                     /locus_tag="THITE_2046186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651203.1"
                     /db_xref="GeneID:11518929"
     CDS             complement(join(401945..402242,402316..402412,
                     402481..402690,402762..402869,402925..403121,
                     403180..403334,403408..403608))
                     /locus_tag="THITE_2046186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651251.1"
                     /db_xref="GeneID:11518929"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="JGIDB:Thite2_2046186"
                     /translation="MACSRWSLIITAVAAVGCSLFLSDASRAVGGPPGDWDSIPPQVQ
                     IIDQRTFNVLHTVPPPTEADGNAQFIPPGTTKESLAARPFHIYDKEFLDIIGPHPTLT
                     LLAHTDSDPLFHEAPVWYPGKDEMFFVQNAGAKAAGTGLAKSAIIQKISLSAVTPAVA
                     SQRDARGSVKVEVVDSNPMVVNPNGAINYKGQLLFLGEGQGDKTAPAMYLMNPEAPYN
                     TTVILDNFFGRQFNSLNDASINPRNGEIYFTDPTYGYVQDFRPPPGLPNQVWRFNEAT
                     GAVAIAADGFNMPNGITFSPDGSHVYVADTGMIQGFFGNNFTFPSTIYRFDVNEDGTL
                     DNRRTFAYVTPGVPDGLHVDTKGNVYAGCGDGVQVYNPSGKLLGKIYVGSTSANFQFA
                     GKGRMVVLAETELYYATLAAEGAFPGKLY"
     gene            complement(<405776..>406261)
                     /locus_tag="THITE_2016489"
                     /db_xref="GeneID:11518930"
     mRNA            complement(<405776..>406261)
                     /locus_tag="THITE_2016489"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651204.1"
                     /db_xref="GeneID:11518930"
     CDS             complement(<405776..>406261)
                     /locus_tag="THITE_2016489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651252.1"
                     /db_xref="GeneID:11518930"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Thite2_2016489"
                     /translation="QIKAWLDRCSSHPDCGRPGYGQEGRAVPQPQLPYRVLDLGQTPD
                     AVVKLAETSQWEDSRRHAEYACLSHCWGDSRPDCITTRENYEKNKRGIELSRFSKTFR
                     HAVALCRELGFRYLWIDSCYIIQDDEADWRSQSAEMCNIFKNATITVAAAASRSGDEG
                     CF"
     gene            <408056..>409308
                     /locus_tag="THITE_2142696"
                     /db_xref="GeneID:11518931"
     mRNA            join(<408056..408136,408233..408382,408467..409177,
                     409246..>409308)
                     /locus_tag="THITE_2142696"
                     /product="glyoside hydrolase family 61 protein"
                     /transcript_id="XM_003653683.1"
                     /db_xref="GeneID:11518931"
     CDS             join(408056..408136,408233..408382,408467..409177,
                     409246..409308)
                     /locus_tag="THITE_2142696"
                     /codon_start=1
                     /product="glyoside hydrolase family 61 protein"
                     /protein_id="XP_003653731.1"
                     /db_xref="GeneID:11518931"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR005103"
                     /db_xref="JGIDB:Thite2_2142696"
                     /translation="MRTTFAAALAAFAAQEVAGHAIFQQLWHGSSCVRMPLSNSPVTN
                     VGSRDMICNAGTRPVSGKCPVKAGGTVTVEMHQQPGDRSCNNEAIGGAHWGPVQVYLS
                     KVEDASTADGSTGWFKIFADTWSKKAGSSVGDDDNWGTRDLNACCGKMQVKIPADIPS
                     GDYLLRAEALALHTAGQVGGAQFYMSCYQITVSGGGSASPATVKFPGAYSANDPGIHI
                     NIHAAVSNYVAPGPAVYSGGTTKVAGSGCQGCENTCKVGSSPTATAPSGKSGAGSDGG
                     AGTDGGSSSSSPDTGSACSVQAYGQCGGNGYSGCTQCAPGYTCKAVSPPYYSQCAPSS
                     "
     gene            complement(409598..410781)
                     /locus_tag="THITE_2111307"
                     /db_xref="GeneID:11518932"
     mRNA            complement(join(409598..410095,410243..410448,
                     410537..410553,410607..410781))
                     /locus_tag="THITE_2111307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651205.1"
                     /db_xref="GeneID:11518932"
     CDS             complement(join(409812..410095,410243..410448,
                     410537..410553,410607..410669))
                     /locus_tag="THITE_2111307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651253.1"
                     /db_xref="GeneID:11518932"
                     /db_xref="JGIDB:Thite2_2111307"
                     /translation="MSNNQTETYQWPSKTVKTDYPLIDNDPHFTRVIRYARPSDYVHG
                     AAAAAAGPGLLYAMERFAPSHVGKGGFAQAMRLAGFIGVAGGFLYFYQRSILRFYGMT
                     ENAREVEMDMREMTDRVKAGLPLYGESRLTPAMQGVAARQSRYSALFFGVLPWFNFVN
                     HPQHGVDTAKYYQQAERELEAERLAKGSS"
     gene            410945..412393
                     /locus_tag="THITE_2111309"
                     /db_xref="GeneID:11514806"
     mRNA            join(410945..411290,411353..411428,411482..412393)
                     /locus_tag="THITE_2111309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651206.1"
                     /db_xref="GeneID:11514806"
     CDS             join(411058..411290,411353..411428,411482..412201)
                     /locus_tag="THITE_2111309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651254.1"
                     /db_xref="GeneID:11514806"
                     /db_xref="InterPro:IPR012923"
                     /db_xref="JGIDB:Thite2_2111309"
                     /translation="MTSRTANSVLPGRDSGNFVNDYLADWPDDDPFRSPSPEPAKTSD
                     RKENAKKRDVLGIETQLDLKRKPRAPRVKLDETRLLSDKGIPRLRRMAPKLKLKGKGH
                     EFSDAARLLSFYQEWLDDLFPKATFLDALAMVEKEGHKTAMRNARQQWIDEDKPKPAA
                     AEAEDDQDYRLHQGSSGPRQPERVAPVFEKAAQAGKERARTPAADDLFGDDDIYNATP
                     RRDMGSTAPAGQVVNDGVPDEDDLDALMAEAEAEAQSGQSSGVASAPFTSIFGDGSKT
                     ATSAPAAEPDEDDLDALMAEVEAEGGATTRPSNDQKDSSSAGTDTGQPSVNFEDDEEA
                     MAEMDGLW"
     gene            412395..414745
                     /locus_tag="THITE_2111311"
                     /db_xref="GeneID:11518933"
     mRNA            412395..414745
                     /locus_tag="THITE_2111311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651207.1"
                     /db_xref="GeneID:11518933"
     CDS             412810..414510
                     /locus_tag="THITE_2111311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651255.1"
                     /db_xref="GeneID:11518933"
                     /db_xref="InterPro:IPR000918"
                     /db_xref="JGIDB:Thite2_2111311"
                     /translation="MAALPPVDPTMPSTAPATSYQLLPEARKAGAAEDALHQQQVQEV
                     EAWWASPRFAGIKRDWTAADVVSKRGSLQQSYPSSIMARKLWNLVREREAAGQPIHTL
                     GAIDPVQMTQQAPHQEVLYISGWACSSLLTTTNEVSPDFGDYPYNTVPNQVQRMFKAQ
                     SMHDRKQWFLRSKMTAEERAKTPYVDYFRPIIADGDTGHGGLTAVMKLAKLFAENGAA
                     AVHFEDQMHGGKKCGHLAGKVLVPTGEHINRLKAARFQWDVMGTENLLIARTDSESGK
                     LLSSSIDVRDHEFILGVADPSVEPLAETLATLEAKGASGAEIDAFEAQWVKNTKLVTF
                     DEAAVAHFEARGVGADKIAAYTRAVAADRDMGITARRKLAASITPDSPVYWSWDVPRT
                     REGFYHFRAGMAAATKRALAFAPYADMLWVETGDPNVRVAADLGRAVRSAFPGKPLVY
                     NLSPSFNWMAHGFTPETLRSFIWDIAREGFVLQLVSLAGLHSTATISSELARRFKDEG
                     MAAYVELVQKREKELGVDVLTHQKWSGANYVDAVLGHILSGSSGSRSMGEGNTEGQFV
                     "
     gene            414747..416114
                     /locus_tag="THITE_2111312"
                     /db_xref="GeneID:11518934"
     mRNA            join(414747..414907,415039..415180,415246..416114)
                     /locus_tag="THITE_2111312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651208.1"
                     /db_xref="GeneID:11518934"
     CDS             join(414846..414907,415039..415180,415246..415899)
                     /locus_tag="THITE_2111312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651256.1"
                     /db_xref="GeneID:11518934"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2111312"
                     /translation="MASASRGRLAGKNAVITGAGGGIGLETSILFAKEGANVLMTDIS
                     QEALDRALAKVKQLVPSAGRVETRLCDVSKEADVKAAVEHLDAWGGLDVIFNNAGIMH
                     ARDDDALNTPEEIWDLTHNINVKGVWYGCKHAVLALRRHGKKKGSIINTASVVALVGS
                     ATPQLAYTTSKGAVLALTRELAIVHAREGFRFNSLCPAPLNTPLLQDWLGDDQHKRHR
                     REVHFPTGRFGEAVEQAQAVVFLASDESSFVNGTDFVVDGGMTKAYVTPEGPALPPPV
                     NNALKDSLE"
     gene            416115..420276
                     /locus_tag="THITE_2111314"
                     /db_xref="GeneID:11518935"
     mRNA            416115..420276
                     /locus_tag="THITE_2111314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651209.1"
                     /db_xref="GeneID:11518935"
     CDS             416348..420211
                     /locus_tag="THITE_2111314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651257.1"
                     /db_xref="GeneID:11518935"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="JGIDB:Thite2_2111314"
                     /translation="MALELHEAMQRLHLDDSSSFGVIDDIFDRTVAAKPQPQRPEQLR
                     AELEAKYLSPPTIFSTEWLDKLQQRWDAPTDYSLLFRVAPTQSRTVTRFVRHGLEGRV
                     TGYRNVTVPASHATAKTSTSMLRKPAGRAEFVRGAAGFFPFAPGGLEGIESTAALEDQ
                     LRSSAAAEHESDSRKKLEKVITLGEGGLLEVAPGLSRGIDFSKRRKLADAESERQAKE
                     VEEVLDQEPEAAPGGEDEDGERQGSGIDGGEDEEGQEDVEDIDSILPVEFPALEPRGT
                     LAASSARKAGREWAHMVDVKREMPNFRELVPDMAREWPFELDTFQKEAIYHLENGDSV
                     FVAAHTSAGKTVVAEYAIALAARHMTKAIYTSPIKALSNQKFRDFRQTFDEVGILTGD
                     VQINPEASCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDFERGVVWEEVIIML
                     PEHVSLILLSATVPNTYEFASWVGRTKQKDIYVISTPKRPVPLEHYLWGNKNIYKIVD
                     SEKNFLEKGWKEANAAIQGRDKQKAPAPQAPAPSRGGGNQRGNGRGGAQRGANQQRGG
                     GRGGGQQRGRGGPPRASHAPGHMGRTGRPGGFTSAAQDKNLWVHLVQFLKKQNLLPAC
                     IFVFSKKRCEENADALSNQDFCTAHEKSAIHMIIEKSIARLKPEDRVLPQIIRLRELL
                     SRGIAVHHGGLLPIVKELVEILFAQTLVKVLFATETFAMGLNLPTRTVVFSGYRKHDG
                     HQFRNLLPGEYTQMAGRAGRRGLDTVGSVIIVSPGADEAPPVTDLRQMILGEPSKLRS
                     QFRLTYNMILNLLRVEALKIEEMIKRSFSEHATQQLLPEHEKAVKLSEADLAKVKRDP
                     CPICDVHMDECHQAGEDFKQLTEDLYRQLLVNPLGRKMFSPGRLIVWMKEGVRTPGIL
                     LAEGASVKSSATNPTLHVLEIKTGRELRNDSDLLPFVPAFRKHLTPLPQNKKHIATKT
                     LHVPISDIVCLTKHVTKGILPDIFGGEGYPKAKDRIHQICRSWNSDIWDEADLGRIRN
                     LAIHEIVTKRREAELKAVKSPAAECKSFLKHYAMCHDQWLIQTHIQQLRQTLSEQNLQ
                     LLPDYEQRIQVLKDLSFIDADSRIQLKGKVACEIHSGDELVLTELILENVLAEYEPAE
                     IAALLSAFVFQEKTESVPRLTANLERGMRTIVAISEKVDAVQTLHQVVQASDESNDFV
                     NKPRFGLMEVVYEWARGMSFKNITDLTDVLEGTIVRTITRLDETCREVKNAARIIGDP
                     DLYQKMAAAQEMIRRDITAVASLYM"
     gene            complement(420716..422015)
                     /locus_tag="THITE_2111315"
                     /db_xref="GeneID:11518936"
     mRNA            complement(420716..422015)
                     /locus_tag="THITE_2111315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651210.1"
                     /db_xref="GeneID:11518936"
     CDS             complement(420904..421353)
                     /locus_tag="THITE_2111315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651258.1"
                     /db_xref="GeneID:11518936"
                     /db_xref="JGIDB:Thite2_2111315"
                     /translation="MLLAKQAIAAQMDQAADMAELSLAQIQANNAMNRMTAMMAQSSR
                     TMQRAQRSANPERTLLTLEQFRAQNEEYAMSNGIYQDAMTQNTSVQVSDDAVHELLGK
                     LADDAGLELGQELSQATTSKVDPAKEPAEPTPEVEDALQQRLRALRA"
     gene            422203..423226
                     /locus_tag="THITE_2169812"
                     /db_xref="GeneID:11518937"
     mRNA            join(422203..422479,422656..423226)
                     /locus_tag="THITE_2169812"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651211.1"
                     /db_xref="GeneID:11518937"
     CDS             join(422323..422479,422656..422999)
                     /locus_tag="THITE_2169812"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651259.1"
                     /db_xref="GeneID:11518937"
                     /db_xref="InterPro:IPR007361"
                     /db_xref="JGIDB:Thite2_2169812"
                     /translation="MSAMRKHNVTTFPRLPIVERTNRHIQIKWHGQLLADCPPGEAYW
                     VLEAHHAPVYYIPPSRVRLPLSTTPRSTFSEFHGAATYYAIMSPISAAEIISNRIWSY
                     NEPPKEYEAIKGYLAFFVGPWECYVDNERAHPPPGDYYGGWVTSDIEGLVKPQWGAPP
                     AWDSVF"
     gene            425746..427741
                     /locus_tag="THITE_2111320"
                     /db_xref="GeneID:11517154"
     mRNA            join(425746..426219,426279..427741)
                     /locus_tag="THITE_2111320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651212.1"
                     /db_xref="GeneID:11517154"
     CDS             join(425855..426219,426279..427653)
                     /locus_tag="THITE_2111320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651260.1"
                     /db_xref="GeneID:11517154"
                     /db_xref="InterPro:IPR011700"
                     /db_xref="JGIDB:Thite2_2111320"
                     /translation="MDSWTAHTAPPNIKFEDSPAESLLSTPDEMYPSLFGSSSESNPT
                     VNPIDMLTPQSIAGDKQPDLTLLAGLTALTQTALTPTTLAAPHAASTAPAPEPEKKPV
                     KKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKRLEVEAL
                     ERRNKELEAALLQAQQINFTLLEEIQKFRQGAGVVSRAAPSFDALRQNPVTFSQQLFG
                     SQDGHGAPISGASSLEQLLQSIPSAVNNKTVNPASLSPALSPIPEAAEEQKQPATVAT
                     PVAEPPATSEKNASADTTQHPAAMLCQDLQCRSAEAAPSTWLAASQQPLHPVVSLLLP
                     LQLLLASTSAMLSVCQRPLMQIAMSLKAGFSLRPTRAITNTIIWLVTTPHRSPSRTRP
                     TNSTSTSSSPTASSTPRPAANSSRSSSPAAPSQTRPSSLRLRTLRKILTCSPTLARPL
                     MDATMEALRLASSEGCSVDRVSGGDVSAAAAAGGEAQKQLYRRGLAGWPTGAALPSKE
                     ALLTLLWVLRVEERRLQIREQVLASSKPGTLSVPKSTAPTVKTTSFVLAVSRKRSREE
                     ENDVSEPRRRRCQ"
     gene            complement(<428466..>430754)
                     /locus_tag="THITE_2048089"
                     /db_xref="GeneID:11517155"
     mRNA            complement(join(<428466..428581,428646..428670,
                     428694..429026,429134..430268,430351..>430754))
                     /locus_tag="THITE_2048089"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651213.1"
                     /db_xref="GeneID:11517155"
     CDS             complement(join(428466..428581,428646..428670,
                     428694..429026,429134..430268,430351..430754))
                     /locus_tag="THITE_2048089"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651261.1"
                     /db_xref="GeneID:11517155"
                     /db_xref="InterPro:IPR012878"
                     /db_xref="JGIDB:Thite2_2048089"
                     /translation="MAHPQSTFAQTAFHGPSLLRARRTTISRTTVKAQLKQLRDTGRY
                     DCFKLQWHPVYDDKSSWPVPPSLFWDSDVAKWIEGACYLLADEYDEEVDRAVRELVDM
                     IRGAQQPDGYLNVYFTVVEPDKRWSNIRDMHELYNAGHLIEAALAHKNYYHNNLLLEP
                     IEKYVSLIHSVFGPAEHQLHGYPGHPEIELALLRLHAATGSTQAYELARYFVEERGNP
                     RGQDGMHFFDWEARRRGDSPWKRPDHYPVSRTSHWYNQSHAPVLRQTSVEGHAVRAMY
                     LLTAVADLACLDELGVRAWPARDAYLAAVRALWDNMVDRKMYVTGGIGAVKQWEGFGI
                     DYFLPQGTDEGGCYAETCAAIGVMMLAERLLHVDLDARYADVMELCLYNAVMTAMSLD
                     GTAFTYVNQLASSDADRSVRHTWFECSCCPPNLMRLFGNLGGYLWDYGAAAEDGEPPF
                     VNVHLYTTAKVTFQAGGQEYVFEQVSDWPWEGRVSFKLQAPAATTTGLAVRLRIPGWS
                     AGGYTLTPPCPTATLSKGYLSLPASYTAANPTFTLSIHGLSPRLIAPHPYTNQHTLTL
                     ARGPVIYCVEDADNPWEANHFRDITLSADARVTEEERTLAGERYVALRTVCRPRDLRG
                     AGPGSGRASGGLGAERELVFVPYYLRANRGGKGHMRVGLLNQSVVM"
     gene            431664..433586
                     /locus_tag="THITE_2111324"
                     /db_xref="GeneID:11517156"
     mRNA            join(431664..432058,432136..432514,432592..433053,
                     433139..433586)
                     /locus_tag="THITE_2111324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651214.1"
                     /db_xref="GeneID:11517156"
     CDS             join(431670..432058,432136..432514,432592..433053,
                     433139..433330)
                     /locus_tag="THITE_2111324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651262.1"
                     /db_xref="GeneID:11517156"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="JGIDB:Thite2_2111324"
                     /translation="MTVILADKQFIQYYSVDATRSGTIAAVPWASTGLAQLFVGGTLA
                     NKVGRLWALRISIASMIIGVIVQVVPNTYGVLILGRLITGLGFGCVYIASNLYVAECS
                     PKLLRGSFVGTVAQFGYQLGTFIAFWTGYGMSFHTSPFNIAWRVSNVIQIPIGIAFII
                     LSFWYPESPRWLLEKDNPDKALRVLCKLRMGTPQSEHVRAEFHELVAARESRRRFDTG
                     YAGLFKSAGLRKRLLYGLYATALQQAGGIAALTMYATIIYESLGWNAGHQALAINGVQ
                     AALQLVIVLVNTFTVDRFGRKALLIAGFAIQAAALLILSSLTTAFPDNSNRAAGVAEV
                     AMLFIVGLTYCWSNGPITPAIASEIFPQEVRDKAFGLSLLGQTVCLLALTQPWPTFTS
                     EVGGKSYWLLFGLNTLLLVSVIFILPETKGISLERMDKIFGEVDAVEVGEEQGVDKVE
                     AMVVSQLEHEENARHEGMELPRL"
     gene            complement(435044..436696)
                     /locus_tag="THITE_2111326"
                     /db_xref="GeneID:11517157"
     mRNA            complement(join(435044..435684,435789..436696))
                     /locus_tag="THITE_2111326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651215.1"
                     /db_xref="GeneID:11517157"
     CDS             complement(join(435259..435684,435789..436631))
                     /locus_tag="THITE_2111326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651263.1"
                     /db_xref="GeneID:11517157"
                     /db_xref="InterPro:IPR005547"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="JGIDB:Thite2_2111326"
                     /translation="MGASGALSLLSTPAYPLPGAVGNDNAGLSRRPPRAKQNSEPPSV
                     SGGRPRSSKSFTTRRSRPRPRPWLFRRTWALPLVLMLAFVSLYALNPSESNVLHRFLF
                     LSYRLDDDQHGHRYGKGPWDLAFVCFYTVVLSFAREFVMHEVLRPLARRGGIRSRGKQ
                     VRFMEQMYTVCYIAFIGPLGLYTMRQTPGLWYFETRGMYEGFPHTTHAAVFKFYYLFQ
                     AAFWVQQAIVMLLGQEKRRKDFRELVAHHIITIALIGLSYRFHFTYMGIAVYITHDIS
                     DFFLAISKSLNYLSHQLQVPAFALCIAMWIYQRHYLNLSILRSVATEFATVGPFGLDW
                     PAQQYKCRLSQAVTLALLAALQALNLFWLGCLLRSAYRFVALGVARDDRSEGEEEDEA
                     EVVGDGQARDSRAGLSERRTGKKGLGVKQC"
     gene            <439082..>441929
                     /locus_tag="THITE_2049403"
                     /db_xref="GeneID:11517158"
     mRNA            join(<439082..439155,439214..439439,439507..439673,
                     439729..439833,439951..439972,440026..440162,
                     440222..440243,440310..440403,440467..440631,
                     440690..440912,440971..441463,441575..441711,
                     441791..>441929)
                     /locus_tag="THITE_2049403"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651216.1"
                     /db_xref="GeneID:11517158"
     CDS             join(439082..439155,439214..439439,439507..439673,
                     439729..439833,439951..439972,440026..440162,
                     440222..440243,440310..440403,440467..440631,
                     440690..440912,440971..441463,441575..441711,
                     441791..441929)
                     /locus_tag="THITE_2049403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651264.1"
                     /db_xref="GeneID:11517158"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="JGIDB:Thite2_2049403"
                     /translation="MSPLPEEFDIIVCGGGSCGCVVAGRLANLDHNLTVLLIEAGENN
                     LNNPWVYWPGIYPRNMKLDSKTATFYESRPSKWLGGRSAIVPAAHVLGGGSSINFMMY
                     TRASASDYDDFQAKGWTTKELIPLMQKHETYQRASHNRDIHGFDGPIKVSFGNYTYPI
                     KHDFLRAVESQGIPVVDDLQDLKTGHGAEHWLKWINRDTGRRSDSAHAYIHATRAVHS
                     NLYLACDTKVDKVIIENGRAVAVQTVPTKPIGDNRGTRIFRARRQIVVSAGTLSSPLI
                     LQRSGIGDPDKLRRAGVKPIVDLPGVGLNFQDHYLTFAVYRAKPGTESFDDFARGDPE
                     VQKRVFEEWHVKGTGPLSTNGIEAGVKIRPTEAELKEMESWPTPDFKKGWESYFKNKP
                     DKPVMHYSIIAGWFGDHMLMPPGNFFTMFHFLEYPFSRGWTHISSADPYAAPDFDAGF
                     MSDERDMAPMVWGYIKSRETARRMDAYAGEVQAMHPFFDYDSEASAHDLNLDDTNRYA
                     LPDNITAGIQHGSWSVPVPEPDAPRPGRAVVSSSRKEKRGELKYSKKDIEAIEEWVKR
                     HVETTWHCLGTCSMAPKEGNSIVKHGVVDERLNVHGVKGLKVADLSICPDNVGCNTYS
                     TALLIGEKAAVLVAEDLGYSGEALAMEVPDYHAPGENRLASRL"
     gene            complement(442381..443871)
                     /locus_tag="THITE_2111327"
                     /db_xref="GeneID:11517159"
     mRNA            complement(join(442381..443503,443575..443871))
                     /locus_tag="THITE_2111327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651217.1"
                     /db_xref="GeneID:11517159"
     CDS             complement(join(442470..443503,443575..443752))
                     /locus_tag="THITE_2111327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651265.1"
                     /db_xref="GeneID:11517159"
                     /db_xref="InterPro:IPR013919"
                     /db_xref="JGIDB:Thite2_2111327"
                     /translation="MGPPGIGRPSGRSAAPARSSVGNALPSHWLQMYDEFITKNAHQV
                     SQIESTLRSLTYIIPGRFRDAEIASESIHTGVQLLSLYHDALLRRAHTLSKLRAFRSS
                     VPPLSPPPLPHSRYTRFWTLKSALYRRVAYVLQIVEYVQLLCEMAAKRRGERTRWRVV
                     VLLEAIKAVCKLLLLRITRSRPLVTPALPEREPIPEEPPEDSDEDAAFAGLEEDDPDR
                     RSSSAPGPQPNGHSSAPLGPNGEWTMPRTGMTLPSLPSPGDTSGYLLSRVLTADDIKP
                     APKLLNRLQGQAYAAEVLHILAPLIFAVALARSKDKRKAWTPWVLGVGAELAARQLRD
                     RGLRTTPLERDEWRRRGWAMGWWAMRGAFYEHVTKGAVEGVRQRLPRLLSGILEDYEY
                     LWENYHFSTSP"
     gene            complement(444155..445544)
                     /locus_tag="THITE_2111329"
                     /db_xref="GeneID:11517160"
     mRNA            complement(join(444155..444618,444698..445137,
                     445209..445544))
                     /locus_tag="THITE_2111329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651218.1"
                     /db_xref="GeneID:11517160"
     CDS             complement(join(444403..444618,444698..445137,
                     445209..445260))
                     /locus_tag="THITE_2111329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651266.1"
                     /db_xref="GeneID:11517160"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="JGIDB:Thite2_2111329"
                     /translation="MGGQDAKLILYTNHRCPWAHRAHIALEELKIPFEEVIIDLDTPR
                     TPEYLKINPRGLVPALSYNGEIIIESAIVVQFLTDAYPSHLVPASNEPGGALRRARIA
                     LFVDAYVSKVNGNVFGIFRAKTDEEISSLPEKIVAGIVSEVEPKLADANPFFGGSDKL
                     TLAEVLTGSLVLRLKTFTKAGIYPETLWTTIQEKAPNFAKWADAVTAHPSVTSIFDEK
                     AQIEGTRARLAKLRAAA"
     gene            <447277..>449409
                     /locus_tag="THITE_34523"
                     /db_xref="GeneID:11517161"
     mRNA            join(<447277..447477,447514..449129,449196..>449409)
                     /locus_tag="THITE_34523"
                     /product="polysaccharide lyase family 4 protein"
                     /transcript_id="XM_003651219.1"
                     /db_xref="GeneID:11517161"
     CDS             join(447277..447477,447514..449129,449196..449409)
                     /locus_tag="THITE_34523"
                     /note="CAZy_ID 269740"
                     /codon_start=1
                     /product="polysaccharide lyase family 4 protein"
                     /protein_id="XP_003651267.1"
                     /db_xref="GeneID:11517161"
                     /db_xref="JGIDB:Thite2_34523"
                     /translation="MRLNSVLGGLLALSSSSLVSAFLTVNETSHSVEIANDRLVFSVN
                     KSIGAIDVLTLDGQDLLGSRASAFGIGPYLDCYCVPSGSYTPGSIDPTYKVFQGVDAS
                     HVKYGGVVMSEVYPPTGQLLEQYWFLRDGETGLHTFSRIAYHNSTTPFLRNLQEFRTL
                     FRPSTNIWTHLITDDQLWAPLPVPNPASGSTANSTTVQDATWYLGNRTGDPYVEQFSD
                     YFTKYTFAAVWRDHTVHGMFADGSYIDDKSTFGAWLVMNTKDTYFGGPLHSDLVVDGI
                     VYNYLVSNHHGDGTPNITDGFDRTFGPQYYHFNKGPAGGSWQALRDEAVKFASPSWNA
                     AFYDSIAQHVPNYVPTGGRGSWKAQIALPKGAKNAIAVLAQDGVDFQDNVFDTTAYQY
                     WADIESSSGKVQIDRIKAGTYRLTVYADGIFGDYVHDGIVVKAGKTTDSGRLVWSAES
                     AGRELWRIGTPDKSAGEWRHGDVRDAQHPLHPPEYRIYFGAYDFIDDFPNGVRFHVGT
                     SDEAKDFNYIHWSVFGGYANFLRPVQVEGHGEINNWTITFDLKEEQLRHTSLATFTIQ
                     LAGAKTAAGNTDVFNATQEYNNLPFVVVVNGHELEPWIIPYYQSSSCGVRSGVVCYQV
                     SHKFTFPTAYLTAGEATNEIILSLPYNATDYESALLPRSVYVQYDALRLEVK"
     gene            complement(500105..>502250)
                     /locus_tag="THITE_2153770"
                     /db_xref="GeneID:11517240"
     mRNA            complement(join(500105..501583,501645..501978,
                     502043..>502250))
                     /locus_tag="THITE_2153770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651220.1"
                     /db_xref="GeneID:11517240"
     CDS             complement(join(500605..501583,501645..501978,
                     502043..502250))
                     /locus_tag="THITE_2153770"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651268.1"
                     /db_xref="GeneID:11517240"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2153770"
                     /translation="MWPGGLGAGVLCLVLSLVLLKAIYRLFLSPLAGIPGPSLAALTS
                     WYECYFDVAKPGQYVFKIKQLHEQYGPVVRITPSEVSISDPEFLDTIYAPGPGHKRDK
                     DLNKVKGLGINTSVGGAVSHDLHRRRREALNPFFSKQNVARLAPRLRSKVGQLERHFA
                     QARESGAVLNLSDLYFGLANDVVREYCFGHGQDLLADPALAHTQRENVSGVLRSVKFN
                     LHFPWVRDLLRKLPPSIGARFTPPGVRDMIQFRIGIRREIRDILAHKHDGRSSSSRSD
                     PTIFTALRDSPILPPPEKAPHRLEDEATLLVMAGTESTAKSLTLAHCHLLANPPAMAK
                     LRAELADRDLPTTTPPDQLPYLNGVIQEAHRLSFGLTGRNPRVAPDEPIVYHSGSKTF
                     TFPPGTPLSTSTLLVHTNEALFPDPWRFEPARWLGPAGAARRRYMLAFMRGPRMCIGM
                     HLANAEMAAAVAAMARWDMRLVDTTADDVAFLHDYHVATPRLDSKGVRVEVVGRAS"
     gene            <504122..>505099
                     /locus_tag="THITE_2048890"
                     /db_xref="GeneID:11517241"
     mRNA            join(<504122..504636,504714..504868,504933..>505099)
                     /locus_tag="THITE_2048890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651221.1"
                     /db_xref="GeneID:11517241"
     CDS             join(504122..504636,504714..504868,504933..505099)
                     /locus_tag="THITE_2048890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651269.1"
                     /db_xref="GeneID:11517241"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Thite2_2048890"
                     /translation="MDKSGAAAVDYRGLGKDVFEFFTHRTAFNSAAYLLPTIESMKKE
                     NPRLRLLDVGAGVGSVSATLAEVLGPDGHVVCTDLAPSVLPQAQALAESRGVTNISFQ
                     TADVHALPFEDGEFDIVHCHQLFGHIRDPVAALREMLRVTKPGGVMAAREGDKETEII
                     WPPLPGVLKWHEFDSNVAKAHGGTLTAGRQLLAWALEGGAKRDQITVSYGTWLTSEEA
                     TKAVYARGISKVLTGPTRQNALKFGLSEEDIDEICRDTLAWADREDATWLMLQTEIII
                     RK"
     gene            complement(<505909..>507815)
                     /locus_tag="THITE_2049026"
                     /db_xref="GeneID:11517242"
     mRNA            complement(join(<505909..506129,506226..506689,
                     506784..507548,507619..>507815))
                     /locus_tag="THITE_2049026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651222.1"
                     /db_xref="GeneID:11517242"
     CDS             complement(join(505909..506129,506226..506689,
                     506784..507548,507619..507815))
                     /locus_tag="THITE_2049026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651270.1"
                     /db_xref="GeneID:11517242"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2049026"
                     /translation="MEHKAVSSGAALLSALVFALVAFVHFTSRRNTASGPTPPSLHDP
                     IPFVFNTVQFVFNNEKFMKRATKALERSPVVRFWMGTTPVYLFGGPKHYQAIFASRDL
                     TYNGIMLQIGFPKLWRMTREEIQRFANDKSGHKETPLPGTEHVPPQQRYWATKYHVLY
                     DFLSRKHHIKPIVDEFARQFSRDVVEKFPLGQWTTLSIDELTRRDFTRCAITTLFGPK
                     ILELNPDFLDAFWYFDSYASVLVYGFPRWMYPQPFRASDRFLDRIEKYVEAGLKDFDW
                     NGPDVDAQWEPHFGTRITRELTKWLTDAGFQRKSVAGALGTLVFGQNSNTIPVVSWML
                     MELNKDPQLLSAVRAEVADAFVTDPLTGARTLDTQKVAALPLLQSLFTEILRLRVSMV
                     IMRVADRPMTINGVDVPRGALVHAYSRIAQTDEATWGSPEHPADQFWPERHIKYVEER
                     DPETGTLRKRREFAMAASPACFFPFGGGVPMCPGRHFAKNEIFTMVAILVDRFEMEFV
                     RWTNPDGSPSDRPAESDQRFSGIGSLPPDRDMIVRWKRIR"
     gene            complement(<508740..>509661)
                     /locus_tag="THITE_2142713"
                     /db_xref="GeneID:11517243"
     mRNA            complement(join(<508740..509166,509249..>509661))
                     /locus_tag="THITE_2142713"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651223.1"
                     /db_xref="GeneID:11517243"
     CDS             complement(join(508740..509166,509249..509661))
                     /locus_tag="THITE_2142713"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651271.1"
                     /db_xref="GeneID:11517243"
                     /db_xref="JGIDB:Thite2_2142713"
                     /translation="MKFRGILLVGAALASGAAAACNRTFLVDATDKYVAAQAEGKPAT
                     LTAITADNLNYTESDKTVDITTGVLAQPMKIDHNRSIHDTTLCATFTELIVTDPAKPY
                     VIATRMVFTNDKASLIETIATKPGDWAFNATGYLHWNSLENWDPIPADKRDTRAVIQA
                     AGDAYFNRFDNASYAVPFGTPCARLEGGAYTDPRGAGGNTCSLGLPSTIVVTNRRYVV
                     DEEMGAVSIFLGFPGLDRSVPQEPMPDSHLFRVEGGKIRYIHTVSACVHAGCGLNGTG
                     IPA"
     gene            <511638..>512222
                     /locus_tag="THITE_2043428"
                     /db_xref="GeneID:11517244"
     mRNA            <511638..>512222
                     /locus_tag="THITE_2043428"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651224.1"
                     /db_xref="GeneID:11517244"
     CDS             511638..512222
                     /locus_tag="THITE_2043428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651272.1"
                     /db_xref="GeneID:11517244"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Thite2_2043428"
                     /translation="MTNSSEASQPAPASTPSLLPEEPALPKGYTLHSGYPPVPDYLHL
                     RAAAGLSPKTPAQAAPVARNSWYGCYVTYTPPDSPDSETTASASPASNSSSSSPTIVA
                     MGRIIADGGWYFHVTDMAVLPAHQRRGLGGAVLRHLLARIRTHAPRGEGGVGGAYVTL
                     FADAPGRRLYARNGFVETAPGQVGMMMPMGWEGR"
     gene            <527682..>529135
                     /locus_tag="THITE_2127199"
                     /db_xref="GeneID:11517245"
     mRNA            join(<527682..527799,527872..527964,528047..528752,
                     528817..>529135)
                     /locus_tag="THITE_2127199"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651225.1"
                     /db_xref="GeneID:11517245"
     CDS             join(527682..527799,527872..527964,528047..528752,
                     528817..529135)
                     /locus_tag="THITE_2127199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651273.1"
                     /db_xref="GeneID:11517245"
                     /db_xref="JGIDB:Thite2_2127199"
                     /translation="MRSEGSPWGLLVALLGSVAAAGLSDVPSPENYLRKATASATLIG
                     NYVYIDGGEIAQLVDGKVPSFRTTNQVNSTLSIDMSKSWNASTVVQRTIDRPWWSKVN
                     QVIWTNHEAGTFYVWGGKWIWGDNMTKNELWKFTPDGKGAGTWSIEPPANADLFNGLH
                     ESEFGAYANTNDTGFVIGGIASGWTEYGRASTSVLPGMVTFNMQTNVWQNGTTAFSPF
                     GTLAGARAHYIPTFGPNGLVMVLGGQSHSLVGDPDWSAATPYDLRNLTFFDPQTKKQY
                     WQATTGSIPPFPRTFFCLAGFQNTDGGYEILLAGGSNERDKFLYQDTYILSLPGFVWV
                     KAADSPSGKRRDAACVSVGNRQVLSIGGTDGTWTDPDPAPQGLQLFDMTEMQWKYSYD
                     ANAAAYERPADLAVWYKNG"
     gene            complement(<530100..>530925)
                     /locus_tag="THITE_153552"
                     /db_xref="GeneID:11517246"
     mRNA            complement(join(<530100..530421,530518..530797,
                     530871..>530925))
                     /locus_tag="THITE_153552"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651226.1"
                     /db_xref="GeneID:11517246"
     CDS             complement(join(530100..530421,530518..530797,
                     530871..530925))
                     /locus_tag="THITE_153552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651274.1"
                     /db_xref="GeneID:11517246"
                     /db_xref="JGIDB:Thite2_153552"
                     /translation="MLWTTWLGLAAAILGTGKSAAADTVYRDPDTGLVFTSNFELYKS
                     DGHGITVRIAIPDNVQSYTAFDAVIQMVIPNEVGWAGLAWGGSMTNNPLLVAWRGTSN
                     NAVLSPRWASSHVQPQPYSGAQYTLFKTGTKTNATHTQFTALCKGCTSWTASDGSTRY
                     LSPRGGNRLAFAYSPTRPASPNSPTSSLSIHEVVGYWQHDFSQAANANFEATVSKLVS
                     "
     gene            534491..536122
                     /locus_tag="THITE_2169814"
                     /db_xref="GeneID:11517247"
     mRNA            join(534491..534808,534859..536122)
                     /locus_tag="THITE_2169814"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651227.1"
                     /db_xref="GeneID:11517247"
     CDS             join(534737..534808,534859..535896)
                     /locus_tag="THITE_2169814"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651275.1"
                     /db_xref="GeneID:11517247"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Thite2_2169814"
                     /translation="MSGAAIASSVSSDPYSTSLDASQLETEAYPYFSPVSVFDADDFG
                     ADFTSDSATSPVSPISPALSASSLGFPPTEGWAAWDSSELFPKPDGLLGCQTFASCPP
                     SNPTLSPAINPMDLSTPPYLNQSPQALLASCQTQQQQTPFPSSSPSTASPTSPTTDIT
                     TTKRRPSRMPKRKSTSAHTSDDEPAPTKRSPSRRSSRKTAEGAATTTTTTTTTNPAAG
                     PRKKAHNMVEKRYRTNLNDKIVQLRDAVPSLREMAARARLYERAGAGGASSELSGFEE
                     ANEGEDGGHSLANGLSGARNLDLDGGIGGSGGAAKLNKATILAKATEYILLLEQRNRG
                     LETENDALRGRMEGLEMWVMQAANAGAEPVVGGWS"
     gene            <537579..>538135
                     /locus_tag="THITE_2086434"
                     /db_xref="GeneID:11517248"
     mRNA            join(<537579..537596,537932..>538135)
                     /locus_tag="THITE_2086434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651228.1"
                     /db_xref="GeneID:11517248"
     CDS             join(537579..537596,537932..538135)
                     /locus_tag="THITE_2086434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651276.1"
                     /db_xref="GeneID:11517248"
                     /db_xref="JGIDB:Thite2_2086434"
                     /translation="MAVQQLDAHKIKADVWLLSGRYDEATTLSTEPWFKHNPRVWWIT
                     FENSSHMAHWEERERYIEVTGAFLPSTTP"
     gene            complement(<538852..>540770)
                     /locus_tag="THITE_120112"
                     /db_xref="GeneID:11517249"
     mRNA            complement(join(<538852..540080,540155..>540770))
                     /locus_tag="THITE_120112"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651229.1"
                     /db_xref="GeneID:11517249"
     CDS             complement(join(538852..540080,540155..540770))
                     /locus_tag="THITE_120112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651277.1"
                     /db_xref="GeneID:11517249"
                     /db_xref="JGIDB:Thite2_120112"
                     /translation="MDIRDGQNTPTTTTTDYDSGDSESVDYVYEGQRHVERQNRKGSG
                     RTRKRSPRGKTRRPARCVCGTNRGDEDNTEISTGGEDDDGDEKRGRRGRKSEPRPSKT
                     GSSSGSEDTSNKTDRKVRGARSPYIEEYPDELPRPVVVLRKHALPRRFSTSDTDHVRA
                     PENPSLSSGSQAMSSKGEGLPPRRLHRTVKEAPKHSGRYTSRLESYKTLGGDAVEILS
                     DSDGPSLPTRRSSHEHAQGVTTAVSRSTAWNDHSPPQYPSSWPRHTPSRLIQQRPWHR
                     GHGSESEERTEEPEQTANEHSTSAESRDRTRPQLPSAREREREQESERSSRSRQTPSH
                     PNERARPRSRTAASRASMTTIDQGHRSVATSLCEVWRGAAEDWESPYASASDDSDDSD
                     VDEPIINPRRTTHLARRPSSPHLLPPRGERRAFGFPTTTPRSPAYHHHHHAYHHQSTR
                     MRDHSLSPVQDMIHHPPWPTTDTRLLLLPLLDDGTVDPAPPDAMTDDDEAGAHYHYYS
                     YCARRPPSRASGPRPTPTTPAPPTTRRRLRLMPPTERGGSRGGGGGGGGGGGGGGCWT
                     TTTTTTTYPLLPPPDRVSPPVFAARRTREFLAPTPTRPARFDFGAWGL"
     gene            complement(541685..542862)
                     /locus_tag="THITE_2111333"
                     /db_xref="GeneID:11517250"
     mRNA            complement(541685..542862)
                     /locus_tag="THITE_2111333"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651230.1"
                     /db_xref="GeneID:11517250"
     CDS             complement(541798..542715)
                     /locus_tag="THITE_2111333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651278.1"
                     /db_xref="GeneID:11517250"
                     /db_xref="JGIDB:Thite2_2111333"
                     /translation="MASRKPAPPGANPYQTIQCSHCKSSCTVRCIESHGDFFRCHNRD
                     CPLHTNPAHVLPFEGLIVPWKTYPDPDPDYDLFGVPSQDDDQPPTDFRPATGGGRRDR
                     DPFRPFDFGPEPDMDSIRRDRHRRPPRGLDPDYDEREKWRSDLPPKDGRRPGRAPPDD
                     GFPWSDRVPFDSGFPRPTRDYGLDPDRGRHRDRTTSRTGTGIPPWGGRDPFDSDFFRR
                     ARERHMGPFSNFFTASDPFGSTFFQSSRGGYGHATGGLFGPDSDFARTMADIDRMTEG
                     LGRMGLNDDPFGSFFSSPFGRRRPGPGPF"
     gene            complement(542863..544453)
                     /locus_tag="THITE_2111334"
                     /db_xref="GeneID:11517251"
     mRNA            complement(join(542863..544143,544238..544453))
                     /locus_tag="THITE_2111334"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651231.1"
                     /db_xref="GeneID:11517251"
     CDS             complement(join(543010..544143,544238..544261))
                     /locus_tag="THITE_2111334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651279.1"
                     /db_xref="GeneID:11517251"
                     /db_xref="JGIDB:Thite2_2111334"
                     /translation="MVSFWPWRKDDSSPASFEKALSGLAAKITATQAQLDRTRARSRR
                     VKLLCTLYLGFAYLVYGIVLVLVVGWRNMGSWEWTGLAGGPVVISLVRAVTTAFFDYS
                     IERLSARLKEAQAERAKTIQKLKDATKYDSTLELLEKYGGAEHKQKERKDTADEDEGV
                     AERARDGRLKGRHARLPQHTNMPPPPTANIPRPAAPGLGTPQSRPQSRLGPPSQPALA
                     QPDMEASAEFAPNAFDGGPPPPPPAFMQYPPAAMGPPAETHWYDRILDALLGEDETAA
                     KNRIVLICSKCRLVNGQAPPGTKSLSELGMWKCMACGATNGEMDEGTRIVQEVLGDRG
                     VATKTETADENASRSSEGELVEVDKDVPEANPRREDSAAEGPRKRRGKGNN"
     gene            545121..549138
                     /locus_tag="THITE_2111335"
                     /db_xref="GeneID:11517252"
     mRNA            join(545121..545235,545293..545845,545928..548748,
                     548818..549138)
                     /locus_tag="THITE_2111335"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651232.1"
                     /db_xref="GeneID:11517252"
     CDS             join(545227..545235,545293..545845,545928..548748,
                     548818..548869)
                     /locus_tag="THITE_2111335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651280.1"
                     /db_xref="GeneID:11517252"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="JGIDB:Thite2_2111335"
                     /translation="MFQRLKGAIDRTIAEEQARQRAALESQKPAPTASSATSGRSRST
                     SAAGNQSPARRPRPAKKASEDHTPRDANGDGGTANPDPAVFEAAFVIDDSEETAAPSR
                     IATPLSTSNATKTGQSGGDTPPADADASVNGPSDARPASDLAQAAKASADQPANAAST
                     AAPGASELPPEVRARLRKLEKLEKTYPELLRSYRIAHGRATSIEPFEKALRENTPLTS
                     IKDPEALVEYLNQINLKGDMLMEELKRVTAEKDAYKERADGAEKELAALKEELASLKS
                     AQSKDSLGDKEPVKNAGDAEKVPQHPKEKPADGSDGEEFFSYDDEIPQLQAEVQKKTE
                     EIEKLQAEVTHLKDELSVAKEHSAGLIESLENATRELSETRDAVAIKASVETQLAARN
                     AEIATLTERLDKAQAKLKDVEAQAEKARSDAAEAVKEKASQLTSISSRNKDLESELEK
                     VLRTKSSLDEKIKGLTSEIEELKKAKAEDEARITELTKQSQPAATKPAPLEGPVSTQE
                     SSLAPPTGAASGKKKNKKKKKGGASAAAAAAASEPAPSEASTTDQPPPSPREDSSVDE
                     LQAELARLQEELAEKDHRIERLLEKRKTEEDLREEIENLQENLMTIGQDHVEAKERIK
                     ELEAEKKALQQRISELEQEVASSASAAKGAAELQSEHESLRQEFDNLKMKTSTLQSDL
                     AAAQQLAQTRYKDLTELREVLQKAQPELKSLRQDSAALKTTREELSAKTTELRNLEKR
                     EKELKAELARAQRLAFDREGEIKSLHEKVGQETNARLRLEEEKRIAGRDLRRSEAEKI
                     EISAREEKATRELQRVQEEAAKLRPRIRELEDEAGRLRKEQEVLREEVELKTSQYSNA
                     QSLLGSMRDQTAELSIQLRESQAQCESLDEELAEARKMLGERTREAETMRRLLADVDE
                     RADARVRDMRAKMEAAVEERDRLEDESSALARRKAREAEELRQRIRDLEREVKALAGE
                     KDELEHREREWRRRREELEACEERAGAEVAEMRSAVSSLRSTLDASEQQVRDAEKKNA
                     ELRRALDDYRLRYDKLAKEAKTLQARLASPAVASSGRSSIDSTRSGTGALNGSSAALP
                     GGSQDAMYLKTILLQFLEQKDNKLRAQLVPVLGKLLKFDKTDEQKWLAAIQHISNR"
     gene            551646..553583
                     /locus_tag="THITE_2111338"
                     /db_xref="GeneID:11517253"
     mRNA            join(551646..551954,552040..552629,552702..553583)
                     /locus_tag="THITE_2111338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651233.1"
                     /db_xref="GeneID:11517253"
     CDS             join(551817..551954,552040..552629,552702..553293)
                     /locus_tag="THITE_2111338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651281.1"
                     /db_xref="GeneID:11517253"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="JGIDB:Thite2_2111338"
                     /translation="MGLNAYFAYTVVGEHGSGAVPYEVALTAIFVEGFIFFGLALLGL
                     RQWLARVIPRCIKLATSVGIGLFLTLIGLTYSEGIGLIVGSTSTPVALAGCTSGSLDA
                     SGQCPDSAKMRNPAMWIGIFCGGVFTAMLMLYRVKGAIIFGIILVSIISWPRTTPVTY
                     FPYTDVGNSNFDFFKKVVDFHPIQKVLNVQRWDIGSYGGQFGLALITFLYVDILDTTG
                     TLYSMARYANLVDPVTQDFEGSTLAYMVDSMSIAIGSLMGTPPVTAFVESGAGIGEGG
                     KTGLTAITTGICFFIAIFFAPIFASIPPWATGCVLVLVGSMMVQAVTDINWKYLGDSL
                     PAFVTIALMPFTYSIADGLIGGICLYILINTLVWIIEKASGGRIVPPNKELKEPWSLV
                     TDGGIMPPWMGRLAKGKKDFWRPGPSRSVSGAEGVTVNIDGKTSASD"
     gene            <553913..>555337
                     /locus_tag="THITE_111929"
                     /db_xref="GeneID:11517254"
     mRNA            <553913..>555337
                     /locus_tag="THITE_111929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651234.1"
                     /db_xref="GeneID:11517254"
     CDS             553913..555337
                     /locus_tag="THITE_111929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651282.1"
                     /db_xref="GeneID:11517254"
                     /db_xref="InterPro:IPR006913"
                     /db_xref="JGIDB:Thite2_111929"
                     /translation="MAAARNFTISCHCGAARQAVAPRGNQSLFSEVSFCHCDSCRHLT
                     GLLCASYAPISSHPAPSVAGLQSYSTSPASTRYFCSTCGCHVFRASRPSPSSAPEQWS
                     WEVATGAVVDGPAPTSSLPEQWRHLHIRDTKDGGLSAWLPNADPPPQSSEHSPASPDQ
                     STTLPASCHCRSISLQITRPSPDPALNPDSPYADLLLPYHSTPSTTVSNPSREKWYLR
                     PDPALLRSHHSPSPNHQPQHVRYLAGTCACETCRLTSGFEIQTWSFIPRRNILIRLSQ
                     PGEAGSSTNPAATANASSHPDPQQQQQEEEQQHQQPQKPHQEQEQQQQEEQQQQQKQQ
                     QQQQQPQPEGEEKEEEDYRPLDFTRLPTNSPLKAYESSPGRLREFCGRCGATVFWHDR
                     VRPDLIDVSAGLFRAAAGARAEDWLAWWTGRVSFSEEAGTGRHGGAKAWGKGVIKALE
                     RRLKAHHQGQSESQVRVSRGSDGA"
     gene            complement(555468..558499)
                     /locus_tag="THITE_2111344"
                     /db_xref="GeneID:11517255"
     mRNA            complement(join(555468..555562,555628..556075,
                     556130..556919,557117..558499))
                     /locus_tag="THITE_2111344"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651235.1"
                     /db_xref="GeneID:11517255"
     CDS             complement(join(555867..556075,556130..556919,
                     557117..557878))
                     /locus_tag="THITE_2111344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651283.1"
                     /db_xref="GeneID:11517255"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="JGIDB:Thite2_2111344"
                     /translation="MAGTLFLKAISATGLKIAAFLQSLFLFPVNTLLQVVDLVPFARR
                     TSQPILPCSTAGSGSSTPPSSRQPHDDVDAGGRHAASDMMAASSSSAASDPANPKTPV
                     PGMASISPPNPPAGKLDCSPTKADSPAADAQLSGVLSRLELNDNRSAAPTTPLHDGVN
                     GTGAGAAQNGTFPCYPGPNGTDSATARGVTPALPGSLECSAAQTSKSEETAAMPVTTT
                     IQLGSDTIQIQAKHETPEQAAERAKHSRFMREALDMARLALRTNETPVGCVLVYKERV
                     IAKGMNATNVTRNGTRHAELMAISALLSYSSSADLEPATNGSREGLDTTRAPLTDKTN
                     EMQPAETSTWGDVDPRDGHLYPYGQKLHPSPRVDISIIRECTLYVTVEPCVMCASLLR
                     QLGIKKVYFGAVNDKFGGTGGVFRIHKNSPRSMASAPPTPTPQKGKGLARPVLERLPA
                     STDGVSDQRNAMEDNKDENGIIISHMESANLPGDGGNIERGFEAEGGWGRDEAVTLLR
                     QFYVQENNRAPVPRKKEGRAARLAAMMERDGHAGGPMIVANAVPTAQGDSGSSTTDDQ
                     ESNIEATAEDPTAAAGAPAA"
     gene            complement(558501..561787)
                     /locus_tag="THITE_2111346"
                     /db_xref="GeneID:11517256"
     mRNA            complement(558501..561787)
                     /locus_tag="THITE_2111346"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651236.1"
                     /db_xref="GeneID:11517256"
     CDS             complement(558896..561283)
                     /locus_tag="THITE_2111346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651284.1"
                     /db_xref="GeneID:11517256"
                     /db_xref="JGIDB:Thite2_2111346"
                     /translation="MARHGSVGAFSGFSVSQPALGAALQWLPAIGTPELDEMINAFLP
                     GPASIQDKRAHISMDFFEYSRRTGENFKFYPVPSGSFTPVTASPATSALYDSGYASSL
                     NYSSVLSPAPVALAPSDGRTQSRSSASRKSSSSSSRRETVDFANHPGMRILTKDGRDV
                     TNSASRGCKTKEQRDHAHLMRIIKACDACRKKKVRCDPSHRKRNASQSSPSSQPEQKP
                     VKRSRKAEESPPVTVADASADLFAGVLNAPEVALTFPAVDAGFPQDLDEFWNDFITFD
                     PEPAPVAAAPNFDDFVFDPFTDSQNFSPSSGSSSTSPSQTFTPFTPAPSGGSPATASD
                     AAADLAGGFSLQDPTVPYLNPGVAHGTNYIDFNLYSPGPEIIDDDPVLQLRDLTSRQP
                     SPQSHELAQAYAIHNSPRALAAEPVIHAPISWATSAGDRPVDERPAIAASSIDGAWYY
                     DPEPSFRERDRTSGRSSTLRQLNTNHNRLAGSEAGVPCPSSDGRITHGDASEIGPLLP
                     VSSTAMHSEYHNGGAPSTVFARAAQSSVSPCTSPGPRRLEPATVAGPASSTVEAAVST
                     DAVSPRTISQLATAAAWQPRLLRATGSTSSAASSQPCHGVVDGSLGSAARHDQGCVSS
                     SLASQLLPGRELGSSALVDALRGVQLDVGAAHAMLRTTVFSTLPTRCNVAGEGVINNT
                     FFFQLAVFGLVSLLCARALQALLADQVNLVNILAISSISLARLAPRCAGPPSVALPVS
                     KTLPSPPPSPSGIVGQVRSTIQSVTGSLGALRCTVSRRVRRIVPRLPSVQTWRLQ"
     gene            complement(563111..>566709)
                     /locus_tag="THITE_2094717"
                     /db_xref="GeneID:11517257"
     mRNA            complement(join(563111..565388,565454..565917,
                     566520..>566709))
                     /locus_tag="THITE_2094717"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651237.1"
                     /db_xref="GeneID:11517257"
     CDS             complement(join(563817..565388,565454..565917,
                     566520..566709))
                     /locus_tag="THITE_2094717"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651285.1"
                     /db_xref="GeneID:11517257"
                     /db_xref="JGIDB:Thite2_2094717"
                     /translation="MEEAALGAREQRPGSPLRGMFAQVSTARSWCATYAGLASSADLA
                     IKAETRQHAQTFAELPVVDSWRGSRPPINGMPRGTKRKFTSNQEPSGHMAPQASNQRA
                     ALLRPIPTPETQELYNKMRREEEKLTEESLEQVQEGPPSHLQLPLSSQVTVSSPSLSH
                     ASTTHSISQAMNDMGVAGDPPGPRGQRPGRHGPLSEKKKARTHLMRKLGACNECRERR
                     CDHFDFSLFEAAYQAEKRAAAQVPDSGHPTSTATATLYQPRLGEPSDLLGVGVGQNST
                     NQPSQLVWAGRDDVHADSDPLLEQTHQQNPPVPQHLASVLGRVEYLQVPFALSDTTPQ
                     HHPPALPQSMPVVQHRAGTTMVRSASAAPHYQGAGTVTRSVPAALYQAAAPMARSTSA
                     SPYYPGAATVPRGTPAGRHQDVAALTRSTAEDMAPIGREVSPNGQEWDCLWGTDNCGS
                     SLSHGGLSPCHERCSTLEELKMHYASAHAPIYEDWPMWHCTNCGFNDWIRPTLPCFEC
                     PNPGSSSWQKWQWARVSIPSRAISDPLGGLASLDGAPSNSSSWTDYSAPFSGSPGGQN
                     SPYARSCGGYGYGSGSSGQAFRSAQAVIEKARTCRGFGSPVVRCASRPFHSGMCHPPL
                     FPGLAWAWGAAGTAVRRHACSAAVLFAVVIFALVDGWLSASGVDGGLWRTACDGLSHH
                     GRAGPTRVLNLSIACIVAGLIATWAFRHEMLALAQHRDAAAQVSPPFCLLNNRRTLAA
                     F"
     gene            complement(567918..571124)
                     /locus_tag="THITE_2111350"
                     /db_xref="GeneID:11517258"
     mRNA            complement(567918..571124)
                     /locus_tag="THITE_2111350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651238.1"
                     /db_xref="GeneID:11517258"
     CDS             complement(567989..570922)
                     /locus_tag="THITE_2111350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651286.1"
                     /db_xref="GeneID:11517258"
                     /db_xref="JGIDB:Thite2_2111350"
                     /translation="MLSTVSSRPVPAGATSASSGRCSAPVLEFVCLFTHDLRRKQKRW
                     EDGRLKYHTFNKRVMVYDERGNFVGDMHWQRESEFGEGEEFQLERGGAIVQAIECVGR
                     QNQDLSELLDKRAKEKEQRQARVALRPAPLGASANTPVAGIRVNDHFQTRHRPLNQVL
                     GTPTGPLGRAVVPTESPFELRQRANEMPVNHDDARPAKRRKCDLTPPSKMGYARSLFG
                     ATLSLSAVPLSSIPRPQPEASGPRGTGTLDIEPVPKDRTLDRGDPPATVSRANVVSRP
                     SGVPLEHGPDDRVGEREPPETAPRSMAHTRLGKARSTSRIGVQDLPNTSGRCSSFSSE
                     NRTRIDTFRPPLASRSLKEPDGPQNAESTKHPQVGPEEVAPVTDCPGLGASRSQAIVL
                     DEDTGQRPDGETHVSRTLAPERNTAGSKRVASSPARQRPAKQKSPQAEADRPPAIAPE
                     SDETLKEAQLPNEERTVLRLKPRQKRGLLLLSEKRKKNQQLKGRSSPSREQIHATDRP
                     ATPVHDKAAELHTQVGHKTANHTSIVSRGDSTAPSFADLGEAPAPGDSVPDAEDEPRD
                     QSIPPQREKRKQKAKRSAKLQERARETASPDMQGDSSDDGHTVNTRKSARQGQKTRRP
                     SDQVSSHPKTVQAADSEESENEELPQAEVGPHLVRLGRKSVRSREVFGFVPSSPPIVS
                     IAGPFEPTPGIRDPHLAVEETTAATCLPDPRANEAPIPHQRQPLEESPRNCLSPSTPP
                     RETAPVVQRRNSLPDDETGERINSEATDGAETRRTQQPGDVSMRRSLARRETSAITLG
                     TAMAKGTNDQISPPTRQSIATIGKERPPPTTGRCVNNKSLPAPTAEAERSQLHNAGQP
                     PHPISNTTGIRVEDGVTKRPSSPIPEAPPVERTRPKIANPATRGRKAALKSDAAGQVP
                     RSILPMEPVHAHAIAEPSAAPRPEPAADERPKRKMTFPGFVSAKAGGPWSREAHDLLE
                     SGRPG"
     gene            <580306..>581904
                     /locus_tag="THITE_2142725"
                     /db_xref="GeneID:11517259"
     mRNA            <580306..>581904
                     /locus_tag="THITE_2142725"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003651239.1"
                     /db_xref="GeneID:11517259"
     CDS             580306..581904
                     /locus_tag="THITE_2142725"
                     /note="CAZy_ID 269657"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003651287.1"
                     /db_xref="GeneID:11517259"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Thite2_2142725"
                     /translation="MTTATTTPPCSSSSSSSSASSVASSPSATFTNPVIYADFADNDV
                     FLGPDNVFYYLASNMHYSPGGPILKSYDLVNWELIGHAIPSIGDFGPAYSMTNNTTAY
                     REGTWASTLRYRKSNDQWYWIGCVDFWITYIYTAPSPTGPWVKSASMPGTCYYDCGLL
                     IDDDDTMYVVYGNTNVSVAQLSTDGLSQVKTAPVFNAADTNRSVIEGNRMYKINGTYY
                     VLDDDTQGTTIIWKSSSPFGPYTPKILVNNINSPVPNGAPIDQGSLVQTQDGNWYFMS
                     FVWAYPAGRMPILAPIVWGADGFPSLVTDSAGGWGASYPYPLTPHPLASWTGRDTFQG
                     TTLSPNWEWNHAPDTTKYTVNNGLRLSTATVTTDLFHARNTLTLRPFGPSPVGTVALD
                     ISSMADGDIAGLAALRDGTSWIGVQRSGPGASYTLQMRLNATQDASANWATASTGTVA
                     ATAAVPEGTSKLWLRVAMDARATGSKQAVFYYSFDGVVFTQLGPSYTMTSGWEFFLGY
                     RYGVLNFATKALGGSVVVEEFVSA"
     gene            <582174..>582464
                     /locus_tag="THITE_2046138"
                     /db_xref="GeneID:11517260"
     mRNA            <582174..>582464
                     /locus_tag="THITE_2046138"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651240.1"
                     /db_xref="GeneID:11517260"
     CDS             582174..582464
                     /locus_tag="THITE_2046138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651288.1"
                     /db_xref="GeneID:11517260"
                     /db_xref="JGIDB:Thite2_2046138"
                     /translation="MKWLIWFIIISVNIMLGVSAAIMWIRCCPVARLWIFDMEGTCWP
                     SYVVKDYQTFATVYSGALDIVLSLLPRRIVWNDAIYKKEKIGALIAMSFGVL"
     gene            complement(584439..584742)
                     /locus_tag="THITE_2111352"
                     /db_xref="GeneID:11517261"
     mRNA            complement(584439..584742)
                     /locus_tag="THITE_2111352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651241.1"
                     /db_xref="GeneID:11517261"
     CDS             complement(584453..584698)
                     /locus_tag="THITE_2111352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651289.1"
                     /db_xref="GeneID:11517261"
                     /db_xref="JGIDB:Thite2_2111352"
                     /translation="MRRRIRRRLWLNVPSPWHPLLLSISDLERLAPKTTVVPSEQESH
                     GNPQTGKMAARCGISRHKSEETPQFMMPSSKKHHGLW"
     gene            584743..586121
                     /locus_tag="THITE_2111353"
                     /db_xref="GeneID:11517262"
     mRNA            584743..586121
                     /locus_tag="THITE_2111353"
                     /product="carbohydrate esterase family 2 protein"
                     /transcript_id="XM_003651242.1"
                     /db_xref="GeneID:11517262"
     CDS             584834..586075
                     /locus_tag="THITE_2111353"
                     /note="CAZy_ID 269869"
                     /codon_start=1
                     /product="carbohydrate esterase family 2 protein"
                     /protein_id="XP_003651290.1"
                     /db_xref="GeneID:11517262"
                     /db_xref="InterPro:IPR000254"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="JGIDB:Thite2_2111353"
                     /translation="MKPSVVAGLFASGAAAQSGAWGQCGGIGYTGPTSCVSGYRCVYV
                     NDWYSQCQPGAATTTTSPPASSTSTPPTSTGTAGVRYVGRVNPSTKELSWPGTGISFT
                     FTGTSATIGIASVSGTNSVDLVVDDGDPIVITSFGSSITTPAGLSQGTHTVTLRKRSE
                     ALYGSIFLGSVTTDGAFVAGTVPTRQIEIIGDSITVGYGLDGTNPCTNNATVEDNPKT
                     YGALAAAALGADYNVIAWSGKGVVRNVATGSPDTSPLMPELYTRYGANDPDNSYPYPP
                     TWSPDAVVINLGTNDFSYIAWDASGNAYAARPPLNATTYTDGMVAFAQSIRAHYPAAH
                     VFLVGSPMLSDSYPTAADAQKTTQTNALKSAVAQLGANAHFVDWPTQGSDVGCDYHPN
                     AATHAAEAAVLADAIRSALGW"
     gene            <587219..>588866
                     /locus_tag="THITE_2044608"
                     /db_xref="GeneID:11518050"
     mRNA            join(<587219..587332,587394..587822,587893..588713,
                     588803..>588866)
                     /locus_tag="THITE_2044608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651243.1"
                     /db_xref="GeneID:11518050"
     CDS             join(587219..587332,587394..587822,587893..588713,
                     588803..588866)
                     /locus_tag="THITE_2044608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651291.1"
                     /db_xref="GeneID:11518050"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="JGIDB:Thite2_2044608"
                     /translation="MQSMQRQFGKLWNKGPGDNAKVSALLNDYEDVDRLLAKIIDNAK
                     SWRDSWTALVTTQLQVVTEYEALYDPIVGASDGRAQTAPTPQLQLERTFRLKTAYAEL
                     KAELMEEIALIDGHVMQPASSAREAIAPIRKTIKKRENKRLDYEKAQDKALKLQRKPA
                     RTAKEDAALAKAEVEVSHAANEFSIADEHLRETLPPIITAAFSLVNPLLANLVMIQTR
                     LLGLYYTTLHGYCQEFGFPSPPPPMEDVVATWNAALGPVRSQVESISFIARGKASQQH
                     PSLGRDGAPTKPGPTPINGARRTSSGLIPSSHARTLRAPPATSLQPPSAAPATGSARS
                     TSPYKRPDLSNATDFTTATILGGGTVNRSRGASPGAGAAASGPKTPSPFSRATTASST
                     TTNGLAKKKPPPPPPPPKRAATAKPDEWVVAEYAFAGQGQGDLSFRQGDRIRVIKRTD
                     TDQDWWVGELGGVTGSFPANYCKPL"
     gene            complement(589403..591476)
                     /locus_tag="THITE_2111355"
                     /db_xref="GeneID:11518051"
     mRNA            complement(join(589403..590294,590401..590584,
                     590962..591476))
                     /locus_tag="THITE_2111355"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651244.1"
                     /db_xref="GeneID:11518051"
     CDS             complement(join(589466..590294,590401..590584,
                     590962..591226))
                     /locus_tag="THITE_2111355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651292.1"
                     /db_xref="GeneID:11518051"
                     /db_xref="JGIDB:Thite2_2111355"
                     /translation="MYEMESSKRRWRSLLPATRPPMLRRTDSSSSDASHDSRRSLGSH
                     ESEDQFAFSPVHTPAKENPPPSRAAVPRYVTDPSAGRHGLLLGKAVHTHPPNSENNST
                     ATNDELLSPNSKSRPIAIDLPGPGSAYPTAPTSSNPTEPLSARGDIAGGYFPLHEDPE
                     SRVRVPHPFHHDADKARQSSLQQAAESSKCGTDSRPMRSSDASRPPFVPLIRSTSPSA
                     SPHTPVSSYMPSGAHQDVVLPLGKYYPTNWEKRHGKDPRHRPSTLVAHPTAPVRSEPQ
                     VPKYHDDLGSARPGSDVKRRLQQYQRDMVAQAAMAASAVLANSASTTSSAGSPSPGGL
                     TLPAANLAAAFLKTHKPLSPRLRPVGSPGGPVTPMSLEGECYLTLRLPAAGSDAASST
                     AEAGDAMAAPSKETYHRRRDSRSSPVELGTVSV"
     gene            complement(593415..594501)
                     /locus_tag="THITE_2111359"
                     /db_xref="GeneID:11518052"
     mRNA            complement(join(593415..593914,593987..594130,
                     594187..594501))
                     /locus_tag="THITE_2111359"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651245.1"
                     /db_xref="GeneID:11518052"
     CDS             complement(join(593741..593914,593987..594130,
                     594187..594318))
                     /locus_tag="THITE_2111359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651293.1"
                     /db_xref="GeneID:11518052"
                     /db_xref="JGIDB:Thite2_2111359"
                     /translation="MVLSYLLFSILHFFQFVLAITVCGLYGADIDRTRKAGGQADGKW
                     VYAVVVGGISAVTTLLYWIPFILRFALIWAWNLILFILWIALFGLFGGMYIHEDPNGN
                     GDIQRMKNAVWVVLASAILWLIGVIAHFIYWWGHRERHTRFTSRAKV"
     gene            596070..597019
                     /locus_tag="THITE_2111361"
                     /db_xref="GeneID:11518053"
     mRNA            join(596070..596443,596509..597019)
                     /locus_tag="THITE_2111361"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651246.1"
                     /db_xref="GeneID:11518053"
     CDS             join(596267..596443,596509..596940)
                     /locus_tag="THITE_2111361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651294.1"
                     /db_xref="GeneID:11518053"
                     /db_xref="JGIDB:Thite2_2111361"
                     /translation="MPKSHERPVRWLHLVSGADVASMSVRFRLGLSISGWGNAQTPPK
                     VRWGWESTAREKASSSFVWRGLRRNAGHETPVFGRDVEALLFTHFRWTGQGPTPSPFA
                     RSGSTRRTSHAPLRCPFLNHVAVLGARTTIHHHQRHSTLGSFIPGANVSWPLIEGGLP
                     LSPRNGPTRSPRRRWRSLELPPIAWDCDDFTSLLGLRSKHDR"
     gene            <597314..>598337
                     /locus_tag="THITE_2127216"
                     /db_xref="GeneID:11518054"
     mRNA            join(<597314..597340,597450..597578,597848..597913,
                     598115..598141,598263..>598337)
                     /locus_tag="THITE_2127216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651247.1"
                     /db_xref="GeneID:11518054"
     CDS             join(597314..597340,597450..597578,597848..597913,
                     598115..598141,598263..598337)
                     /locus_tag="THITE_2127216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651295.1"
                     /db_xref="GeneID:11518054"
                     /db_xref="JGIDB:Thite2_2127216"
                     /translation="MPRHNGTRAAYELLEQWICCDCKEIYNTATVLRCLNCHHIFDRS
                     HCEVEEHWFSLGFGRYQFLLDECTGMVWQEPLSDAVCPSDSAFDSGGAHSQTGNSRVL
                     MLGLV"
     gene            599253..>601245
                     /locus_tag="THITE_2075269"
                     /db_xref="GeneID:11518055"
     mRNA            join(599253..599941,600377..600524,600708..600891,
                     601047..>601245)
                     /locus_tag="THITE_2075269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651248.1"
                     /db_xref="GeneID:11518055"
     CDS             join(599471..599941,600377..600524,600708..600891,
                     601047..601245)
                     /locus_tag="THITE_2075269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651296.1"
                     /db_xref="GeneID:11518055"
                     /db_xref="JGIDB:Thite2_2075269"
                     /translation="MATTFDSDRAAACTTTDTATTTTTSTSSSTTGSTTLPSPPFIDA
                     PGLANLRDAGGYALSSQPGKAIRRGVLYRSADLTRLDSGGRAALRRLGITRVFDLRSA
                     AELEKHDAVQQQQQNPPGGWAWEGATRVFVPVFLDKDYSPEALAWRFRNYSDGPQGFV
                     KAYSAILAAAAEPDHPYAPFRTVLEHFASPSSPPEPVLVHCTAGKDRTGVLVALILSL
                     CGLDDAAVAHEYSLTDLGLASRREEIVRHLMQGETLFGDRERAERMVGARKENMLETL
                     ALIRERYGSVEGYVIDHLGLSPASVEQIRKNLVVDIAEGEEPLDWRSLAGLNGEPHR"
     gene            complement(601322..602791)
                     /locus_tag="THITE_2111366"
                     /db_xref="GeneID:11518056"
     mRNA            complement(join(601322..601941,602152..602791))
                     /locus_tag="THITE_2111366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651249.1"
                     /db_xref="GeneID:11518056"
     CDS             complement(join(601405..601941,602152..602682))
                     /locus_tag="THITE_2111366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651297.1"
                     /db_xref="GeneID:11518056"
                     /db_xref="JGIDB:Thite2_2111366"
                     /translation="MPPRLRGSSCQPQLLLTYLEPAPSSSLAPRRAALAGSQPSPLAL
                     GSSAPTTPSAAPPCSRPFSTTPAPQETRLRRRFKEWCSKQGELLRAPPTRECPAYVTR
                     AVRPKDPDSATMVFPLNPTFRSEPVLSAEAREMIWHQVMVKGMPLKAVSAQYSVDVRR
                     VAAVVRMKEIEKRWKRENKPLATPYARAVLSMLPKHHLRQGDPPFEPINDIHIHSFTM
                     QQLFLPTSESREFTREDAAKAFGDHILPPDQKIRIPELVQMERNIANNMPFEQAREEF
                     IKAAAQSEKEAAEKQRARQQAAESRLVRVDSGRFEFRFEKINAEDVGPTGRARRAVGW
                     RYGVPFMDRKRGQVKIPTSVG"
     gene            complement(603493..606154)
                     /locus_tag="THITE_2111368"
                     /db_xref="GeneID:11518057"
     mRNA            complement(join(603493..603775,603865..606154))
                     /locus_tag="THITE_2111368"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651250.1"
                     /db_xref="GeneID:11518057"
     CDS             complement(join(603581..603775,603865..606066))
                     /locus_tag="THITE_2111368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651298.1"
                     /db_xref="GeneID:11518057"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="JGIDB:Thite2_2111368"
                     /translation="MGDLKSKLRAKISRRHSGIPPLPSAAKQVNDSSNNFGESDSAKA
                     AETAADAPERRQARRLSGAQWTEKLRLGAKHLSAVVTADVNDANDGNNGPAAAAAAAA
                     AAAAGENDPGAENATNVSCSVPPAPPRPGSDGPGQHLDGNDRPFPDPSTGLASNTDSS
                     TAAAAAAAGRQSRTSPEPPLTGPTPAPEDEAKTGGSTGTVRRTRLSNRDRPVSSDSSA
                     PSNSVDPTSNPQLRSSTSLSRPAPPPRRQSLLPSRQTTLIRTLLSSGHADNPDQPSSE
                     QLLPISANMVTRKLWVKRPGGSPTLVTINEEDLVDDVRELILRKYANSLGRQFDAPDL
                     TLRLVPREGQRQERVLGPEEPMARTLDAYFPGGQTVDEALLIDVPHRRTPRASPRHGP
                     PHAQHLTSVSYDDIRPVDAGSTDYFGPGAIAHIPVTIAGPANGTTHSISVLNTGQVPQ
                     IPSPGGTSRSRQYRERSERPRLGRQHTSSPTILNVVGGGGHTATIAVAASHGMHQAHS
                     MPRSRTHSNASSEQANPGQSAPAAPSLPTPPTQEPAVVPIARTATPPPRAASPRPPPT
                     ARVKKKKTIDAPALPAGMLNGGVPPINVLIVEDNIINLRLLEAFVKRLKVRWQTAMNG
                     REAVTKWRTGGFHLVLMDIQLPVMSGLEATREIRRLERTNSIGVFSTSSHSTGQTLVE
                     PQETKGETAEEDKLQNRELFKSPVIIVALTASSLQSDRHEALAAGCNDFLTKPVTYVW
                     LERKVMEWGCMQALIDYDGWRKWKSYSQKLEGEDGAGKKAKTKKNRSVGPNSSSSEGQ
                     "
     gene            607384..609886
                     /locus_tag="THITE_2111371"
                     /db_xref="GeneID:11518058"
     mRNA            join(607384..608629,608718..609886)
                     /locus_tag="THITE_2111371"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651251.1"
                     /db_xref="GeneID:11518058"
     CDS             join(607595..608629,608718..609785)
                     /locus_tag="THITE_2111371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651299.1"
                     /db_xref="GeneID:11518058"
                     /db_xref="JGIDB:Thite2_2111371"
                     /translation="MRTRPSLASSRQGRDPSQEGSRRHNHSSLFSHINQTFVSKPSDL
                     PVSARDSAFGSSTSSFVFTAGGSGGTPVSKSPFAQRSDPPSTVPTFSFTVPQSPSTPE
                     YRGSSDSDSRSDSMDSLSHSMANLEIPRGMPKKLAKEDEAMSLSAASASDMSKPPSPS
                     ADDALAGDAAEESMSAESELSSDEISTLNIHLGLLKRRPELEELNEIKTTPIFTESVR
                     KYARSLSGANAEQPFSQYGLLAGDITGSANEGSADPRLFWNIAAPSSFFICGSQGSGK
                     SHTLSCLLENALAPCKANVLPRPLTGILFHYDTFISDSGGSPCEAAWLSTNPDIKVRV
                     LCPPTNIRTMQRLYGKFPNIKVEELRLNETDLNTKRMLDLMAVTTGGNLPLYLHVAQR
                     ILRDLRVTQQRTNTGFSYTAFKRSLAGEDLSEMQLAPLKQRLETLESFMVEDQAKAYN
                     MFTNVSSQAPKSHPAKGGGTSWAPQNGHLTIVDLSCPCVTPEMACSLFNICLSLFLEQ
                     DPAAVGRVVALDEAHKYMTDSQECAALTEALLATIRLQRHLGARVIISTQEPTISPKL
                     LDLCSVTVVHRFTSPDWLNALRKHLAGVSAGGRLLERARKLNGEVDRDGEEGAEGAAA
                     LALGDADPALELFSRIVDLRVGEALLFAPSAIVGVKKRKDGQTGRCGDVKRLAHGVLK
                     VRIRNRTTADGGRSIMAA"
     gene            610241..611679
                     /locus_tag="THITE_2111373"
                     /db_xref="GeneID:11518059"
     mRNA            join(610241..610323,610378..610619,610869..611679)
                     /locus_tag="THITE_2111373"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651252.1"
                     /db_xref="GeneID:11518059"
     CDS             join(610448..610619,610869..611554)
                     /locus_tag="THITE_2111373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651300.1"
                     /db_xref="GeneID:11518059"
                     /db_xref="JGIDB:Thite2_2111373"
                     /translation="MVPHFEFPPASPDSFSRPRPRPPRSPGHSAQIRAQNRRRAYLDS
                     HPDYFQSADHELADPLLYDFLIRRFQTPAEREADGRAKGYARVLEGSLLRGEERLAKL
                     RAAQPVGSRQQRRRRQRRNGNGAEDADDADDVDDADDVDAVDAEEDAGSPGGSGGGGV
                     DGGGMPRARATADDEAEAGTTFSSLNAELTPPPKTREEGRAQWVEFLRDRFIRGEDED
                     FDYAAVDGDEGYDVLEREDREEAWFEEEEPEWASDGDGSSDEGEGEGGRHGGKAERVL
                     KGETGIQDF"
     gene            complement(611654..613215)
                     /locus_tag="THITE_2111374"
                     /db_xref="GeneID:11518060"
     mRNA            complement(join(611654..612268,612320..612523,
                     612589..613215))
                     /locus_tag="THITE_2111374"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651253.1"
                     /db_xref="GeneID:11518060"
     CDS             complement(join(611754..612268,612320..612523,
                     612589..612787))
                     /locus_tag="THITE_2111374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651301.1"
                     /db_xref="GeneID:11518060"
                     /db_xref="JGIDB:Thite2_2111374"
                     /translation="MATAAGSRQLPEPQEKDDCDDCLTDDAQLDIETSHAASQEYPQP
                     IKEYGDQWDWDSACQDYVRFRDDGVKLFYTSYQRAAILPSSSEKPETAKDSTRHAAPS
                     ASSPEPTTAPAIARPVQPPVPKVAPHEEPLGEAFQVVAKPKRFFCFGRIFKTVWFEPA
                     GSELPKKRPEIETWCEKCPPFRGEKPVAQFRWFIVVRRRLHHSLCFSITTYGGKAAAK
                     TSRGRPMDYVVLYRANVEPPRPYADERIERDPIAIIIEDGDQYISPLARLDCGRIYTV
                     QHDLKVMKIGRVHPAALPLLDQYYKESVA"
     gene            complement(<614529..>616034)
                     /locus_tag="THITE_2142736"
                     /db_xref="GeneID:11518061"
     mRNA            complement(join(<614529..614978,615042..615432,
                     615503..615868,616015..>616034))
                     /locus_tag="THITE_2142736"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651254.1"
                     /db_xref="GeneID:11518061"
     CDS             complement(join(614529..614978,615042..615432,
                     615503..615868,616015..616034))
                     /locus_tag="THITE_2142736"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651302.1"
                     /db_xref="GeneID:11518061"
                     /db_xref="JGIDB:Thite2_2142736"
                     /translation="MAQITQPTVDVVTATGALEQPTYNGKPNYNGTGQLLRGSCRQTD
                     FTRVDAGSTVYYAGFMGCIKDRPECCPWPVATAMTSSPSATADGAPSNGQGGGEYDFP
                     QPVNSVQSRLSTCAEDYYSISGGCCPVGFWLFTTAVGGLTPCWSSVSHIDPPTLTVSS
                     DDKPKGKPTSAVVNIVWSMRFEVGSSGDGLSTAAKAGIGVGAGIAAILIAGLAICLWR
                     QRRKNKNLPRAQPPMAAPPAQTQPPPQPAFQQPQMVQQPQMQPGAPNTLYPPGAYAMG
                     TSPAANMMAPPPSDPASTGASMTGSSPDPASVVTQHTGTSNGGISELSAQSGQTPLLQ
                     QQNGRPGSYFRSSSAAAAGAAAAAANGQQQQQQQQQQQQYQQQYQQQQQQGYPGNVAE
                     MSAQREADPVQEVAGS"
     gene            617822..619321
                     /locus_tag="THITE_2111382"
                     /db_xref="GeneID:11518062"
     mRNA            617822..619321
                     /locus_tag="THITE_2111382"
                     /product="glycoside hydrolase family 43 protein"
                     /transcript_id="XM_003651255.1"
                     /db_xref="GeneID:11518062"
     CDS             618201..619184
                     /locus_tag="THITE_2111382"
                     /note="CAZy_ID 269678"
                     /codon_start=1
                     /product="glycoside hydrolase family 43 protein"
                     /protein_id="XP_003651303.1"
                     /db_xref="GeneID:11518062"
                     /db_xref="InterPro:IPR006710"
                     /db_xref="JGIDB:Thite2_2111382"
                     /translation="MAPLITHIYTADPSAHVFEGKIYVYPSHDRETDIQFNDNGDQYD
                     MVDYHVFSTESLDPAAPVVDHGVVLKAEDVPWVSKQLWAPDAAYKDGKYYLYFPARDK
                     QGIFRIGVAVGDRPEGPFVPDPEPIKGSYSIDPATFVDDDGQAYMYFGGLWGGQLQCY
                     QKGNDVFDPSWQGPKEPSGAGARALGPRVAKLADDMRQFAGEVREVVILAPETGEPLA
                     ADDHDRRFFEAAWMHKYGGKYYFSYSTGDTHYLCYAVGTSPYGPFTYRGRMLEPVLGW
                     TTHHSVVEFQGRWWLFHHDCELSNGVDHLRSVKVKEIFYDAEGNIVGEKPE"
     gene            619493..620554
                     /locus_tag="THITE_2111384"
                     /db_xref="GeneID:11518063"
     mRNA            join(619493..619966,620039..620554)
                     /locus_tag="THITE_2111384"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651256.1"
                     /db_xref="GeneID:11518063"
     CDS             join(619677..619966,620039..620285)
                     /locus_tag="THITE_2111384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651304.1"
                     /db_xref="GeneID:11518063"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="JGIDB:Thite2_2111384"
                     /translation="MAEPALFSAEYLSPEVQAALPEGYKLRALRRTDYDSGFLDCLRV
                     LTTVGDISKEQWEERYDWIARQDGSYFILVVEDTNTSPPRIVGTGALLAERKFIHNLG
                     SVGHIEDIAVAKDQQGKKLGLRIIQALDYIAKRVGCYKTILDCSEHNEGFYVKCGFRR
                     AGLEMAHYHEGPKSNNAQ"
     gene            <621728..>623440
                     /locus_tag="THITE_2142739"
                     /db_xref="GeneID:11518064"
     mRNA            join(<621728..621841,621986..622060,622157..622629,
                     622708..623001,623069..623201,623273..>623440)
                     /locus_tag="THITE_2142739"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651257.1"
                     /db_xref="GeneID:11518064"
     CDS             join(621728..621841,621986..622060,622157..622629,
                     622708..623001,623069..623201,623273..623440)
                     /locus_tag="THITE_2142739"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651305.1"
                     /db_xref="GeneID:11518064"
                     /db_xref="InterPro:IPR010520"
                     /db_xref="JGIDB:Thite2_2142739"
                     /translation="MFEAESPRHWIMGKAAFEGRMPHHDGIEALWEEKWQPMCAKSAY
                     PFHDGAYEDFEPIFQHLIENNINDATSPDYTSAFISAARKIAEQGDRALEKNNQHDQA
                     LSLYLRACAVYRIARFPYITSFPQVNDKRKWTAWEEQKRVYRKAGELWENPLEEASVP
                     HTHAEGRDLDVIPVYVRMPNPLAARGVARRNGAPVVVLMTGLDGYRPDNTARCEECLR
                     RGWATVVVEIPGTADCPADSADPESPDRLWSSLFEWMEDDGRFDMRRIIVWGLSCGGY
                     YAVRIAHTHPHRLAGCVAQGAGCHYFFGKDWLEKVDGHEYPFQLTPAMAMKYGFDSVE
                     EYKENAQHKFSLLYSGILDKPATRLLLVNGTRDGLMPIEDSLMLFEHGTPKEGRFFGG
                     NLHMGYPQANSCVYPWMEEIMASVRE"
     gene            complement(623356..625068)
                     /locus_tag="THITE_2111388"
                     /db_xref="GeneID:11518065"
     mRNA            complement(join(623356..623733,623819..624154,
                     624344..624556,624717..625068))
                     /locus_tag="THITE_2111388"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651258.1"
                     /db_xref="GeneID:11518065"
     CDS             complement(join(623623..623733,623819..624154,
                     624344..624556,624717..624827))
                     /locus_tag="THITE_2111388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651306.1"
                     /db_xref="GeneID:11518065"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2111388"
                     /translation="MFSLEGHTALVTGGTRGIGKAVAIALAEAGADLLLVQRDATSTE
                     TLNAVRALGRKATIYTADLSSAEDVAGLVPRILADGHEIRILVNCAGIQRRHPCEKFP
                     DSDFNEVIQVNLTSVFTLCRDVGAHMLTLEPSPVTGRRGSVINFASLLTFQGGLTVPA
                     YAASKGAVGQLTKSFANEWTARGVTVNAIAPGYIETEMNTALLNDPDRLASISARIPA
                     GRWGTPEDFKGTVVYLASRASAYVSGHVLVVDGGWMGR"
     gene            626242..627810
                     /locus_tag="THITE_2111393"
                     /db_xref="GeneID:11518066"
     mRNA            join(626242..626433,626508..626878,626942..627350,
                     627420..627810)
                     /locus_tag="THITE_2111393"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651259.1"
                     /db_xref="GeneID:11518066"
     CDS             join(626377..626433,626508..626878,626942..627350,
                     627420..627716)
                     /locus_tag="THITE_2111393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651307.1"
                     /db_xref="GeneID:11518066"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2111393"
                     /translation="MAAARVNASVLHGARDLRLEQRELPAPGADDVQVAVKATGLCGS
                     DLHYFNHFRNGDILVREPLTLGHESAGVVTAVGSGVTSLRVGDHVALEVGQPCEQCEL
                     CREGRYNICREMKFRSSAKAYPHAQGTLQERITHPARWCHKLPSEVSLELGALVEPLS
                     VALHASDRARLAPGSTVLVFGAGTVGLLCAAISRVVSDAKVVIADIQADRVKFAVDNG
                     FADAAVVVPMKRPDTVEAKLEFAREVAAAVKSTSLNGRLLGEVSATYECTGVETCLQA
                     SIYATAPGGRIMLIGMGNPIQTLPISAAALREVDLVGVFRYANTYPRVIELLASGNPR
                     LPDFTKLITQRYAGMENIPKAFDMAARVKDDEGNLVLKVMVDM"
     gene            complement(627778..629402)
                     /locus_tag="THITE_2111398"
                     /db_xref="GeneID:11518067"
     mRNA            complement(join(627778..628100,628202..628448,
                     628515..628648,628713..628740,628819..629087,
                     629197..629402))
                     /locus_tag="THITE_2111398"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651260.1"
                     /db_xref="GeneID:11518067"
     CDS             complement(join(627904..628100,628202..628448,
                     628515..628648,628713..628740,628819..629087,
                     629197..629254))
                     /locus_tag="THITE_2111398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651308.1"
                     /db_xref="GeneID:11518067"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="JGIDB:Thite2_2111398"
                     /translation="MATKTFKLNTGQDIPAIGLGTWQSEPGKVRTAVAEALKAGYRLI
                     DCAYCYGNEEEVGQGLADAFAEGVVKREDVFVVSKVWATYTTRCELGLQKSLKSLGLD
                     YVDLFLVHWPLLMNPEGNDDRFPKLPNGERDIIRSHNHVDTWKQMEKLLATGKTKAIG
                     VSNYSKRYLEQLLPHATVVPAVNQIENHPALPQQEIVDLCKEKGIHIMAYSPLGSTGG
                     PLFTAEPVVKVAEKHGVKPSAVLLSYHLPRGSTVLAKSVTPERIRENLNLIELDAEDM
                     KLLNDYSDKLTKEGKLQRFVYPPFGVDFGFPDKS"
     gene            complement(630134..631976)
                     /locus_tag="THITE_2153785"
                     /db_xref="GeneID:11518068"
     mRNA            complement(join(630134..630501,630564..630669,
                     630722..630787,630852..631147,631210..631377,
                     631433..631482,631538..631976))
                     /locus_tag="THITE_2153785"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651261.1"
                     /db_xref="GeneID:11518068"
     CDS             complement(join(630463..630501,630564..630669,
                     630722..630787,630852..631147,631210..631377,
                     631433..631482,631538..631763))
                     /locus_tag="THITE_2153785"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651309.1"
                     /db_xref="GeneID:11518068"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="JGIDB:Thite2_2153785"
                     /translation="MAVAINDRTAEFRHVVLAAQRKQAAKPGSQRFLSDAQKHAAGGG
                     AQPRRSEFARHAAEIGRGISATMGKLQKLAQLAKKRSLFDDNPVEVNELTFIIKQDLS
                     RLNEDIRNLQALSKRLHPKPDQEGENNKNILLLLQGKLGDVSASFKDVLEIRTKNIQA
                     SRSRTEAFVSTVGQHAHAALPPSASPLYGTPHRGTPSPGADLISLNPMGGDQQLQLQM
                     MEEGQNSYIQQRGQAIEAIESTINELGSIFGQLAAMVSEQSEMIQRIDANTEEVVDNV
                     EGAQKELLKYWSRVSSNRWLIAKMFGVLMVFFLLWVLIAG"
     gene            633223..637288
                     /locus_tag="THITE_2111404"
                     /db_xref="GeneID:11518069"
     mRNA            join(633223..633636,633709..637288)
                     /locus_tag="THITE_2111404"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651262.1"
                     /db_xref="GeneID:11518069"
     CDS             635501..637000
                     /locus_tag="THITE_2111404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651310.1"
                     /db_xref="GeneID:11518069"
                     /db_xref="JGIDB:Thite2_2111404"
                     /translation="MGSLQAPPDAPDHVGSLSAAHSAAATESEVATPTSAATERAEIT
                     PTAPLNPRRGTLEAAHSIQPVLPSPPIGSESVLDVTSGSPVKDSDMLSEEIIKSLTPA
                     QPTGSEGSTAAYHTAAPDLARESTYLGDVYGDYWAATEDKAEPGSLTVGKTSEREHGR
                     PDPPGPAESRIEETARTATALGSGSPSSPPNAGPAQVSETQAEPAPEAEGLRRRFSWE
                     AALEGPVPAGLSPPGTGLLVEQKVLGSGLSNVAPSAANLSAPKTESVERPSVSESDKS
                     ADDLRAETAPELLAPTPPTDGRRESPLPVSALTDGASANKRMSLAEEKIALQESANSL
                     PPSPPLEQHPVFAAPEQPRQAELQAAPSPKNVMGLRNIMELPSPSERIKQYNESRWQV
                     SATDTGLDNWLKEMMARYPEHANAMLSSSATVRVAQQSGQGASQMPGHGARAPAHLHM
                     AHLQQGLAGIGHSGNQMGTKSKELLMAAGKAGKGLLSKGRNKLRGTGRE"
     gene            <638219..>643819
                     /locus_tag="THITE_133510"
                     /db_xref="GeneID:11518070"
     mRNA            <638219..>643819
                     /locus_tag="THITE_133510"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651263.1"
                     /db_xref="GeneID:11518070"
     CDS             638219..643819
                     /locus_tag="THITE_133510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651311.1"
                     /db_xref="GeneID:11518070"
                     /db_xref="JGIDB:Thite2_133510"
                     /translation="MATYAQGQNYKPLPPQGNNFQQGYPQGYHLQVPQYHQQQQQQYQ
                     QQQQQQQQQQQQQQLSTDGAQRRGSFVGLPPIRRASTFGSSLGLTAEEFLPTENDADG
                     TSRRQRTQQPQQSQQPQQPQQASPPPQGTQSQPTMATQQGGPFMPASQPSGQFVQNVY
                     RPTQGAQNAQGPTHQGQTWQLQGQYPGQPQGFPGGAPGVGFQGTPQGPPRAFAGHPGP
                     VPQVMNASAPQMGQGQPFVPGGGGRPMMIPPYMLPGGLLQRFHPQGGGWNLQESHLSE
                     PLQPTGRHRHSPSNASSQQQQQQQQQQQPFYGFDKETGVSSAGGSPVQRQKSPPVQQA
                     QQGQQTQQLQQPAPQQASGLPSQTGNTVPPQPRQGIPANQQAAQRPDGAAQPRFESDQ
                     NDLARPGGMPAADGAQPKRNSAVFSSLRGRFTGAHSEDRRDPEGGPKLQVTNGDAASV
                     ASTTTQETGPPARPNAGFGPRAGEPTPDNLSYSQSKESIVAHGPSTPLGERMSPQPSQ
                     FALPNGKLNRFFGIGAHANPAQSGGGQIRPDLPRTSTSTNTTEHKHAGSLGGLPKRFS
                     ALKDVFHRSSPHEGSKSSAPSFTVRMPSQSPAQMQTQGQYQGQPLGAPQGPTPQTGPS
                     PQPGPSPQTGPSPQSSPPPSTRPTEPDLQANPSSTPPIAPGPQQSSPAAQAVAGPERA
                     APVTGLRQPGYGLPPMPSPQGPVPNQTPTRKPTGGILGFLRVRSNSKSQETPQLQGQP
                     VGPGQPLAFPSGQGQFQGQQFGMQVPVGPNGQPAPGAGQQARPGQFPSQPQFSQSGPP
                     GTAGSLPPQGQPFAQRLMMGIAPQPGFPQGQAPGVQLTSEPSTFPPQSTQPTQPTQAT
                     IQPQSERMPAPGQQQAPAAMFQPSQSQSTPQQGLAKPVEPTPAASVVESPISQHSQPV
                     TQVPAEQSRLLTESPASLRQPFAAPQAGPNQLRQATPGSQTVSPAPAAQAVFGKPVQP
                     SSDPSAPQGTESADDDQIQRPVSPASQVQPPLSSIPGEELERISAAQQQTTGAQSQNS
                     GSVPPAAFPGDGPSPSVRIPASIPGESAQASGPTQQPPSSQQSNQPSIRSPTGQQGAP
                     MPPGQAYPPGQPPWMAGAVPPHLQQQFGPASARPNAAALNVPPKEKEQSTLSRLFKGS
                     KAPSSAAPAPKPDKEKNAKSSLMSAFKRTPKQADAQPPSAQMPFGQPPQGQPFAGPQQ
                     FVAGPQPPQQQAPGPQAVPGTTAQRPGPQQFGPAAAQGQSQTQGRPGPTVPINGQPQV
                     PPQPQAPPQVRPPAPEPQYDRVPIPAGYGYVHGEGRVAPAPAPFYVGPPQTGPVYGLP
                     AGQVLLPGFAPQPWAQPGVLVPQAPLVAASAQQVMPQQAHGPQVPSVPQAAIAPQAQA
                     PPQLLAQGLAPQPPANATAQEHRQDTPSTEPTRQQSPSQPPVQTAQPAQSVAGTAAAQ
                     AREASDQPSVQAPSIQVSHSNGLPDGQQGQPRPEPIREYGQGNPPHQVQSAAPPQSSG
                     PPLPPLAQGASQAQHARTVSEDGIASLPSQRPGRIQYPGPDAANPAANANLAGRPPNA
                     SPSPQPAAGWTASSAATVQGNADMGRDSRAASPTQSSQAAASPVNRLTTPTRRVAEDN
                     IYDATPRQSQFPAQQQPQQQPQQQPQQPQSQPSGIVNRSPPAPQPQQQAQHQHPNIPN
                     TATIVINGGVEPKSAGLSHEVSRSKPAAVPAAAPAAAAAAAAAPPATPPAEHAAADPD
                     APDGSHDDLESDSDDMESPIIQSATIATVQQASPTTGSPVASSGTAQNGGSGTAAAAA
                     AVAKDSVAIFERAKRKAEQQREAERRLVLEEKIPVVSSDELDGGGGPAGRRRDDDVPL
                     MSATSYPGQEWNPYGEGGFEAWDD"
     gene            complement(645116..647629)
                     /locus_tag="THITE_2111408"
                     /db_xref="GeneID:11518071"
     mRNA            complement(join(645116..647404,647525..647629))
                     /locus_tag="THITE_2111408"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651264.1"
                     /db_xref="GeneID:11518071"
     CDS             complement(join(645310..647404,647525..647535))
                     /locus_tag="THITE_2111408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651312.1"
                     /db_xref="GeneID:11518071"
                     /db_xref="InterPro:IPR009449"
                     /db_xref="JGIDB:Thite2_2111408"
                     /translation="MDYPFVAVTGWPSHPASSASGRPTFGHHRSLSSILRSASPKPSS
                     THVRSNSSAEQSVPADVARSLPSTPQPKRFLVPSSLDDDNDMSTIPDPRCRAVSPTNG
                     GAMASPHHPDLDDEVATLSTKLINAINHQTTLDDNLTAARLELEKSRERIRQLEAVVE
                     EQREMLAGDVWVRRKVVEEEKAQLIARAAEEKRARLDMEQQKRKIEQELENLTAALFE
                     EANKMVIAAKEDARIEQEALQRKNDQLRAQLADTEGLLRSQQEQLAELKHVMEQMTVE
                     KEEQSPPTLPSSPGFESFDPREAAVLPAGSRYQSLSAPLSPSYPTSFTHLLHPVLRTD
                     LAAYDDFKELLRTSKRLSAPRPPSGSSGLASLGIGLGSVSSHVSHGSSSTVSLGMTGS
                     PPASSPQTPNTPASSAGSASSAATPIPLPHLKETKFYKRVLAEDIEPTLRLDTAPGLS
                     WLARRSVLASMTDGSLVVEPTPSTATGRFGRVIKPELYPCALCGESRKEEEHLRTHRF
                     RIHESDSTQVGYPLCKYCLGRVRSTCEFLGFLRIVKDGHWRAEDEDAEKAAWEESVRL
                     REQMFWSRIGGGVVPAAHTRHLSSSSVAPSLRGEKSPRPSYEGTPRPPQPAKLHLELP
                     RASEPDHPGETVDSAQTHAAQDADEAPAADAPIAVETEKNSSPAFDDANEQQPDTKPT
                     VEGGGQNQLPLSAAVSMAF"
     gene            complement(652624..656427)
                     /locus_tag="THITE_2111411"
                     /db_xref="GeneID:11518072"
     mRNA            complement(join(652624..653000,653094..653532,
                     653792..655258,655319..655602,655665..655954,
                     656033..656427))
                     /locus_tag="THITE_2111411"
                     /product="glycosyltransferase family 39 protein"
                     /transcript_id="XM_003651265.1"
                     /db_xref="GeneID:11518072"
     CDS             complement(join(652849..653000,653094..653532,
                     653792..655258,655319..655602,655665..655954,
                     656033..656289))
                     /locus_tag="THITE_2111411"
                     /note="CAZy_ID 269817"
                     /codon_start=1
                     /product="glycosyltransferase family 39 protein"
                     /protein_id="XP_003651313.1"
                     /db_xref="GeneID:11518072"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR003608"
                     /db_xref="JGIDB:Thite2_2111411"
                     /translation="MARSAGSKPAVARASPPPPRSHPGHRPESRAAKHKDDYSSEGVE
                     DNDVFLLPGSDFQLMLGITVLAAAVRLFRIYQPTSVVFDEVHFGGFASKYIKGRFFMD
                     VHPPLAKLMITLFGWLAGFDGNFDFKEIGKDYLEPGVPYVAMRMFPAICGILLAPTMF
                     LTLKAAGCRTFTAAMGAGLIIFENGLLTQARLILLDSPLMIATAFTALSFISFSNQQE
                     LGPSRAFGLSWWFWLVMTGLGLGVTLSIKWVGLFTIAWVGAITLVHLWVLLGDYKHVT
                     IRIFAKHFMARVFCLIFIPLTFYMAMFGIHFLCLVNPGDGDGFMSSEFQSTLNSKGMQ
                     DVPADVLLGSRVTIRHVNTQGGYLHSHPLMYPTGSKQQQVTLYPHKDDNNLWLFENQT
                     QPLDSNGQPINGTNAWYNIPETPYIQNGAIIRLYHLTTHRRLHSHDVRPPITEADWQN
                     EVSAYGYEGFDGDANDFFRVEIVKKKSKSGVAQERLRTIDTKFRLIHVMTGCVLFSHK
                     VRLPDWASEQQEVTCARGGTLPNSLWYVEYNDHPKLGPDSEKVNYANPGFFGKFWELQ
                     KVMWKTNAGLVESHAWDSRPPSWPILRRGINFWGKDHRQIYLIGNPVVWWSATAAVVV
                     YVLFKGIAVLRWQRSCDDYSIPVFKRFDYEIGTSVLGWALHYFPFFLMQRQLFLHHYF
                     PALYFAIIAFCQLYDFVFARIPGVGLRENPIIGKACAVGFLVLSVVVFTLLSPLAYGN
                     PWTKAECNRVKLFSSWDWDCNTFLDSYEGYKTLPSTPAAVQTPQQSVQAQQAPPPVAG
                     GQAGQIPIADAQKAAQAQEGKPNVSGAPLPPNQRLLRTEQHVEYRDQHGNLLNEEQVK
                     ALEGKVEFKTRYETRTRLIDAQGNEILLPPGGGQPPQEQQNQAAAAGVAPPHPDVEGV
                     DRETPKRVVPDEQIPEPKQSVEGEKEREEKSAKPASEKNEASAKADEL"
     gene            <657454..>659126
                     /locus_tag="THITE_2086470"
                     /db_xref="GeneID:11518073"
     mRNA            join(<657454..658759,658816..>659126)
                     /locus_tag="THITE_2086470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651266.1"
                     /db_xref="GeneID:11518073"
     CDS             join(657454..658759,658816..659126)
                     /locus_tag="THITE_2086470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651314.1"
                     /db_xref="GeneID:11518073"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="JGIDB:Thite2_2086470"
                     /translation="MAVATTNGDAASAAAAALDNLKPPPGIIIPPPGEIREAIEKTAG
                     YVMRGGAGLEQRIRDNHGKNPKFSFLMTSSDPYNAYYEWRKQEIKAGRGTALSTGRVG
                     EAGAAPAPEKPAGPPKPPDFQFSARMPRMSQKDLEIVRLTALFVAKNGRPFMTQLAQR
                     EASNPQFQFLIPNHTFHNFFQSMVDQYSVLLREGGVSSDGSNAQQERINQLRQNVADK
                     FKVLARAKQRAAYAKWQEAEKAKQEEEEEKKKIEFARIDWNDFVVVETIVFTEADDQA
                     NLPPPTTLNDLQYASLEEKNKVSVSSSLRIEEAFPFEDTSYNAYPPQTYGVQAPAAQQ
                     PPPAANAPAPQAHGAPVHLAARTRPSEEETEAQKMQEKEQERLRTQQAQAEARSGPAP
                     MKIKEDYVPRAAQRAANKFGTQTAMCPNCKQQIPLNEMDEHMRIELLDPRWKEQKAKA
                     EARYATTNLSTVDVANNLKRLASQRSDVFDTTTGQAVSEEELARRKKVALHAFDGNPD
                     GKSQAHINQLQTFNLDEQIRAIHQKFADKK"
     gene            659506..660961
                     /locus_tag="THITE_2111424"
                     /db_xref="GeneID:11518074"
     mRNA            join(659506..660468,660575..660769,660833..660961)
                     /locus_tag="THITE_2111424"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651267.1"
                     /db_xref="GeneID:11518074"
     CDS             join(659919..660468,660575..660603)
                     /locus_tag="THITE_2111424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651315.1"
                     /db_xref="GeneID:11518074"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="JGIDB:Thite2_2111424"
                     /translation="MMASQTTGTTQAAGASAEQQQTAPQKSPTSPTTNTAATAAAAAA
                     RLHRPILQSIPDTRPQSFDEIYGPPENFLEIEVRNPQTHGIGRHMYTDYEIVCRTNIP
                     AFKLRASSVRRRYSDFEYFRDILERESARVTIPPLPGKVFTNRFSDDVIEGRRAGLEK
                     FLKIVVGHPLLQTGSKVLAAFVQDPNWDRNAW"
     gene            complement(661866..663509)
                     /locus_tag="THITE_2111426"
                     /db_xref="GeneID:11518075"
     mRNA            complement(join(661866..662221,662293..663034,
                     663110..663509))
                     /locus_tag="THITE_2111426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651268.1"
                     /db_xref="GeneID:11518075"
     CDS             complement(join(662009..662221,662293..663034,
                     663110..663300))
                     /locus_tag="THITE_2111426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651316.1"
                     /db_xref="GeneID:11518075"
                     /db_xref="InterPro:IPR001993"
                     /db_xref="JGIDB:Thite2_2111426"
                     /translation="MASASAARAMPGSPEKTTSHGDAPLTQSRETGDINPESRQGDPI
                     VNRRRATPFAKSWAHMVAGGIGGMTAATLTAPLDVLKTRLQSDFYQAQIKASRAAHPA
                     SMNPLRAVAFHFSETVSILGSVYRQEGPRALFKGLGPNLVGVIPARSINFFTYGNGKR
                     IIGEYLNDGKDSAWVHLSAAALAGIATSTATNPIWMVKTRLQLDKNMAIESGGVAKRR
                     YKNSVDCIRQVLREEGVRGLYKGMSASYLGVAESTMHWMLYEQIKRSLARREERIVLS
                     GRPKNWWDHTVDWTGKFGAAGFAKLVAAVLTYPHEVARTRLRQAPMADGRPKYTGLIQ
                     CFKLVFKEEGMLGLYGGMTPHLLRTVPSAAIMFGMYESILRLLNTPA"
     gene            complement(<664833..>666234)
                     /locus_tag="THITE_37843"
                     /db_xref="GeneID:11518076"
     mRNA            complement(join(<664833..665489,665566..665982,
                     666052..>666234))
                     /locus_tag="THITE_37843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651269.1"
                     /db_xref="GeneID:11518076"
     CDS             complement(join(664833..665489,665566..665982,
                     666052..666234))
                     /locus_tag="THITE_37843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651317.1"
                     /db_xref="GeneID:11518076"
                     /db_xref="JGIDB:Thite2_37843"
                     /translation="MFYVPASAEIRALRSAQLNKLTEGPAGVPSQDVGLSEQNFPFID
                     ATTQGGPVSHGVIKIKNIPFATKRAEIIAFLGRNSRILNDNQEPVHIIMERVSSKTQD
                     CYVEFITPQDAIRAVERHKDNIQKGRPARLGDRPVEIQLSSQAALMQDLFPLASGVYW
                     DNAKPVIQAPVEGQPWKTFKGFVTEEELTMLVKHVEMPQRSPYSKECPQRPYECMIST
                     IKKFPWYMSDYITVAQRHSIVEGTMKMIVLLQQALQRGNRMQETMINEQLLKRLVTAA
                     MLCPGFSVVQKDNIAVLAGMEPERARMFNQPRFAEEWVHLHTICPRPGIPLDVLEWYI
                     AVIREETTRYIHSKSAAERNEIQRKACFTSLYFGYIWCETNLPVGKALENLTLAKVAR
                     QELCALQQVLRRVFPRGPTRQLEASH"
     gene            complement(670122..671430)
                     /locus_tag="THITE_2111430"
                     /db_xref="GeneID:11518077"
     mRNA            complement(join(670122..670482,670541..670585,
                     670654..670779,670854..671180,671262..671430))
                     /locus_tag="THITE_2111430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651270.1"
                     /db_xref="GeneID:11518077"
     CDS             complement(join(670474..670482,670541..670585,
                     670654..670779,670854..671180,671262..671264))
                     /locus_tag="THITE_2111430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651318.1"
                     /db_xref="GeneID:11518077"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="JGIDB:Thite2_2111430"
                     /translation="MSQSLRPYLQAVRSSLTAALCLSNFASQTAERHNVPEVEARTSP
                     EVLLTPLTIARNENERVLIEPSINSVRISIKIKQADEIEHILVHKFTRFLTQRAESFF
                     ILRRKPIKGYDISFLITNFHTEEMLKHKLVDFIIQFMEEVDKEISEMKLFLNARARFV
                     AESFLTPFD"
     gene            671538..673705
                     /locus_tag="THITE_2111431"
                     /db_xref="GeneID:11518078"
     mRNA            join(671538..671766,671840..673705)
                     /locus_tag="THITE_2111431"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651271.1"
                     /db_xref="GeneID:11518078"
     CDS             join(671751..671766,671840..673512)
                     /locus_tag="THITE_2111431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651319.1"
                     /db_xref="GeneID:11518078"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="JGIDB:Thite2_2111431"
                     /translation="MATVNVVIKHQGKKYDVEVDTSATGELLKYQLFSLTGVEPERQK
                     ILIKGGQLKDDTDLSKLGLKPGQVIMMMGTPGEGGGQIVRPTEKIKFLEDMTEAEAAQ
                     QAGAIPAGLVNLGNTCYLNSTLQALRSIPELQDALAKHKHTSMSEIPQLDITNQLKDL
                     FKDMSETQGGMSPFTFLNALRVTYPQFAERSKKGPGYAQQDAEEAWSQIVSQLRQKLR
                     GPEPAEGDTARAGSFVDKYMAGEFSSTLECNEPEAREGGEQPTSAKETFLKLNCHIDS
                     QTAHLRDGLVSGLTEKIEKRSEVLGRDATYTKTSRISRLPKYLTVHFVRFFWKRDVQK
                     KAKIMRKVTFPHELDAVEFCTDELKKALIPVRDKVREVRKDEEDIERARKRRKKNHML
                     DGEVPGEKKEGAKKDDKKDDKKDDKKPAKSADGDVEMAETFKTEAEWEAEKEAALLES
                     KKELNALIDPDLRKDEGANHSGLYELRAVVTHQGASADSGHYTAYVKKTGPKDPVTGK
                     IGEEDGKWWWFNDDKVTEVTSDKIDALAGGGESHSALILLYKAIPLPTAEGVME"
     gene            complement(673725..674668)
                     /locus_tag="THITE_2111432"
                     /db_xref="GeneID:11518079"
     mRNA            complement(join(673725..674098,674237..674668))
                     /locus_tag="THITE_2111432"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651272.1"
                     /db_xref="GeneID:11518079"
     CDS             complement(join(673937..674098,674237..674488))
                     /locus_tag="THITE_2111432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651320.1"
                     /db_xref="GeneID:11518079"
                     /db_xref="JGIDB:Thite2_2111432"
                     /translation="MPPSPPAARAAAAAKAAASAARAAARTASTPSRASPSPAGAAAA
                     SQSRQTPKWKVMLWTGLFAAVTITATIYGAGLKTQQEWKAEKKRVTEATLEEKVAILE
                     QHRADLERRKAEIEDKLAGVRARIKAADEGHGPGG"
     gene            675452..677104
                     /locus_tag="THITE_2111434"
                     /db_xref="GeneID:11518080"
     mRNA            join(675452..675788,676034..676297,676367..676426,
                     676537..676701,676764..676831,676947..677104)
                     /locus_tag="THITE_2111434"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651273.1"
                     /db_xref="GeneID:11518080"
     CDS             join(675610..675788,676034..676297,676367..676426,
                     676537..676701,676764..676831,676947..676978)
                     /locus_tag="THITE_2111434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651321.1"
                     /db_xref="GeneID:11518080"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="JGIDB:Thite2_2111434"
                     /translation="MSTPRVFIVRHGETEWSLNGRHTGSTDIPLTANGEKRVLATGKA
                     LVGNDRLIVPSKLAHIYVSPRRRAQRTLELLNLVHKEQLPWNAHGEPFCEGRRCEAKI
                     EVTEDIREWDYGDYEGITTPQIKELRKQQGLDPNWDIWRDGCPGGESPSDITERLDRL
                     IKEIREKWHAPVMSKPKGEAANGDVLIVAHGHILRAFAQHWAGQSLDGGPSFLLEAGG
                     VGTLSYEHHNINEPAILLGGAFIVDLPEVQQKLNEGA"
     gene            complement(<677231..>678821)
                     /locus_tag="THITE_2048153"
                     /db_xref="GeneID:11518279"
     mRNA            complement(join(<677231..677422,677589..677819,
                     677893..677921,678001..678058,678177..678184,
                     678394..678611,678751..>678821))
                     /locus_tag="THITE_2048153"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651274.1"
                     /db_xref="GeneID:11518279"
     CDS             complement(join(677231..677422,677589..677819,
                     677893..677921,678001..678058,678177..678184,
                     678394..678611,678751..678821))
                     /locus_tag="THITE_2048153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651322.1"
                     /db_xref="GeneID:11518279"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Thite2_2048153"
                     /translation="MSASSAHQHEVAISASGHNQEYFNKEAATYDSKHEKTLNRLIEE
                     IRARLDFIGADWVDDDESEDDDGNEDDGGKNGQAAQAGKTVRLLDYACGTGVVSRALA
                     PYTTQCVGIDLSENMATAYNARAENQGLTHSEMHAYQGNLCVPEDPNPAAFAAPEFFS
                     FDVAAVGLGFHHFDDPALAARRLAERLKTGGVLVILDFFAHDKPDPSHPATQTVTHHG
                     FSEETIRRIYEEAGVGKDFALVEAGVVFHFSKENGTEVRRRIFIARGTKA"
     gene            692420..694211
                     /locus_tag="THITE_2111441"
                     /db_xref="GeneID:11518280"
     mRNA            join(692420..693265,693339..694211)
                     /locus_tag="THITE_2111441"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651275.1"
                     /db_xref="GeneID:11518280"
     CDS             join(692591..693265,693339..694151)
                     /locus_tag="THITE_2111441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651323.1"
                     /db_xref="GeneID:11518280"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2111441"
                     /translation="MADDYRRVKEDGARDPQEAMRYPPPSESDDRRRPPQAGLDSAPL
                     PAMPSYPPPGPAYQPDPRYPDRGYPPDPRYPPDPRSWPPEPPAPNGYHPPPDPRYPPP
                     YPAQDPRQFEDRRQFDDRSRPYDDRMRQYDDRRQYEDRRPYEDQRLYDDPRQYPDRRP
                     YPDPYYDQQQAAQGRGGGYGPDYYRYPPAPYPYGMGPPPPPPSTQQQTAPRQRTSIAC
                     RYCRKRKIRCSGYTHTTNGKCTNCDKLRIDCIFQPVSSNSSAAFVPVSAVPGGVPPGT
                     PLYGAYGQPLPPATAPAQQARPYPYPPTEYTPPMQSPTGAYVPYDDKDPGRRRARPLE
                     EEHSSRPPPPNYPLDDDPRRRSPVSLGSNGTPPAAYPQYQQQGPYDRDRPPTPTRNSP
                     SRPMPLQPPSRTPQVPLSQVQPAQPPLQSQLLPQARPQPQPAPSSYSQPPPPSSYSQP
                     PSSSYSQAPSSTYSNPMSLDNLMGPGPRTVNDIDRNMLGRLDRRS"
     gene            complement(<700859..702795)
                     /locus_tag="THITE_2153799"
                     /db_xref="GeneID:11518281"
     mRNA            complement(join(<700859..701785,701860..702234,
                     702432..702499,702576..702795))
                     /locus_tag="THITE_2153799"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651276.1"
                     /db_xref="GeneID:11518281"
     CDS             complement(join(700859..701785,701860..702234,
                     702432..702499,702576..702636))
                     /locus_tag="THITE_2153799"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651324.1"
                     /db_xref="GeneID:11518281"
                     /db_xref="JGIDB:Thite2_2153799"
                     /translation="MAGFSMNKVLGTIRKRPTFGGSGDDSPADLANEPPEVVAAHCVG
                     DDVIFLPAIVEAAVASPAAAAECARLTRKFMTRDHWSKPSCQYNAIMLVRILADNPGP
                     GFTRFLDKKFVDTTKELLRGGRDPSVRQILMESLDAFETTKSGDEGLALIIEMWKKEK
                     EKAYKAYGGGVPMAAVAGMPNPYQPRQPWPQTYYPRHHRSSKRLPDPVELANRLEEAR
                     TSAKLLEQVVASTPPSEVLSNDLIKEFAERCTSASRSIQGYMAAEDPAPDNDTMESLI
                     DTNEQLQHALNHHHRAVLQAKKHLGIGDSRTNVSNPAPPSQQQQPQQREQQQLQSRPL
                     PSAPGRKPIAGSSSNGKGKANLGVYDSAAVAGPSRSASATPRHETATDDDDDGQDPFR
                     DPVPEPSGSHSMSRPTGRLGDSPPRLSFEPYHPGFGGSSSSAAAAAAAAAGGKGRRES
                     GSDDDDDDVHDVYGATPKKEGHVFRY"
     gene            complement(703382..705646)
                     /locus_tag="THITE_2111444"
                     /db_xref="GeneID:11518282"
     mRNA            complement(join(703382..705088,705151..705646))
                     /locus_tag="THITE_2111444"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651277.1"
                     /db_xref="GeneID:11518282"
     CDS             complement(join(703679..705088,705151..705288))
                     /locus_tag="THITE_2111444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651325.1"
                     /db_xref="GeneID:11518282"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="JGIDB:Thite2_2111444"
                     /translation="MASNGNFDLGSLTASQREALQQYTDVTSQDIKDAIPLLERSQWN
                     VQIAIAKFFDGEGPDPLAEAQAAHQNLPRTAARHDNLHESFLNVDSRPYRSSTRRLTE
                     PAPRVVPSPPFLYRTPFLVTVLFAPFRLGYTVFAAVFNSLLYFLSFLPLSLRPRFVAT
                     SITKGLRQTNGRRVTLPTETAQRFRRDFEEEYGPQALPFFEGGHAQALDTAKRDVKFL
                     LTVLLSPEHDDTESFVRNTLLSPEVLNFINDPANNIILWGGNVLDSEAYQVAREYNCV
                     KFPFSCLVCLTPKEGSTRMGIVKRLVGPMTPEAYLAGIQSAIAKYGPDLNGVRAERAA
                     QEMARKLRSQQDSAYERSLAADRERARQKREAAAAAAAAEKRAREEAEAAARLQQLRQ
                     KWREWRASTVAPEPDAATKGVVRLALNMPASSGAGRVVRRFTSQTTTEELYAFVECYD
                     LLGQQRGEKAPEKPEGYEHKYAFRIASVMPREILEPSAATTLGEKLGRGGNLVVEDID
                     PDDEDDE"
     gene            705759..709070
                     /locus_tag="THITE_2111447"
                     /db_xref="GeneID:11518283"
     mRNA            join(705759..706114,706197..706331,706389..706503,
                     706828..706958,707015..707106,707164..707497,
                     707551..707703,707776..709070)
                     /locus_tag="THITE_2111447"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651278.1"
                     /db_xref="GeneID:11518283"
     CDS             join(706262..706331,706389..706503,706828..706958,
                     707015..707106,707164..707497,707551..707703,
                     707776..708827)
                     /locus_tag="THITE_2111447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651326.1"
                     /db_xref="GeneID:11518283"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Thite2_2111447"
                     /translation="MAATRYSSNDLRRQVGSPRSKGRENKDTLCRNILIYGNCRYEDQ
                     GCTFNHDQNKNPPPQGDVVKKAFNVDSPSFTPASQQSAPAKKSTLSSQAASAAPFTPR
                     GVGTPSLPQTVEPSVFNPAAIREFTPQNYDISNTNTNGVTQDNGLYNDPFTAMGSMAS
                     ALPAAGQFNLYAAEHNALTASGAQFYPQHGAFPTAPLQPPNYHLYQPFDTYRQDLQPW
                     QRATYDFFMPAKMREEIQRKMFATQQVMPNSGLPQLERWHSLFPLDTNNRKNTSSFGY
                     PSWVYKAQNSRTGSHYALRRLEGYRLTNEKAILSVMKEWKKIKNASIVTVHEAFTTRE
                     FGDSSLIFAYDYHPLSKTLQEQHLQPAHGNRYRAPSAVPENVLWGYICQIANALKTIH
                     SNKLAARCLEPSKIILTDHNRIRLAACAILDVVQFEINTKTVQELQQEDLVKFGRLVL
                     SLATGAPPAHLNNIQAALDSLGAKYSANLRDAVAWLIAPPNPGESKSIDNLISGVATH
                     MTTFFDLSLQDNDEKQFHLAKELENGRVARSVMKLMTVVERGDLGGTQAWSETGDRYQ
                     LKLFRDYVFHRVEADGKPNLSIGHMLTCMSKLEAGVDEMVALTSRDNETVFVLTYREL
                     KKMFDRSFNELVKHSKTGAPGANN"
     gene            complement(709643..710609)
                     /locus_tag="THITE_2111451"
                     /db_xref="GeneID:11518284"
     mRNA            complement(join(709643..709856,709963..710034,
                     710158..710609))
                     /locus_tag="THITE_2111451"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651279.1"
                     /db_xref="GeneID:11518284"
     CDS             complement(join(709726..709856,709963..710034,
                     710158..710422))
                     /locus_tag="THITE_2111451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651327.1"
                     /db_xref="GeneID:11518284"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="JGIDB:Thite2_2111451"
                     /translation="MADRPHRGGRGGPRGGRGGGGGSGRGGGSAAAGGGGGGGGAGAA
                     GNHAQQGAAGQDAGSKERPKKENILDLKKYMDQRITVKFNGGREATGVLKGYDALMNL
                     VLDDVEEVLRDDEGNTTTRPLGLVVVRGTLLVVVSPVNGSEVIANPFLQADED"
     gene            714183..718155
                     /locus_tag="THITE_2111453"
                     /db_xref="GeneID:11518285"
     mRNA            join(714183..715654,715731..716113,716166..718155)
                     /locus_tag="THITE_2111453"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651280.1"
                     /db_xref="GeneID:11518285"
     CDS             join(714367..715654,715731..716113,716166..717347)
                     /locus_tag="THITE_2111453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651328.1"
                     /db_xref="GeneID:11518285"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Thite2_2111453"
                     /translation="MATLEAAPTMAELDTLLLDASSFSSSTPSDRSSANSASLSSTPP
                     TTISPDSMSLASEPDAAKPLSAAASSIEAVIASPKAPETAQQNEPRQQTPVGHDAIVV
                     AEQPLPAEPPSNSRPRRARSSLPVYNLARLAGTDVHGRRRSKGDAGLEKRRRTVSEAT
                     LAAPHDGATSDSTDAPAGTAQSPARIAPGALPASPTTTRTATRLSTPRSARISKKSRS
                     IRASPHLTRRSTRLSGAPVEDLATKLSALNKRGKKAAQKALGGLSRELKRLQDTNEFL
                     HIDTRPVRYTVWSNGKYVDTDPSQPTAPEPPRKKVKVDKNAAGEQETSETGKPEAGVP
                     ATNKPRVKKWLEKGLYAGQEAPVDIFQGLTAQEKKKLASIPELLRSSKPNRTFPLPMY
                     NGLRILIHGRDFKLPFDICNPLPPGQPKPAAYRTMTKNRFVGNAAAYWKKTPHFGDFA
                     SKCVCKPEDGCGEDCQNRIMLYECDETNCNIGREYCTNRAFQDLQERTKKGGRYRVGV
                     EVFKTPDRGYGVRSNRCFEPNQIIMEYTGEIITEEECERRMNEEYKDNECYYLMSFDQ
                     NMIIDATTGSIARFVNHSCSPNCRMIKWIVSGQPRMALFAGDRPIMTGEELTYDYNFD
                     PFSAKNVQKCLCGSANCRGVLGPKPKEVKPPKQPPKQPSEQEKKLGKGSSKVSAKGTG
                     KGSAKAPGQSSAKPSAKRKLKDAFEFDGDDEVAAGTAKKRKLAATVGPKRTLSSASLK
                     GVKGAAKGAAKKATKGATKGAVTAIKRGGLSISVAAKKRGLSSKSAKTKTVKKGATTT
                     ALGRISKKTTYGKKSQTVATATTTKAPKPKAAAPSRSPSLTIVAAGVESAASASATAT
                     PVPQTTPRKAAAAIPASSSSRKQLPKLTISGGKTSARKWTPSRKAIEAGLADKSPAAA
                     ASAKSSGASDGAQKTGKGLDLSRTPKIKLVNATKSN"
     gene            complement(720287..721022)
                     /locus_tag="THITE_2111457"
                     /db_xref="GeneID:11518286"
     mRNA            complement(join(720287..720417,720483..721022))
                     /locus_tag="THITE_2111457"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651281.1"
                     /db_xref="GeneID:11518286"
     CDS             complement(join(720301..720417,720483..720539))
                     /locus_tag="THITE_2111457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651329.1"
                     /db_xref="GeneID:11518286"
                     /db_xref="JGIDB:Thite2_2111457"
                     /translation="MGHESASNKSYTSSRTWYCHNCNDGPLNYNLILSCPICDHQRCE
                     FCRVVKVKQPSTH"
     gene            724206..726242
                     /locus_tag="THITE_2111458"
                     /db_xref="GeneID:11518287"
     mRNA            join(724206..724575,724644..725081,725138..726242)
                     /locus_tag="THITE_2111458"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651282.1"
                     /db_xref="GeneID:11518287"
     CDS             join(724467..724575,724644..725081,725138..725829)
                     /locus_tag="THITE_2111458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651330.1"
                     /db_xref="GeneID:11518287"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Thite2_2111458"
                     /translation="MVSARRPETRWLSRIIPFVLGGCVGFATYVVVKHICVDYFLSDQ
                     DRPGTAVPFLVLYSIFLFLILLTFARVYLVIQLNPGVTDLGPRAAEHKAKARGRSRRG
                     RDIEAGLRYEARPDDNPDSPGLEQFYSKDVFVCETDGRPRWCSTCCNWKPDRAHHCSE
                     IERCVKKMDHYCPWVGGIVAETSFKFFVQFTFYTSLYCAIVVAAAIMCLESKLRTGHS
                     TDGLAVGALVLAVLFGLFTLTMTLTSIRYILLNLTTVDYLKSKNVVHQLAIRVPRGTP
                     RGQNYNVITYPLPISTTSPDPSRQTATYEVSSARDQLATRTFAIVRTEMGENPWDLGY
                     YRNWKSVMGDNLIEWLLPIHESPCATHESNESFYEMGPLYQRLRARFGLPDVSSEEEK
                     AEMKEMESRLKHGIHGTGDR"
     gene            726631..729215
                     /locus_tag="THITE_2111461"
                     /db_xref="GeneID:11518288"
     mRNA            join(726631..727300,727381..729215)
                     /locus_tag="THITE_2111461"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651283.1"
                     /db_xref="GeneID:11518288"
     CDS             join(727014..727300,727381..729022)
                     /locus_tag="THITE_2111461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651331.1"
                     /db_xref="GeneID:11518288"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="JGIDB:Thite2_2111461"
                     /translation="MPKRRWFASGSPRTGRSPCSNGSSAACYLPRPSATFHCPETDSW
                     FCVRSRQGLVAVNYPARAYGIGRMCTVTEAKKLCPDLLHPHVATWREGDDKWAYRPDA
                     AENIATDKVSLDPYRLESRRILAIIKEHLPSHLQKVEKAGIDEVFLDLSAHVHAVLLE
                     RFPELSAPPPDGNPSELLPVPPVSALDWQADALVDLDDESAEFDDPDWDDVAFLVASE
                     IVRNIRAAIRDKLRYTCAAGIARNKLLSKLGSAHRKPNQQTVIRNRAVRKFLSGFKFT
                     KFRNLGGKLGEHVSQVFNTESVQELLSVSLEQLKLRLGDETGTWVYNTLRGIDTSEVN
                     SRTQIKSMLSAKSFRPGINTVEQATRWLKIFAADIFARLVEEGVLEHKRRPKTINLHH
                     RHGSQTRSRQSPIPQGRSLDAETLFRLAKSLLHQIVQEGHVWPCSNLSLSVGGFEDGI
                     SGNMGIAGFLLKGDEAQAIDPGPRARPAEEAIGLAQPAEKRQRIDDGSIQRFFTRKLS
                     SPPLGSNDAAITDNGGETLGSRQSRASPGVDDGLNGSISLGKGPEVQANDQGGGYPCT
                     RCNACLDSPEALQCHQDWHFAKDLQEQERVTPAFGSHPSASAASPHLGGSKAGPATNK
                     RPGRPRKMERGQKKLSFG"
     gene            731381..732952
                     /locus_tag="THITE_2111463"
                     /db_xref="GeneID:11518289"
     mRNA            join(731381..731653,731727..731786,731860..732595,
                     732662..732952)
                     /locus_tag="THITE_2111463"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651284.1"
                     /db_xref="GeneID:11518289"
     CDS             join(731483..731653,731727..731786,731860..732595,
                     732662..732939)
                     /locus_tag="THITE_2111463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651332.1"
                     /db_xref="GeneID:11518289"
                     /db_xref="JGIDB:Thite2_2111463"
                     /translation="MAGRPSNRTSQTPAMPPAPPRQNEYFVPRDGIDREVITSDICRY
                     LGNDALVRPGTYEGPDGRVTQGYYITAYRNLTSAMIQDLKADSARWEQERRAAARSSG
                     GAGGTTHSSHPNGMFVRSSNSPVGSREQPRGQSDYSAWKNSLREREYDAAYGSAMDVD
                     YAPAAGSAGNQGYPGQPYPGPPAASYPPAPYPPQVHASSAPYPAQPAYAYPPNPPPTQ
                     YSPQPQNPGDRYSAIPPPPGPGSYGQDTAYVHGSNYQAAQGYAAAGPARMPPPMPHVS
                     AAPARTFPAPAAGTPGYGTETDPYGYPPPAGNPPAQSFPTDPLYGRGTTQRQGYPAPP
                     DPQYDDLQKKPGLQPATTPTSAAPAQMTNNAPPPARRDRDSEPREREPSHREPSHRDH
                     RARRPEQERDDRHADRNRHRHR"
     gene            734726..735663
                     /locus_tag="THITE_2111468"
                     /db_xref="GeneID:11518290"
     mRNA            join(734726..734785,734882..735663)
                     /locus_tag="THITE_2111468"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651285.1"
                     /db_xref="GeneID:11518290"
     CDS             734931..735089
                     /locus_tag="THITE_2111468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651333.1"
                     /db_xref="GeneID:11518290"
                     /db_xref="JGIDB:Thite2_2111468"
                     /translation="MASMVLAGRWFSYNKSGRPRHRREDWCLRCGDIQGFRLDILLLL
                     LFCSTSGV"
     gene            738039..742256
                     /locus_tag="THITE_2111470"
                     /db_xref="GeneID:11518291"
     mRNA            join(738039..738225,738456..738534,738669..739135,
                     739198..739382,739454..740646,740728..741362,
                     741428..741470,741523..741701,741804..741927,
                     741994..742256)
                     /locus_tag="THITE_2111470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651286.1"
                     /db_xref="GeneID:11518291"
     CDS             join(738136..738225,738456..738534,738669..739135,
                     739198..739382,739454..740646,740728..741362,
                     741428..741470,741523..741701,741804..741927,
                     741994..742145)
                     /locus_tag="THITE_2111470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651334.1"
                     /db_xref="GeneID:11518291"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="JGIDB:Thite2_2111470"
                     /translation="MDAAAIRDCIAATLDSNADVRRQAELQLKQAEGQPGFTDVLLDL
                     VQSEQDAKLQLPTVIYLKNRVNRAWERSDYYPHDILIPEDEKARFRERLLPILAGSQN
                     LVRHQLVPILQRILHFDFPEKWPTFMDYALQLLNTNDARSVLAGLQCLLAVCRAYRFK
                     ASDSDSRAHFDKIIEATFPRLLIICNELVNQESDEAGEMLHIALKCYKHATWLELCEF
                     LRQSAVNLGWCAVFLQTVSKPIPASAMQGDPLERERHHWWKAKKWAYFNLNRLYIRHG
                     NMQAALDRSVEPPTRFVKEFSAQVAPEILKHYLQEIEKWVSKTIWLSRPCLSYTIVFL
                     DECIRPKDMWAHLKPHLNNLVTHFIFPVLCLTEEDIEKFEDEPEEYLHRKLNFFEEVS
                     APDVSATNFLVTLTKARRKQTFELLSFINVVVNEYEQAPEGSKNHIAKEGALRMIGTL
                     APVILGKKSPIASQVEYFIVRYVFPDFTSDQGFLRARACDTIEKFEQLDFKDQNNLLA
                     IYRHILDRMADPKLPVRVTAALALQPLIRHDIIRTSMKTSIPTIMQQLLKLANEADID
                     ALANVMEDFVEVFAAELTPFAVALSEQLRDTYLRIVRELLENSDRRDDMDNEYGDFLD
                     DKSITALGVLQTIGTLILTLESTPDILLHIESVLMPVIQITLENKLYDLYNEVFEIID
                     SCTFAAKQISPTMWRAFELVHATFKSGAELYLEDMLPALDNFVQYGAPQLLEKPEYVE
                     ALFSMVSDMFTDGKVGGVDRICACKLAEAMMLSLRGHINNCVHGFINMAMGVLAREDV
                     KLKSYKVHLMEMVINAIYYDPLLSLQILEAQGWTNKFFSLWFGSMASFTRVHDKQLCI
                     LAIIALLNIKPDQVPASVMVGWPRLLQGIKILFDTLPAAMQNREAALKDDFQFDSGNY
                     GYDESDDEWNDEEANWNGTENEEEPAGETKDESTAYLEFLNEEAQKLKAADIEESEDE
                     LGEDSVLLESPLDRIDPYLAFRDSFKKLQEEQPQFCATLLSHLSADDQTALQEVCRRA
                     DTQEMMARAHVPTANGAS"
     gene            complement(750197..753017)
                     /locus_tag="THITE_2111475"
                     /db_xref="GeneID:11518292"
     mRNA            complement(750197..753017)
                     /locus_tag="THITE_2111475"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651287.1"
                     /db_xref="GeneID:11518292"
     CDS             complement(750405..752606)
                     /locus_tag="THITE_2111475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651335.1"
                     /db_xref="GeneID:11518292"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2111475"
                     /translation="MTTVRRQTAYSTFLTPLGPSRNAGSNQSSLSSSPRQYPTDLTHP
                     ILEEGDETDSEAINEPVTPVSGRQSQDFQTLPNQDGHLDAAHEQLAADQSVAAFAPAH
                     PGSAPGAKTALAVDPSATTPSRAPRSPQQAPQSARPATPAPTTSTLADQDVPPPPSSR
                     RSTFGSASSSFRRTMSSFLKRVGSDKAALTAEAGDSATASALSLSDAAHRKLPTRRWS
                     MNRSSATTRSNTPPSPSSPLEMAIKTMEEASQPTVPGSDAFFKKKSRASTGFALRSSR
                     PAAKDAASREGLHPRRRASSFDYSKQRKHVVGDPEKTVHMERSLWGLPAETGTGVKAR
                     RMSLSLPDDFTVDVVELSSEFEYQHKLLGRHGKHLGRGATSKVTLMVSKNGGELYAVK
                     EFRGKSSSETREEYEKKIKSEYTLAKSLHHPNIVDTVRLCIDHGRWNHVMEYCEDGDL
                     FTLVNKKYLKTEEREKDRLCLFKQLVTGIHYLHSNGIAHRDIKLENLLITKECRLKIT
                     DFGVSEVFSGIHPGLREAGGQCGKNMGEVRRCAPGICGSIPYISPEVLKKQGDYDPRG
                     LDVWSAAIVMVNLIFGGPLWHKAEVAENASPKDNYASLVRGWEKWRESHPDDSDTPVT
                     EMDYPHVFVFDTFVKPPALRRVLLQMLNPDPEKRISIAGVVNNRWVKNIECCQTDSFD
                     EPNGANMIDATKKLCQQRVSGKKIYCHNHLPPKDVFHGSHSLGKMPGSAGY"
     gene            762428..765008
                     /locus_tag="THITE_2111479"
                     /db_xref="GeneID:11518293"
     mRNA            762428..765008
                     /locus_tag="THITE_2111479"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651288.1"
                     /db_xref="GeneID:11518293"
     CDS             762902..764878
                     /locus_tag="THITE_2111479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651336.1"
                     /db_xref="GeneID:11518293"
                     /db_xref="JGIDB:Thite2_2111479"
                     /translation="MANPSDSSPLVSSPDKGNRMPFSKHTTESLSTIISPLALPRGVS
                     GCFDQVAANGSAQTQLACGIHASSSAPAPHHRRGGQVYSPLSPGIRGPAVRAASLLSP
                     RLHPMAKQETSHLEPRRSSYRSPETRNGMSSSRQVQNATTATTRDPAVGDSAVNGSNP
                     VANESGQSMPLLSPTWAGQLQRPPDDSLAAPLLDTVSHTQTIQRLLKQNARIRDAWEA
                     ERKHLEANRERAEEVYKEERAIMEEERTEWEAERALLLAEIERLHQLVAALGGGTAPA
                     KTPFCEGCGMRGGTEALSRESTDGSGSAQGSARSPTQPGESATADVGRVSSEAAPGTL
                     KPAFLVSPNGPSHPASDFLKPTDTEAGPVPVVDVQDIHPELEGIRIKASSVRKATFTD
                     SASSNGSKTAGLAGSPPSASTVQRGRKEQTLQVLAAAEADRLTMHAGHTPSHSLSDLA
                     SVPSSGTGTQTSSNGTATPTMPHEVGTTDPAPAKASKEQPASQAANDPHPLLRPSDAH
                     GQPTDDHPEPMFEPTHDPQLTGPLMVRNMPAHDEIFFQALTDKLEEVSKDDKAALPAV
                     LKDLDSAQDAGEPGEQTKPPATEAPADDSRSESSSRSPGSSIGDDELDIPLKFKKSTN
                     FGAPFGELRASGIRGTRPSVVQDSQAPGRLPGRS"
     gene            complement(765474..767559)
                     /locus_tag="THITE_2111481"
                     /db_xref="GeneID:11518294"
     mRNA            complement(join(765474..766463,766538..766849,
                     766908..767066,767145..767180,767245..767559))
                     /locus_tag="THITE_2111481"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651289.1"
                     /db_xref="GeneID:11518294"
     CDS             complement(join(765712..766463,766538..766849,
                     766908..767066,767145..767180,767245..767269))
                     /locus_tag="THITE_2111481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651337.1"
                     /db_xref="GeneID:11518294"
                     /db_xref="InterPro:IPR009453"
                     /db_xref="JGIDB:Thite2_2111481"
                     /translation="MTTRYRVEYALKTHRRDQFIEWIKGLLAVPFVLYSQPQGVFDGQ
                     GTSLAQTREEAHRRYSEILRDVELMIDDHIAHQNDPSNLFPSKLKLLVPSIGPFFTRL
                     PLEAAFKFQDRKRYISSRRFVSPSFNDVRLILNSAQMMAVTTYGTLQLATFDGDVTLY
                     EDGQSLETTSPIIPRLIDLLRKNVKIGIVTAAGYTTADKYYARLHGLLDALANSAELT
                     PAQKQSVVIMGGEANYLFEFDPSSPHLLSPVPRHRWLTPEMAAWDERDIAQVLDVAEA
                     ALRDCIKTLNLPAALMRKDRAVGIVPQPPEARIPRESLEETVLVVQKILELSGAGRLR
                     RVPFCAFNGGRDVFVDIGDKSWGVTVCQRWFGASMPGGAIKGDNTLHVGDQFLSAGAN
                     DFRARSVGTTAWIASPAETVDLLDELAELMEKKLS"
     gene            complement(<768162..>768743)
                     /locus_tag="THITE_26843"
                     /db_xref="GeneID:11518295"
     mRNA            complement(<768162..>768743)
                     /locus_tag="THITE_26843"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651290.1"
                     /db_xref="GeneID:11518295"
     CDS             complement(<768162..>768743)
                     /locus_tag="THITE_26843"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651338.1"
                     /db_xref="GeneID:11518295"
                     /db_xref="JGIDB:Thite2_26843"
                     /translation="LAVAQGPNTPVCPTATRTIQNRGCHKSCALSDCTFQTTILNPCD
                     CPRTLPTATLIAPCEADCPYQGCSIDFRTFALPCPTIPSTTTTTTSTRHWPWPPTTTT
                     TTSKTTTTTTSPTGVITSIVTLPTKTTRTPCPTVTHTTSPADCPALRCPVPTCRVQSS
                     LVVPCGCTPKTLLYVTGCATACPDGCLTRTETIS"
     gene            complement(770452..774036)
                     /locus_tag="THITE_2111485"
                     /db_xref="GeneID:11518296"
     mRNA            complement(join(770452..773056,773113..774036))
                     /locus_tag="THITE_2111485"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651291.1"
                     /db_xref="GeneID:11518296"
     CDS             complement(join(770608..773056,773113..773591))
                     /locus_tag="THITE_2111485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651339.1"
                     /db_xref="GeneID:11518296"
                     /db_xref="JGIDB:Thite2_2111485"
                     /translation="MGWTVFLLTYLFGGITFLPLLVIVILAHAYFTLPYRKDADASDA
                     STSADGDLIQPGDDLEPLKAAQKDGARARGVRHEPDVAAGYFAVCREYTPMGINAKPI
                     ERSTPVGSATVAAPSPSVYQTMYRSIFDRKQAAGPLDNKNGGSQRPKRAGNVFYVVLR
                     HGHLMLFDDDEQLEVRHVISLAHHDISVYSGEPVTPEGELFIKRNAICLSRRAGGPEL
                     GPDSQVSKPFYLFSENCSAKEDFYLALLRNQEQTLAAESRTPTPIQFDVKNIISLVQR
                     LHSSEEHMHTRWLNAMIGRVFLGVHKTKDMENFIREKLTKKISRVKRPAFLSNIAIKA
                     IDTGESAPYITNPRLKDLTVEGECGVGADVRYTGNFRLEVAATARIDLGSRFKAREVN
                     LVLAVVLRRLEGHVLFKIKPPPSNRIWFSFQQMPKLEMTIEPIVSSRQITYTVILRQI
                     ENRIKEVIAETLVLPFWDDVPFFGTEHKKWRGGIFHDDTVKSPADRESAAAQEGEISE
                     VAHLEETHGVQESDLPHMEKSHSLPVLEKKPSTGLFGRKVSRKASKTDLTSTTPSTSS
                     SSIEVKNEAKSETGVSPPALSAPFVQPSSPTVGTIAANAEHFRPSSSPPEGNTAASTM
                     ATLSANSQSPAPPQAPNPDGFTPYITSKSSSQTSSSSSRDATDTENNTDRTPQARRNT
                     ASSTESHSDGGSRSPTMAAKASARRQAGSTARGLFGRRETDSSTSFGLTSHGSNETQK
                     RTALNAVANAAASAKRWGLNAFQRRPVDEAGAGQARRNESASGLDLSQPMGRGQPLPP
                     PGTPLPMPEKRAPTAIPKRKPIPPPSTEPHGEAVKQQTKQTIERRPVPPPPLPKRRHY
                     QEQEATDDNLLVVAAPADSEPTTPLSGSHSPYVQPWVEDAGDSDDNDLSKNAPATVAD
                     EQADTEAPSLAAIPDGSRPEPGGVAGMPESAVDDDDFSAWMDGHELEHSEPPTNAEAV
                     QGI"
     gene            complement(774037..775323)
                     /locus_tag="THITE_2111487"
                     /db_xref="GeneID:11518297"
     mRNA            complement(join(774037..774812,774953..775000,
                     775065..775323))
                     /locus_tag="THITE_2111487"
                     /product="60S ribosomal protein L21"
                     /transcript_id="XM_003651292.1"
                     /db_xref="GeneID:11518297"
     CDS             complement(join(774482..774812,774953..775000,
                     775065..775168))
                     /locus_tag="THITE_2111487"
                     /codon_start=1
                     /product="60S ribosomal protein L21"
                     /protein_id="XP_003651340.1"
                     /db_xref="GeneID:11518297"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="JGIDB:Thite2_2111487"
                     /translation="MGHPAGLRAGTRYAFSRGFRQKGTIPLSTYLRQYKVGDIVDIKV
                     NGAVQKGMAHKVYHGKTGVIYNVTKSAVGIIIYKKVKHRYIEKRINVRIEHIKPSRSR
                     EDFLRRVKENAELKKKAKAEGKPVQLKRQPAMPRDARTISFVDNKPETVAPVAYETTI
                     "
     gene            775462..>776393
                     /locus_tag="THITE_2075346"
                     /db_xref="GeneID:11518298"
     mRNA            join(775462..775537,775701..775799,775874..776278,
                     776303..>776393)
                     /locus_tag="THITE_2075346"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_003651293.1"
                     /db_xref="GeneID:11518298"
     CDS             join(775473..775537,775701..775799,775874..776278,
                     776303..776393)
                     /locus_tag="THITE_2075346"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_003651341.1"
                     /db_xref="GeneID:11518298"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="JGIDB:Thite2_2075346"
                     /translation="MAPLSYSKTAKVPRRPFEAARLDSELKLVGEYGLRNKREVWRVL
                     LTLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKAEDF
                     LERRLQTLVYKLGLAKSIHHARVLIRQRHIRVGKQIVNVPSFIVRLDSQKHIDFALTS
                     PFGGGRPGRVRRKKAKAAKKGEEGEEEDEEEMVGTARYGQRKSAWAGTFDVCIMLFRR
                     L"
     gene            complement(776439..778075)
                     /locus_tag="THITE_2111492"
                     /db_xref="GeneID:11518299"
     mRNA            complement(776439..778075)
                     /locus_tag="THITE_2111492"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651294.1"
                     /db_xref="GeneID:11518299"
     CDS             complement(776595..777887)
                     /locus_tag="THITE_2111492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651342.1"
                     /db_xref="GeneID:11518299"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="JGIDB:Thite2_2111492"
                     /translation="MPPPPPRRPAPAPAAGASTDSGSGAGAARKEDNIYIPAYISKQP
                     FYVSGLDDHDDSLQHQRSRAPHEDENFTIERGGRKTGPARTKWVKGACENCGAMGHKK
                     KECLERPRKVGAKFTGKDIQADRTVRDVSLGYEAKRDIWASYDPKQYREVVEEYNMIE
                     DARRKLQGQNGDKTEGEDVYEEGFKYAEESELGKDKTVKQSMRIREDTAKYLLNLDSD
                     SAKYNPKKRALVDGGAIGDKSAKLFAEEAFLRASGEAAEFEKAQRYAWEAQERTGDTS
                     MHLQANPTAGEFRRKKESEEREAKRRKRAEMLASQYGEQPTVPEALRAAITESETFVE
                     YDEAGLIKGAPRKAAKSKYPEDVFINNHTSVWGSWWSDFKWGYACCHSFVKNSYCTGE
                     LGKLAGKEADSWDRWGGEDGNNGQDDQKGSGATDSPSQ"
     gene            778390..784207
                     /locus_tag="THITE_2111493"
                     /db_xref="GeneID:11518300"
     mRNA            join(778390..778793,778876..784207)
                     /locus_tag="THITE_2111493"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651295.1"
                     /db_xref="GeneID:11518300"
     CDS             join(778559..778793,778876..783899)
                     /locus_tag="THITE_2111493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651343.1"
                     /db_xref="GeneID:11518300"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="JGIDB:Thite2_2111493"
                     /translation="MDVFRVRLNCIDHYQAAPTRYDPPLRRDAHLTEAAKQPKVPVIR
                     VFGSTETGQKVCAHIHGAFPYLYIEYGGPLDKATVSEYIYRLHLSIDHALAVSYRRDQ
                     YRDRQSFVARITLVKGVPFYGFYVGYRFYLKIYMLNPVVMTRLADLLQQGLIMGRKFQ
                     PYEAHLQYLLQFMTDYNLYGCDYLDAGKVRFRAPVPDPAGPDEAPRIWDSNTIPPESI
                     TDEYGLPRVSHCSIEVDICVQDILNRKAVKERRLHHDFVERTHPIPPDLKLVHSMAGL
                     WRDETKRRKRRMLKSDAGDSPFPKEALVSMSADLRASQPPGWIHEEEYREQVRLLIEQ
                     ESMQDGAELTFSNYIEPDPNGESVRTALQSVEDLFPENLLPALGLEQQLVSEPSNVAS
                     SIQVDEKGILELEVSEEEEQLSPDDSDDDLNSDEVLNQNGAAAGVRGQLVQKQPPTHP
                     VVSGAEPPADAYSDEQPRKLVADLKRTINGLRGGFGVSGLRSGKRPSIPLPASLCSEA
                     AFLALTSKPNVDTQPSETAELNDLKRPAPAPETDVPSKRPKRDPQSPASGSARAEPAP
                     LNSDRPASESTAGEQKSTPTRPPQSLSQRRKAVSKGSSAKLVGNQTLSFPVVKDAHDP
                     DTVLRLTQRSASQRSDGGARGGTARKQVSFDPLVSVQEVNLGSKTTSTSRTTESPPPK
                     WPPTPRRADLHWNGHTTMFLVNSKPPSVQDVRSTLQAYGLPDVLYQDCFYSNDNDVPP
                     RPREYAGREYRLDGNTVPYLPDFDPSGQSPAAFGVKPEQAPDLSELESAYEKQQTQCT
                     LRSWEIAEPPPTFAEVSRWWTQKKKGKAHKTSSVRLPPGTQGPKTEFSQIAGPTPKNT
                     HGFKYSQKQKSTSVQHEAQYMSTMSLEIHVNTRGKLVPNPEEDEVQCIFWCLRSDEMC
                     LYGSQSTDDTISGVIVLSEDGSRARQIRSQTSVEVVEETSELDLMTKMVDIVRAHDPD
                     ILTGYEVHGSSWGYLIERAMHKYDYDLCNEFSRMKSASFGRSGREADRWGFQKTSMLH
                     VTGRHVINVWRAMRGELNLLQYSMENVVWHLLHRRIPHYSWRTLTDWYLSGRPGDLSK
                     VLRYYLRRTRLDIEILEANELIPRTSEQARLLGVDFFSVFSRGSQFKVESIMFRIAKP
                     ENFLLISPSRKQVGAQNALECLPLVMEPQSAFYTSPVLVLDFQSLYPSVMIAYNYCYS
                     TCLGRIVSWRGTNKLGFTEYKRREGLLRLLKDYINIAPNGIMYTKPEIRKSLLAKMLT
                     EILETRVMVKSGMKEDKDDKTLQKLLHNRQLALKLLANVTYGYTSASFSGRMPCSEIA
                     DSIVQTGRETLERAIAYIHSVERWNAEVVYGDTDSLFVYLKGRTREQAFEIGAEMAEE
                     ITKMNPRPVKLKFEKVYHPCVLLAKKRYVGYKYESREQTVPEFDAKGIETVRRDGTPA
                     DQKIEEKALKILFETADLSQVKEYFQSQCSKIMRGSVSVQDFCFAREVKLGTYSGKGP
                     GPPGALISTKRMLEDARAEPQYGERVPYVVISGAPGARLIDRCVSPEDLLNNPHASLD
                     AEYYISKNIIPPLERIFNLVGANVRAWYDEMPKVQHVRRLETTSALSALTALAANSSN
                     NNNNTTNKKTLEFFMNSASCIACGVKMAKPPIAAAAAAADAHDDHHLRPLCSRCASDP
                     ATTMAQLQARLNAEERKYADVVRVCQSCAGFAPLERDVPCDSRDCPVFYTRVKQRARV
                     AADRAVVVPLLRALGAEGRGNGGLDW"
     gene            786467..792244
                     /locus_tag="THITE_2111495"
                     /db_xref="GeneID:11518301"
     mRNA            join(786467..787127,787189..791854,791930..792244)
                     /locus_tag="THITE_2111495"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651296.1"
                     /db_xref="GeneID:11518301"
     CDS             join(786672..787127,787189..791854,791930..792060)
                     /locus_tag="THITE_2111495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651344.1"
                     /db_xref="GeneID:11518301"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Thite2_2111495"
                     /translation="MTTSLGFDKPVAASAAGDASDPFLASPSGPTHLRHSNFDTQLFA
                     LAPGSSAEQVKRAIEAHLRDTERRMEEAGKLGTALVQQQKQLTEKLREVEQLQSEAEL
                     SPELRQRLIEIEKDYNEVARESARALLPKQRVPSNEAQGSPFSPDKAASRRSVSPSKF
                     ESLAAPSPTKFGIPNRKIRNQPASRVHDIEFAAEISTSLIAQVRNLQALLSEREEELK
                     EVKSERSRLEIEVEGFQQRLKSLDESESRYKDENWNLETQIHELIAAQKEAAEREKKL
                     TQALNVIQAERNAAQRELEEVKDSLARQDEKHSAEIKNLEIELGTSRRSAVLFETERS
                     ALQRKVDELTGQNQELAKAFSALQRGRALDREAPHGGSEEDSNSAPDHNTPEHSPPPS
                     PMKPTPRHSALESETLKTSLGHAQRTIQTLRTNIHREKTEKLELKRMLQDARDEIEKL
                     RSDPHPQPKRIRKAELRESKKPSFKLNRLGVPRSSRTEVVEDPDWEDQSEGPSPRALS
                     HRGSVLRLSGDAGAQRPLDSNSDQFETAHETSDAAFETAHERATETEDFQTGIEDMSD
                     DDDDAATETEAGPSRGAHSIKRPPPLPPHQSSNQYSFDSTASTSSDEDDHPVGSEMKT
                     PTAGPRIRMRVSRGSLGRRSRQFSEEPAVPSSPVSIPAHSTSAASGGQSLFAELNNVD
                     NSDDDSCAGAATPGRRSIRSATPATPRSVVSRRHSPPPRVPALPRIMVDSGVMTEPVD
                     IRPVSAITDGEDLPEDGVNSVSRPPSIVFPARPLSMESVIGPRGLGDELRDEEPSKPL
                     AAVPYNDASVQSDWESGTTLDQLASPPSAPSVLPTLPALSISSVHAESIEPQSEPDSS
                     PSPPSLKLSSILSEQTEPVAEQVELPVLTMPPPISEDIEPVSQPEPPQPEPPRLSAIL
                     SQNIEPVSEPEPSLPEPPTLSVPMVLSQEIEPAPLSPVALSFSAVTSEQVEPVADPAT
                     APPSPIALSCPPIRCEEVEPVELPAPIIDERTESDVGVPSSVSLSFSPIASEHVEPQS
                     EEPIPPVKLSFAPINVQEVEPLQEAETEAPPLALASIQTLDVAPREAPAPPLALASIQ
                     TLDVAPREAPAPPLSVSSAQSWSIEPLDTPPAVPPALSLSGIETQSVEPLLADNVGVA
                     PVLGVSGIQSWHTEPAEPRSPKRNAFIIPRDVEGAVNGAQSPPRTPPADAAPGPKKVV
                     ATTDQGAQTALTSQAIEEMLRVQTEPSGPADLERRNSLGSMGTPSTVRIHRPRQVSVD
                     GSMRAKGKMADAGADGLESSVPRRPGSSASAMTSLGEVPPLPPNHKEVIEAARSGSSQ
                     GGPGTIGLMGPPLVPASALRAQNQSLRPRTPTGARRPTSPVSHASGRGTPTPRAAGRP
                     GAPFGTADVHEVQSLSKATLRSRKSSISSFTSEVDTRFNLHQGGGFESQGFGPNTDPR
                     MIQAITQTMIGEYLWKYTRKAGRGEMSEKRHRRYFWVHPYTRTLYWSDRDPSTAGRSE
                     LRAKSVQIEAVRVVADDNPMPPGLHQKSLVIVSPGRSVKFTCTTGQRHETWFNALSYL
                     LLRTASEGQTDAEEMAGNITREDVEEFNPSFGRRQANGNRTAPSPSLSSYNSRTVRDS
                     PPMDISMSIPTLTPTRSKASHNRASFGTLSRISGYLKDNKLSGTFGSIRSRSAQGHYS
                     SQGVYEASEVPDSAEDLRRMIERQDREADRIENVRACCDGKHDVGTLTNSAKRGRHSV
                     AGFRSPTPGPSTSPTPVGTVRSRA"
     gene            792964..794288
                     /locus_tag="THITE_2111496"
                     /db_xref="GeneID:11518302"
     mRNA            792964..794288
                     /locus_tag="THITE_2111496"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651297.1"
                     /db_xref="GeneID:11518302"
     CDS             793040..794173
                     /locus_tag="THITE_2111496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651345.1"
                     /db_xref="GeneID:11518302"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2111496"
                     /translation="MADAGTTAGGASTAPAAPVAIFKKRGAKGKANIRKRPATPPPAA
                     DSDDSDFSSSEDEAGQRIKRRKRNPGAVVASSKDSAAPGARDADLSATVYEADRTLPL
                     DSGKREATKQSNWYDEDAADARSSRNLLGSTRAMPNKAKDPADASSSSKDSSAAPDGT
                     YKGLANQASYIQRNPNAPPRVVGPIKAPTNIRTITITDMAPDVCKDYKQTGFCGFGDT
                     CKFLHAREDYAHGWQLDREWENVTKGKKVLGGTVVASVDRKLAGRGGGGDGGGERDED
                     EEEAAMLENIPFACIICRGPYKAPIVTRCGHYFCESCALNRYRRDPSCAACGAGTNGV
                     FNAAKRLQKLLDKKRERVARKRQEAREAGEEVSDEEEQEEPES"
     gene            complement(794278..795837)
                     /locus_tag="THITE_2111497"
                     /db_xref="GeneID:11518303"
     mRNA            complement(join(794278..794436,794504..794972,
                     795041..795837))
                     /locus_tag="THITE_2111497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651298.1"
                     /db_xref="GeneID:11518303"
     CDS             complement(join(794383..794436,794504..794972,
                     795041..795543))
                     /locus_tag="THITE_2111497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651346.1"
                     /db_xref="GeneID:11518303"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="JGIDB:Thite2_2111497"
                     /translation="MNILYSTVNSLRDRYTPANHTSTFRSTGEITPEEFLAAGDYLVF
                     KFPSWSWADAETPSKRISHLPPGKQYLVTRHVPCHRRLNDDFAGDAGHEESVVEGGKN
                     SDDDGWLRTGGLTSSQPLKVREVRTVDDAGNVGDREVIEDDDIPDMEDEEDDEAIIRD
                     AEGDGKNSGRRTYSLYIMYSPWYRTPRMYMSGYQPNGEPLPPHLMMEDIVGDYKDKTV
                     TLEDFPFFANPVKMASIHPCKHASVMKTLLDRADAALKLRSEKRKAGLAEGSGQGLEG
                     LEAEIGHLSVSGTGSSGDNNDEWEDVQHDVADQEPAIRVDQYLVVFLKFIASVTPGIE
                     HDFTMGV"
     gene            795930..800018
                     /locus_tag="THITE_2111501"
                     /db_xref="GeneID:11518304"
     mRNA            join(795930..796316,796392..797014,797072..799482,
                     799598..800018)
                     /locus_tag="THITE_2111501"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651299.1"
                     /db_xref="GeneID:11518304"
     CDS             join(796285..796316,796392..797014,797072..799482,
                     799598..799684)
                     /locus_tag="THITE_2111501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651347.1"
                     /db_xref="GeneID:11518304"
                     /db_xref="InterPro:IPR002558"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="JGIDB:Thite2_2111501"
                     /translation="MATIRSLDHTKSEAELAINIKKATSPEETAPKRKHVRSCIVYTW
                     DHKSSQSFWAGLKVQPILADEVQTFKALIMVHKVLQEGHPVTLREAMANRGWIDSLNR
                     GMIGEGVRGYGPLIKEYVYYLLAKLSFHKQHPEFNGTFEYEEYISLKAINDPNEGYET
                     ITDLMTLQDKIDQFQKLIFSHFRNVGNNECRISALVPLVTESYGIYKFITSMLRAMHS
                     TTGDNDALEPLRQRYDAQHYRLVKFYYECSNLRYLTSLITIPKLPQDPPNLLADDDTA
                     PALPARPKQEIEKQPTPPPAPKSDEPDEITEFWKSEIDRQNREFEEQQRVLEAQQQAA
                     LLAQQQAQLQAQREFEEQQRRLLEQQQREQEALRAQQAQWQTQGRLAELEQENLNARA
                     QYERDQLMLQQYDQRVKALEGELQQIQSNYGQQIASKDDQIRALQEQVNTWRTKYEAL
                     AKLYSQLRHEHLDLLQKFKAVQLKAASAQEAIDRREKLEREIKTKNLELADMIRERDR
                     ALHEKDRLQGSNKDEVEKLKRELRMALDRADNLERSKGNELSAMLSKYNREVADLEEA
                     LRNKSRALEEAQAKLRDGNSDLEALLREKEEELEVYKAGMDQTLIELNELKNNQGTTE
                     QVLDGQIDALVLAQLAKINEIIDSVLQAGVQRVDDAMYELDSTMQAGNQSASPSYVLS
                     QIEKASASATEFATSFNNFIADGPNSTPADLIKNVNIFAGAIADVCGNTKGLTRLATD
                     EKMSDSLINGARQSAHATVKFFRSLLSFRLEGMEPLQKTDVVINSNHDVQMNLQRLNK
                     AVEAFAPGYGKLAAKGDLGEIVDKELSKAADAIEAAVARLNKLKSKPRDGYSTYELRV
                     HDSILDAAMAITTAIAQLIKAATIAQQEIVQAGRGSSSRTAFYKKNNRWTEGLISAAK
                     AVASSTNTLIETADGVLSNRNTPEQLIVASNDVAASTAQLVAASRVKAGFMSKSQENL
                     EQASKAVGAACRALVRQVQDMIKDRNAEEEQVDYSKLGQHEFKVREMEQQVEILQLEN
                     ALAAARHRLGEMRKISYREE"
     gene            complement(801019..802453)
                     /locus_tag="THITE_2111503"
                     /db_xref="GeneID:11518305"
     mRNA            complement(join(801019..801321,801389..802120,
                     802172..802453))
                     /locus_tag="THITE_2111503"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651300.1"
                     /db_xref="GeneID:11518305"
     CDS             complement(join(801311..801321,801389..802120,
                     802172..802322))
                     /locus_tag="THITE_2111503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651348.1"
                     /db_xref="GeneID:11518305"
                     /db_xref="InterPro:IPR006856"
                     /db_xref="JGIDB:Thite2_2111503"
                     /translation="MSGINQIIQTFEGLGEGERETTMKALSTMMRAENQSQPAKKKVN
                     GFMGYRAYYSSLFSLLTQKEKSPIMTTLWKQDPFHKEWDFMCAVYSAIREFLSDEEVS
                     LQDWIQFAVKHLGIVVRENYLETLGWELVKLEDGTHKVQRTATRVVQGYSQPMNGLGL
                     FMNCLNDGLPVSNPLPIIAKLSALTNDIICINTQRGAAAKPSNTMDGFRQFAKNHPQL
                     AMSALLQVPAAHPVITQGVTVHNLSDIIGLPTPEPFFAAQDEDPELDAMLERVLRGDD
                     PGNFGNQFFPMDMGNSAQGFN"
     gene            complement(<802753..>804124)
                     /locus_tag="THITE_2127265"
                     /db_xref="GeneID:11518306"
     mRNA            complement(join(<802753..802935,802995..803072,
                     803141..803185,803236..803952,804026..>804124))
                     /locus_tag="THITE_2127265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651301.1"
                     /db_xref="GeneID:11518306"
     CDS             complement(join(802753..802935,802995..803072,
                     803141..803185,803236..803952,804026..804124))
                     /locus_tag="THITE_2127265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651349.1"
                     /db_xref="GeneID:11518306"
                     /db_xref="JGIDB:Thite2_2127265"
                     /translation="MADDQAATGGLGNLKNQPFSSRGAQMDRHTLGQVVLRLQAQYIR
                     SSLAKEIEEFENTFEEILQAASVFLVTTQRVSHAPSLVIVDEASVIKTVCHFLASSNT
                     ILEFLDFQRRKTGLASGGDSSLEKQVKAAQALVAQLLSALLLHMKSETYPGKESGLIY
                     NEDVKIFGGMVFHKNAEADYADIPDPADDGEGLLRCISYWHPETLFHPLRHVPGTPWH
                     KFFGNLQVGETGNPALFRKRKSLPAFKVIIPETIEWLVPELRSNYDTYREIFENTRRM
                     PGPRLPEYIRNRRLSTLFEGWKRFDDRMDLHPEDMSDIPCPEFDLLGLSRLESLNAHL
                     NATDLAGISLLGAEIPRVPVILTGESRRYCLEFDGQWDA"
     gene            804450..805846
                     /locus_tag="THITE_2111506"
                     /db_xref="GeneID:11518307"
     mRNA            join(804450..804854,804906..805033,805092..805250,
                     805300..805671,805756..805846)
                     /locus_tag="THITE_2111506"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651302.1"
                     /db_xref="GeneID:11518307"
     CDS             join(804688..804854,804906..805033,805092..805250,
                     805300..805514)
                     /locus_tag="THITE_2111506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651350.1"
                     /db_xref="GeneID:11518307"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="JGIDB:Thite2_2111506"
                     /translation="MASSVQNANLPAMENQAPAPLAFVFHGNEMIIQCTANIDDQAAA
                     VRYLEPVMRNYQNFNDGKATAIVRCAESTKYWITSIAYAETLDNDSYTIIKTSVDSPE
                     NPPVDAEPVKLPKVSKVHIRRPRNQFIIYRQWMSARIHAETPGVTAGCVSQLVAQMWR
                     HEDPAVKARFKALADEEDRMHKLMYPGYRYVAGRRRPQLALSKRNLPHDPMTVAERLI
                     AAGF"
     gene            complement(806541..809216)
                     /locus_tag="THITE_2111508"
                     /db_xref="GeneID:11518308"
     mRNA            complement(join(806541..806929,807108..808697,
                     808765..808897,808953..809011,809074..809216))
                     /locus_tag="THITE_2111508"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651303.1"
                     /db_xref="GeneID:11518308"
     CDS             complement(join(806817..806929,807108..808697,
                     808765..808897,808953..809011,809074..809101))
                     /locus_tag="THITE_2111508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651351.1"
                     /db_xref="GeneID:11518308"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Thite2_2111508"
                     /translation="MPLRITTWNVNGIRNPFGYQPWRENRSFQAMFDTLEADIVVMQE
                     TKIQRKDLRDDMVLVPGWDVYFSFPKYKKGYSGVAIYTRSSKCCPIRAEEGITGVLCP
                     PNSSTKFRELPSDLQIGGYPKPGQLSDSIDEQTLDSEGRCVILEFPAFVLIGVYSPAT
                     RDETRTEFREAYIDAIDVRVRNLVAMGKQVFLCGDLNIVRSPLDTAGLAERLRKEGMT
                     LDEFMSTPPRRLLNHLVFGGTVVGGRDEGREEPVLWDLCREFHPTRAGMFTCWETKKN
                     ARPGNFGSRIDYVLCSSGIKDWFIDANIQEGLLGSDHCPVYATIGDAVSFGDTNVPIE
                     DVMNPAGMFKGGKRLREWSSKDLLPTSAKLIPEFDRRQSIREMFFKKSAPSAKTSTQA
                     QMDNQDGRGVLDAANGVKTTGILENNTTPGSDRNPTIASVSVSSTTPNSAASPQKSVP
                     TKRQAESSTAVRRPQKKGKGNLNRAGSTNSTTGSSQSTLKGFFKPKTPVPDEDPPTPA
                     QGVDESSPELKADRDCPGVQTASGAESNSGTSTGDDVDNTLEQSQKPEGSSSEKVFDP
                     IQAKESWGKLLGKRVVPKCEHGEDCQMLVTKKPGINCGRSFFMCARPLGPSGDKEQGT
                     EFRCRTFIWSSDWSGR"
     gene            <809832..>810698
                     /locus_tag="THITE_2046525"
                     /db_xref="GeneID:11520627"
     mRNA            join(<809832..810004,810313..810472,810531..810538,
                     810653..>810698)
                     /locus_tag="THITE_2046525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651304.1"
                     /db_xref="GeneID:11520627"
     CDS             join(809832..810004,810313..810472,810531..810538,
                     810653..810698)
                     /locus_tag="THITE_2046525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651352.1"
                     /db_xref="GeneID:11520627"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="JGIDB:Thite2_2046525"
                     /translation="MLAQRLTSRAAQRFATQLRAQAPRRFASTETESQFVRERRAVKE
                     HAVATTGEHRRAFRAVPPALLLSGLNAYNLWNEHWEHWEHLPPLEERTEYPYQNIRTR
                     NFPWGDGDKTLFWNDKVNYHNKDKTT"
     gene            complement(811024..813724)
                     /locus_tag="THITE_2111513"
                     /db_xref="GeneID:11520628"
     mRNA            complement(join(811024..812673,812723..812816,
                     812871..813724))
                     /locus_tag="THITE_2111513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651305.1"
                     /db_xref="GeneID:11520628"
     CDS             complement(join(811173..812673,812723..812816,
                     812871..813624))
                     /locus_tag="THITE_2111513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651353.1"
                     /db_xref="GeneID:11520628"
                     /db_xref="JGIDB:Thite2_2111513"
                     /translation="MPRYLAPARIGLLALVELYAEGAVPNDAIIPVIDFITTHLLDCS
                     LINPSAGLAERWKKADSTIKLIASVHHFEELLGGYPAADRLPGRRLWDRFLEKLWGID
                     SLHSLHEFFDQLPNLLQRTKAELRELAARGEEPPSGVLFSRNSPFGVFLRRSYLEFSR
                     MQFSQAAELWKVFVKYRQPTAAYWRRRNPHYSRLSFDSVLLAGEHEWGDQTDEIAVAA
                     YGNMLLMDDEDATVPVSTDEIESLLEFQIEQVQKYGVRVPTEIREQFQTLLKSSRTVP
                     SLSHYLSFSDSWRAGDLPASFDYLHRYFDYTMQSRDRLFYQYALLNLGIVQSDFGCHR
                     EAVATMLEAITTAKENRDTTCLNFALNWFFHFGRAHPNLVRELQDSSMLGTGKESLVF
                     LRAKAKETGMWILWSSALLSEAKLGLANGESVSASMESMVRSSQLIVEKNVKTMIGPQ
                     LSLVIALWDRLGLGVLSTMVCDVFLRCHGRSAVLDDRLKLTCRMAGLLAAKGKYGDAF
                     AKLDTIDPSMLRSAKPDQYWHLYRGILKLRRDLHHNNLESAENLLYQLLQSGPEDIDP
                     DLVFIIDSLHIEALTRRQDFNAAFSKIEKLMSQLREENRDVSLRIRLLLAKVHLFDCI
                     GRPEKGFTLAMRAAGMAWRARLVALLWQAIGAVANILNALGEFAAAEQLLVAVLPRSL
                     ETDATYTNGVLYSLLADARIGLAGEVQGRGRATERAEMLAKALKALDAGYQCFSAVED
                     VNKRCEMMAKKATVLRAEGDHVRAAECIDTYLRLWEEEMARR"
     gene            complement(814373..817229)
                     /locus_tag="THITE_2111514"
                     /db_xref="GeneID:11520629"
     mRNA            complement(join(814373..814885,814948..817229))
                     /locus_tag="THITE_2111514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651306.1"
                     /db_xref="GeneID:11520629"
     CDS             complement(join(814543..814885,814948..817148))
                     /locus_tag="THITE_2111514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651354.1"
                     /db_xref="GeneID:11520629"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="JGIDB:Thite2_2111514"
                     /translation="MRPPRVAILVLFCSASLFLIYRSVSSFGRPRPAAQPLAAQKSSL
                     RAFFSFSAPFSLFPPNAAISLTDDNSTFFPARPAAFGPPLPASGLSGQLWIGSGFSEE
                     SLQDGDGEGELGCSDIPGWEDGRSQPALQVAERGSISNKRAHGAADGRSPKADLGMDP
                     VVDRDAVEEPSERESKPVNDGTDDYLHQQTRSTRSEGTTTSASSHADIQSIQESAEIT
                     GKIVLLSRGGCGFLEKVKWAQRRGAIAVIVGDNQKGGPLIQMFARGNVDNVTIPSVFT
                     SRTTAHLLSSLTQPGSFIEDTLDEHGKPKLSVQRSVKGGKDQRSRDRVLSAKAASRTS
                     ALASPAQQSPPPEIARSTRVRRSWISRIFRWSGDQGTSSDWGRTRSSAGSDRVLVDNP
                     DNNLDKPTKNSLGKTAEGEAQDGGSHIETRNWRNSDLPGRTAKRNEDSTTRKSINGDA
                     QLFHSAPSARQVGKAGRGPSADIDRPEGGINAPRSGRYKASAVENAATHSPGTSGSSY
                     PRGRGLFPRIFGGEDDSKHKQDQMSDKSQSPPATNPVPVPPSAGGNEAREGLWVTITP
                     TGSASPFFDTLLVLVISPLITLTVVYALLILRVKIRMRRWRAPKSVIEQLPVRTYHAV
                     APSPTQSPRTPSPASSSPTTPLLQGSSRSRPRSRTTTDVPEAAALLGPDGVSPTARTR
                     SREKKKPSGTSSQWRKYMGRQVECVVCLEEYVDGVSRVMRLPCGHEFHAECITPWLTT
                     RRRTCPICKSDVVRSLARHSSPGPQYEPFREDSYDSSGESSDTYQNRLPSPNRVDDLE
                     RGPTWTQASRQEWQPARHDVWFSALTSRWAGNSSFSREREASGEDGDRR"
     gene            818197..822488
                     /locus_tag="THITE_2111516"
                     /db_xref="GeneID:11520630"
     mRNA            join(818197..818564,818631..819036,819108..819701,
                     819751..820218,820304..822488)
                     /locus_tag="THITE_2111516"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651307.1"
                     /db_xref="GeneID:11520630"
     CDS             join(818483..818564,818631..819036,819108..819701,
                     819751..820218,820304..821918)
                     /locus_tag="THITE_2111516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651355.1"
                     /db_xref="GeneID:11520630"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="JGIDB:Thite2_2111516"
                     /translation="MAPDATAAAPSPSPGSPAPDAATAKKNEQKEKAKADKAAKFAAK
                     QAKLKQQQQPVQKAAAQSTPKTQTPSLPPYVDETPHGEKKILQPFDHPHFQAYNPKAV
                     ESAWYAWWEKSGFFQPRPPRSPDAGRFVIPLPPPNVTGALHCGHALANSLQDTLIRWY
                     RMKGYSTLWVPGCDHAGISTQSVVEKMLWKKQRKTRLELGREEFTKLVWEWKGEYHER
                     INNAQRLMGGSMDWSREAFTMDENLSAATMETFCRLHDEGYIYRSNRLVNWCTHLRTA
                     LSSLEVENKEISGRTMLEVPGYDRKIEFGVLTYFKYPIDGTDLTIEVATTRPETMLGD
                     SGIAVSPGDPRYAHLVGKFARHPFTDRLLPIVEDSYVDPEFGTGAVKLTPAHDFNDYK
                     LGERHNLEFINILNEDGTLNENAGPMFQGQKRFHARYTVVEELTKRGLFVKKEPNPMT
                     IPLCEKTKDVIEPYMTPQWWVRMKEMADAALKVVEEGKIKISPESARKSYDRWLSNIN
                     DWCISRQLWWGHRIPAYRVIFENEEGPETNDSQWVVGRTPEEAQARAEAKYAGKKFRL
                     EQDPDCLDTWFSSGLWPMSILGWPNTESSDFKNFFPTSMLETGWDILFFWVSRMIMLS
                     LKLTGEVPFTEVYCHSLIRDSEGRKMSKSLGNVIDPLDIINGIELEALHAKLLTGNLK
                     EDEVERATKYQKTAFPGGIPECGADALRFTLLSYTTGGGDINFDIKVMHAYRRFCNKV
                     WQASKYVLSKLPEDFVPSSKLDTSALSVPERWILHRMNAAVKGINEALEARQFSTSTK
                     LAYQFFYDELCDVFIENSKGILSDGTPQEQQSVQQTLYRTLDVALRLMHPFMPFITEE
                     LWQRLPRAKDDAVPSIMLAPYPEPDDALAFASDAEDYELGLQCAGGIRSLAADYNIRS
                     DGRAFIKASTAASLEKVSAQLQAIKTLSGKGIAEVSIIGPDAEESSSPKGCAVYVISA
                     DVAVLLQVSTQIKDIDAEIKKINAKLQKTNIAIAKQQELMGREGFEKASDVVVTAEKK
                     KLADAQAAKENYERTLAEFSKLKV"
     gene            <822948..>823911
                     /locus_tag="THITE_2086510"
                     /db_xref="GeneID:11520631"
     mRNA            join(<822948..823092,823387..823414,823476..823511,
                     823625..823695,823763..>823911)
                     /locus_tag="THITE_2086510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651308.1"
                     /db_xref="GeneID:11520631"
     CDS             join(822948..823092,823387..823414,823476..823511,
                     823625..823695,823763..823911)
                     /locus_tag="THITE_2086510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651356.1"
                     /db_xref="GeneID:11520631"
                     /db_xref="InterPro:IPR001569"
                     /db_xref="JGIDB:Thite2_2086510"
                     /translation="MRLTCGWKFSAALTEANRWGHTFPKFRDLGPEFENLNTTTRPLA
                     DDDAAKGTSSFGKRHTKTHGLCKRCGRRAFHNQKKVCASCGYPAAKTRKYNWSEKAKR
                     RKVTGTGRMRYLSTVSRRFKNGFRTGVPKGSRGPAISTAS"
     gene            complement(824101..825625)
                     /locus_tag="THITE_2111529"
                     /db_xref="GeneID:11520632"
     mRNA            complement(join(824101..824556,824614..825625))
                     /locus_tag="THITE_2111529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651309.1"
                     /db_xref="GeneID:11520632"
     CDS             complement(join(824278..824556,824614..825384))
                     /locus_tag="THITE_2111529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651357.1"
                     /db_xref="GeneID:11520632"
                     /db_xref="JGIDB:Thite2_2111529"
                     /translation="MTSRIPHLLEPYLALPDEASLIVLTGVLGASTNWLVLRHLYALL
                     KQAGTAKPPQPGVTVTGASPAAAAGQEEEAAVLLVSFLRDLAFWRDGLARLGVDLEAA
                     ARRGRFAYVDGLGGGLGGGGSLKSGEATGGGGGGGGGGSTQAIRPHHQSQSQHQSRQQ
                     QQQQQQQRAGVAGWKRVPASLAPGDIARVVLEGVAQLKKGGSAGTGLGDREGRERKVV
                     LVIDGLDFVLAASPPPSSAGGEPSGIATAVWEMLMDLRENTHAAIVTVAADDPLIKEQ
                     QTSLEKQHAWFALSLVHEADAVLSLRLLDTGVAKDVSGVIRITHGGGRLLARDQEYLY
                     HVGGDGGVKVFERGQ"
     gene            complement(825626..828414)
                     /locus_tag="THITE_2111531"
                     /db_xref="GeneID:11520633"
     mRNA            complement(join(825626..827215,827277..827976,
                     828049..828414))
                     /locus_tag="THITE_2111531"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651310.1"
                     /db_xref="GeneID:11520633"
     CDS             complement(join(825868..827215,827277..827976,
                     828049..828199))
                     /locus_tag="THITE_2111531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651358.1"
                     /db_xref="GeneID:11520633"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2111531"
                     /translation="MGQDTQDPSPSRLWRSFGARKSRGERDAEKSGPPKWTMGILEDK
                     ETIEVPGSVLLLAADHNEPLGLRNAPARTSHSSIPTGIHRQLPEDAEEVPKKKTPDGK
                     IILEPQPEESANDPLNWPAWRRDLALLSLGLFCMVGGGTTPLLAAGFTDVAKEYGVDV
                     HSVSLTTGLYMMGMGLGSIIFSPTAILWGKRPVYLFGAIVFIATSVWCAASPNFPSLV
                     LARIFQGIAVSPVECLPSATIAEIFFLHERAFRIGIYTLLLLGGKNLVPLVSAVIIQN
                     MGWRWVFWTVAIVVAFCGLLLFFFVPETFWDRAPVPRTAKKSHSRPGIFRRLSSRPDV
                     PHAAPLPAARPSMEVAGDGPVSPGGRTKALRVGFAPDAETDVVKHVDTSSESSGNSEA
                     DHVLEKETDAGKPVPSGDRPTPGQEYSPQTTSQPPTPAPPTPATPHALEIPPADAISN
                     HGGHIDTDSESQSVRSSRTGGPLPYTAALREQPPRSFVQSLKPFNGRLNKDKWHKVVV
                     RPLILFSYPAVLWSAVVYSCSVGWLIVISESVAVIYREQIYDFNALQTGLIYISPFVG
                     GILGSAIAGRVSDTIVKAMARRNGGLYEPEFRLVMAIPIAITTVIGLMGFGWSAQVHD
                     HWMVPTAFFGIVSFGCTMGSTTSITFCVDSYRQYAGEALVTLNFSKNVLHGLVFSLFV
                     TGWITDDGSKIVYIWIGVIQLILLIFTIPMYIFGKRLRMWTVRRNFMERF"
     gene            836554..837573
                     /locus_tag="THITE_2111533"
                     /db_xref="GeneID:11520634"
     mRNA            join(836554..836945,837048..837573)
                     /locus_tag="THITE_2111533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651311.1"
                     /db_xref="GeneID:11520634"
     CDS             join(836785..836945,837048..837483)
                     /locus_tag="THITE_2111533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651359.1"
                     /db_xref="GeneID:11520634"
                     /db_xref="JGIDB:Thite2_2111533"
                     /translation="MQLLSSRLAHAERRLLASKPIIKSKPVINRGQPAARLQFSTSRQ
                     AQAPNQVYASVRNPDQFHTYQLLSSSSRTPLLTLWTTSWCSTCRVVAPLVRELVESGV
                     GEAEGGVGYCTVEFDAPDVMAAGLGLTYMINSVPTLLSFDAGEAQVQTKVTDGRQLAD
                     RKFLEEWIKNEARRHGNRGGGGPGGGANLLGSLFGKLR"
     gene            complement(<838580..>839527)
                     /locus_tag="THITE_2127275"
                     /db_xref="GeneID:11520635"
     mRNA            complement(<838580..>839527)
                     /locus_tag="THITE_2127275"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651312.1"
                     /db_xref="GeneID:11520635"
     CDS             complement(838580..839527)
                     /locus_tag="THITE_2127275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651360.1"
                     /db_xref="GeneID:11520635"
                     /db_xref="JGIDB:Thite2_2127275"
                     /translation="MRRANQPAKAYRALEEPQSTPGHEYTILKISEPIYSAVSSSHEK
                     DNNNNRNNNDKNKNNGTAENAASRTSDVSTASLDAPTPASLEADLAHYKELFAKLRFS
                     YVEQVTKEKFIRAIIGDPPLIVSPQENAELEASNAAAKAALKALKAEVAAMVADLESR
                     GRDLARRYEEVRAGAALAAELPGKIAALEEKVAALRAAQQLQLRLGGAEDARPEMNLP
                     LGKTLALVEERRRELARVERQLEVLGGQVPRKRKEVERLRAEVAALENRKANSAAAAR
                     EAKRRRENAQGGVEDELEARGRWYRASGMALRQILDLQE"
     gene            complement(840131..843789)
                     /locus_tag="THITE_2111536"
                     /db_xref="GeneID:11520636"
     mRNA            complement(840131..843789)
                     /locus_tag="THITE_2111536"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651313.1"
                     /db_xref="GeneID:11520636"
     CDS             complement(840216..843686)
                     /locus_tag="THITE_2111536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651361.1"
                     /db_xref="GeneID:11520636"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR013129"
                     /db_xref="JGIDB:Thite2_2111536"
                     /translation="MDALQLKVDSIRGEVGEISSALRAYLDHGIASGRKVQPPKTKAG
                     RDLLQHLLGRLDQASTGLADVHNRVSHTSQSPPAIYGPGTPPSIHPVAGAQQIAAPAT
                     EPAGRPNAQTDSASREDPPSSVPAAADAEPEPEPPTHGPEAPSAAIASRVLAPQDARE
                     IRLSNGSVYQAPLLSEHAAPLFDCTYQDIRVLNEELFELYSSHPVVRDRGYFKLQVRD
                     LPPLNVQKVARPTKDHATSFTYKADHLGLVKVDTGKRFKFAPPNLPLPVSAKTDWSLQ
                     EQQYLWNSSAADPPKGTWPYIIGNPLFDDVELSPGEKLRRRGRTILEGINTQYVYFNL
                     TGKTLTTMHREDAHVRSENLLRSGQHKFWCFVKPVHSRKLEERLAYEYPEMRRCSQAV
                     RHLSRHIPPAKLDEWGIEYTLDYCVPGQAVVTEPGTYHQVLNLGPNYAIAINMEYNSS
                     PDMPLDYRFCDKHCPDKFAMSADDFRIYDEPPPRPGQEDHVPRTPETTGSQEGPAAVP
                     SAAAPLRDAATGSLLTPTTPPPEPTVLDKDEPVIAQPVRPESRLQVPAVSGRQEQQAC
                     AESSLRAEAPQGSLLEVNTNTLPLPPVQSPYLIPSNLTSEGSVPSKPVPVGQFNLPPQ
                     QLNWVPVCQPSESQSKPLESRPPEPPPGLLQAAAAGPIQGRNLTVPATNGFPQSVAQS
                     AQIVSPIHPIIPPEPDLRPCIRSSSETLPPIRKTARMINPDREPDTPTEGPSKKQKLE
                     LATTQFAQVSPVGGAFEHLSALLRGRQSSRPGSSVAEKLRGKPAFERLSRLVREWRQY
                     TKSRPIVLGGFELVKTADDTLHSHPELHTFLSRLLKMQAAMFVGAATADSGDDSAEVS
                     MNRLLQLLKWAETERHRLHDYLREGRCWRTICGGYDGLLCLLPPDLDCFDLALFKDDL
                     AAFHSELNADFVLRLCAVGSALQKSIWECLELPEFIWESTTTTWLPEDDIAPLLAPFR
                     LLKSNFFDENSGFAWPRPPRWPWHWPVDPSVVMPGDRPCNFCTRKSCRCIEITVPQVP
                     RISDDGSKGPGIRSLGTHRANEVLGELVGELVPLGARAGDWTMALRRPDLDDEAVAEI
                     YPRRMGNWVRKVNHSANPSAAFRMMKISGRWRQMLVAIRDIGDGEEITAKYGKGFFKR
                     QPYSVVEGLH"
     gene            845469..845741
                     /locus_tag="THITE_2111538"
                     /db_xref="GeneID:11520637"
     mRNA            845469..845741
                     /locus_tag="THITE_2111538"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651314.1"
                     /db_xref="GeneID:11520637"
     CDS             845490..845735
                     /locus_tag="THITE_2111538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651362.1"
                     /db_xref="GeneID:11520637"
                     /db_xref="JGIDB:Thite2_2111538"
                     /translation="MDSRFSEDYDPASDVQLELAETGDWDEALEAYRDRQKWKQQGAA
                     RLRAAGFTDAQIRQWEKGGEKDIDDVRWSGAGEKREW"
     gene            complement(846095..847515)
                     /locus_tag="THITE_2064529"
                     /db_xref="GeneID:11520638"
     mRNA            complement(join(846095..847230,847304..847515))
                     /locus_tag="THITE_2064529"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651315.1"
                     /db_xref="GeneID:11520638"
     CDS             complement(join(846482..847230,847304..847382))
                     /locus_tag="THITE_2064529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651363.1"
                     /db_xref="GeneID:11520638"
                     /db_xref="InterPro:IPR013857"
                     /db_xref="JGIDB:Thite2_2064529"
                     /translation="MQATRPLLYKGFIGRSVDEFKRLSHIVFSLEGIKGAQGPYELHS
                     FRSPGSVHDCKVMSDVEIGGVSKANLDWVPSPPPSSGMQPPSPHSPGYARFHGSISTE
                     LPKDRPEIKRTGYAAFRTRDRPPTVFGRSLWNIDPYVYLALRVKSDGRSYFVNVQTDS
                     VVPTDLHQHRLFVKKPGEWETVLIKWNDFVRTNLGLVVEPQTEILRQKVKSIGIGLTD
                     RIPGPFELCIERMWATNDESEADSVVGLSTSSSDKATAAKEGELKTKQGQKIAWGSK"
     gene            <850654..>853281
                     /locus_tag="THITE_2086518"
                     /db_xref="GeneID:11520639"
     mRNA            join(<850654..850756,851057..851105,851165..851248,
                     851308..851622,851686..851827,851883..851973,
                     852044..852231,852297..852528,852591..852664,
                     852748..>853281)
                     /locus_tag="THITE_2086518"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651316.1"
                     /db_xref="GeneID:11520639"
     CDS             join(850654..850756,851057..851105,851165..851248,
                     851308..851622,851686..851827,851883..851973,
                     852044..852231,852297..852528,852591..852664,
                     852748..853281)
                     /locus_tag="THITE_2086518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651364.1"
                     /db_xref="GeneID:11520639"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2086518"
                     /translation="MSAMLRAHKAGKNRRTRSFSLSDESSIASFDSDDVSGATAFTMN
                     DSHPRVRFSSSITRDFGRMSFASSAASGGSDRDDTSSVFQLGKKPSGDVFTDSPVKTA
                     LKIDEDKFKTPVRIPTAENKANGSPIKDTEGRRHQRSVTTGGAMVLSGSGNRTLRSSS
                     SRHKIGGIDAQGIYPPSACVFIANLPESKDDRALEAAVTREFSRYGTVFVKIRREMRG
                     ANCGMPYAFAQFTNDDDAKAAVEMGRGTLIFGRPCRTEMVKANRVFVVYSRDGLEIST
                     DTVMKMLEPYGELSKCEYLSDEMQATLNLPSAVLVEFAKFDPKRDLNSAVRQYDRFCI
                     DAFDLKKNTFVSRANADEEFLRKYDVDRRSVFVGNVSVDSEKEEIADFFSAVGKVLEV
                     TLIKRANHHGVLTRAFAFVEFARADTPDHAIKHLSGSVLRGSVLKVERKAFKHVGTPR
                     RVKSQAFSIKTTTTPKTPRTDAPTASGSVRYSAKKETPVRASGQEFNLPDSGQAFVPF
                     PFPPLASPVPPADGKPLLGASGLPVTPVNTTPFAPNPFTYAGGYWPGMSIAQDPITGH
                     TFWAYTPPVGANTTDEQDAEPPSPTRSSARKHYRGGH"
     gene            854437..857202
                     /locus_tag="THITE_2111546"
                     /db_xref="GeneID:11520640"
     mRNA            join(854437..854650,854726..854805,854927..854959,
                     855503..855847,855918..856129,856201..857202)
                     /locus_tag="THITE_2111546"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651317.1"
                     /db_xref="GeneID:11520640"
     CDS             join(854589..854650,854726..854805,854927..854959,
                     855503..855847,855918..856129,856201..857085)
                     /locus_tag="THITE_2111546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651365.1"
                     /db_xref="GeneID:11520640"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="JGIDB:Thite2_2111546"
                     /translation="MGQPSFQASNAIIYVTYGLFLLVGTGVAWKFKSQSKSEFLAGNR
                     TQTALPLALNFIASALGSGILFAYPQLATLAGVQGVVVYALSSALPLLIFAALGPIIR
                     RKCPEGFVLTEWTRQRYGTFAALYLSFMTLVTLFLYMVSELSAIGQVVNLLTGLDGLP
                     VLIVECIVTTVYTSMGGFKISFFTDNIQGAMVLGLILIATITIGVETKIDTSLIDSSG
                     LTKASLLGWQLLYILPVAILTNDFFLSNFWLRTFASKTDRDLWLGISGAVVGTLIIVT
                     LVGATGLVAAWAGIWPGPADDPVDGSVAFFALLEQLPSWVVGIVLVMSVTLSTAAFDS
                     LQSAMVTSASNDLFRNRLNIWLIRAGVVLVMIPVVVIAIRAPSILQIYLISDLVSAAS
                     IPVLMIGLCDACYWWRGFEVVVGGLGGLFTVFLFGTVYYGNAQLGAELMLLEQGLYTA
                     DWGAFGAFVAAPVGGLLWGFGALGLRLGIQYIRARAKGERFDALDRPLATGGPRPVVD
                     PEVGGNAGFGEESEISSDAPGLAKTTGKFF"
     gene            complement(857616..859125)
                     /locus_tag="THITE_107795"
                     /db_xref="GeneID:11520641"
     mRNA            complement(join(857616..858573,858660..859125))
                     /locus_tag="THITE_107795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651318.1"
                     /db_xref="GeneID:11520641"
     CDS             complement(join(857909..858573,858660..858666))
                     /locus_tag="THITE_107795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651366.1"
                     /db_xref="GeneID:11520641"
                     /db_xref="JGIDB:Thite2_107795"
                     /translation="MPGTFVLPPLSQFPRPLGQKFRLLGYWIVIKGQETITNAFHRFM
                     SKPTLFSRARFKPKRSTLIPTAKALHRAMAEALASGDKDTINKVCGRRLASQLLASID
                     ARPRGRRYGWELVGYTNKLFYPSVKSHKISPVSRERHAPIIQQAVVAISSRQRRVEYD
                     AHGQVVPGSEKEIEVVENVAISCMVDTRTWTQGEWRVVGSVRPTTLEGWKAEAELLKT
                     TMLQQ"
     gene            <859119..>860621
                     /locus_tag="THITE_120035"
                     /db_xref="GeneID:11520642"
     mRNA            join(<859119..859197,859659..859987,860086..860289,
                     860376..>860621)
                     /locus_tag="THITE_120035"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651319.1"
                     /db_xref="GeneID:11520642"
     CDS             join(859119..859197,859659..859987,860086..860289,
                     860376..860621)
                     /locus_tag="THITE_120035"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651367.1"
                     /db_xref="GeneID:11520642"
                     /db_xref="JGIDB:Thite2_120035"
                     /translation="MCGTPDAVGLKIDGLSMGRPKFAGPAGADPDHAGAGPVRSTLLQ
                     PRVAVALGVSKKWYPLLFLCRLASIAPGALFGLPNVLRLLTTLHLMYLDRVLDGGTLS
                     KLGRGGGGSSPTSGYDAAFEARLRLTETLLATIWCCASGYLSFFFTDCLMSRWLLHYT
                     PQATIVRLLTVDAINGYLTSWVLQLTGGFDDPRLILPAWIVISTTLTVLYHITQRKIN
                     IRKETSMSISVFSIASFVSMVALLAQLHSNRTDYPDIPLLNFVRRAFHEAEKLAMRIM
                     EYGDITREL"
     gene            complement(860765..862140)
                     /locus_tag="THITE_126353"
                     /db_xref="GeneID:11520643"
     mRNA            complement(join(860765..861169,861232..861374,
                     861432..861524,861627..861701,861921..862140))
                     /locus_tag="THITE_126353"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651320.1"
                     /db_xref="GeneID:11520643"
     CDS             complement(join(861155..861169,861232..861374,
                     861432..861524,861627..861701,861921..861960))
                     /locus_tag="THITE_126353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651368.1"
                     /db_xref="GeneID:11520643"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="JGIDB:Thite2_126353"
                     /translation="MSGEIEIQNLKSRDPFAEADEDSGQTTQTQEYIHIRIQQRNGRK
                     TLTTVQGIPAKFDHKKILKVIKKEFACNGTIISDTESKGLGEVIQLQGDHRIKIRDFL
                     INEETGLGLDEKTIKIHGF"
     gene            862343..864707
                     /locus_tag="THITE_2111556"
                     /db_xref="GeneID:11520644"
     mRNA            join(862343..862426,862487..864707)
                     /locus_tag="THITE_2111556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651321.1"
                     /db_xref="GeneID:11520644"
     CDS             862855..864384
                     /locus_tag="THITE_2111556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651369.1"
                     /db_xref="GeneID:11520644"
                     /db_xref="InterPro:IPR011671"
                     /db_xref="JGIDB:Thite2_2111556"
                     /translation="MTTFKPQELAADAKPIILTEDTKCNGDAASWRPLFRHPCSFNPD
                     IFNDVLVNLIRNPNINSSWLFRADILSDAAASQTCSAPTGTESLPAAPIPRFVGFELR
                     RCIIRKLIPRNTLRDKPLDQTCLIYGTAPHPKVDEGSVEKTLVVYLPHVSAASEMPFY
                     HPIVRGIAFLHEWNAAESCGAISISYLFFSDEDRSSVRLTRTAFHLLEVVHKHGKGRL
                     EGYRKRVHHDQLLPQARVQNTYTRLKQKYARGLIEGWVETTDPEKHVFEDLCIAAFLI
                     ELWADMYGQGTFPGFVDIGCGNGLLVHILNQEGFTGWGFDARSRKSWAAYNTKLKTPA
                     GEQDTLRQLVLLPPPVSRDRLTGGASDHAFSEELVHDGRFPRGTFIISNHADELTPWT
                     PIIAAVSECPFIAIPCCSHNLAGERFRAPAPKDKTKADSAYSSLVVWVAAIAEDCGWE
                     VEQEMLRIPSTRNTALVGRRRSTRSSPLDIQAVVDRYGGAAGYLESVIKLVASTAANE
                     H"
     gene            complement(864708..865901)
                     /locus_tag="THITE_2111558"
                     /db_xref="GeneID:11520645"
     mRNA            complement(864708..865901)
                     /locus_tag="THITE_2111558"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651322.1"
                     /db_xref="GeneID:11520645"
     CDS             complement(864780..865121)
                     /locus_tag="THITE_2111558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651370.1"
                     /db_xref="GeneID:11520645"
                     /db_xref="InterPro:IPR000627"
                     /db_xref="JGIDB:Thite2_2111558"
                     /translation="MTSDPEGEPMLAICTVKDTQGNPIAGVTIDIWETDSSGHYDVQH
                     ADRTAPSERCVMVSDEQGRFWFKGIKPVSYPIPHDGPVGKLLQLLNRHCWRPAHVHFM
                     FGKEGWDRLIT"
     gene            complement(865902..866523)
                     /locus_tag="THITE_2111559"
                     /db_xref="GeneID:11520646"
     mRNA            complement(865902..866523)
                     /locus_tag="THITE_2111559"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651323.1"
                     /db_xref="GeneID:11520646"
     CDS             complement(866151..866456)
                     /locus_tag="THITE_2111559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651371.1"
                     /db_xref="GeneID:11520646"
                     /db_xref="JGIDB:Thite2_2111559"
                     /translation="MAPLHLAGFNIRQADASRRGQSQRTCIAREESGPSGSAVEFQRA
                     KQGVRHSTRCPAAIPPRLQLPNPSFPKPHHGRRDFTRPLLTGSSSPNHFVKSERGDG"
     gene            complement(866525..869672)
                     /locus_tag="THITE_2111560"
                     /db_xref="GeneID:11520647"
     mRNA            complement(join(866525..869053,869104..869158,
                     869221..869241,869293..869672))
                     /locus_tag="THITE_2111560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651324.1"
                     /db_xref="GeneID:11520647"
     CDS             complement(join(866746..869053,869104..869158,
                     869221..869241,869293..869500))
                     /locus_tag="THITE_2111560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651372.1"
                     /db_xref="GeneID:11520647"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="JGIDB:Thite2_2111560"
                     /translation="MPIPGFNVGMNGLTGNRYAPALYSGDFGNCLAGQSPFTITELDI
                     LYDAGNKTLVFHVNGTSAFEDEPLLVHLSIDAYGSRRFDATVDPCSSNITSLCPPKLS
                     VPITARGVLPVGDDLSVDELPNAVFQAADFEGSARLQIYARTSGTELGCFQAALTNGK
                     TLSHPVIIAPILGAFTLIAIAASFITAAYGVSIPHMRMHHAHSLPVFVVFETFQAIFF
                     SGALEVSWPSVLTAWWSNFAWSAGLIYSHAMFRSIDIFAGVTSNASQIGDLSSLETNT
                     GNGSGSRLFAPSTVQETSQSVGQGTYNSSFLTDYTWSRGPVAPGMPLPGTWSGFPSVL
                     SAVDIPIVDAFMVGLVWLLIAIGLVALTVGSLKISLDGLARAGRMKEDRLAYFRSHWA
                     GYLGHAMLRTLVIAFFPVMTLAMLQFTIRVSAGAIAVAAVVFVVVLVGILSLVASACR
                     ARTRDGKTVIVPDRIVFYRGAIRPSFRRIGVVWDSTLRKHALDVRPLLSVPLFRIRHD
                     NTDPDRPTVHMDKPFIKKFGSFSARYRRTRWWYLAYHVGYLFCRAAFLGAGWQSPRAQ
                     VSGVLVTDVVNFGIGIILNPFEGARNTAMAVWMLGVCKIITTALSIAFLPELDLARST
                     AATLGLVIIAVQGLTVAALLVLIVLSAVSSCMSLTRNREEIHPDWLEPARVRYFEKME
                     KRARDARFEEETPEPAPPTPRFSVISVRRKPKIEDEDEGDEGDDATGTGQPPARGRDR
                     HSRTSSAGLRLSTGSLPRTARPYRASWSSRDFGDPSLSRPSSVVAQRLSGATCVVVTD
                     CDASNNSSVALVRPQSSLWSLNTPSASRASSPSPVRLSRETVMTTADGRRPPTALPED
                     PEPQDQI"
     gene            complement(871834..874812)
                     /locus_tag="THITE_2111563"
                     /db_xref="GeneID:11520648"
     mRNA            complement(871834..874812)
                     /locus_tag="THITE_2111563"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651325.1"
                     /db_xref="GeneID:11520648"
     CDS             complement(871963..874725)
                     /locus_tag="THITE_2111563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651373.1"
                     /db_xref="GeneID:11520648"
                     /db_xref="JGIDB:Thite2_2111563"
                     /translation="MPSSKDRDADGVDDRPREKPHRSKSERKDKDRDRERDKDKDRKR
                     ERDRDRDRDRDRDADRDKDSHLSSFQRHHSHRSSRSSKLKATDSEAHSRPHRRHKPRD
                     MDGDELDGRPAGTRSLTDLVPELARGLESERGSIPYPSFSKAHSKEFLHSKEDVSSPA
                     TRRTDPLTPDTTDLGGSEMRRSKSADSPGAARKTSTARQDARQDDRPPSPPETDLSAQ
                     KKQGSETPGSVKEAGLPDTRPSSRGSWVSRSTSKHESKSRISKTSSQATFVMRPAASV
                     RAARAGDSQTAKSEITNASTVEQGSTATALPRRSVSAAKHSPVDAADSSPESAIDVSP
                     KTPTHAPDFPPPPVIAEEKHHYSTSDVPTPSATPAFTPAPPPPPPPPPPPPAFNLQEV
                     PRVDYLLQNGGLPHPVPRSFLSVLPRQNGTRPSNPPLQGAEILFAPFFDLLRQYQTVL
                     SGHGSIAVATGHRTVARRLLDRLENVFSRDLSPDGCPCIMCERSGEPHRGLGWGEVLE
                     RVSGRIALPPWPPFDFSLLSSKAVEELADVPPRPSSPVKMDPDIAEEFREHYLRQTKR
                     VRAAVDKWMTNCEKTAAPPPQDIDDETLAFAILTNLEYEDRPYFNALLAGSRELQSAV
                     RAPTPLRSPRNDFMVKSGLSLQRLYRLQQAPRDAETAVYLVKNPGTHDLLYTISDISA
                     SEWEILTSGRFDGFLWSGAEDDGIAFGEGPSRLATPASGMYPASRIMSPAAAGGRGLG
                     GPPMSRTTTPFGPFMRGQTPASFVSGMSAASSSYPVRAAVTNDEEAEVAALAELEREI
                     FNGMEALEDAFEKLHEQAMAVRDGLRRRGAALQMSLQQRRGGVGAGRGIDVLPLSGSS
                     GTYDRPAWADEESIDGADSEWGGDDISELAPDDSASQVSSNRLRRPKRRRERATPAPI
                     EEEDEQ"
     gene            complement(875492..878486)
                     /locus_tag="THITE_2111564"
                     /db_xref="GeneID:11520649"
     mRNA            complement(join(875492..877064,877155..877300,
                     877400..877582,877653..877680,877838..878486))
                     /locus_tag="THITE_2111564"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651326.1"
                     /db_xref="GeneID:11520649"
     CDS             complement(join(875869..877064,877155..877300,
                     877400..877582,877653..877680,877838..878006))
                     /locus_tag="THITE_2111564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651374.1"
                     /db_xref="GeneID:11520649"
                     /db_xref="InterPro:IPR002650"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="JGIDB:Thite2_2111564"
                     /translation="MANPPHGGVLKDLLARDLPRQAELAAEAETLPALVLTERQLCDL
                     ELLLNGGFSPLEGFMNEQDYNGVVKENRLASGLLFSMPITLDVAQETIDELSLKAGAR
                     ITLRDFRDDRNLAILTVEDVYKPDKAVEAKEVFGGDEDHPAVRYLFNTAKDFYVGGKL
                     EAVNKLQHYDFVELRYTPAELRAHFDKLGWTKVVAFQTRNPMHRAHRELTVRAARSHH
                     ANVLIHPVVGLTKPGDIDHFTRVRVYKALLPRYPNGMAVLGLLPLAMRMGGPREAIWH
                     AIIRKNHGATHFIVGRDHAGPGKNSKGVDFYGPYDAQHAVEKYRDELGIEVVPFQMMT
                     YLPDRDEYAPVDQIPPGVRTLNISGTELRARLRSGREIPEWFSYPEVVKVLRESHPPR
                     SKQGFTVFLTGYMNSGKDQIARALQVTLNQQGGRSVSMLLGETVRHELSSELGFSRED
                     RDKNIARIAFVASELTRSGAAVIAAPIAPFEQARQHARELVEKYGDFYLVHVATPLEY
                     CEKTDKRGIYRKARAGEIKGFTGVDDPYEPPVKPDLVVDCEKQSVRSIVHQIVLLLEG
                     QGLLDRF"
     gene            881927..882582
                     /locus_tag="THITE_2111570"
                     /db_xref="GeneID:11520650"
     mRNA            881927..882582
                     /locus_tag="THITE_2111570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651327.1"
                     /db_xref="GeneID:11520650"
     CDS             882240..882413
                     /locus_tag="THITE_2111570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651375.1"
                     /db_xref="GeneID:11520650"
                     /db_xref="JGIDB:Thite2_2111570"
                     /translation="MEEARILSELVIERRATGLEALSKNSISPPYVEDTDSTEEEDDD
                     DDEEEGKIKEKEA"
     gene            complement(884844..886428)
                     /locus_tag="THITE_2111573"
                     /db_xref="GeneID:11520651"
     mRNA            complement(join(884844..884965,885143..885216,
                     885279..885310,885366..885398,885465..885897,
                     885973..886048,886202..886428))
                     /locus_tag="THITE_2111573"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651328.1"
                     /db_xref="GeneID:11520651"
     CDS             complement(join(884884..884965,885143..885216,
                     885279..885310,885366..885398,885465..885897,
                     885973..886048,886202..886239))
                     /locus_tag="THITE_2111573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651376.1"
                     /db_xref="GeneID:11520651"
                     /db_xref="JGIDB:Thite2_2111573"
                     /translation="MASHIVNKAQEAAREDYGQAKRLLNEAARSRSYLYPIKGVAYFL
                     SHPALWKPLRSKLVPYLTLYSGVLGSMFFFTYLPQLAVMAFVNGPLAVLTTALLILNE
                     SSTITSLISKNYLLQDALLDTFDGTLVARDATGIVAEGRELNTRGDSIQRLGKVIKKP
                     FSGLSLNDLVRYVMYLPLNFVPVVGTVAFILLRGRSRGDSVHDRYFQLKGWPASRRSK
                     WLEDHKGPYTAFGTVATLLEMVPLASILFSFTNTGKF"
     gene            complement(886830..889065)
                     /locus_tag="THITE_2111578"
                     /db_xref="GeneID:11520652"
     mRNA            complement(join(886830..887044,887113..888007,
                     888073..889065))
                     /locus_tag="THITE_2111578"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651329.1"
                     /db_xref="GeneID:11520652"
     CDS             complement(join(886974..887044,887113..888007,
                     888073..888621))
                     /locus_tag="THITE_2111578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651377.1"
                     /db_xref="GeneID:11520652"
                     /db_xref="InterPro:IPR001727"
                     /db_xref="JGIDB:Thite2_2111578"
                     /translation="MRLRNRKSPLLFLLLPSLAIAAALADKQLDRDSASIADRVPPAR
                     RYGTKDAPVDGKDGKPHDGPFVEIDADAESAKNLPPLKDRPADPLVVDGKRIPESHDG
                     VMDDKNRPGPKKGTTGTEGGVSEKEKDRKLKEKQTGEKAENKPPTPKEAPPLPHSEQE
                     RIQAGDSEGQYEDKTASGASGLEKPADLPDKTHGTSPPVPESVAKIDHLDVSNGEKPL
                     KSEESAEEGNEGLIQPFHSFILSFTMIIFSEIGDKTFLVAALMAMKHDRVVVFTAAFG
                     ALITMTVLSAVLGHAVPTLIPKRVTTFLAALLFLVFGARLLREGLAMSPDEGVSAEMQ
                     EVEMELEEKESLARREGRAGSGVSPYALEMGLGSRKSRSKSRFPAPARSPSSSPEGRS
                     PSPRPGALMGFVSGLNNLLSLLLSPAWVQTFAMTFLGEWGDRSQIATIAMAAGQDYWW
                     VTLGAVLGHACCTGVAVIGGRAIAGKVSLKVVTVGGAVAFLFFGFIYLFEAFYS"
     gene            889392..892432
                     /locus_tag="THITE_2111580"
                     /db_xref="GeneID:11520653"
     mRNA            join(889392..890018,890087..891164,891221..891949,
                     892060..892432)
                     /locus_tag="THITE_2111580"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651330.1"
                     /db_xref="GeneID:11520653"
     CDS             join(889649..890018,890087..891164,891221..891949,
                     892060..892267)
                     /locus_tag="THITE_2111580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651378.1"
                     /db_xref="GeneID:11520653"
                     /db_xref="JGIDB:Thite2_2111580"
                     /translation="MSGRGRARPASRSAPESSAGPGRRSTRHHQQQELQEQAPEEERP
                     AQLEVPMSTPDYHDDIDPAITGPQDGSMPPPPLPSAKGLRGQDGPIVARRGTRRDPQA
                     SSIASVNSMAVTDAFSQAEPQGSASQRTITAHLFGTAGPAASAASSEGDSAPSRNLDR
                     VRRMEQMLPRLFAASENLFSHLCSDQGDAEIWEIDRIGFRGAFAAYLAHYPPVSGNGV
                     GNGNPVIDLARVANDMQIDQASLSWKPIFRTILAANLASLLDDITPIDRQDLLPVLQK
                     WDSHFLDGIVGDDLSNWDVEMKKKIIEQVLMIRIQLSIFTLQSLQRSSHTPFHPYEQI
                     ARIWCTGDVSAEAVESFLGDDQDALQLRPVMRADPADAELEKIARDAATLRFTSLCRM
                     LPNEVVVGFDHDISDIHETTYTIGEFEDGLRGFARLCFAENKAAMQQGPSNGRHASLP
                     FAPSDASSRADSQIRSQLESDALAHQFSQVESSAHPQSFDPEGMAMLKRLGHPGPAGY
                     GDGQLLPPHPQRPAPYPPDIGGAPSVEYTGLSLQGGFPPNGTTYGEAAAQTPGSRKRR
                     APAGPAATGDGAAGSAAPAAKKPRARRRKSDIPVAGAAAALASTATPPSAPTAPAPAA
                     PAPMQPSQYPPLPGSDDEPDLEALAQRTREISAAARKVKQPQVRSAWVRKDVSLLIKA
                     VHAFQCKWSTIEKEIKAGTLKFERNVNQQALRDKARLLKQDFLKADAVLPRGFDLVVL
                     GKKEKEAVIACGKNPFRKEADIDENGRPINTEYNPAAEGAPEVEPQPEAQQEGL"
     gene            892757..896215
                     /locus_tag="THITE_2111582"
                     /db_xref="GeneID:11520654"
     mRNA            join(892757..893009,893113..893423,893501..894815,
                     894871..895695,895781..896215)
                     /locus_tag="THITE_2111582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651331.1"
                     /db_xref="GeneID:11520654"
     CDS             join(892934..893009,893113..893423,893501..894815,
                     894871..895695,895781..896013)
                     /locus_tag="THITE_2111582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651379.1"
                     /db_xref="GeneID:11520654"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR014863"
                     /db_xref="JGIDB:Thite2_2111582"
                     /translation="MSYGKKDEDADSGLVKIDRTQVFQEARLFNSSPIQPRRCRVLLT
                     KIALLLYTGEKFPTTEATTLFFGISKLFQNKDVGLRQMVHLVIKELASSAEDIIMVTS
                     TIMKDTGGSTDSIYRPNAIRALCRIIDATTVQSIERVMKTAIVDKNPSVSSSALVSSY
                     HLLPIARDVVKRWQSETQEAAASTKSSGGFSLGFSSSSGNLPVNNSTMTQYHAIGLLY
                     QMRMHDRMALVKMVQQFGAAGAMKNPAAIVMLVRLAAQLAEEDPQLRKPMMQLLDGWL
                     RHKSEMVNFEAAKAICDMRDVTDDEVTQAVHVLQLFLSSPRAVTKFAALRILHTIASF
                     KPHVVNVCNPDIELLISNSNRSIATFAITTLLKTGNEASVDRLMKQISGFMSEITDEF
                     KITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEFKRAVVESMFDLIKFVPDSKE
                     EALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYIRYIYNRVVLENAIVRAAA
                     VTALAKFGVGQKDPEVKRSVDVLLTRCLDDVDDEVRDRAALNLRLMHEEDELAARFVK
                     NDNMFALPFFEHQLVMYVTSDDKSAFETPFDISKIPVVTREQADAEDRTKKLTATIPS
                     LKPPKVGPTKTAPSSADAAASASAAAQKYAQELMQIPEMNEFGSVLKSSPPVELTEAE
                     TEYVVSVVKHIFKEHIVLQYEIKNTLPATILENVSVMATPSDEEELEEVFIIQAETLQ
                     TDVPGKVYVAFRKVNGGSSLPVCTFSNVLKFTSKEIDPTTNEPEEGGYEDEYEVSDFD
                     LSGSDYVIPTFASNFAHVWEQVGAQPQAEEAEETLQLSGMKSIPEATEQLAKTLSLQP
                     LEGTDVPVNQTTHTLKLLGKTVNGGRVVANVRMAYSSKTGVTTKITVRSEEEGVAALV
                     VASVA"
     gene            896216..898370
                     /locus_tag="THITE_2111584"
                     /db_xref="GeneID:11520655"
     mRNA            join(896216..896669,896757..897268,897362..898370)
                     /locus_tag="THITE_2111584"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651332.1"
                     /db_xref="GeneID:11520655"
     CDS             join(896961..897268,897362..898334)
                     /locus_tag="THITE_2111584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651380.1"
                     /db_xref="GeneID:11520655"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="JGIDB:Thite2_2111584"
                     /translation="MVYVRQEYLPNLRQYKYSGVDHSLLSRYVLKPFYTNVVIKCFPM
                     SMAPNLITLTGFMFVVANFLTLLWYNPSLDQDCPAWVYYSWAVGLFLYQTFDAVDGTQ
                     ARRTHQSGPLGELFDHGVDALNTALEVLLFAGATNMGQSWKTVATLFASLLTFYVQTW
                     DEYHTKTLTLGVINGPVEGILTIVAIYALTGYLGGASFWSRSMLPTLGIPQTVAGVTL
                     PAPVYNLSFTGWYMVQGAVVLVYNTAESARNVIRARRARGDRSRHALVGLLPFFATWA
                     LIVAYLALQPTILRGHLVPFAVFAGIVNAYSVGQMITAHLVKLPFPYWNVMVVPLAWG
                     VIDSVGPLLLLHSPVPWLGWPSALGDGVYQVAFMFCMLGMAVGVYGSFVVDVIVTICD
                     YLDIWCLTIKHPWVEGENGSASLQVKGAAEKKQQ"
     gene            complement(899348..900996)
                     /locus_tag="THITE_2111586"
                     /db_xref="GeneID:11520656"
     mRNA            complement(join(899348..899972,900130..900443,
                     900669..900996))
                     /locus_tag="THITE_2111586"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651333.1"
                     /db_xref="GeneID:11520656"
     CDS             complement(join(899456..899972,900130..900443,
                     900669..900800))
                     /locus_tag="THITE_2111586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651381.1"
                     /db_xref="GeneID:11520656"
                     /db_xref="InterPro:IPR011616"
                     /db_xref="JGIDB:Thite2_2111586"
                     /translation="MDYTHTTYFAGAAPYQFIGAQVPPLTPAHSNSVASDDFNTTSPP
                     DIYDQFPNDIPHDQFQNFDGYVPFNSSQAFPGPPTPPGQHPVHAAAVPPPPPPPVNGL
                     VGSTPEIVPVSKTEPDDQAPSRKQASNSEDDDLTPAQSRRKAQNRAAQRAFRERKERH
                     VKDLESRLQQLEQAQQDAVSENERLKRDLQKMSTENEILRATSMATANAGAPGAAAPT
                     TTGPMSYKPTDFYSNVLQGHANKTPSHRVVTSEKGERLLAAGATWELIVNHELYKRGL
                     VDVAQVSDRLRPQAKCDGQGPVFEESAIIEAIEQSVVENSDELL"
     gene            903981..905908
                     /locus_tag="THITE_2111589"
                     /db_xref="GeneID:11520657"
     mRNA            903981..905908
                     /locus_tag="THITE_2111589"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651334.1"
                     /db_xref="GeneID:11520657"
     CDS             904316..905593
                     /locus_tag="THITE_2111589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651382.1"
                     /db_xref="GeneID:11520657"
                     /db_xref="JGIDB:Thite2_2111589"
                     /translation="MSTVPSIRPGNLPSPVGFGGNDSVASEDSLTSRITVKSLTNLAS
                     YSNPMQKAAQKALARARTANLGVHRAEASSQFLSPGSDVSKDRLPGTYRPTPGAAGPP
                     QPLTAGPPGHRPYKPSSLEAASRIPHLDGQSVQAPLKTTTTTTTSGSQSRSPPMGLPY
                     TIASSVLATIDDDDKVEGTIQPGPFRFDETNHGSLPYNQPELTGYRHPPTEIPSETTA
                     TSVEHAKPKIHDTLPPERIEKYYPRGFPHNYVGRHQPVKEDGYMSFPTMNGQLAQKAC
                     PEQVNRIHQNFYAGSKAFTKKLDSLVGDNNNRCLESKVGIIGEERERLRGSNIEKFGA
                     DGEIQSQFLSVEEANRMNGSDATRPLIELALATLLGYKEASKTGIYQWPCSFIKADDA
                     WVDDSDEGNTSFFSKPKDELKKRRIVKKARRGY"
     gene            complement(906819..909606)
                     /locus_tag="THITE_56897"
                     /db_xref="GeneID:11518591"
     mRNA            complement(join(906819..907515,907573..908995,
                     909053..909606))
                     /locus_tag="THITE_56897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651335.1"
                     /db_xref="GeneID:11518591"
     CDS             complement(join(906981..907515,907573..908995,
                     909053..909239))
                     /locus_tag="THITE_56897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651383.1"
                     /db_xref="GeneID:11518591"
                     /db_xref="InterPro:IPR014850"
                     /db_xref="JGIDB:Thite2_56897"
                     /translation="MLRPATPLSVLLFAAFVLLMLSVLSTPIIRVIPLASWQGVDFGV
                     FGYCDKNGCTSIGIGYDVHDVLGSSNSNDFDLPSSTRSTISSLLIIHPVAAGVTLFMF
                     VLAVVAHFHSPSHSSRYLLLLFIVGILNFLVCLLSFLADVLLFVPHMAWGSYVVLAAT
                     ILVALSGLVSCAMRRTIVGRKARKKRIAENAEMSGENYYKRQAQQTTAPVPVSSTLQP
                     TLPVVSGANGGADTLPEFASFEKKDDRSSDERIPLTSRSPSDRPPGTFTSEPAAAYVN
                     GASSPTDMAPLRSMTNTPNARDQYGNPLPPQDGYPARAPSIERMGSPGRGGLPQGGYR
                     GRGGYPGPGRGGYGGYGPPPGGRGGYGPPGRGGYGPPGGRGGYGPPPRGYGGPIRGGR
                     PPPPPSYPGSQGPYDRRPSPAGPYGPGPYGARRPSPGPPSAPGYVNQSASNVSSGGFD
                     SYNLNQDDLPRAESPPPLPGIDDGVPPGQAVELDATTGSPAHAPRGFGQFNIRDSDSD
                     VAGMLELQQARSSAPDRHMSDTSRYSQDDLRGSYVPPRQAWTQGPGRGSPRVPSPLNT
                     AGRPAELPPHGSPPPQPPVAAAGEYYEDVDPRFAEPPPAQKPTPTPITMADSYEDIPP
                     GSRSPAESERSTFTSISQRGINPRWIPPVPPPPGPSSYGGNMMPRRPVNRSDLLLDSN
                     PDFELPTRGGPSRSAGAMVPDSAYPARALQGD"
     gene            911828..914135
                     /locus_tag="THITE_56894"
                     /db_xref="GeneID:11518592"
     mRNA            join(911828..912496,912542..912594,912669..913186,
                     913316..914135)
                     /locus_tag="THITE_56894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651336.1"
                     /db_xref="GeneID:11518592"
     CDS             join(912113..912496,912542..912594,912669..913186,
                     913316..914016)
                     /locus_tag="THITE_56894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651384.1"
                     /db_xref="GeneID:11518592"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="JGIDB:Thite2_56894"
                     /translation="MGLLVAADYKLNFRPEPLPLVGSAGGIPELHRRSAERLFRLLRE
                     NGGLYLKIGQAIAMQSALLPPEFQRMFARMFDDAPQDPWEAVEQVIREDFGGRSVEDV
                     FGVSFAGVEGKGVMERTARASASVAQIQKPEIAKQIGWDLWAFKVVMKVYTWWFDLPL
                     YSLVPFIAERLMLETDFENEAKNSEIMRQLVNSEPSLRGRVYIPPVYPELSSKRVLTA
                     EWIEGVRLWDRDALTQPWLGGYQNGSMGAHGSQLAPPDMEAIRRELRENPHSQKLKPE
                     RTEWRGRRGKGGLGVSTKDVMTIMVDLFSAQIFKWGVVHCDPHPGNIFIRRLPNGLPE
                     LVLIDHGLYVYMSDKFRHEYGVFWKALMTFDNKKIAEITQKWGIKAADLFASATLMRP
                     YEGGEQQLQKGMLGALDDQKTASQRHFEMQQRMKQGIRDVLADEDKWPKELIFIGRNM
                     RIVQGNNAYMGSPVNRIKMMGEWASRSLFQDRNLPWRQRAINIWQHLLFKAVLFLSDV
                     AFYFFRLKQLLGRGGGMEDEVEARLKTVAKEFGVELQHDVFEG"
     gene            916247..918596
                     /locus_tag="THITE_2111597"
                     /db_xref="GeneID:11518593"
     mRNA            join(916247..916425,916638..917149,917215..918596)
                     /locus_tag="THITE_2111597"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651337.1"
                     /db_xref="GeneID:11518593"
     CDS             join(916740..917149,917215..918310)
                     /locus_tag="THITE_2111597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651385.1"
                     /db_xref="GeneID:11518593"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="JGIDB:Thite2_2111597"
                     /translation="MLLRRSKSSDLKRQQAAKEQELQRQRDAVSKSPPRLPLPVLSPA
                     SQLGLGGDNRPDSLAIVSGRAEQMSGATPRPSMDPPRSVISVPPPPIPNGGFDPYAHT
                     GSMAHRGRYSYASSAISTINSPRRVRRRKDPTPFNILIVGTTNSGKTSFLEFLKTALA
                     LPAKKQSKSTIDPDDLPRVSPSGNFVPHYLETEIDGERVGLTLWDSEGLEKNVVDLQL
                     REMSSFLESKFEETFTEEMKVVRSPGVQDTHIHAVFLILDPSRLDRNIAAAKAAAANG
                     QHNRGRYSPHARILGSLDEDLDLQVLRTLQGKTTVIPVISKADTVSTKHMSVLKRTVA
                     DSLKKANLDPLEALGLDDDDEGSTPDSSRIVEEDEDQASTPGEAEAKDEGEDAPAEGE
                     GSDSPPKSGRLSGGSVRRHKVSEEGAKEEEVPFLPLSILSPDIYEPDVVGRQFPWGFA
                     DPYNEEHCDFVRLKETVFSEWRGELRELSREQWYEGWRTSRLKQQGTKGHR"
     gene            complement(919221..921132)
                     /locus_tag="THITE_2111602"
                     /db_xref="GeneID:11518594"
     mRNA            complement(join(919221..919690,919765..921132))
                     /locus_tag="THITE_2111602"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651338.1"
                     /db_xref="GeneID:11518594"
     CDS             complement(join(919319..919690,919765..920823))
                     /locus_tag="THITE_2111602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651386.1"
                     /db_xref="GeneID:11518594"
                     /db_xref="JGIDB:Thite2_2111602"
                     /translation="MPELLLQSALAASRSTQFATEAAQIRTNCHAQHGDTNSLISCPQ
                     CYEAVLEAFRARYLGFKPRPTAGSPAADQQPQQQQQQQQQNQEQQREWFASRRAFLSD
                     LDDLISSAKEYQVSPQAVDDRVREERSRWYAERVRASLLRLVVEDPSSRAAVFEKLED
                     LSSASALGADPVRLAREVAEILSRGPLAAERGTGDLPGKLAAATDGAGSAEVLRDAFF
                     VAEDGTVPADHQKYLDMLLRQGLSMEQVVDRILEERQAAAGAKEQAAKLSQRLDELRR
                     ARAAHEAQKSRKAQRRESLALQKVPDELYDLPACAVCGGAPSTRDYFCCSICTILADR
                     GIQQRQTLFCSAKCEENGHASHAGTHTCASSSGCIRPHANFPSNPTDDQDTHMDEAPP
                     SPNDLRFCTECLGSLKQPTIWCSLACAEANFRTHREDVHLAERKKRGLEDVDDDVADI
                     RALTTSLSEAVKEWEERNRVRLQPLA"
     gene            complement(921597..923484)
                     /locus_tag="THITE_2111605"
                     /db_xref="GeneID:11518595"
     mRNA            complement(join(921597..922856,922918..923128,
                     923187..923484))
                     /locus_tag="THITE_2111605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651339.1"
                     /db_xref="GeneID:11518595"
     CDS             complement(join(922036..922856,922918..923128,
                     923187..923213))
                     /locus_tag="THITE_2111605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651387.1"
                     /db_xref="GeneID:11518595"
                     /db_xref="InterPro:IPR002190"
                     /db_xref="JGIDB:Thite2_2111605"
                     /translation="MSTRRRRRQVAQDDEDENMQQRPPQSPDDAESDADDADEPMADL
                     GQRDETSQLIKNLVRYALACEYSRTPIRRDGIRDKVLGSNGREFKKVFAGAQKQLRAT
                     FGMEMVELPIRDRALMTTEQKRKGRFPCIGNGASIAKADMVSAAAKSQSQKEPSSNTY
                     ILVSTLPEAYKSPAVITPSKVQSAEGEASYIALYTTLIAIITLSGGELSEPRLRRYLT
                     RLNAAENMPSMNPNDGTSPNEKTDVLLQRMVKQGYLVRVTESKSMGDDESTTWHVGPR
                     GKVEVDKEAIAAFVRTVYGGSSEELEKKLQASLKIQNRPPRPAEEEEGAPPDDDPGPS
                     NRANRRRRRAQVENEESE"
     gene            923609..926620
                     /locus_tag="THITE_2111608"
                     /db_xref="GeneID:11518596"
     mRNA            join(923609..924668,924764..925038,925098..926620)
                     /locus_tag="THITE_2111608"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651340.1"
                     /db_xref="GeneID:11518596"
     CDS             join(923729..924668,924764..925038,925098..926444)
                     /locus_tag="THITE_2111608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651388.1"
                     /db_xref="GeneID:11518596"
                     /db_xref="JGIDB:Thite2_2111608"
                     /translation="MLGRKLTGSASFVCLRCRRLLVGAPQRLPPPALAFLPSSRTHRR
                     SVGSQAGLTGPGGPSDDQFDHQDNAELGSEPSTEPDDVSAGHSEGFGSHRPPSTPLSP
                     QQRTYKSKGHLLSPVPEGLSVDILGKPGSAIVLREKRALPKKPRSADPLRSDDDHETS
                     VSPASLLPDETADETSEDVLLNIHELKPKETRILTDKQFKKLKRTLIEGFTSSQLESY
                     LREHEQTLQFAEEETGNLDETPWILEREPWVPLVQAAGQDVEPRLEGYVHKAMAPKER
                     LAVRLMRQCWDVLNQKVLDQDGYLSIKLRDVEFSLLTLGNRRWLEGTPRAILARVKQV
                     KLIRETRTVSIVAPKHTADSILDRINRVLSNARTSDFPVDLASPKPLEPGILEEVGRL
                     TNTVTRLDPSGNKVVVTWIHMPERDENFENAAETVLRFLRDAYGPKARMSSALQIVPS
                     DLAKQGRYIGMLNYAQKLPWQERFEKWERWTAALSYRNPDSDAPASIPADILAFPLDG
                     EAAAKAPETEQSTEHPPGWSLQSQTDTSAVFGHVVFTRQKQPSLPSPAPESTSQLDPS
                     LPRTFLPTLPALGSLNLPTNLHEEGLWHSTVVIRFAPSPDIAQELITSAPGLELRIEA
                     DHRELKRLVSLRAITETFTGDVLFPAAAVDTRLVQQRYFTLPGAGIEHHVPAIITFLS
                     KSNLRPWDGKLSTPPVLLGVRLPRRLFPSTFDATHAGADGSTDLVQIDYALASIEVQR
                     TVTAAYSGLKLRYTSIQGGQRGGERAEISLDAVRVPEGKGEDASSPGEPDLYEIVDEA
                     DVRRPRFISHTIHAVREKAAQRAAPAKPVELAEFIRVASGIVHETGGLKWHAKRS"
     gene            complement(926969..929340)
                     /locus_tag="THITE_2111611"
                     /db_xref="GeneID:11518597"
     mRNA            complement(join(926969..928091,928153..928291,
                     928559..928621,928691..928718,928783..928821,
                     928903..928968,929034..929340))
                     /locus_tag="THITE_2111611"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651341.1"
                     /db_xref="GeneID:11518597"
     CDS             complement(join(926983..928091,928153..928291,
                     928559..928621,928691..928718,928783..928821,
                     928903..928907))
                     /locus_tag="THITE_2111611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651389.1"
                     /db_xref="GeneID:11518597"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="JGIDB:Thite2_2111611"
                     /translation="MGKEDKTHINVVVIGHVDSGKSTTTGHLIYKCGGIDSRTIEKFE
                     KEAAQLGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYMVTVIDAPGHRDFIKN
                     MITGTSQADCAILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTTN
                     WSEARFNEIIKETSNFIKKVGYNPKSVAFVPISGFHGDNMLEPSANAPWYKGWEKEVK
                     NGKVTGKTLLEAIDAIEPPKRPTDKPLRLPLQDVYKIGGIGTVPVGRIETGILKPGMV
                     VTFAPSNVTTEVKSVEMHHESLAEGVPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPA
                     GAASFEAQVIILNHPGQVGAGYAPVLDCHTAHIACKFAELLQKIDRRTGKAVEDNPKF
                     IKSGDAAIVKMIPSKPMCVEAFTEYPPLGRFAVRDMRQTVAVGVIKKVEKAAAGAGKV
                     TKSAVKASKK"
     gene            complement(931123..933058)
                     /locus_tag="THITE_2111616"
                     /db_xref="GeneID:11518598"
     mRNA            complement(931123..933058)
                     /locus_tag="THITE_2111616"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651342.1"
                     /db_xref="GeneID:11518598"
     CDS             complement(931322..932791)
                     /locus_tag="THITE_2111616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651390.1"
                     /db_xref="GeneID:11518598"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2111616"
                     /translation="MAEEAGSSPRQGRPSMSAAMRSSSFLREHQQYRPPHKPENHYGI
                     DTVVEDLQATSVSPRGISHFKGVPSPENPPKIVESGLSHELSHPNCTPRPGAHTDRLV
                     ATLFYRSSAPRVSNVIPSPKQGTSPQGSRSPSLRAADSDIPPTMAPSSSLDTFPLEPP
                     AAEPEPLDHLYGSFVSPMCIASFLHLMSTFPLPAGSTDLTSAHRCLKLDAKQDHHPVV
                     VELTVSPAPSVDYLSLADLRKHELIYRFEREWNVDVALRDDSLWRRYPRLVVFDMDST
                     LITQEVIDLLAATIKDPPDLAARVADITHRAMLGELEFDSAFRERVKLLTGLPGDIFH
                     ELRPVLEVTNGVRPLLRALKRLGIKTAVLSGGFLPLTSWLAGELGIDYAHANEVVVDE
                     VTGRLTGDVKGRIVGKERKRELLIEIAEKEGIPLEQVVAVGDGANDLLMMDAAGLGVA
                     WNAKPRVQMEASARLNGDSLLDLLYLFGFTDEEIQQLIA"
     gene            934181..935654
                     /locus_tag="THITE_2169864"
                     /db_xref="GeneID:11518599"
     mRNA            934181..935654
                     /locus_tag="THITE_2169864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651343.1"
                     /db_xref="GeneID:11518599"
     CDS             934476..935372
                     /locus_tag="THITE_2169864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651391.1"
                     /db_xref="GeneID:11518599"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="JGIDB:Thite2_2169864"
                     /translation="MADDSRTETSSQLSSPTDHGSVDSGFLSGTPSTVSLPRISLTQP
                     HLQHLNKQLESLHPMDILRFCKIFFPNLYQSTAFGLTGLVTVDMLSKIDAESANPQPI
                     DLIFLDTLYHFQETYDLVERVKSRYNVRVHVFKPADVETVSQFEELYGEKLYETSSEL
                     YDWIAKVEPLQRAYSELKVAAVLTGRRRSQGGQRGDIKIIEVDDERGVIKINPLANWT
                     FAQVKEYVTEHKVPYNALLDRGYKSVGDWHSTVPVGEDEDERAGRWKGQDKTECGIHN
                     KQSRYAQWLKATAQREQQVQVA"
     gene            <936847..>939763
                     /locus_tag="THITE_2064577"
                     /db_xref="GeneID:11518600"
     mRNA            join(<936847..936952,937006..937349,937409..937848,
                     937938..938067,938710..939261,939292..>939763)
                     /locus_tag="THITE_2064577"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651344.1"
                     /db_xref="GeneID:11518600"
     CDS             join(936847..936952,937006..937349,937409..937848,
                     937938..938067,938710..939261,939292..939762)
                     /locus_tag="THITE_2064577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651392.1"
                     /db_xref="GeneID:11518600"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="JGIDB:Thite2_2064577"
                     /translation="MRLSHLLPLALVAKVSAESLTSILTKNNATLSTLSSLLSLVPDV
                     VQALSTAQNITVLAPSNAAFANLMARNPKSAELMRNPAALTGVLQYHVLMGKLMSTDF
                     STTPKFAATMLTAPFANVTGGQRVELAKVNNTAMIYSGYKQAAAVVTADVQFDGGNVV
                     HIIDTVLTVPASPGQTAINTGLTSLAGALTAAGLVDTLNSLADITVFAPSNDAFKAIG
                     SALGTLSTQDLVSILGYHVLTQQVRFSTDLLKVDQMTLSTLQGQNITVRRDGAQLFVN
                     SAKVLLADVLTSNGVVHVLDNVLNPSNASATPNPSASTQAPAFAGVTAVADAPLTSGI
                     MPTTTFRLPAPGAAFSLRKQKILSQLSVPDAEYTDASPKGSVDAGIRHLIDEINARPG
                     LVTTSSCAGRVSVYLEGRKKEAGDAADDDPADERRPVAVGGLGAGGRHAASLAGGKGG
                     GEWLFVSHDPVEEPDDDGDDACHDGAREKGYPVLFGLRSAAAQEEAAMHGALTRSLRL
                     IHFKFEPMARFPSLRRILHILTASPEHAQMVIQAGMQAGFRETGAVSLLKRQADEEAT
                     PMVAVRSMGLSFESLIGAETEGVRRLIVSPEYLKTLVRIANERFIENRKRIERFRDAL
                     SAAFAPPKGKEHWEDAQARRERKRQEGLKRREELNKPKNTPVDESTLEFMLQPPVL"
     gene            complement(<939975..940738)
                     /locus_tag="THITE_133460"
                     /db_xref="GeneID:11518601"
     mRNA            complement(join(<939975..940367,940441..940498,
                     940569..940738))
                     /locus_tag="THITE_133460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651345.1"
                     /db_xref="GeneID:11518601"
     CDS             complement(join(939975..940367,940441..940498,
                     940569..940621))
                     /locus_tag="THITE_133460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651393.1"
                     /db_xref="GeneID:11518601"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="JGIDB:Thite2_133460"
                     /translation="MGSSSSKLSNPAPHVWKGTSQTGVSQNLVETLEASNETDVSRLQ
                     SVELEIQARVAAELKRLRAQEAEALREALQKVSAQQEEGGEQRQQPGGPGRQEVSKAI
                     DGLRAKLEERVKERPLPDSVERARSEVVRCLRENDRRPLDCWREVEAFKEEVRRLEKG
                     WVDKVVS"
     gene            943024..945672
                     /locus_tag="THITE_2111628"
                     /db_xref="GeneID:11518602"
     mRNA            943024..945672
                     /locus_tag="THITE_2111628"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651346.1"
                     /db_xref="GeneID:11518602"
     CDS             943568..945286
                     /locus_tag="THITE_2111628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651394.1"
                     /db_xref="GeneID:11518602"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Thite2_2111628"
                     /translation="MLFTHLLWWSLGAVGLLMLLIRILELAWAKLRLVNAMALSGDKQ
                     TYWKMEHWDWMPGLKRNLIYAPLWKKRHNREIRLSSVANMGTLPSRLHALLLLGYLAS
                     NLAYLFVLDWKNANRYALCAELRGRSGTLAVVSMVPLIIFAGRNNPLIRLLNVSFDTY
                     NLLHRWMGRVAIVEVIIHFVAWAIVQVADDGWAGVQHRILHDRFITSGTVGAVAMVII
                     LISAFSPLRHAFYETFLNTHIILALISFICTWVHCTSAAVPGGLPQTPWILAILTLWL
                     AERAARMIRLAYANWSSRGFTEAIVEPMPGEACRVTMHLPRFVDVKPGQHAYLRFGGL
                     RCWESHPFSIAWFEHSYGSEPVLPITEKEDIEPARKPVGTSVTFIIGAHTGFTRRLHN
                     ASRQSQGRAVSMRAAFEGPYAGHHSMDSYGHVVLIAGATGITHQISYLRHLIDGYNAG
                     TSATRRLMLVWIVRDYEVLEWVRPWMDKILRLPNRKQVLQVRLFVTRPKAASQVISNS
                     TTVQMFPGRPNIPMLLAKEVCEQMGAMCVSVCGPGGLADDVRDAVRKVQGHGTVVDFV
                     EESFTW"
     gene            946785..949586
                     /locus_tag="THITE_2111629"
                     /db_xref="GeneID:11518603"
     mRNA            join(946785..947152,947244..947388,947454..949031,
                     949113..949586)
                     /locus_tag="THITE_2111629"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651347.1"
                     /db_xref="GeneID:11518603"
     CDS             join(947145..947152,947244..947388,947454..949031,
                     949113..949232)
                     /locus_tag="THITE_2111629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651395.1"
                     /db_xref="GeneID:11518603"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="JGIDB:Thite2_2111629"
                     /translation="MPMLKDPSKKYKRFPPLNLPDRQWPSKTIDKAPRWLATDLRDGN
                     QSLVDPMNGDQKWEYFHMLCELGYKEIEVSFPSASQTDYDFTRRLIETPGAVPDDVWL
                     QVLSPCREDLIRRTVESLKGAKKAIVHIYLATSECFRRVVFGFTEDESVELASRCTAL
                     VRSLTKDDPSQSGTEWAFEFSPETFSDTSPEFVVRICEAVKKAWEPTTENPIIFNLPA
                     TVEMSTPNVYADQIEYFCRNISEREKICVSLHPHNDRGCAVAAAELAQMAGADRVEGC
                     LFGNGERTGNVDLVTLALNLYTQGISPNIDFSDLNRVIRVVEQCNKIEVHPRAPYGGS
                     LVVCAFSGSHQDAIKKGFQLREKEGKQYDDYWQIPYLPLDPKDIGRDYQAVIRVNSQS
                     GKGGAAWIIQQHLHLDLPRGLQVSFAKVVQEMAERKGRELLPTEITELFQHTYSLTQN
                     PRFTMVDYTISPDRSSSPTPPEPGKTQDTTNLRRVFEGVISIDGKEYTLRGRGTGPIS
                     SLANALRTVGIDLDVQDYKEHAVGRGRDVKAATYIECTAAGAKEKVWGVGIHEDVVQS
                     SLLALLSAASNFPPSIRGSSVVSKDTVDGANGSAKVPDIINALEEKADEM"
     gene            951115..954207
                     /locus_tag="THITE_2111635"
                     /db_xref="GeneID:11518604"
     mRNA            join(951115..951248,951349..951407,951474..953453,
                     953543..953786,953848..953956,954012..954207)
                     /locus_tag="THITE_2111635"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651348.1"
                     /db_xref="GeneID:11518604"
     CDS             join(951197..951248,951349..951407,951474..953453,
                     953543..953786,953848..953956,954012..954201)
                     /locus_tag="THITE_2111635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651396.1"
                     /db_xref="GeneID:11518604"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="JGIDB:Thite2_2111635"
                     /translation="MEGAPDINTVLTNSLSPDATLRNAAEQQLTLAAETNFSQYLSTL
                     VQALANESAEGHIRAAAGIALKNAFTAREFARQAALQAKWLNQTDQETKTRVKELALQ
                     TLSSTNTQAGQATAQVVAAIAAIELPRNQWPELMHALVRNVSEGTQHQKQASLTAIGF
                     ICESQDTDLRNSLVSHSNAILTAVVQGARKEEPNNEVRLAAITALGDSLEFVGNNFKH
                     EGERNYIMQVVCEATQAEDSRIQQGAFGCLNRIMALYYENMRFYMEKALFGLTILGMK
                     NADEDVAKLAVEFWSTVCEEEIAIEDDNAQVESSEQMRPFFNFARVATNEVVPVLLGL
                     LTKQDEDAADDEYNISRAAYQCLQLYAQAVGAAIIPPVIQFVEANLRHEDWHNRDAAV
                     SAFGAIMDGPEEKVLEPIVKSGMQPLIGMMEDPSIHVRDSTAYALGRITEACSEAIDP
                     NEHLEPLIRSLFNGLMNNPKMAASCCWALMNLAERFAGDVGAAQNPLTPHFNQSVANL
                     LAVTGRMDGDPAARTAAYEVLNVFVQSAANDSLSAIADLSTVILQRLQDTLPLQQQVV
                     SVEDRIILEDMQTSLCAVLQATVQRLDKEIAPQGDKIMQILLQILSTVGAKSSVPESV
                     FAAISSLANAMEEEFVKYMEAFSPFLFNALANQEEPSLCSMAIGLVSDITRSMGERSQ
                     PYCDNFMNYLLSNLRSTALANQFKPAILQCFGDIASAIGGHFETYLAVVAQVLQQAAT
                     ITAGADGSYEMFDYVIALREGIMDAWGGIIGAMKSSGKTGILQPYVASIFELLNSIAN
                     DSNRSEALMRSSMGVIGDLADAYPSGELADAFRQDWVTAMIKETRANREFQSRTIETA
                     RWAREQVKRQIGGTQTVMQQA"
     gene            956599..956985
                     /locus_tag="THITE_2111636"
                     /db_xref="GeneID:11518605"
     mRNA            956599..956985
                     /locus_tag="THITE_2111636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651349.1"
                     /db_xref="GeneID:11518605"
     CDS             956606..956974
                     /locus_tag="THITE_2111636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651397.1"
                     /db_xref="GeneID:11518605"
                     /db_xref="JGIDB:Thite2_2111636"
                     /translation="MKLASTPQHPDEGDKESGACGPQLRRAGSLTDPGTSRLAGASSA
                     GVDIDVEMDPPPDPPAAPTAAPPLDNVNGVNGIQEVNPGQPQPEAAPPPVIRRRAPIA
                     CRRFVWCLAQQLPGSLCRFS"
     gene            957000..960150
                     /locus_tag="THITE_2111640"
                     /db_xref="GeneID:11518606"
     mRNA            join(957000..957152,957245..957752,957827..957949,
                     958015..958422,958491..958558,958631..958784,
                     958846..958903,958982..959160,959225..960150)
                     /locus_tag="THITE_2111640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651350.1"
                     /db_xref="GeneID:11518606"
     CDS             join(957073..957152,957245..957752,957827..957949,
                     958015..958422,958491..958558,958631..958784,
                     958846..958903,958982..959160,959225..959836)
                     /locus_tag="THITE_2111640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651398.1"
                     /db_xref="GeneID:11518606"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_2111640"
                     /translation="MRSKCLHEKGKSPCQACIDAGLDPSECVFPARGQPDLDREYRHP
                     RVRADKSKKRDAAKARRDALDGPAPPSMPAIPADDWDLLPPLPDIIQAVNKFTRHYFQ
                     LGFIPKQQFAERLRTQHRSISVFFLLGILSVSARLTPALVERYGTAVRASETFMARAS
                     AMAQNEVYKEPTLERCQAFYLLSIAQQGSGLKLMSSINLAIAMRMATLMQLHREETYV
                     VPHPAPELIIRAESARRTLWMLHSQDNLHSGPRSPVLLSASDITALLPSNEKDFANAR
                     VPHSRAALEDTPPAVENPSLVSDDGRSLFAALIQAHHYWGAIYRRAVSNNKSARPWEP
                     NSEYARMERRLTEWEAGLPNDYRWSSLLLKGYKQEGQDLAYLGVTMITRLCNIVIRKA
                     YLHEMISHDRSDPEMTTFWTGMARKLFWNVNALYEQIETHYADRTPDEGPGAQMAAFC
                     VYSCGLLACYPCKFPDICPDPVIARNSPMMVERILHILAESRSIWPLASRWYDLLERF
                     YKSHNSMTAGAEGSMADSKEPIPHVLQATSSRPPVKPIQPRILAPAPDEKNDAPVQDG
                     GNVPMLSVIQPLAGQAGYSEPGLRPSVAPSQAPSGGQAPPPPPSTAGGPRQTTDGLGL
                     LIEAFDTHQTAAAAAAAAAAAAAAAAASTAPVGPGTTSPPSAGPPPGPAYDAHSSVPA
                     PPQYYAPPGLAMNDGYEHELGYYMSDGVPPPGMQQGWADGGNAMYGY"
     gene            960153..961459
                     /locus_tag="THITE_2111645"
                     /db_xref="GeneID:11518607"
     mRNA            join(960153..960384,960524..960688,960767..960829,
                     960911..960960,961024..961459)
                     /locus_tag="THITE_2111645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651351.1"
                     /db_xref="GeneID:11518607"
     CDS             join(960328..960384,960524..960688,960767..960829,
                     960911..960960,961024..961033)
                     /locus_tag="THITE_2111645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651399.1"
                     /db_xref="GeneID:11518607"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="JGIDB:Thite2_2111645"
                     /translation="MSAIQTAARPESAQKVLSLYRQLLRQGNQFASYNFREYAKRRTR
                     DAFRENKNVEDPRRIQELMQKGLRDLQMMKRQTVISQFYQLDRLVVEGGISGKDEAGH
                     GETVRQKDTGWD"
     gene            961466..964313
                     /locus_tag="THITE_2111648"
                     /db_xref="GeneID:11518608"
     mRNA            join(961466..961702,961769..961841,961933..962663,
                     962729..964313)
                     /locus_tag="THITE_2111648"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651352.1"
                     /db_xref="GeneID:11518608"
     CDS             join(961691..961702,961769..961841,961933..962663,
                     962729..963898)
                     /locus_tag="THITE_2111648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651400.1"
                     /db_xref="GeneID:11518608"
                     /db_xref="JGIDB:Thite2_2111648"
                     /translation="MQRTQQLRTATQTRRSARTGFPEPDDFEGLPVRQWRQEWVTIAP
                     SLPQEMTQQGDRWAVELPYGMPRESHLLPPHSQELLRAARSGRLYKRPAPAEEEEGDP
                     ELDAVKGEKRDWEPPSEGYMVKIWKQVPRNAESPTISHLAKRHKNTVTLASKAAAAPL
                     PTGPTVIRATVRRIDAAGNPYEQTVTISEGQHVDGEIISSTVVPASSAVQGELPLKQP
                     TPSRRRPPPPKRKAKGLGRGRKKGRLPLPLPATRSQAPAADGAAPIKAEGVGSDGIKI
                     QDIEGSVNQDSEMANTSGVPSEDEEGEGGEGEEEEDGEEEGGDDETGETSVLQSSNGD
                     APGQEAEDPEMSDAVHPTSAEEPDEPRAAPSEVEDVTIPKPPNIANLAPPPLAPFKLE
                     GSPLKNVMIQSPTEPSPLVSPQAAHASFPTSSSLDVQSRTQSTELGSGDTVVETGVQD
                     ISTRPMDSAGAAGEQAAVPGVVAEILAPETSTSAPAGEASQTTAAASNGPQETAGPSQ
                     TSLPQTSEPSASSVPVTTEVADPEVVQPVDPPAALPGVSLQPPDSPALLPTAAEDEDD
                     GLNLLGSLERELDRQEGMSNASSGSEAKATPNDHNNMAPATVEGPTAADTSAEATAPS
                     STDAPAAAAAPADGDRDAEAPAPAGDGDDASVQDAQV"
     gene            complement(<964687..>966634)
                     /locus_tag="THITE_2142830"
                     /db_xref="GeneID:11518609"
     mRNA            complement(join(<964687..965505,965561..>966634))
                     /locus_tag="THITE_2142830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651353.1"
                     /db_xref="GeneID:11518609"
     CDS             complement(join(964687..965505,965561..966634))
                     /locus_tag="THITE_2142830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651401.1"
                     /db_xref="GeneID:11518609"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="JGIDB:Thite2_2142830"
                     /translation="MTDDGGDTEAHRGAGSQRRSGLYSDATSRPGTARTGVSQRSPWA
                     QGPALRRGLSGKRGSVTGSVGSSSAGARPTSSMSRSHVPTLTSHAFFRPMSSQKLQAQ
                     RGITRPTTMSRQTGAQDESDETNRGSVVSNPNPPVGAQSADEVDMRPPPSRGTEFTEQ
                     ETYDRVTATTSPTQGHNPAASLTDSVRPLQRKPEAAANLTLDLSKTFKAGANAATPVR
                     TPRSLRSSFLMPRLESSSGNREMQGGEKLESLASSPQLPPSTGDGKRRPPQENQKSEI
                     GRNYEYFDGNTVFCLGGRLQNTRHRPVNIATGGFVVLPSVLFFIFSAPWIWDNISPAI
                     PITFAYAFFICMSSFFHASVSDPGILPRNMHRFPPADENEDPLRLGPPTTEWALVKSS
                     DPATAAMEVPTKYCKTCNIWRPPRAHHCRLCDNCVETQDHHCVWLNNCVGRRNYRYFF
                     TFISTATLLALYLSGASLAQILVYANRQDISVGDAISHFRVPFAMVLYGFIGFLYPAA
                     LMGYHVFLMARGETTREYLNSHKFLKKDRYRAFTQGSWFKNWFVVLCRPRPPTYYQFK
                     GAYTHGDQRLGSHRRAHRAVGRAGDSKDGVELQDVKSQSQQTQTGFQGPVSLRNAANS
                     ATAGST"
     gene            967700..968757
                     /locus_tag="THITE_2111651"
                     /db_xref="GeneID:11518610"
     mRNA            join(967700..967910,968050..968101,968207..968391,
                     968449..968757)
                     /locus_tag="THITE_2111651"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651354.1"
                     /db_xref="GeneID:11518610"
     CDS             join(967806..967910,968050..968101,968207..968391,
                     968449..968493)
                     /locus_tag="THITE_2111651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651402.1"
                     /db_xref="GeneID:11518610"
                     /db_xref="JGIDB:Thite2_2111651"
                     /translation="MASIIARRAFSTTVRRLATSEEALKTESKKNPEIMILGGVMVCA
                     IAGAGFYFGRSPTKSTSESPVPLAKNSMPWEAGSGQGKYQYYPGGDANAAPKDAPSAV
                     NVVVIPDVELPKRLHDKYNKWGKDGY"
     gene            complement(<969058..>970257)
                     /locus_tag="THITE_2045304"
                     /db_xref="GeneID:11518611"
     mRNA            complement(join(<969058..969165,969218..969477,
                     969771..969797,970236..>970257))
                     /locus_tag="THITE_2045304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651355.1"
                     /db_xref="GeneID:11518611"
     CDS             complement(join(969058..969165,969218..969477,
                     969771..969797,970236..970257))
                     /locus_tag="THITE_2045304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651403.1"
                     /db_xref="GeneID:11518611"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="JGIDB:Thite2_2045304"
                     /translation="MSDHEFGGNDDLSLPKATVQKIVSEILSGSSGIAFSKEARDVLI
                     ECCVEFITLISSEANEISEKEAKKTIACDHIVKALDQLGFPDYVPAVLEAAAEHKEVQ
                     KGREKKANKLEQSGLTLEELERLQQEQFAAAAARHN"
     gene            complement(971462..972688)
                     /locus_tag="THITE_2111657"
                     /db_xref="GeneID:11518612"
     mRNA            complement(join(971462..971544,971594..971964,
                     972027..972188,972288..972688))
                     /locus_tag="THITE_2111657"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651356.1"
                     /db_xref="GeneID:11518612"
     CDS             complement(join(971508..971544,971594..971964,
                     972027..972188,972288..972473))
                     /locus_tag="THITE_2111657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651404.1"
                     /db_xref="GeneID:11518612"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_2111657"
                     /translation="MASKVIIVTGASRGIGLAVAKWLLAASHRVILVSRSAEQLEELK
                     ARYPSQVAYLAADMTVADTAWRATELAVLTFGRVDGVVVNHGVLSPMTRIEDASVEEW
                     RKLYEANFFSALALVKETIPQLRAAKGRIVFVSSGAATSAYTSWGAYGSSKAALNSLA
                     RHVAVEEPDITAVAISPGRVDTDMQKELREKGGAAMSKEDYETFKSDFEEGRLIKPEQ
                     AGGIIAKLAVDAKPGLSGKYFKWDAPELVEYRQ"
     gene            972689..974243
                     /locus_tag="THITE_2111659"
                     /db_xref="GeneID:11518613"
     mRNA            972689..974243
                     /locus_tag="THITE_2111659"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651357.1"
                     /db_xref="GeneID:11518613"
     CDS             972905..974185
                     /locus_tag="THITE_2111659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651405.1"
                     /db_xref="GeneID:11518613"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2111659"
                     /translation="MAPNHATVILGAGIIGVSTAYYLCQHEDGSSIHLVEPSPELFSS
                     ASGYAGGFLAKDWFAPSVSELGALSFEEHRRLAKEHGGREKWGYSPTTSVSYAASAAA
                     RDSQRRGDDWLRDGTSRADAAPGIPDSRSGMTPTWLRRLEGDHIELISDKDATAQVDP
                     LLLCRFLLQECIKRGVQLHQPAKPIAIRTDGNGELAGIRIADTRSSAQTELPCARLII
                     AAGCWTGQVFRTLFPESALELPIKSLAGHSLVLKSPRWHAGLESNGCHAVYTTYKDAF
                     CPEMFARLGGHIYFAGLNSAALPLPDAAAGKATPYRESLERLRQAAVELLGAGSGAEN
                     DLEIVREGLCFRPVTPWGTPIVSRIRDCDLGAGTVTRSGAGGVFVAAGHGPWGIALSL
                     GTGLVLAEMVQGRKLSADISGLAFDGDRARLFAN"
     gene            976042..979304
                     /locus_tag="THITE_2111660"
                     /db_xref="GeneID:11518614"
     mRNA            976042..979304
                     /locus_tag="THITE_2111660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651358.1"
                     /db_xref="GeneID:11518614"
     CDS             976223..978985
                     /locus_tag="THITE_2111660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651406.1"
                     /db_xref="GeneID:11518614"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Thite2_2111660"
                     /translation="MASHVQPALRHAADASSQTATELAKRISIPLLPNSPAGLVQALT
                     VDPWSQSGKYGLGWTYFAIVLGGLAVLVRIWHYWQDKIRQAIYKQEMEQHFQTLYSLD
                     PGWDRSAALATGVTTSESRRHFFPDEPPAQVKNFRPKAHFSSVGFVNDTLALFRWVFY
                     RPIPDIVWRNHRFTFSSLAVLGCAFIALSFVTVYCFLQQPLYWQSIRFGSPPLAIRSG
                     MIAVAMTPWIFATSTKANLLTLITGIGPERLNVFHRWLSYLCLFLSLVHMIPFYIQPV
                     WEDGGMEVFGALFPPGSGIIYGTGIACLVPLCWLCAASLPVIRRKAYEIFALLHAPVG
                     YVYLGVLFWHTKNFLMSWGYLYASIGIIVLCNILRLFKLNWAKPWRMSWLIGDEAAIN
                     IMTENAIKITIPTQMRWKPGQYVYLRMPGISLLENHPFTISSLCSDDFPSVYGEEYRD
                     CVLVFRPFGGFTRKVLETAIEKGPFHTYRAFLDGPYGGMRRELAAFDTCILIAGGSGI
                     TSLMSQLLNLIKRMRDGKAITKKVVVVWALKRLEAMDWFREELRICRESAPPESVTCK
                     FFVTAAVRPKANPAGYQGRAPRPLSNAFHDKLDGFVAGIASKRNSALIAAEAQGDPDK
                     ERELRREDEDRITALPQQKYLQPHTFPPPPPPGPPPNKTGLSPAEEALKKLEGRNSES
                     KTIEHDLPEGKHGTGGQRKHDGEFHFPPLGARGAGAPHFNFAPPAGRQRYSQILAEAD
                     SRVSQAGGESASDTKEGQRKQQQQEEEEEQEVDSDKKTNGGPAPVQPPELAHLRTDVG
                     AASARRRPTSTFGPPSGFDFGFPETPTEFQRSLMRFAFPVPHEIDGGWSVEYGRPDLG
                     YMLREWATGGPDGRGILGRRTAVFVCGPPAMRVGVANTVARLQAEIWGDDMLEEIFLH
                     TENYAL"
     gene            complement(980175..981931)
                     /locus_tag="THITE_2111662"
                     /db_xref="GeneID:11518615"
     mRNA            complement(join(980175..980719,980884..981196,
                     981274..981446,981524..981931))
                     /locus_tag="THITE_2111662"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651359.1"
                     /db_xref="GeneID:11518615"
     CDS             complement(join(980423..980719,980884..981196,
                     981274..981446,981524..981718))
                     /locus_tag="THITE_2111662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651407.1"
                     /db_xref="GeneID:11518615"
                     /db_xref="InterPro:IPR004183"
                     /db_xref="JGIDB:Thite2_2111662"
                     /translation="MSGLWPSRHRPWLLLLPTSILILILALLLSPTSRLARWLPSLTQ
                     IKNCSSLNMPRTPVYYFSHGGPDVQYNKTHPVYPVLQSLGKEITQKVKPKAVVVFSAH
                     WQAEPNEVHLNNAEDTDLIYDFYGFPPEYYKATFPSKGSPALASRILSLLSGAGIKAK
                     GLKRGLDHGVFSGFNVAFSPEENPLQCPLVQVSLFNSEDPDAHYRLGQAVAALRDENI
                     VIICTGMSVHNLRDLRFSWGSSTPLPYVVSFDNALKEAVEADPSVRQERMAAVTKRPD
                     AKQAHPWMDHLMPVYIAAGAAGEDKGTQLWTLHEASMAWAQYRFGEVAA"
     gene            982047..983313
                     /locus_tag="THITE_2111664"
                     /db_xref="GeneID:11518616"
     mRNA            join(982047..982557,982628..983025,983090..983313)
                     /locus_tag="THITE_2111664"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651360.1"
                     /db_xref="GeneID:11518616"
     CDS             join(982327..982557,982628..983025,983090..983195)
                     /locus_tag="THITE_2111664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651408.1"
                     /db_xref="GeneID:11518616"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="JGIDB:Thite2_2111664"
                     /translation="MSTIVRRPPLLFPATARHTATVIFIHGLGDTGHGWAGAVENWRR
                     RQRLDEVKFILPHAPAIPITCNWGVRMPGWYDIHAIDGNPESLRRNEDEAGILLSQAY
                     FHELIQQEIDAGIPSDRIIIGGFSQGGAMSIFSGLTAKVKLAGIVALSSYLLLSLKFA
                     DLVPKPEVNKETPIFMAHGDSDQVVNTKLGRMSYDLLKGMGYNATLKIYEDMGHSACP
                     EEMDDVEAFLTERLPALGSTEAKPEL"
     gene            complement(983913..>986939)
                     /locus_tag="THITE_2169870"
                     /db_xref="GeneID:11518617"
     mRNA            complement(join(983913..986791,986851..>986939))
                     /locus_tag="THITE_2169870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651361.1"
                     /db_xref="GeneID:11518617"
     CDS             complement(join(985591..986791,986851..986939))
                     /locus_tag="THITE_2169870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651409.1"
                     /db_xref="GeneID:11518617"
                     /db_xref="JGIDB:Thite2_2169870"
                     /translation="MAPLILHNVPDEELYVGDDGIQRPYAMVFSQDGSLRSRKMTHET
                     GSFGKSTRRTRSKTATPARKEDPTIAAADKVFSSWLATQNQNAPQAQNTPATAQRRPS
                     VAASVSSQSAAQLRDDAATPSQNRFQKQLVPTEVILRGYRSSQQQYAAINHYEQLAGR
                     ICEDYPREPPVESRRYKSELRDPAFTRRRALTPEERAKVNKADGGEHWVKVTFESHEA
                     ADAAIFASPQKILGHLVYAEPYQGIPPSRDEAIPDQSYLGSGLRETPLRRRHSRTQSG
                     FGAQQPGGFNWSPPHSQASSSATADTMTVNSSTISSSTVIGQAATGGSGAGVVPAPQE
                     KHDDEFCRVIPTVRKAKLLPVEQALLPAPSFTQRIANHIPFLRWFNGAMIGSEVPRTE
                     MGEFDWNRASLYWKLMWWLDFLLGLFGGEIRDADKDD"
     gene            988480..>991176
                     /locus_tag="THITE_2111669"
                     /db_xref="GeneID:11518618"
     mRNA            join(988480..989021,989942..990017,990788..990959,
                     991146..>991176)
                     /locus_tag="THITE_2111669"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651362.1"
                     /db_xref="GeneID:11518618"
     CDS             join(988866..989021,989942..990017,990788..>990959)
                     /locus_tag="THITE_2111669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651410.1"
                     /db_xref="GeneID:11518618"
                     /db_xref="JGIDB:Thite2_2111669"
                     /translation="MRAQVPRVPCQEALMVLLTWVVSKYCEALELLRPNLEVDIQGNN
                     VNRDLQHFLPKTMSIATTFSKTSSPWPSSHPSNRQQRQSQPLSKTSSPRPGSHPSNRS
                     NLRPINRSNRSPQPVAPIKEPDWPVAPIKEPN"
     gene            <992608..>993890
                     /locus_tag="THITE_37358"
                     /db_xref="GeneID:11518619"
     mRNA            join(<992608..993685,993745..>993890)
                     /locus_tag="THITE_37358"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651363.1"
                     /db_xref="GeneID:11518619"
     CDS             join(<992608..993685,993745..993890)
                     /locus_tag="THITE_37358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651411.1"
                     /db_xref="GeneID:11518619"
                     /db_xref="JGIDB:Thite2_37358"
                     /translation="QFDVTVEFLLQMANYLTERHTSQLRAQMLKAAAGRGSSAPSPVP
                     GADAPGAHPATAEPMRRTNSGAGRAPSALSMRKETATPLAKNLAEASGAAAGPSVRTA
                     FPSRPGSTRNSSANTPVPSQNPPSSRPGTATRTSDPPRRPLSHLQNTAAHQQQRLEQQ
                     DNTGAPPSPAASTSSSPSSSSESLVESRIIRRPPRFTKPKDVRGGGNSDRPAGDDDDD
                     DDVEAAFLPPQKHQVDSAPSPVGGSQDLGATLRGDMRHLVGRRGGDANQSQTSDSSVS
                     SAAIVSPPPATAGARAGAGAGAGETAGRRATSTRQGLQGPLSPRRTAELAGRGPGQGG
                     AKGRGTSREGSDGTPSMGSSFSDLDDASVTQSALEEALASGMQDGTIGSRMSVIGGTI
                     GHALRSRYLPKSNRH"
     gene            complement(994685..996647)
                     /locus_tag="THITE_2111674"
                     /db_xref="GeneID:11518620"
     mRNA            complement(join(994685..994944,995013..995232,
                     995334..996647))
                     /locus_tag="THITE_2111674"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651364.1"
                     /db_xref="GeneID:11518620"
     CDS             complement(join(994743..994944,995013..995232,
                     995334..996501))
                     /locus_tag="THITE_2111674"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651412.1"
                     /db_xref="GeneID:11518620"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2111674"
                     /translation="MGSLVVAALSVPLSAWGIHRAYSWLVPDSSDVSLSRYLLLVGLA
                     ALAIRVSCSFFNSDRFQARARLLGCGPVALYPHKDPILGLDGFFGALRALNSHRLLEF
                     YAGRFSSCAPTYYTIALGKWILMTNEAENIKTILSTKMADWPIDGPRLLATLPVLGPD
                     SIFTSNGEPWHRARAMLKPSFVRDQVADLKCFDRHTRNMLAAIPGDDVAFDMQSLLLD
                     MTMDSSTDFLLGYSTNLLSEASPEAQQFVRDFEYASRESAKKARLGTLLFHLPHPALR
                     RAVRGLREYVRFYLKKAIAEAEKGAGARERSYVFLDELLKANPPEDYTIDQILSILIA
                     GRDTTATAMTAAFYFLARDPAAVAKLRDEILGVGDANPTWEQLKQLKYLNNVIKEALR
                     LFSPVATNSRTANKETILPRGGGKDGKQPILVPKGMSVRWSLHALHRSKDVFGPDADE
                     FRPERWDSDLRVSWEYVPFSGGPRICLGQQFALTQIAYTLFQFFRTFRSLEARDDGPL
                     LARTNLTISFPFGCLVSVKRA"
     gene            998707..1000164
                     /locus_tag="THITE_2111676"
                     /db_xref="GeneID:11518621"
     mRNA            join(998707..998947,999044..1000164)
                     /locus_tag="THITE_2111676"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651365.1"
                     /db_xref="GeneID:11518621"
     CDS             join(998839..998947,999044..1000038)
                     /locus_tag="THITE_2111676"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651413.1"
                     /db_xref="GeneID:11518621"
                     /db_xref="JGIDB:Thite2_2111676"
                     /translation="MAASGIIDPTKAGKYPVILSDALLGKPSKETYTGIRYNYRPPLS
                     SDTAPETARLKKSPKDESYDLDFEDQGDKYQYSGIRTSNDGNYVLLFDPARKAFVLHR
                     VDSTFHMNLTRTPTDSSAESLRKQFPHLEVKSGSPAKKPRAKATEKARAAKATPTRAK
                     EGNRAPQGSSKPARGGEPEKTQETLLTLPDVNATPPTSASPPSQQAEKKAKRPALSPV
                     DSEEDDDDDGDDVLTLEIPRGNPAAFGPTSNFSTTFRPFSELAREMAGDPEGQEELEE
                     GYEEGDEYDENDEDDDDEPPRRPPIPARPSKTESPVAVEPDRYTFDDGDEDSDEAGGN
                     EALDQDFGELEAELERELQNDGNGSDSSVSEEE"
     gene            complement(<1000932..>1003286)
                     /locus_tag="THITE_36773"
                     /db_xref="GeneID:11520853"
     mRNA            complement(join(<1000932..1001195,1001307..>1003286))
                     /locus_tag="THITE_36773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651366.1"
                     /db_xref="GeneID:11520853"
     CDS             complement(join(1000932..1001195,1001307..1003286))
                     /locus_tag="THITE_36773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651414.1"
                     /db_xref="GeneID:11520853"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="JGIDB:Thite2_36773"
                     /translation="MTDRSRPYPLGGPCNPFVIDDDDEYEDKDDVARRNHRIEEEAQT
                     GRRLAEWAASRSTRWATSNEVAISDLSDDFDADQHIEDILAQDISHIIDLTGDEDDPS
                     TSSPVPSREEGREIESCVSPDGLLLRAGQAVELHSSLGNYGVRFLKIKSIVQHGPNSE
                     IVLRGWGYARTRELDGMLPAKLNELVLVAEFRGPDPTSLEKQGLVEVPLSWVKCGRDL
                     RVTNAPFPEHRFDPLEYSIMGKNWVEEHGTLVCRYRYEIHYHGNSEKPCEWVLGCMDE
                     DAADPSYRLSNAQSLNRWRGGKIPGGSYNPSGSSRPVFDLESGSLSSAHTQTRNLLPD
                     QRYTAGDVFAGAGGASRGIERAGVHLAFAVDHWPPAVESLRANFPETQVYEMDVTDFL
                     ESEFIRHVVDILHVSPPCQFWSPAHTVAGRDDDKNSAVLFASAPLIKKHRPRLFTMEQ
                     TFGLLSPKFTGFFNTMLRDIAQLGCSMRWRVAPLANYGVPQLRRRLIIIGSAPGEKLP
                     PFPPATHSKDGAGGLKRWVTPKKVLDKLQSRRDFKLHQPQLSRRFRPPKAPWDPTKLA
                     RTITTNGGQNYHWDGERDFTLLEYALLQGFPTWHKFRGGYIKKQIGNAFAPTVVKVLY
                     EHLKKWLLVQDGFDSEARPQVSAGLPRNTSPRDCVWLPCPGSQRSRSSRRLSEVVRRL
                     NLVAKQEENLVDLVDLDGADELSDTATLRGDEEVQDLMDVEDSAADLVVDGGGGGTRD
                     DPYLVWD"
     gene            1006039..1008406
                     /locus_tag="THITE_2111678"
                     /db_xref="GeneID:11520854"
     mRNA            1006039..1008406
                     /locus_tag="THITE_2111678"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651367.1"
                     /db_xref="GeneID:11520854"
     CDS             1006264..1008030
                     /locus_tag="THITE_2111678"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651415.1"
                     /db_xref="GeneID:11520854"
                     /db_xref="JGIDB:Thite2_2111678"
                     /translation="MQTRAAAKRFAAAAEAARSAIGTPSQPTTLTQPPETANDPSPAH
                     NPEPVGKATRGSKLTRAGKKKAPPVKGGWALPHGMGVGVAKQDDGSLLKTEETPLVLG
                     SIGLSSTAVAGQIRDNSPADSQSSTKQDVPRRTRQTRLSLRVTKAGLTNRNNLPKEDK
                     PNVSLEEVDNPSIKQDDGRPSKRARTARLAAGQTVDSPATTRATLALALAETEKDQTT
                     EPTALKLLVFRGVTFQDGMFAKSSDKIIVDTSKFLDPNFKRIVKRGKENPYGLTPGLS
                     PYPYRRVPTPEACEEVHRILSEFHGEVKQPEKMPSASLEVAGCGEVPCVLDALLRTLI
                     SGNTLMAMADAAIKNLAQHYGLRTEGTGAGSINWEKVRLSSHQELVEVIKIAGNGPKK
                     ARHIKQILDMVYEENLQRAQGQPSLTKANPIQRGDGTCVATQNLLSLDHMHSMSKDEA
                     MAKFVSYPGIGIKTAACVTLFCLRMPCFAVDTHVHKFCRWLGWVPAKADPDNCFRHGE
                     VMVPDHLKYGLHQLFIRHGQQCFKCRKVTKPGTKEWDEAPDCPLEHLLDRSKDEAAAK
                     PKRNGKVEEESDPEDASSGMED"
     gene            1008866..1015659
                     /locus_tag="THITE_2111680"
                     /db_xref="GeneID:11520855"
     mRNA            join(1008866..1008908,1008968..1009398,1009482..1015029,
                     1015101..1015283,1015348..1015659)
                     /locus_tag="THITE_2111680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651368.1"
                     /db_xref="GeneID:11520855"
     CDS             join(1009043..1009398,1009482..1015029,1015101..1015283,
                     1015348..1015416)
                     /locus_tag="THITE_2111680"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651416.1"
                     /db_xref="GeneID:11520855"
                     /db_xref="JGIDB:Thite2_2111680"
                     /translation="MDIDALFQAAITWHRAFEDRPPDAHLCCPKVDDEDPANYDEPDV
                     PDEGGVSVDGKKRRIKEYEDRFHNVYNLSILMGLGREVAGEWLDNWVQAVEFCLTRCD
                     SCVRNWHRNREPYLNGLRLGPEHIDYMRKRLDEFDKQRIDAGLQRARRILEEHGPMST
                     AKLVEHDMSAVLALFEALCSVQYLTSPDDRQDFDYVFGQTQRKRPLRLQGGLLPAMTL
                     FLFDESSFPERRIFAENAWEKRPAESLTDQEWDWAVSPLLTAAILRVSLSRGMPSPDK
                     ICRFWRGFSFILRSLSEKQIINSLRAMEVSPSVYFLALEHFATDSGEALAMVLRGLRA
                     LMEKSSSAFWSAFDQVTPSQLVEEIFKSPAFRRFLNKSLESDMMVTDGGTQVPALAAW
                     MRALIRSLPAIQRSDVCESSLRHLFDTFRQDPTVDRAAQATCTLAGLVTLSESLDGFL
                     HQEVSFDTGTALIMVNQLLNRVVQYSDVISTAAGLKPGDTFNVGISQTAMDIIHSALA
                     LDARATEIEWKALIDGVPVQDAVNRDSGALWESFLEMLWYGQLGHLELAKAMLMATLR
                     LRHIEQFLPKRKEQLKQEHQKFNQRYQQQTAAIGKMLGRLSDFKQEDLNKFCSDRQSP
                     TIHPILSTLIHGEDAIREAGFELLKAITGESLPSDAVTKMLEDHFIAFLDACSEAVGK
                     VTARVHPSSPWSHMLPILKCSEFVLNGLCDPSVGQLRRKSLTAEEHAAVKRWWQTTWQ
                     VVGHSFRMMRSWHERVDKKIMEDFCRDVMELSNKLLAQDGLMASALSQHCSDDAARTE
                     GDATTRAMKIVLEPPRRQSQSIADMLQLKDKYLIMGIIEVIKKLLARLQQNAMDLPQS
                     ALAHLHNMLKRRKLPDGRLDYAQKTNMTDEQRIELLKALGEDAVIEEQFIGTKPGQKE
                     RSMRQSKLDFSKGSLNLVEAMKDHVAEITPNFEKHKSALRESWKDDIPKIKAPPKLDQ
                     KAILANQASIKEARAREKAEKAKRDAEAIAKARALRAPPKTVAGEGSGLQGIAGVRGK
                     DHAPVIKDEIMVGSSSSEEDDSEDERIALKAKASNKNLNEAERRHLLLLAEKRGPVKK
                     VKLQRSAKDMRARLIPPMDVLHQAILEWDIFHEGNDPPNGYRCEGVSDTYTDPHSYKQ
                     TFFPLLINEAWRSFVTAKDEATSKPFGIKVLNRTAVDKFVEIVASVPAQVSKDRGLSE
                     GDIVIFSKGEDPLNQPTELHCLSRIWKTTYKKDTVEVLYRLNARGNQILPVLLPGSEF
                     HVVKITNMTTIEREYAALESLQYYDLMDEVLKAQPSPMLTFGEEAVRGVMQNYQLNPG
                     QARAILNAKENDGFTLIQGPPGTGKTKTIVAMVGCLLTGVLKSSNGGVALARPGGAAP
                     AGSAPSKKLLVCAPSNAAVDELVLRLKAGVKTMNGTTHKIEVLRLGRSDAINAAVKDV
                     TLDELVRIRMEAEINNGGPSDREKLHQEAGELKEKVAELKPQLEAARASDNRALAMKL
                     QREFDELKRRQAHIGAKIDAQKSDGNTFAREVEIKRRQIQQDILDKAQVLCATLSGSG
                     HEMFKNLNVEFETVIIDEAAQCVELSALIPLKYGCSKCILVGDPKQLPPTVLSQSAAR
                     YGYDQSLFVRMQKNHAKDVHLLDMQYRMHPEISRFPSKVFYEGLLQDGADMGKLRLQP
                     WHQSVLLGPYRFFDVKGSQERGPKNQSLVNEEELKVALQLYRRFRTDYSNVDLKGKIG
                     IITPYKAQLFRLRQRFTEKYGEGITEEIEFNTTDAFQGRECEIIIFSCVRASPTGGIG
                     FMTDIRRMNVGLTRAKSSLWILGDSRALVQGEFWAKLIEDAKQRDRYTNGNIMALLSQ
                     PGPKVPLASLAAPSPRPTEAQGLAWEENDVMMTDAPVNHKQESPTSMSSTPAQQGWGT
                     PRPYQDEETTAPPPLPYRGTGIGGLNEKGEVTAIMPRGAGPPMIQSTTGSAGKKRQRD
                     NDDGHASTKKTQHNSDRAPVKPPTGPNAAQPPKTPGDPSGMEVLGMTPPTRPPPPQPR
                     PPPIRPPGPNAPKGQVVMPKRPNADPFIRRKPGKR"
     gene            1016587..1019051
                     /locus_tag="THITE_2111685"
                     /db_xref="GeneID:11520856"
     mRNA            join(1016587..1018468,1018713..1019051)
                     /locus_tag="THITE_2111685"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651369.1"
                     /db_xref="GeneID:11520856"
     CDS             join(1016812..1018468,1018713..1018765)
                     /locus_tag="THITE_2111685"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651417.1"
                     /db_xref="GeneID:11520856"
                     /db_xref="JGIDB:Thite2_2111685"
                     /translation="MAAVRSFDRQDRSSATGTVRSRGAISPAATQRNRPWSFPGRYGS
                     TSVMDGMLRSDTLRRRARRTSEGNVVEDLIDFFRNTPPPPGNFVSTPDPLDEKPKENK
                     RFAFWPFRRKANVAGKEARAAPRRIKLPDSAVAGTTVDGYRHIAISIPIEYAHLELLT
                     DNTAVPGAEHAKAGQVEDESKVPSFVKADYSSRTEQDHRKAEPSALRTGDTVVDAGTP
                     AAPSELSPRQNTRRSGSTVAMMKDGPEKKRALHHQPVIGRWLANSEDLQGIWACQSGN
                     SHLLGKRPSSPESVSSTSSEPINSEAETVYIPSPSSGAGLPNSSRSNNSDEETASYHT
                     PALSPSSPGFPPREAPDIWGESENWSALSDLSAPYGRGTFQTSSSAHGASFSHHVMYR
                     DHQPHTLSDIPSETQTLQSFHLAPTPVTVVADIEPSTQTPSRHIGPGTNDEASSADTS
                     SQPRTPVLVERRRPRRVRGISDLRVLAPSPDPSPCASQAGHPSPVSQSPPRSASRGDH
                     IRRYDDGRQRARQREFDLLLLDRLERLEQAFERWTSALVPLLGRRAGFAACRILAVLP
                     CPV"
     gene            complement(1019052..1021067)
                     /locus_tag="THITE_2111687"
                     /db_xref="GeneID:11520857"
     mRNA            complement(1019052..1021067)
                     /locus_tag="THITE_2111687"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651370.1"
                     /db_xref="GeneID:11520857"
     CDS             complement(1019339..1020991)
                     /locus_tag="THITE_2111687"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651418.1"
                     /db_xref="GeneID:11520857"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Thite2_2111687"
                     /translation="MAAFHAIVTVITVVSLSLSGAWGLVDVFDVRETTIAGVHDALFK
                     GRTTCRGIVSAFITRIEELNPILNAVISLNREALVVADRLDERIAAGYVTGPLFCIPV
                     LLKDNFDAAGMSTTGGCRALIDNEPLADAPTVRALADARAVILGKTNMHEMALEGLTV
                     SSLGGQAVNPYDLSRTPGGSSGGAGAAVAASLAVLATGTDTVNSLRSPASANSLFSFR
                     PTRGLITRAGVIPVSFAQDAVGAMARNPRDLAVALTVMASAGFDARDNATALAPAPVR
                     RADYSAHLHGGGLKGLRFGLLSGFFNRTASAETTPVNDVMANMIFHLTRAGATVVNIT
                     APVYDTLALAELDVQAYEFREMLDAYLAAGTASPHSRPAGFRELYDSGSFLVIPAQHN
                     FIRRASRCSTGDAAYFETLGRIRQLTRTLGATFASNKLDAVIYPEQKNLVVKIGSPSQ
                     AGRNGILAALTGHPVVCVPAGFSPPSADAPLGVPVGMEILGRPWSESLLLNIATHISE
                     LVPVRRMPPFASKTFEPRAYDGVPSVVPNTASIPTEYPHGVY"
     gene            complement(1021640..1024390)
                     /locus_tag="THITE_2111691"
                     /db_xref="GeneID:11520858"
     mRNA            complement(join(1021640..1021756,1021839..1022069,
                     1022162..1022562,1022673..1023250,1023315..1023681,
                     1024222..1024390))
                     /locus_tag="THITE_2111691"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651371.1"
                     /db_xref="GeneID:11520858"
     CDS             complement(join(1021699..1021756,1021839..1022069,
                     1022162..1022562,1022673..1023250,1023315..1023675))
                     /locus_tag="THITE_2111691"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651419.1"
                     /db_xref="GeneID:11520858"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="JGIDB:Thite2_2111691"
                     /translation="MASYEAVLQGVNVLGPVQESQRKILTPQALAFLALLQRTFNPTR
                     KALLERRKLRQAELDKGALPDFLPETKHIREDPTWKGAPPAPGLVDRRVEITGPTDRK
                     MVVNALNADVWTYMADFEDSSAPTWDNMVNGQVNLYDAVRRQIDFKQGGKEYKLRTDR
                     KLPTLIVRPRGWHLEEKHVTVDGEPMSGSLFDFGLYFFHNAFETVKRGFGPYFYLPKM
                     ESHLEARLWNDVFNLAQDYIGMPRGTIRGTVLIETILAAFEMEEIIYELRDHSSGLNC
                     GRWDYIFSVIKKFRQNSNFVLPDRSCVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAA
                     QIPIKDDPAANEKAMEGVRADKLREVRAGHDGTWVAHPALASIASDIFNKHMPTPNQL
                     FVRREDVSIGANDLLNMNVPGQITEQGIRKNLNIGLGYMEAWLRGVGCVPINHLMEDA
                     ATAEVSRSQLWQWVRHGVTTAEGKRVDKGYALKLLKEQAQELSAKAPKGNKYQLAAQY
                     FSGQVTGEGYADFLTSLLYNEITSAGSPKPASKL"
     gene            complement(1025262..1027294)
                     /locus_tag="THITE_2111697"
                     /db_xref="GeneID:11520859"
     mRNA            complement(join(1025262..1025598,1025678..1026701,
                     1026801..1027294))
                     /locus_tag="THITE_2111697"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651372.1"
                     /db_xref="GeneID:11520859"
     CDS             complement(join(1025409..1025598,1025678..1026701,
                     1026801..1027200))
                     /locus_tag="THITE_2111697"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651420.1"
                     /db_xref="GeneID:11520859"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="JGIDB:Thite2_2111697"
                     /translation="MLRSVRIAGPAARGSLAVPRTAIRPLSTCQKASPSASSHIPVSS
                     PATRRSTPALQQQRHFHGSAIRMAAKTRTESDAFGEIQVPADKYWGAQTERSLENFRI
                     NQPQDRMPPAIIRAFGILKGAAATVNMRYGLDPTIGKAIQQAAKEVADLKLIDHFPLV
                     IWQTGSGTQSNMNANEVISNRAIEILGGTMGTKKPVHPNDHVNRSASSNDTFPTVMHI
                     AAVLEIEGELLPALRSLRAALQAKVEEFEAKKIIKIGRTHLQDATPLTLAQEFSGYVA
                     QLDFGIKRVESALPDLRLLAQGGTAVGTGINTFEGFAEAIAEEVSKMTGTEFKTAPNK
                     FEALAAHDAIVQAHGCLNTLAASLTKIAQDIRYLGSGPRCGLGELILPENEPGSSIMP
                     GKVNPTQCEALTMVCAQVMGNHVACTIGGMNGQFELNVYKPLVIRNLLHSIRLLADGM
                     RSFEKNLVVGLQANEEKIASIMKESLMLVTCLNPKIGYDMASKVAKNAHKKGLTLKQS
                     AMELNALTEEEFDALVKPELMIGPKPYKG"
     gene            complement(1027994..1032320)
                     /locus_tag="THITE_2111700"
                     /db_xref="GeneID:11520860"
     mRNA            complement(join(1027994..1028332,1028404..1028730,
                     1028798..1030563,1030623..1031342,1031408..1032320))
                     /locus_tag="THITE_2111700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651373.1"
                     /db_xref="GeneID:11520860"
     CDS             complement(join(1028112..1028332,1028404..1028730,
                     1028798..1030563,1030623..1031342,1031408..1032090))
                     /locus_tag="THITE_2111700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651421.1"
                     /db_xref="GeneID:11520860"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2111700"
                     /translation="MDTPTTARNQAPRQPLSDATQRLNHATVTNVSRRHQVGDDENYL
                     LSKSNNAARGRSHPVLTSHHPAVEPRPQHVPAPAAVVAEPGPAHPRLSAISRDARDVS
                     DSRRVSQFSNVSSNASSTRQLKTHIGPWQLGKTLGKGSSARVRLARHRVSHQLVAIKI
                     VAKSTAHMTQAGSLANLDRIDYRNPTTAADGGLRRMPLAIEREVAILKLIRHPNIIEL
                     LDIWENRSEIYLVTEYVEKGDLFEFINWNGPLHEEEAIFYFRQIMTALDYCHSFNICH
                     RDLKPENILLKANGQIKIADFGMAALQQDPSHQLRTACGSPHYAAPELLRHQFYKGSA
                     VDIWSMGVILFAMLAGRLPFDDDNMDVMLAKAKRAEYKMAAHLTREAKDLIRRILVDQ
                     PAHRITMKQMWRHALIKKYEYLAEHQNWDDQSQNTVRDLGAAPIPEEIDIQILRQLKA
                     LWHTYSEAALREKLSQDKPNDQKLFYWLLYNHREAQLENYNNNVPVSKSDFHHLKPPN
                     WSKRISTCQFTKPGRNGHPKTVSRFTVISNVPDVDEVGTIRSYDPYNASRVLQPCGSQ
                     VSHAKIIVHRNSPEPGVGPSPTTVSHSYRSYRSVNGSFRQRARTISRRASSASNLKSP
                     QASMSSIRSHHSNPRVRANNRSRRSVDFSSVRSKSRRHRRNRHATLAAPATAAGDDAT
                     PDHDALTAANRADGADARQVAATRSMIEVGDTTDDTFIWSEELEELGHRIARDCDEAF
                     MSSLLLSEPSAAGADSREASPFTLSLGTLPALRSSEGQAPSNESRSGTHPWDNRPLPP
                     VPSQGTTSPLSVRDNGLNIGSVSQTSRPYTLHSSRNVQVPDRRVVSEPLYDRVTKEPR
                     LLPSIYENTPDSWMKRNGGCHESGPTCPETPTHAKNKGFDYLAQAENTIRLVNSPTAF
                     GAEEPVEVPAPLKIQKVSQNTGTHSAFEASLQAPPRRSSCGQQQKTSSIDDRNSGDVL
                     PPKKRVSSWFKRASKEETGGSSFVAVSDSSARSKETLVNSEASRLSRPVSQLTDEPAV
                     RRAQKKKSFGFAFWKGGKEELKMSLGDSDPDDAQGRQEKAIKKRSSKEARQVSGARQS
                     VWSESDGGIRKIEVQQNWLARLFRVKPAMRYLCFNIAKRRARQEVAILLREWRRYGMR
                     DVEVDKERNIIFARVGAKNYLNLKEVSFAVELMTVIEHGRRNQLSIARFTQEKGAASS
                     FHRVVDAINAAFSTRALLVNDKRKVNMMIKTLNS"
     gene            1033550..1037596
                     /locus_tag="THITE_2111701"
                     /db_xref="GeneID:11520861"
     mRNA            join(1033550..1034997,1035066..1035956,1036012..1036084,
                     1036146..1036875,1036948..1037596)
                     /locus_tag="THITE_2111701"
                     /product="SMC5-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651374.1"
                     /db_xref="GeneID:11520861"
     CDS             join(1033672..1034997,1035066..1035956,1036012..1036084,
                     1036146..1036875,1036948..1037317)
                     /locus_tag="THITE_2111701"
                     /note="1| putative SMC5 protein [Sordaria macrospora].
                     Contains conserved domain SbcC[COG0419], ATPase involved
                     in DNA repair, ABC_SMC5_euk[cd03277], Eukaryotic SMC5
                     proteins. and SMC_N[pfam02463], RecF/RecN/SMC N terminal
                     domain"
                     /codon_start=1
                     /product="SMC5-like protein"
                     /protein_id="XP_003651422.1"
                     /db_xref="GeneID:11520861"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="JGIDB:Thite2_2111701"
                     /translation="MLDRTRSNELLNQDDDPHTAPAGKPAESHGAVNPFRYLRLRGGD
                     GSRGLDPGDDGITSDEDGAQPRAGRAAVSRRRNGPPSPEFQPGAIVRVKVRNFVTYEE
                     AEFFLGPNLNMVIGPNGTGKSSLVCAICLGLGYSSSVLGRASAFGEFVKHGNDEAEIE
                     VELYRKPEDSENYVIGLCIRREDNSRRFTINGQRVSHKEVQSFMRSLRIQIDNLCQFL
                     PQDKVAEFAALTPVELLEKTLHAAAPEEMLTWRAQLRDYFKLQKEAEHSGEKIREELR
                     KMEARQQVLQADVEKLRERKAIQKEIENLNDLRVVVRYHEARRKFKEAKARKVEAETR
                     LKRLQNSVAPALQAVNKKQEYQAKVKLVVTDRQHRLQAAEAAADTALAQVDAAEAKCQ
                     ELASKKEAERTNFLSKKQELGRLRKKITDLEASYRRAPKEFDAAEWTRRIREQEHLER
                     DLNDEAKPVQEEIDQLRLKGGETREQLARLRGSLRELESQQGQLLTQLRKINNDVAKG
                     WEWLKDNQDGFVKEVFGPPMLTCAIKDKRYTDLVQSMLQADDFLCFTAQTKEDHKKLS
                     EQFYGKMGLSVTIRSCFTPYSAFKPPLPKEALPALGFDGYVNEYLDGPEPVLAMLCSE
                     KRLHASAVALRDISDEQFDRIQQAENLTQFAAGRQLYRITRRREYGPGAVSTRVTQIS
                     KGRFWADQPVDAAEKTELLRRIEELEAQFTAVKEKYKSAEARKKKIDTDLEEIKKKIL
                     DLRNAKNELQAEYTKWRTLPDKIEAEKGALSRAEEALTACKGRILELEKLQDQAVLDK
                     AKSILQHHKQIHGIRKARQALLEAQFVLMEAESEVIVLKAKNSEITQRLEEEKGSLQK
                     IIAELEEQRTVAGEARQEALNVLTEENKDELAAKVKDKTIEEVDEAIQVEKAKLEVIQ
                     ASNPAALEEYERYAAKIERERANQANQESKLAELNERIQHIMGQWEPRLDQLVSQIND
                     AFSYNFEQISCAGEVGVHKDEDFEKWAIEIKVKFRENETLQRLDQHRQSGGERAVSTI
                     FYLMALQSMAQAPFRVVDEINQGMDPRNERMVHERMVEVACREHTSQYFLITPKLLSG
                     LRYDERMRVHTIVSGEHVDEKGTEKMNFANFAKIQRRLMGR"
     gene            1037597..1038497
                     /locus_tag="THITE_2111702"
                     /db_xref="GeneID:11520862"
     mRNA            join(1037597..1037991,1038092..1038497)
                     /locus_tag="THITE_2111702"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651375.1"
                     /db_xref="GeneID:11520862"
     CDS             join(1037971..1037991,1038092..1038322)
                     /locus_tag="THITE_2111702"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651423.1"
                     /db_xref="GeneID:11520862"
                     /db_xref="JGIDB:Thite2_2111702"
                     /translation="MGAVVSCLESCLRTIGRTIMAIINGIGGIIMAIVSGVVHFLDVI
                     VGCLTCNYCSGSGRRRTGMTTGRRRGFGRRRYAGTTSAI"
     gene            complement(1038563..1041647)
                     /locus_tag="THITE_68668"
                     /db_xref="GeneID:11520863"
     mRNA            complement(join(1038563..1041416,1041473..1041647))
                     /locus_tag="THITE_68668"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651376.1"
                     /db_xref="GeneID:11520863"
     CDS             complement(join(1038651..1041416,1041473..1041538))
                     /locus_tag="THITE_68668"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651424.1"
                     /db_xref="GeneID:11520863"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="JGIDB:Thite2_68668"
                     /translation="MSAAGVAQPAQSAQPVKLSLPLIYQQKLFEELRNEDELVVLARG
                     LGLIRLVTNLLHSYDAAGSNLIVVVGAEDRENAWIGEALAEHAAISMSPRARGLTVVN
                     TDFTSVAAREKMYAEGGIFSITSRILVVDMLTGLLNPETITGVVVLHADRVVATSLEA
                     FILRIYRQKNKVGFLKAFSDNPDPFATGFSPLSTMMRNLFLRKASLWPRFHVHVAQAL
                     EGKKKAEVIELEVPMTDAMREIQNAVMECVEVSIHELKKANTGLDMEDWNLDSALLKN
                     FDVIVRRQLDPNWHRVSWKTKQIVNDLTVLRGMLQSVLSLDAVSFLQHLDTIHAAHSP
                     PPGSTRQTQSPWLFLDAAQTIFDTAKRRVYSSSQRAGPDTANIDALRPVLEEQPKWAV
                     LAEVLSEIDRDLYFEPAARDDSNGTVLIMCSDTNTCRQLRDYLQTMHVKPRTEKKVEE
                     FYDPDTDKPSAAFMMRRKLRNYLQWKREFAQVSATLFSENQKALSGAVDPRLGHSRGR
                     APPNKRRRVRGGGAVGVGPGRLDNGSIAQYFEKPGEVAELMAEVQITEEETKQKEDIV
                     ADPLEDMDDYYQLYEMQDLVVVHAYDGDQDEHILEEVKPKYIVMYEPDAAFIRRVEVY
                     RSSHNDRNVRVYFLYYGGSVEEQRYLSTVRREKDAFTKLIKERASMSVVMTTDAQGVE
                     DPQEAFLRTINTRIAGGGKLAATAQPPRVVVDVREFRSSLPSLLHGRSMIIVPCMLTV
                     GDYILSPNICVERKSVSDLISSFKDGRLYNQCETMFQHYKNPMLLIEFDQNKSFTLEP
                     FADLSGSLASVSASNAGANDLQGKIVLLTLAFPNLRIIWSSSPYETAEIFERLKAQEE
                     EPDPIAAVRAGLDGDAPAEEQVFNAVPQEMLAAVPGVTPKNIMNLVLETENIKEVANM
                     TVEELEPLVGKEAAGKIHGFFAKDLLEDE"
     gene            1041772..1042455
                     /locus_tag="THITE_2111706"
                     /db_xref="GeneID:11520864"
     mRNA            join(1041772..1042035,1042099..1042154,1042218..1042455)
                     /locus_tag="THITE_2111706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651377.1"
                     /db_xref="GeneID:11520864"
     CDS             join(1042104..1042154,1042218..1042379)
                     /locus_tag="THITE_2111706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651425.1"
                     /db_xref="GeneID:11520864"
                     /db_xref="JGIDB:Thite2_2111706"
                     /translation="MDTSKTPEQQKDANKQSTKENPLHKAAENVKAAFQAHSANPGPA
                     IPKQFNVQEEGTKEERRAKAQELNKQ"
     gene            1043001..1045354
                     /locus_tag="THITE_2111709"
                     /db_xref="GeneID:11520865"
     mRNA            join(1043001..1043342,1043400..1045137,1045206..1045354)
                     /locus_tag="THITE_2111709"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651378.1"
                     /db_xref="GeneID:11520865"
     CDS             join(1043133..1043342,1043400..1045137,1045206..1045234)
                     /locus_tag="THITE_2111709"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651426.1"
                     /db_xref="GeneID:11520865"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="JGIDB:Thite2_2111709"
                     /translation="MPSILNDDDRETVKRFVPKQTNKIHAVAVARLYIAYPNRSRWTY
                     TGLQGAVVLANDLVGNTYWIKMVDISPGNRGVIWDQEIFENWNYNQDRVFFHTFELEE
                     CLAGLSFVDEKEAKQFLKKMNDREKNASKATQRTKFGGAAPPSHHKHHHGLFGGLFGG
                     HRHSSAPTPPESPRVSAATRDHRSGSVNGYHELAAPTPPSGFEKLDAFDPQWRENFGE
                     DLKAKGLTDDFIRENQDFIVDFLKQEQASQANQPASSVAQPPPPPPPPTNGSGAGLRA
                     PPPPPPAAAHRSVSETIAAPPAPPAPPPPKRGPAPPPPPAPRRSAKAEAPVQPEPAAP
                     REPSPPPARPRFAVPPPLADAGKYARSEPPRPVPSPPAPGPPPPPRPPKTPVENAEPA
                     HRFGVPPPFTGQRSVPPPPPSRGPVPPPPPSREPTQAHAPATPPLPPKAPAASAPPLP
                     PPSSRPPPSLPARSPVPAPPAPPPLPASSAPPAPPPPPPLPSSNAPPPPPLPPTSAAA
                     PPPPPPPPPPGPGISGIPPPPPPPPPPGAGVPPPPPPPPPPNRDSGYSSSAPAPALPS
                     TDPGRAAMLDSIRSAGGIAALKKVDRSQIRDRSAANVGGGGGDTGPHGSGLPPAGIAP
                     GGAGGGMADALAAALQKRKEKVSRSDDEDDDDDW"
     gene            complement(1045689..1046932)
                     /locus_tag="THITE_2094798"
                     /db_xref="GeneID:11520866"
     mRNA            complement(join(1045689..1046269,1046359..1046516,
                     1046579..1046669,1046731..1046932))
                     /locus_tag="THITE_2094798"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651379.1"
                     /db_xref="GeneID:11520866"
     CDS             complement(join(1046101..1046269,1046359..1046516,
                     1046579..1046669,1046731..1046789))
                     /locus_tag="THITE_2094798"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651427.1"
                     /db_xref="GeneID:11520866"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="JGIDB:Thite2_2094798"
                     /translation="MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVLKMLGN
                     GRLEAMCFDGVKRLGLIRGKLRKKIWINNGDIILVSLREYQDNKGDVILKYSADEARS
                     LKAYGELPDTAKINETDTFGPGEDGDCGFEFDEDRDSDSDAGGASGGNKEISIDDI"
     gene            1047117..1048333
                     /locus_tag="THITE_2111712"
                     /db_xref="GeneID:11520867"
     mRNA            1047117..1048333
                     /locus_tag="THITE_2111712"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651380.1"
                     /db_xref="GeneID:11520867"
     CDS             1047251..1047913
                     /locus_tag="THITE_2111712"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651428.1"
                     /db_xref="GeneID:11520867"
                     /db_xref="JGIDB:Thite2_2111712"
                     /translation="MLQHTSGRLKAPQLAQEAARKLQPLRTPRAQPDSAMPTVITPKS
                     LNDETPSRKIQKFAAQFNIGYPTELRLLRHQGADKFFVRVSLSNRHTFSTYHLKYFTA
                     FEHPFTEKLLHFYRQQKESRPLWCYVHASSADSSRPVVRTTSERMVKAALFRALNAAG
                     YDASGRSLDGSEKALQGTIRIAISEPKKVLQIEFGQLQDYLSQLLSNIVKRLHTFSKP
                     SR"
     gene            complement(1048453..1050948)
                     /locus_tag="THITE_2111714"
                     /db_xref="GeneID:11520868"
     mRNA            complement(join(1048453..1048950,1049026..1049047,
                     1049103..1049425,1049493..1049796,1049904..1049950,
                     1050104..1050156,1050225..1050948))
                     /locus_tag="THITE_2111714"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651381.1"
                     /db_xref="GeneID:11520868"
     CDS             complement(join(1048723..1048950,1049026..1049047,
                     1049103..1049425,1049493..1049796,1049904..1049950,
                     1050104..1050156,1050225..1050540))
                     /locus_tag="THITE_2111714"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651429.1"
                     /db_xref="GeneID:11520868"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="JGIDB:Thite2_2111714"
                     /translation="MHHQASAILGPGSSSRSPFRLPFQQCPRQPDRQKADNLTAMLSD
                     IPSETPPNNLAALAEDHYFSANPPPKDLEKHVALAREFINYHSAANRRLVLITSGGTT
                     VPLEKQTVRFIDNFSAGTRGATSAEYFLEAGYAVLFLHRQFSLLPFSRHYSHATDCFL
                     DFLREGPNGSVVARDEDSAKMLHVLRKYRDARDRNMLLLLPFVSISDYLHELRSVAQL
                     MRPLGPRGLLYLAAAVSDFFVPPDRMSEHKIQSTNAADVFKRTGDANSRPAAEEEETF
                     DNFDSSPSVPRSKRLVIDLDPVPKFLKNLVEGWSPQGMIVSFKLETDPTILVHKARYS
                     LDRYQHHLVIGNLLSTRKWEVVFVSPGAPDRWIRVPFRKSGVASTAPALETEKDEPLD
                     PKSLPEAEPEVEIESLIIPAVRDLHTKYINSLEEKGRA"
     gene            1050949..1052374
                     /locus_tag="THITE_2111719"
                     /db_xref="GeneID:11520869"
     mRNA            1050949..1052374
                     /locus_tag="THITE_2111719"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651382.1"
                     /db_xref="GeneID:11520869"
     CDS             1051357..1052172
                     /locus_tag="THITE_2111719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651430.1"
                     /db_xref="GeneID:11520869"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="JGIDB:Thite2_2111719"
                     /translation="MHTTKISGLAVDTEYTFHLVLRTTAGTYSSPRVTVRTHKMTDLS
                     GITITTGILPPAVREGLTAAVERIGAKIVDGVRIDTTHFVTTEGRGVQWEKANELNIP
                     VVRPEWVEACERNGRILGVTKFYLDAVRVGPMFDERPGTGGTAGTTTASPASAPAPPP
                     PPPEKDTPQNQASSSSQPPQPAPEAVPKKEEGGGAESDSSDDAEDEEAKVPPSGQDEQ
                     KVLADERNQKRLAARPKPTVEDDGETAEDKAASEDEKGRKSPGDGSSFQDVAL"
     gene            complement(<1052578..1054290)
                     /locus_tag="THITE_2149730"
                     /db_xref="GeneID:11520870"
     mRNA            complement(join(<1052578..1053688,1053731..1053942,
                     1054009..1054290))
                     /locus_tag="THITE_2149730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651383.1"
                     /db_xref="GeneID:11520870"
     CDS             complement(join(1052578..1053688,1053731..1053942,
                     1054009..1054083))
                     /locus_tag="THITE_2149730"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651431.1"
                     /db_xref="GeneID:11520870"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2149730"
                     /translation="MAPPVDPGIRKRVLRVIFVSLLLDLISFTFILPLFPKLLEFYRN
                     AEAPVDAAQPQSRTLLSAVLGYLNAYKAAFSRPIDSRYDIVLLGGALGSLFSAHSAIR
                     SLLQAVASPVIGHLSDKHGRRTALLASMAGNILSVLLWVMAVDFRTFLASRIVGGLSE
                     GNVQLATAIATDISDVNSRGSTMALIGACFSVAFTFGPALGAWFSSIATVAANPFATA
                     AGVSLFLIVTETVYLYFALPETLPSMTRANGAASAGNDEAKAAPLKAQRTNSHFLLNF
                     VHLAFLLFFSGMEFSLPFMTYDLFGYSSAKNGRLLGYVGLVASILQGGVTRRLPPLLS
                     VRIGVLACLAAFLLLARISTVSGLYLAATCLATTSATVVTGLNALSSFEASENERGGK
                     LGVLRSWGQLGRGLGPVLFTSVYWWAGRETAYAMGALGIAGVATLVLFGLKTPPGSVK
                     HGVGAKTLKAERKEL"
     gene            1055506..1057054
                     /locus_tag="THITE_2111723"
                     /db_xref="GeneID:11520871"
     mRNA            join(1055506..1055816,1055878..1057054)
                     /locus_tag="THITE_2111723"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651384.1"
                     /db_xref="GeneID:11520871"
     CDS             1056241..1056888
                     /locus_tag="THITE_2111723"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651432.1"
                     /db_xref="GeneID:11520871"
                     /db_xref="JGIDB:Thite2_2111723"
                     /translation="MKTAAAALGAFAAQVAAHWIEGGGQAGLTLTLGSPTISLPYPTW
                     KPHPGPPPHKWTTSTVWTTSISTIVSCAPVVTHCPAHSTVLTTVTIPVSTTVCPVTET
                     TAAPPPPPTSVAPPPPPPPPPPPPATTYTHPHSASPAPPPPPPPPPVSSPTVAPPPPP
                     APVITSQPTLTQSVGTITPPSKTSTGQVAVTAGAAHNAHRAGGALAAIAVAAALL"
     gene            complement(1057639..1059914)
                     /locus_tag="THITE_2111726"
                     /db_xref="GeneID:11520872"
     mRNA            complement(join(1057639..1057971,1058030..1059914))
                     /locus_tag="THITE_2111726"
                     /product="glycoside hydrolase family 47 protein"
                     /transcript_id="XM_003651385.1"
                     /db_xref="GeneID:11520872"
     CDS             complement(join(1057852..1057971,1058030..1059619))
                     /locus_tag="THITE_2111726"
                     /note="CAZy_ID 269931"
                     /codon_start=1
                     /product="glycoside hydrolase family 47 protein"
                     /protein_id="XP_003651433.1"
                     /db_xref="GeneID:11520872"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="JGIDB:Thite2_2111726"
                     /translation="MTAVDRRLGRVLLAAAVFLLSLRLLLPAGPRHLKTSHPQINFRP
                     SSFDWTSVAQRYPVSSIRPLPTGRPKQFPPVQHAFRGYVHDATTKRRQEAVRAAFVRS
                     WDSYKTYAWLQDELAPVSGGGKTTFGGWAATLVDSLDTLWIMGLEDEFYVAAAAAAQL
                     DWANTTETAVNVFETTIRHLGGLLGAYELSGVPALLKKATELGDMLYMAFDTPNRIPG
                     FWLNFQNAKQGLQTAGTNDPSASPCSLSLEFTRLSLLTGDAKFYDAVARISDFLERTQ
                     SQSKLPGMWPKLINFHDETVDDDNGFTLGALADSLYEYLPKMAALLGGRVPSYEKMYR
                     AAMRVAKEHLLFRPMVAEHDEEGRNILFAGDAYVHPDHIDHVPEGQHLSCFTGGMFAL
                     GGKLFNVPDHVAIGERLARGCAWAYDAFPTGLMPEIFNIVPCSSIDGPCPWDEERWQK
                     EGDQKLKKGFKNARDPRYILRPEAIESVFLLYRMTGKEDLRDLAWRMFEAVMGATKTA
                     LANSAIADVTVEGETTKTDSMESFFLAETLKYFYLIFSPPDLINLDEFVLNTEAHPLR
                     RAK"
     gene            <1060595..>1062522
                     /locus_tag="THITE_2142870"
                     /db_xref="GeneID:11520873"
     mRNA            join(<1060595..1060797,1060872..1061648,1061766..>1062522)
                     /locus_tag="THITE_2142870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651386.1"
                     /db_xref="GeneID:11520873"
     CDS             join(1060595..1060797,1060872..1061648,1061766..1062522)
                     /locus_tag="THITE_2142870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651434.1"
                     /db_xref="GeneID:11520873"
                     /db_xref="JGIDB:Thite2_2142870"
                     /translation="MSTLMRTLLITLWAGRALGAVCNSNGTSVIALPITDIAVDPSIP
                     DSLMRGIPSRIGTPPQHIVVLPWPDLNNTYIYDQEAYCDPSIIWNDKICEIRRGGYFY
                     EANSTSFTKYSDLVASGGATQELGTRGAELGVPKLLSTSLAGTERFAAGTSNFTTMPI
                     GIPRMRWDNGYTILHALGLGSNSTYLNALVESQQIGSRVWSIFWGRMWTGSAATDLDG
                     SVVLGGYDQEKVIGRNVTQPLDYSEETGCWTGMKVTVSNVLVNFRNGTDYSIMPRNSA
                     VECCIVPQRQLVWEAPVDMVDAFERATQMNSTGLSYGLHWGARQYDASGNIFDGDVTF
                     VLSSGLQIRVPNNQLITPFVEVDRNGSRLVHQSPKELLMGGVSDNPTTLGRYFFTAAY
                     LMVDHEAHTFTMWQANPTTKSNLVPVARTSTDNADGACGGDSGGTGDTGVANGGDSAG
                     EAASKASSSISAGAVAGAAVGGVAALGALAALIFILLRRKKKRAMVTSGQPPPADASG
                     VNPGEPDEIYYKTDMSGIHEMPGISDSHRELHGVSVAPLGNGAWANGERPRPSFTAYE
                     LEAAGLSSGYRT"
     gene            complement(1063148..1064710)
                     /locus_tag="THITE_2111729"
                     /db_xref="GeneID:11520874"
     mRNA            complement(join(1063148..1064409,1064474..1064710))
                     /locus_tag="THITE_2111729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651387.1"
                     /db_xref="GeneID:11520874"
     CDS             complement(join(1063505..1064409,1064474..1064519))
                     /locus_tag="THITE_2111729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651435.1"
                     /db_xref="GeneID:11520874"
                     /db_xref="JGIDB:Thite2_2111729"
                     /translation="MEPSLDVEIEKLQSKISSIKEQLRIHASTLITAPSTRQLLTEGE
                     QALRNGSDNGAPRKKLSLKQKLLNHSTLQQAHTQQCLYRACAAITTFRAQDPDPRAVD
                     GGAILGLRIEVASRARFLRPYYVLLNRPYPGGSRHLRVHRHTLPPCIPLAGLAGRYLP
                     PPPATGKAKASDEGAGSGRAKPQDLARFARSLRREVVRYHHRLGVVADLRKAAGLGGR
                     KKMEEGDGQGGEEDGEDGREGQPQGIRLVDITPADAEVKQLTIEWADGRTGRLVMGDD
                     GEILKLVVVGENGRDREAGRDFLGGAVRVEDVVRRLATLV"
     gene            1065752..1067815
                     /locus_tag="THITE_2111731"
                     /db_xref="GeneID:11520875"
     mRNA            1065752..1067815
                     /locus_tag="THITE_2111731"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651388.1"
                     /db_xref="GeneID:11520875"
     CDS             1065851..1067587
                     /locus_tag="THITE_2111731"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651436.1"
                     /db_xref="GeneID:11520875"
                     /db_xref="JGIDB:Thite2_2111731"
                     /translation="MGAKSRRAKSPTTPNGSLGRTSGRKHNGHAAGMNSNVELLRRNI
                     SHETSTSEGAAANLMARDTFSLDDPVPKQPTINNHGFFDLPPKDQRNFGLLVLLYFLQ
                     GIPLGLATGSVPFLLKNHMSYGEIGIFSLASYPYSLKLFWSPIVDAVWSPKVGRRKSW
                     IVPIQLLSGIGMLWLGSRIESMMELTGKPGGPSVWGFTAWWFFLVLMCATQDIAVDGW
                     ALTLLTPGNVSYASTAQTVGLTAGQFLSYTVFLAFHSKDFANKWFRTEPLDHGLLSLG
                     GYLNFAGWAYIVVTVGLALLKREEKTRNEDGIWDVYKIMWGVLKLKNIQTIILVHLIA
                     KIGFQANDGVTGLKLLDKGFGTDNMALTVLIDFPFEIGLGYYAGKWSQEYTPMRLWCW
                     GFAGRLAAAVLAQFIVSIFPAGGVTSWYLLAVIAQHVFSTFTNTVMFVAVAAFHARIA
                     DPVIGGTYMTLLATVCNLGGTFPRFFVLRMVDYFTSATCIPGSSSEPTSAAAAVTEPF
                     SCAVQADKERCLAGGGTCEMHRDGYYIVNILCVLIGVVTFVLFIRPKVLQLQALPLWA
                     WRLSSAPSASKY"
     gene            complement(<1068072..>1070180)
                     /locus_tag="THITE_2043513"
                     /db_xref="GeneID:11520876"
     mRNA            complement(join(<1068072..1068466,1068521..1069003,
                     1069073..1069513,1069569..1069762,1069834..>1070180))
                     /locus_tag="THITE_2043513"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651389.1"
                     /db_xref="GeneID:11520876"
     CDS             complement(join(1068072..1068466,1068521..1069003,
                     1069073..1069513,1069569..1069762,1069834..1070180))
                     /locus_tag="THITE_2043513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651437.1"
                     /db_xref="GeneID:11520876"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2043513"
                     /translation="MSDHGWVTTSPPAGAGDCIAAQAAGVFTTDEMRAALPANGNNTA
                     DKKPEAPPGWVAATPYDYNAYADSGAHEWESNAAKYEFDGETGDVGPEFPDLEIELFG
                     EPGTRAKEGIDFSKIASIELFQEGPARVNPIASFQDAGLHPVMLKNVELAGYRNPTPI
                     QRYCLPAIHLGYDVIGIAQTGSGKTAAYLIPILNKLMGKAKKLAAPRPNPATYQPGID
                     PPVRAEPLVVIVCPTRELAVQIFNEARKFCYRTMLRPCVVYGGGSYKDQAAQLQKGCD
                     VLVASPGRLVHFMNDPRILTLRRVRYMVIDEADEMLDQDWKDDLDKIMSGGEGNINYM
                     LFSATFPKGARELAKTHLAETHVRLRVGRAGSSHENIKQNIIYVDPSMKKQALIDLIR
                     SLPPTRTIIFVNSKRTAEEVDDYLYNLGMPCTSMHSDRTQKEREASMRGFRSGKWPIL
                     IATGVSARGIDVRNVMHVINYDLPSMDHGGIEEYTHRIGRTGRIGHRGLASSFYSDRD
                     EPIASVLTRTLIETNQEVPDFLQSYIPEGASATNLKFEADSDFEDEAAGTGGGDAGAG
                     EGGWGADTDQNAGGDTGVGGDGWGSGHANGNGDGWGAVASNSAEVDAATSSNW"
     gene            complement(1071783..1073212)
                     /locus_tag="THITE_2111737"
                     /db_xref="GeneID:11520877"
     mRNA            complement(join(1071783..1072727,1072781..1072853,
                     1072906..1073030,1073150..1073212))
                     /locus_tag="THITE_2111737"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651390.1"
                     /db_xref="GeneID:11520877"
     CDS             complement(join(1071853..1072727,1072781..1072853,
                     1072906..1072953))
                     /locus_tag="THITE_2111737"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651438.1"
                     /db_xref="GeneID:11520877"
                     /db_xref="JGIDB:Thite2_2111737"
                     /translation="MGSSAKKKKEKKKNFQKPKLKVGKAKPKASNFTDTSFKSKSIVV
                     NQQTLAADGADPTEKFKLNLSLAVNAKSDNQRRDALAYITSQLSASPPCNPVGTSGVL
                     TKLLPLMSDGSASVRAQFLKLLRALPPAEIGSHVEKILMYIRGGMTHLSNDIRSDTLN
                     VLEWLLEVAGSEAVSCPGGWLKTLNSFSSMLGWNPSVGSAISNKGWTSASRATLGTKK
                     GPEARTRQIQVLAKFLQTGFRPEAPVPYSRTAYWDNIYRLPGTPNPFAYLNLFGTPRD
                     EDSEMYPDRISRQRIFDAKWRAAIFAGMNDAKKEGGMVGRAAATLDRALSCGLEV"
     gene            <1073378..>1073845
                     /locus_tag="THITE_33410"
                     /db_xref="GeneID:11520878"
     mRNA            join(<1073378..1073668,1073741..>1073845)
                     /locus_tag="THITE_33410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651391.1"
                     /db_xref="GeneID:11520878"
     CDS             join(<1073378..1073668,1073741..1073845)
                     /locus_tag="THITE_33410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651439.1"
                     /db_xref="GeneID:11520878"
                     /db_xref="InterPro:IPR004942"
                     /db_xref="JGIDB:Thite2_33410"
                     /translation="SGPDALEEALGRLSKKAGVRATIVLDRASGTILKTSGQISSIRS
                     SKASGSSVPVVGSFPGEANGNNNGQDQGAEELASMVWNFVATAGSFVQELDAEDEVKL
                     LRLRTKKQEFVIVPDAKYLLIVAHDTSSA"
     gene            1074665..1078992
                     /locus_tag="THITE_56802"
                     /db_xref="GeneID:11520879"
     mRNA            join(1074665..1074839,1074943..1075391,1075874..1077731,
                     1077797..1078291,1078388..1078992)
                     /locus_tag="THITE_56802"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651392.1"
                     /db_xref="GeneID:11520879"
     CDS             join(1075080..1075391,1075874..1077731,1077797..1078291,
                     1078388..1078926)
                     /locus_tag="THITE_56802"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651440.1"
                     /db_xref="GeneID:11520879"
                     /db_xref="JGIDB:Thite2_56802"
                     /translation="MAPFSVLRRTPRGRNDRESRNDRNDVKTADDTPQEDGRRDGSTA
                     VGRPKDAGDGNETAETKGRRGLNRELLHNLRSRLTGNQRLAARQPVSSSRAPLGQDAT
                     TTVSETSTPLSPRAPVNANKPLPSPPPPGSEQTRDPPARPVLKLARIMATLTDSEIEK
                     LFSGAPQFFARSEGHYTGAPHPSVAFPWDEELEIRDLTDHTQIEDKAWGSVTAWPHIT
                     RDVNSDRSAAQRASEEKRRAHFLPRCRERPNMLSMAGLEKGSVGYQAALELAVADALQ
                     EEQWGFEGLAGRLPAIVEQRRKMLTSKDGLRHVDETLIMEQLIKNGQRYNEKHLRERR
                     VSSELYNELFLQILHAPTKVLDHRDPYSLAVQILALVKILAAPNMWIDFSQVEWRVRL
                     GQLLWENPVEDDSGKDRPSNETADSASDIHEERYWLLLQILLACELLIRLDTITEGEE
                     AGMESIRPAEIHRFDKDANKSVKWSLILARVWLENIEVVKTEAAEPTNSEEKPSGWLA
                     TLTKRMSLGRDHGSHGHHSRGPVYAIRGKHVQRQVDGLAHFASRLRWPGADPYVLKIS
                     DNCRSVVEGTPLSTPLASPSTRGESRHSFDFGAPKTETSPRRTSSRPRKISAALHPSG
                     WLSKSYVSGLMLPGETVCHLLMATLLENDPEALSRLGPMANFCGGFVYSGKSFWSTAC
                     IVGRVLAAGKGAVECMGWISSDITPQGLGDGWVDVRAEKTAEDAFQVDKKARLWGKKA
                     IEKESNVLGDADPSSVLPADFIIPFENIYRDKTPPVINIELKTLSLRAPVDFVHTSPT
                     EDYGATSVSDASRPSPIHTYAAAVTFTVTDVESGEVKDYTYKLAKDIIFVTAHPCVPS
                     QHVKIMKSPSSPTIRQVDLSGNNVAGKTASVVGHPLHKYYTYTALHLSELLTKQDFSL
                     ESLLGSYSSASHRPSLTPAPNSSTARVLVVDCITGFQPQPQEHEIPLSPVLSRTGSNA
                     SAAPSPAVPPPGGEEGSVAGAGGGDRLAGALESASKKMHSESRRRQFGSDMEMLARAF
                     CAEKGWNALISRRRRGCLACAIREAGALGWKVIIRVD"
     gene            complement(1078966..1080346)
                     /locus_tag="THITE_2064646"
                     /db_xref="GeneID:11520880"
     mRNA            complement(join(1078966..1079296,1079441..1080346))
                     /locus_tag="THITE_2064646"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651393.1"
                     /db_xref="GeneID:11520880"
     CDS             complement(join(1079206..1079296,1079441..1080234))
                     /locus_tag="THITE_2064646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651441.1"
                     /db_xref="GeneID:11520880"
                     /db_xref="JGIDB:Thite2_2064646"
                     /translation="MRFFSITNTFLSYCAASAVAAAVLPAASDRELRIPTSYESAVLG
                     RRILALTPLGTLSTVFPREEDSDGASAQMHHRPSGLGGLPYGLMEYIADCEDDDLGNP
                     TILAITIGTTFRNAAAGSNVSLAVQWTPPHPPAKRIKSGTQRSWLSRLGLTRAGPNDD
                     YDYDDETAEQHHKHRSIALPYSAANLPRFSLIGYLEPIDGGDDRTGDVGARLARCFVD
                     SHPDAKYWLPGNPIHEAHFVRLVVQQIYWVGGFGDRAFIGWIPVEEWRNVSRTEWQKA
                     RLPGEKKGWKEWSVWTDL"
     gene            1080869..1081748
                     /locus_tag="THITE_2111745"
                     /db_xref="GeneID:11520881"
     mRNA            join(1080869..1081081,1081148..1081161,1081274..1081328,
                     1081398..1081473,1081539..1081748)
                     /locus_tag="THITE_2111745"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_003651394.1"
                     /db_xref="GeneID:11520881"
     CDS             join(1081062..1081081,1081148..1081161,1081274..1081328,
                     1081398..1081473,1081539..1081562)
                     /locus_tag="THITE_2111745"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_003651442.1"
                     /db_xref="GeneID:11520881"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="JGIDB:Thite2_2111745"
                     /translation="MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRLTYTRRF
                     VNITLTGGKRKMNPNPGS"
     gene            complement(1082010..1083472)
                     /locus_tag="THITE_2111746"
                     /db_xref="GeneID:11520882"
     mRNA            complement(join(1082010..1082334,1082419..1082817,
                     1082886..1083277,1083339..1083472))
                     /locus_tag="THITE_2111746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651395.1"
                     /db_xref="GeneID:11520882"
     CDS             complement(join(1082086..1082334,1082419..1082817,
                     1082886..1083086))
                     /locus_tag="THITE_2111746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651443.1"
                     /db_xref="GeneID:11520882"
                     /db_xref="JGIDB:Thite2_2111746"
                     /translation="MSRNLNFLRSSLRLGYRFSSRSFLTELLEAAFAPTWDVWYGRRR
                     HEVMPHQKDLLDPKRIPGDPDFQGAVLACPWVNVGLVLEAQQKWCRRNGGPGMLLANS
                     TPPSATVHHALTDVAARFEEDWEAFQADCPAFFSCQHADHIPTEIWRRTFPREATWIE
                     LHPSTKIPSRLLTGPFDWETARMWFWCVRGGATLRQEMWELTGKGYDNIAAASDRQLA
                     LVIFLLLAQMDAFSHWPLFLIEQKLDAARQLQQTAPPADRLLWQFAGTVLENYGDGAR
                     LPKPNG"
     gene            1083485..1085526
                     /locus_tag="THITE_2111749"
                     /db_xref="GeneID:11520883"
     mRNA            join(1083485..1084223,1084296..1084924,1084992..1085526)
                     /locus_tag="THITE_2111749"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651396.1"
                     /db_xref="GeneID:11520883"
     CDS             join(1083648..1084223,1084296..1084924,1084992..1085385)
                     /locus_tag="THITE_2111749"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651444.1"
                     /db_xref="GeneID:11520883"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="JGIDB:Thite2_2111749"
                     /translation="MPPALKPAAPSRRLLRFLRAQSESLVFADSASRLPNRRHACICT
                     KAKPSTKLVRTPAPRRRPALQAAFLHIDAILPKALTKQRTAAGSKSQDLSPPGGAPRY
                     ASSAQTPRQDGTRLTWQEWLFGPDPKKEREPLKEGDIRVQLEEESGSIFQRRSLTAKA
                     AMDPRLRCTEVDGNGNVIMVDGELKKSELIAKYGLLPRDLRKIDSSNLPHILVRPSAI
                     LLNLLHLKVLIKHDRVLLFDVYGSTSSYPQSAFMYDLQGKLQQKQTAGANSLPYEFRA
                     LEAVLMSVTTELEADFESVREPVIRILSELEDDIDREKLRILLVLSKRVSTFEQKAKL
                     VRDAIEELLEADDDLAAMYLTEKTHDLFRGEDDHTEVELLLESYNKICDEVVQEASNL
                     VSSIRNTEEIIRAILDANRNSLMLLDLKFSIGTLGLAMGTFLAGLYGMNLENFIEETK
                     WGFGTITAFSSIFSLMVCWYGLVKLRKVQRVKMNGGVLRSQSHWLREDGTDLLLDPSN
                     RERLRRINMMKYAKQAQTRRWPFR"
     gene            complement(1087783..1091001)
                     /locus_tag="THITE_2111751"
                     /db_xref="GeneID:11518938"
     mRNA            complement(join(1087783..1088282,1088394..1090031,
                     1090093..1091001))
                     /locus_tag="THITE_2111751"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651397.1"
                     /db_xref="GeneID:11518938"
     CDS             complement(join(1088005..1088282,1088394..1090031,
                     1090093..1090531))
                     /locus_tag="THITE_2111751"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651445.1"
                     /db_xref="GeneID:11518938"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="JGIDB:Thite2_2111751"
                     /translation="MMSAGIHEPPYSIHLARNAPYNLPLAALASSSSSSLWSDVASQH
                     SDDSVSTAATSDSDSSDSHYFSRAPTSSQTSVSSLGSSCESAIHPHGTCVKHQAQAHA
                     QVELPAELRQNPRRTGTSATSRTGRPPSLVRQADRKVSFVENLVETSTHIVEAIWPTS
                     SVPSRHDGGGKAVLPLRKFIEETLRRSRTSYSTLQVALYYLILIKPHVPVAYDFTTEQ
                     PNDCPSSQAIQCGRRMFLAALILASKYLQDRNYSARAWSKISGLNTLEINQNELVFLL
                     AVNWKLHLTEEIYKRWADCVSNLTPTQPPSPGGAAQQLYEQQCYEFRRIILNLTPDLD
                     NLEDLAPWSPTRTHTQELPPRSLYTPPAERAGAFASDVELATPFKPHGLPAVMEPVPS
                     MTHASGRLAPALGLLPTPRLTPQTSGFSTPAAGAASSVLGRSSSMGFAMAQASASIVA
                     QSMDRWPPSAASSPLSYVTRRSSLANSVSTASSPESMISDSSRVSRSSSISSASSVSA
                     PSTRMDVQARCRYGKPYGDRLSLRPAIASVPEDDEAAYLMASPEPYAVPTGKESCFVS
                     SDMPLARGEREMDDAARALQELQRHGAGRPAVQVKAGSKRSRALSMENSLQDDVREML
                     ASQHKSNSSWPETMVHVRAGASRRSSQVSVLKGSGHKRICCSTEAALPLRIPSLHPAV
                     GGYGGPGMWEGHTLVLLLFSCIVPFWGVVAEGGLDEFFDSSYQPWRHLAHRRLRWQAK
                     GNERKVRYVLGLHAWSWIMGTWALGAGEGGILSNSLGKAGCCVR"
     gene            complement(1096295..1099183)
                     /locus_tag="THITE_2111758"
                     /db_xref="GeneID:11518939"
     mRNA            complement(join(1096295..1096779,1096840..1097097,
                     1097166..1097526,1097578..1097988,1098673..1099183))
                     /locus_tag="THITE_2111758"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651398.1"
                     /db_xref="GeneID:11518939"
     CDS             complement(join(1096731..1096779,1096840..1097097,
                     1097166..1097526,1097578..1097988,1098673..1098898))
                     /locus_tag="THITE_2111758"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651446.1"
                     /db_xref="GeneID:11518939"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2111758"
                     /translation="MSAEEDLIDYSDDELNNDTAAAAANGKKGDAGAAGQNVDKKGSY
                     VGIHSTGFRDFLLKPELLRAIADCGFEHPSEVQQTCIPQAMLGGDIICQAKSGLGKTA
                     VFVLTTLQQVEPVAGECSVLVMCHTRELAFQIRNEYNRFSKYMPDIKTGVFYGGTPIQ
                     KDAEILKNKETHPHIIVGTPGRLNALVRDKNLRLGSVRMFVLDECDKMLDQIDMRRDV
                     QEIFRATPQQKQVMMFSATLSDEIKPICRKFMQNPTEHYVDEDTKLTLHGLQQYYIPL
                     EEREKNRKLNELLDELQFNQVIIFVKSTLRATELDKLLRECNFPSIAVHSGVSQEERI
                     RRYKEFKEFNKRICVATDVFGRGIDIERINLAINYDMPADADSYLHRVGRAGRFGTKG
                     LAISFVTTDQDKDVLQQIEKRFEVALPEFPKEGVDASTYMAA"
     gene            1099192..1100358
                     /locus_tag="THITE_2111763"
                     /db_xref="GeneID:11518940"
     mRNA            1099192..1100358
                     /locus_tag="THITE_2111763"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651399.1"
                     /db_xref="GeneID:11518940"
     CDS             1099450..1100004
                     /locus_tag="THITE_2111763"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651447.1"
                     /db_xref="GeneID:11518940"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="JGIDB:Thite2_2111763"
                     /translation="MAKGKTGGGVQNRAIYSRISFLQQAAVALSRAGHAHTGPRGEGA
                     AQCTSAVNNPHPLASDSGRDKPAPAHLEAMGRRLATDLRAVSLKTRIRLKPAVKHTIC
                     KFCDSVLIDGESCTSIIENKSKGAKKPWADVLVRRCHTCGGERRYPVSAARPSRKTER
                     GLGGGSSHLQQPAHKGSAMPEHQS"
     gene            complement(1100331..1101175)
                     /locus_tag="THITE_2111764"
                     /db_xref="GeneID:11518941"
     mRNA            complement(join(1100331..1100543,1100720..1101175))
                     /locus_tag="THITE_2111764"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651400.1"
                     /db_xref="GeneID:11518941"
     CDS             complement(join(1100418..1100543,1100720..1100803))
                     /locus_tag="THITE_2111764"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651448.1"
                     /db_xref="GeneID:11518941"
                     /db_xref="InterPro:IPR013183"
                     /db_xref="JGIDB:Thite2_2111764"
                     /translation="MATRNFNTSTAPRQSMASSRGAVKARQLAQLHSQLTQLSANLAD
                     MENLLRMTSVQAESMRGLGSWHAGL"
     gene            complement(<1101463..>1101636)
                     /locus_tag="THITE_34490"
                     /db_xref="GeneID:11518942"
     mRNA            complement(<1101463..>1101636)
                     /locus_tag="THITE_34490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651401.1"
                     /db_xref="GeneID:11518942"
     CDS             complement(1101463..>1101636)
                     /locus_tag="THITE_34490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651449.1"
                     /db_xref="GeneID:11518942"
                     /db_xref="JGIDB:Thite2_34490"
                     /translation="ELGSRLQKTTGKKTYSTRDSLVVTDPTTDLAVGSLSRGERTGSR
                     VFYRLWPYVIGLH"
     gene            complement(1103061..1106580)
                     /locus_tag="THITE_2111769"
                     /db_xref="GeneID:11518943"
     mRNA            complement(join(1103061..1105158,1105225..1105657,
                     1105741..1105781,1105858..1105978,1106283..1106580))
                     /locus_tag="THITE_2111769"
                     /product="2-dehydropantoate 2-reductase-like protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651402.1"
                     /db_xref="GeneID:11518943"
     CDS             complement(join(1103499..1105158,1105225..1105657,
                     1105741..1105781,1105858..1105978,1106283..1106319))
                     /locus_tag="THITE_2111769"
                     /note="1| 2-dehydropantoate 2-reductase [Grosmannia
                     clavigera kw1407] Contains conserved domain
                     PRK08229[PRK08229], 2-dehydropantoate 2-reductase"
                     /codon_start=1
                     /product="2-dehydropantoate 2-reductase-like protein"
                     /protein_id="XP_003651450.1"
                     /db_xref="GeneID:11518943"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="JGIDB:Thite2_2111769"
                     /translation="MAPMAPRLRVLSVGGNSVSAFLSWRLQATNACDITLVWKTGFDH
                     VSQYGISFKSAVFGNERFKPRHVVRTPEEAATRREAPFDYVILCVKALPDVYDLASVI
                     DSVVTPQHTCILVNTTHALGLESAIEERFPTNVVLSLVCGADLTQLGGSEFEHKGSTE
                     LWIGPANKNPNIPPSIQEDMAQALAMTLNTGQVDCKVSSNIRQQQFERVIGPIAFHPL
                     TVIFETPNYAALLEKVGVSKLVSDIMDELLALAQAHGCKFPPDFKQTTIDQFARSNTE
                     NIMWQDYSARRPMEVETYLGSPVRLSQDTGTSVPRIETLYAVLHNLNLVNRSRPKVDP
                     AVAAPAQPGSPSATPSPVPRMSAQGPPRPGPNGLPNGNGMPPMRPRPRGSSSMGPLGP
                     GMRRPQPSMNGGPPNGYPRMPSNGRTPSRRSSMDGTDLEEFSHLVLYDDIPEGGEPSY
                     PQSDPHELALRERELQLRQRELALREQEMRMRRAAGPGPRRGPPPPMWGGGMYDDDDE
                     DDDYFDPTSAPVGPMIDPDNFDMMSVTSRKNRKAPSSAAQFRKNPEHDSGPPRSKFRP
                     SFGRNRSSQIMNTIPGLHEDIMDDPLLGFTSNRYGAVDRGAMHAGSRANSLTAARLDE
                     LQYNQGPPPTGMNGNAPRRSSQSPGNPYSPSIRGGPSGRPSPPNGYPAQQMNGRPSPP
                     EGVRQPMPRYPPGHGNVVAPQQVEQHAGVSALHPPKTNSARSLTGSASASAGSGESTN
                     LDSERSAHSSQSSLGPRPPVGVR"
     gene            complement(1110206..1112076)
                     /locus_tag="THITE_2111773"
                     /db_xref="GeneID:11518944"
     mRNA            complement(1110206..1112076)
                     /locus_tag="THITE_2111773"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651403.1"
                     /db_xref="GeneID:11518944"
     CDS             complement(1110462..1111886)
                     /locus_tag="THITE_2111773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651451.1"
                     /db_xref="GeneID:11518944"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2111773"
                     /translation="MPKNSVLSSETELQDGIYELTSRAAAPVSARTDEADAKSTKTMA
                     TVGGAAPLLGTSKAASASDGPVQAGNLEDHYPEGGIRAWLVVLGCWLALFTSLGFMHI
                     LATFQAYLSPAQQIQLRPGPVAGAIFGYASLSLLLGIYVGPLFDKYGPRWLILAGTVC
                     SVASLLFVSIGTEDWQLFVALGILSSLGSAFLFTPAIAAVGHFFKDRRGFATGVATTA
                     CSASAVVFPFILQALFVRVGWAWAMRALALICFAITVAANFLIRARLPAARDANPHPH
                     GRVFRTKGFAATVLAVVLAQFASFLPLSYMSSYALSKGFSEADSFNTVAILNASSLVG
                     RVVGGWSADKIGPFNVSAMLSAIAALACFGIWLPAGGTKAGITIFAVIFGCASGSSVS
                     LVPVSVGRLCKTQEYGRYYGACYTVASLVSLFAIPAAEGVLREDLGSYWALIVVTGMF
                     YVAAAATFVATKLTVTGWRIWAAF"
     gene            complement(1112548..1113983)
                     /locus_tag="THITE_2111774"
                     /db_xref="GeneID:11518945"
     mRNA            complement(join(1112548..1113717,1113780..1113983))
                     /locus_tag="THITE_2111774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651404.1"
                     /db_xref="GeneID:11518945"
     CDS             complement(join(1112975..1113717,1113780..1113852))
                     /locus_tag="THITE_2111774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651452.1"
                     /db_xref="GeneID:11518945"
                     /db_xref="JGIDB:Thite2_2111774"
                     /translation="MPKERNYNPVQALRKAEKAKAIKKGKAEKQARRNEKLAKRNPAR
                     IQQQIDDLKAIKEGGGKLTAHEEQALEALEKDLKAVKKAREALGDKAPQFGHGPPREG
                     QRGDGVLGKRRRDAEDASSSDSDVPEDVRSIPMPRDTPPPIPKEILDEWYAKRRAKRN
                     AERAPEAEQSQASQKPAAPVIESKTVYEAQPVLRDLRKEAVSAFVPTAVRMKIEKGKG
                     KAGLLEPEEADQLEKEGYLPAPERIRQQENQVQPRRETGPRGVTMEEVEEEEG"
     gene            1114256..1116866
                     /locus_tag="THITE_2111775"
                     /db_xref="GeneID:11518946"
     mRNA            join(1114256..1114459,1114515..1115116,1115189..1116227,
                     1116292..1116866)
                     /locus_tag="THITE_2111775"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651405.1"
                     /db_xref="GeneID:11518946"
     CDS             join(1114534..1115116,1115189..1116227,1116292..1116649)
                     /locus_tag="THITE_2111775"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651453.1"
                     /db_xref="GeneID:11518946"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2111775"
                     /translation="MASFMANLFPGGKQDKTDVRPSTPTRNNFITPATTPQGSPSKKT
                     VPPGANELPAAFQGMNIKAAPSAFDTPVKLSRPQSVVAPLSPGKSNLQNLDEGPSAVD
                     DSVIRKGIVRTGSPVRNQGQENTPPVLPRDPFAEPTYQPSHAAISRQELYQQHRDRPS
                     PTVKRFNTTRGLSAEEREILQRPSVKRLVNVTQLYFLDYYFDLLTYVSARQNRLNAFK
                     AEYPPPPETDQETYDQMWSKYTGRERANLRKRRVRLRHADFQILTQVGQGGYGQVFLA
                     QKKDTKEVCALKVMSKKLLFKLDEVRHVLTERDILTTAKSDWLVRLLYSFQDDKNIYL
                     AMEYVPGGDFRTLLNNTGVLSNRHARFYIAEMFCAVDALHQLGYIHRDLKPENFLVDS
                     TGHVKLTDFGLAAGFLAPSKIESMRIRLEQASATSVPFGKPMDQRTIAERREGYRTMR
                     ERDVNYAKSIVGSPDYMAPEVLRGEEYDFTVDYWSLGCMLFEALTGFPPFAGATADET
                     WRNLNHWREVLKRPVWEDPNYFLSNRTWNFITTCINSRSKRFSNIKDIYDHQYFAEVD
                     WPVLRETKPPFVPELDSETDAGYFDDFSNEADMAKYKEVHEKQQALENMADREEEMRK
                     SLFVGFTFRHRKPATDEGTPRKPIPFEENAFGTML"
     gene            <1118599..>1119668
                     /locus_tag="THITE_2127356"
                     /db_xref="GeneID:11518947"
     mRNA            join(<1118599..1118682,1118746..1118971,1119118..>1119668)
                     /locus_tag="THITE_2127356"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651406.1"
                     /db_xref="GeneID:11518947"
     CDS             join(1118599..1118682,1118746..1118971,1119118..1119668)
                     /locus_tag="THITE_2127356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651454.1"
                     /db_xref="GeneID:11518947"
                     /db_xref="JGIDB:Thite2_2127356"
                     /translation="MKISTISSFLGATAVAHAQWWAGAPDCAHECFSSWWSSSSAWPA
                     PTSYCSATQGASVSSCISSACQATPTALTSYSSLSSSLCSQWSSCSAAGSTGVYTVSV
                     PAYTGNWNGPAGGRPGGGGGGPWRGGGGGPASAVQSAWSQWTRTWTGGTYTVTGCEWN
                     GNPWAGGPGGCGPGGAAGSPWGPWGSGWTWTTVTQTVTQVVTITSSDGATALSTSVGL
                     AAVAQAVSGDVTSTSVIGPAGTAAGSGNGGGASATAGSTGDAPGRDEALRVKVMGAVL
                     GGVVAVAALL"
     gene            <1125223..>1128457
                     /locus_tag="THITE_37279"
                     /db_xref="GeneID:11518948"
     mRNA            join(<1125223..1125764,1125902..1126277,1126409..>1128457)
                     /locus_tag="THITE_37279"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651407.1"
                     /db_xref="GeneID:11518948"
     CDS             join(1125223..1125764,1125902..1126277,1126409..1128457)
                     /locus_tag="THITE_37279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651455.1"
                     /db_xref="GeneID:11518948"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="JGIDB:Thite2_37279"
                     /translation="MAASTTTNSFAASSPLAPMHPTMTEHDFRFPRRPADAAATGSRK
                     PDRFDHGRSPVAGAKTMPPSTTATAATAAAATAAAAAARPSSLRAAEFHHNHRPPLTH
                     GGAHPDLLRAAAFPPFQQIVARETQNLEEMQKRDPLAIQVWRFYAKTKLLLPAQERME
                     NLTWRMMHLKLHGARAANALKANRAPGVSANAPSGIAQLRQSSDHPPLPTDPMNLDDF
                     INNDSVGTPAGLALTPTPETMRRAEHKSAHTTPSAIPINSKPRKEPSSQLLIPQSVPV
                     AAHQRVQEEFGYVPRHPRKTSIDETGQRVSNRKRPADFSPHVPAVTAGLASNGLEADA
                     DLNEYSLDHLHPAGTMSQPPNHAGIPFPLDTFRLDNDPIITSAGPFQQHFSFSPASSP
                     LVTHDPFSAMYNGPSMPAGSLGANYYSPPGSAYQSAVSTPHPLGDGDGFYFGSMDVRH
                     ARQQPYRTAHPGMGSALGHQLAYGPGSNMMYPSVGAASEPASAFTAPSSFGHIDPAQV
                     FQQEQLGRSSTASLGKDHMFSFGADSDDEDGGAFADRNLPISQDFASQGMEDGGFDSS
                     SLQWDPCLPGNFSTQAARYPAGPPRKQVTIGGTTTDYVDAAGNWEGGSLNRSHSQSFR
                     VTNGRIGKVPRTASTPGLASRGNPSDRLAQSTPNSPPAEPKAASGLSSVNTSRPSSPP
                     PVSRHGSTTNLQGVGAKQGDNNNNNSNNNNNTNSSTPTTCTNCFTQTTPLWRRNPEGQ
                     PLCNACGLFLKLHGVVRPLSLKTDVIKKRNRGSGTGLGVGGTSTRSRKNAGSSGSGTA
                     TKKNSALSTSASANPPQTRASTPPAGLSKAGGATGSGSPASGSASAGNNTTGSTPGSY
                     HGNAGSSSGVVGGKGVVPIAAAPPKSAPGPGAASQPRPPAVSSKRQRRHSKSVTVEQS
                     PSNMDIDSPESSTGSNEAAATTRPLGSSSAISSLQPSSSSLGLSSAFGSLSRPLAGPG
                     SQHTGPQEWEWLTMSL"
     gene            complement(<1129690..>1131637)
                     /locus_tag="THITE_2044375"
                     /db_xref="GeneID:11518949"
     mRNA            complement(join(<1129690..1131279,1131351..1131516,
                     1131576..>1131637))
                     /locus_tag="THITE_2044375"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651408.1"
                     /db_xref="GeneID:11518949"
     CDS             complement(join(1129690..1131279,1131351..1131516,
                     1131576..1131637))
                     /locus_tag="THITE_2044375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651456.1"
                     /db_xref="GeneID:11518949"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="JGIDB:Thite2_2044375"
                     /translation="MAREAAWSLLEQLRVATQSFELIGVPEHVWPYVWTALGVLVVCY
                     LALREDDRPIRYTVPSPKMPDQVEILDEPSIKVAGSTAVHCYAPATGQFLGLVNPSTP
                     NAIDRAVEQAQAAQTKWAATSFRQRRAVLRSMLQYVLDNQEEICRVSCLDSGKTMVDA
                     QLGEVLVTVEKLQWTIAHGEKALRPSRRPTNLLMAYKRNTVHYEPLGVVAALVSWNYP
                     FHNLIGPVISALFSGNGIVVKVSEQTAWSSSYFTNIARGALVAHGHDPALIQTVVCWP
                     QTANHLTSHPGISHITFIGSRPVCHKVAASAAKALIPVVAELGGKDASIVLDSVSKRD
                     LPRVIEILMRGSFQASGQNCIGIERIIATPAIYPQLVSLLEPRVRALRLGPTADVGAM
                     ISSASFDRLEALIADAVQQGARLLVGGARFTHPDHPRGHYFAPTLLADVTPDMAIARE
                     ECFAPIMVLMRAPDASADAVLAVANAPHFGLGSSVFGAESDPRLAALVRGIKAGMVAV
                     NDFGATYAVQLPFGGVSGSGYGRFAGEEGLRGLCNVKAVCEDRFAWLGVRTAIPPPIR
                     YPVLDQERSWRFARGVVEVGYGMDIARKLRGVLGIVKNS"
     gene            complement(1132033..1137755)
                     /locus_tag="THITE_2153879"
                     /db_xref="GeneID:11518950"
     mRNA            complement(join(1132033..1133641,1133757..1136917,
                     1137008..1137755))
                     /locus_tag="THITE_2153879"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651409.1"
                     /db_xref="GeneID:11518950"
     CDS             complement(join(1132669..1133641,1133757..1136917,
                     1137008..1137454))
                     /locus_tag="THITE_2153879"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651457.1"
                     /db_xref="GeneID:11518950"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="JGIDB:Thite2_2153879"
                     /translation="MAAPEGEAGDATGAELPMQRSRWATRKLTVKSSAMKRLSLMGRR
                     HNKSSSGEKKRASGGTDTSQPEDGVKKDDGTSEDDNGDGAGSRRLYFNLPLPRELQDD
                     EGHPKQQYARNKIRTAKYTPLSFIPKNLFFQFHNIANIFFLFLVILVIFPIFGGINPG
                     LNSAPLIFIVCVTAIKDAIEDYRRTVLDNELNNAPVHRLVGCQNVNVREDNVSLWRKF
                     KKANSRFFGAIWHAIERLWKKDAKSGRQTFMAADPRMSIESRTTPWEAVASPNTFVSA
                     QEEIQMTPVPSPLPRNPNRPDISTAVESEMARFENFSGDLINPQIPISGKARFQRDAW
                     KNLVVGDFVRVYNDDELPADIVILATSDPDGACYVETKNLDGETNLKVRSALRCGRTL
                     RHARDCERAQFMIESEAPQPNLYKYNGAIKWRQTVPWDPKAEPIEKSEPIGIDNLLLR
                     GCNLRNTEWALGVVVFTGHDTKIMMNAGITPSKRPRIARELNFNVICNFVVLFAMCLM
                     AAIANGVAWGKPDSSMAWFEHGAMNGSPGLTGFITFWAAVIVFQNLVPISLYISLEIL
                     RTLQAFFIYSDIGMYYDKIDQPCIPKSWNISDDVGQIEYIFSDKTGTLTQNVMEFKKA
                     TINGQPYGEAYTEAQAGMNKRMGIDVEQEAAAIRAEIANAKVRAIRGLRQLHDNPYLH
                     DEDLTFIAPDFVDDLAGKNGPEQQQANEHFMLALALCHTVIPEKQPGDPPKMIFKAQS
                     PDEAALVATARDMGFTVLGSSSDGIDVNVMGTDRHFPVLNTIEFNSSRKRMSAIVRMP
                     DGRILLFCKGADSVIYSRLKKGEQAELRRETAQHLEMFAVEGLRTLCIAERELSEEEY
                     REWRKEHDIAATALENREEKLEEVADKIERDLTLLGGTAIEDRLQDGVPDTIALLGDA
                     GIKLWVLTGDKVETAINIGFSCNLLNNDLDLLRLQVHEEEASTATEEEYIAMAEEQLN
                     AAMAKFNITGSDEELKKARKDHQPPAPTHALVIDGFTLRWVLSDALKQKFLLLCKQCK
                     SVLCCRVSPAQKAAVVSMVKNGLDVITLSIGDGANDVAMIQEADVGVGIAGLEGRQAV
                     MSSDYAIGQFRFLQRLVLVHGRWSYRRVAESISNFFYKNMIWVWAIFWYQIFADFDIS
                     YIFDQTYITMFNLFFTSVPVILMGVLDQDVSDTVSLAVPQLYRRGIERKEWTQPKFWA
                     YMFDGIYQSVASFFIPFIFVVLTTTATGNGLVIAERTRLGCYVAFPAVITINAYILIN
                     TYRWDWVMILVVVLSDLFIFFWTGVYTASTYSAGFYQAAAQLFQELTFWMCLIVTPTI
                     CLLPRLVIKVIQKSRFPYDVDIIREQAKRGDFADADATKAAAMAAGEGIDGGSSKSSS
                     SSGKLSGRSRKPKHTQYASVDEDRRPIYPPSVATHNTRTQNGSDGTNYIMQSRASAEL
                     QGDLVGEEPERAVTRPSIDRARPSYDRIRRSVDRVRPSFEASNDFTSAARLSRVESTH
                     STQGLPDGQRRFNLTTVRKRGLSAFSKKSIDP"
     gene            1140118..1142599
                     /locus_tag="THITE_2111791"
                     /db_xref="GeneID:11518951"
     mRNA            join(1140118..1141501,1141556..1142599)
                     /locus_tag="THITE_2111791"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651410.1"
                     /db_xref="GeneID:11518951"
     CDS             join(1140236..1141501,1141556..1142182)
                     /locus_tag="THITE_2111791"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651458.1"
                     /db_xref="GeneID:11518951"
                     /db_xref="JGIDB:Thite2_2111791"
                     /translation="MSKNGDITRFFKPVPVAKSSSSPQQLQASRRPASPAKNVNSTPT
                     PPPRPPSPLPALLFSSSPPAPASTARDRNTEIPGSDDEDDDNLSSDDDFPSLFPAQPA
                     RKEASLYATPQAKRRALEFHASPLTINTRHKFDLQALLKHAEADNAIAEREQRTAALL
                     AQGSPTALGARIADGAPASLHDTMLDVLSDPEDSQDEGHRRRLLRAVKRTEAAVHRKE
                     WYFFDRQGQTNSTAIEVRPAFPRAKATGVWALLASERHRSEVFEDGLPFHVQTKMQSL
                     PDAIFQWVLSEATRERSTKLRDEYVRLLGVCPDQIGRLIDENRIVELFQDLGASARAL
                     APASQPSGASEEGAPYPELDRIRLQAVLRVLAETAHALRFQALTRTMAILLRLGIDNI
                     VREDYAVMTDYQDALLQTALAVPPRSWNNFCEIVSDSLYHHTREAVLRWNAVSAIPLL
                     HPRLIELRRRLALVFVFDDPRRASSPPEDTFSLRSVIDRLDQADEFVVDRKNTDYFEL
                     LALSEMLSVAVGDGAPPAGNASPEVIKQYNAEVDELAHRIKFMWSNIHEQGAAYMSRL
                     EARVQLRDFERKLLHVVRTRPPPKEDIFGLNAREDEAERPKQQQFMKRFLSKNQPPPV
                     TPSRGG"
     gene            complement(1142601..1143172)
                     /locus_tag="THITE_2111793"
                     /db_xref="GeneID:11518952"
     mRNA            complement(1142601..1143172)
                     /locus_tag="THITE_2111793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651411.1"
                     /db_xref="GeneID:11518952"
     CDS             complement(1142660..1143151)
                     /locus_tag="THITE_2111793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651459.1"
                     /db_xref="GeneID:11518952"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="JGIDB:Thite2_2111793"
                     /translation="MTAFIKQEATEKAREIEIKADEEFAIEKSKLVRQETDAIDAAYR
                     KKFKQATMSQQITQSTVANKTRLRVLGARQALLDDIFAAAEKRLGEATQDKARYAAVL
                     KGLLLEGFYALSESDVRVRARKADYEIVREAIGAAAAEYKEKTGSEVAATIDEEDDLP
                     DGR"
     gene            1143740..1146372
                     /locus_tag="THITE_2111794"
                     /db_xref="GeneID:11518953"
     mRNA            join(1143740..1144390,1144476..1146372)
                     /locus_tag="THITE_2111794"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651412.1"
                     /db_xref="GeneID:11518953"
     CDS             join(1144349..1144390,1144476..1146167)
                     /locus_tag="THITE_2111794"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651460.1"
                     /db_xref="GeneID:11518953"
                     /db_xref="InterPro:IPR008521"
                     /db_xref="JGIDB:Thite2_2111794"
                     /translation="MGLIGGISPGGSIALGIIVGLLSTSVQSLGLTLQRKSHILEDEK
                     IPYDVRRPPYRRRRWQLGMAMFVISNVVGSSVQISMLPLPVLSTLQASGLVFNSICAT
                     LILGEPFTRWSLWGTLLVCSGAVLIAVFGAIPSPAHKLSELLDLLGRRPFVIWMSFQA
                     VFVIGLAAATELVSQLTTLMQDPRFRLARGFSYGCISGTLSAHSLLVAKSAVELIVRT
                     ITDGDNQFVHWQSWMLVLSLVTLALTQLYYLHRGLKLVSTSVLYPLIFCIYNIMAILD
                     GLIYFRQTDLINPLRACLIALGTVILLSGVLALSWRLSDEQHAPSIGQSTLAPGLGLV
                     DDTDGEEEEEEVSLRSGLLNGGESTLHTQSSYQTFQPFPAPEGPVSPSGQPTRRQSSM
                     ARSTRTTSTRWAEHAEIWDELEDRSTQEPVSPAFPRRRSTTLPAHTNSSSSLLARRGT
                     ADSHNPVLANNDAPEEAQPLIGSPRRHFRRRRKSTGFPGFKARKSTGRTTSGGIQDMA
                     RNIWGMRWWGNRPRSTGPSDLPRAGSVSRAGFAYREDPEAGLAGPSSQRRSPVVLDPR
                     LRGNRQDDSPV"
     gene            complement(1146475..1147868)
                     /locus_tag="THITE_2111795"
                     /db_xref="GeneID:11518954"
     mRNA            complement(join(1146475..1147055,1147144..1147376,
                     1147435..1147868))
                     /locus_tag="THITE_2111795"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651413.1"
                     /db_xref="GeneID:11518954"
     CDS             complement(join(1146783..1147055,1147144..1147376,
                     1147435..1147603))
                     /locus_tag="THITE_2111795"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651461.1"
                     /db_xref="GeneID:11518954"
                     /db_xref="JGIDB:Thite2_2111795"
                     /translation="MVNGVQLTYVVADGLFLLMGIFILAFSVIVGNIRNEVPTDGQQA
                     ARNLLYQGFPLTAGIVNAAFIFATFLMTLPGLATSSRRWLKIAGYMAVVCAVFTMILG
                     LYLWIFTLKTKEDFAPLFSAQSDNVKSLMQTSFSCCGYFNSSSPAFVTDSTCPSKAAA
                     AVVRGCATPITSFANVFVDNIFTGLFGIVGIDVVFIMATACLLKERKERERFRHIDEK
                     NGFGTI"
     gene            1151701..1153754
                     /locus_tag="THITE_2064683"
                     /db_xref="GeneID:11518955"
     mRNA            join(1151701..1152451,1152596..1152730,1152822..1153754)
                     /locus_tag="THITE_2064683"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651414.1"
                     /db_xref="GeneID:11518955"
     CDS             join(1152197..1152451,1152596..1152730,1152822..1153094)
                     /locus_tag="THITE_2064683"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651462.1"
                     /db_xref="GeneID:11518955"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="JGIDB:Thite2_2064683"
                     /translation="MADITDQHDQTSPTELDEAHSVGNGNPAVGESRGIKRARPSAAD
                     DDDDDDEKAGRERRKIEIKFISDKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVV
                     SETGLVYTFTTPKLQPLVTKAEGKNLIQACLNAPEPPAGDNGVDDANAVESPEEPTSA
                     HLPPQPTRPGMPQGHMPPGYMPNVGMDPQQALAYSNYVQQSRGNQYIPPSSLQQHAGH
                     QP"
     gene            complement(<1155880..>1156530)
                     /locus_tag="THITE_2044103"
                     /db_xref="GeneID:11518956"
     mRNA            complement(join(<1155880..1155991,1156064..>1156530))
                     /locus_tag="THITE_2044103"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651415.1"
                     /db_xref="GeneID:11518956"
     CDS             complement(join(1155880..1155991,1156064..1156530))
                     /locus_tag="THITE_2044103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651463.1"
                     /db_xref="GeneID:11518956"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="JGIDB:Thite2_2044103"
                     /translation="MGSSDSSSSSSSSNGSSSSGGMTMMGVFQSTTTSPLYSARWTPA
                     STGAYAGTCIFLIALAVVFRGLLALKAWQEARWLDRELDRRYVVVNGKAPLAESLSRD
                     SLAKSATAVLSENGVEENVLVVRRRTTRARPWRLTVDPVRALIDTLIAGVGYLLMLGV
                     MTMNVGYFLSILGGTFLGSLLVGRFVLIAEPH"
     gene            <1157161..>1157804
                     /locus_tag="THITE_2127366"
                     /db_xref="GeneID:11520457"
     mRNA            join(<1157161..1157364,1157409..1157410,1157456..>1157804)
                     /locus_tag="THITE_2127366"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651416.1"
                     /db_xref="GeneID:11520457"
     CDS             join(1157161..1157364,1157409..1157410,1157456..1157804)
                     /locus_tag="THITE_2127366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651464.1"
                     /db_xref="GeneID:11520457"
                     /db_xref="JGIDB:Thite2_2127366"
                     /translation="MSQPFSDILCVSNLLVGCVFDVRTPVIRGRLLEHLCLPSSSRGQ
                     AQVVSGYWIQAEGTDGKARTEAKRRGSLGIALVPPVVGAFGHSLGLATKAKPTTRRGD
                     RALPANAPGCLQDCVTSCRAQGRTGGDIPGCRVSLLCYIATVGPAYDSTAPVPAGREP
                     ISTSGPGADPSCDRGRRDRFWRLV"
     gene            complement(<1158625..>1159347)
                     /locus_tag="THITE_2127367"
                     /db_xref="GeneID:11520458"
     mRNA            complement(join(<1158625..1158953,1159001..1159185,
                     1159271..>1159347))
                     /locus_tag="THITE_2127367"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651417.1"
                     /db_xref="GeneID:11520458"
     CDS             complement(join(1158625..1158953,1159001..1159185,
                     1159271..1159347))
                     /locus_tag="THITE_2127367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651465.1"
                     /db_xref="GeneID:11520458"
                     /db_xref="JGIDB:Thite2_2127367"
                     /translation="MRSCTVSSWFGRGKAVTLDEEELWLGSMNVGEERLTDGTVWWTV
                     EGESECLPTAQEFGDPEGLASGTGFRRRKGVEEGTNVQGPSWARKRTKQAIKPSSLQA
                     NQRESPHSGDPADGAHLMSATHSPRLSRSTAYMWPSHGDKNRASWLLMALIETVLKAA
                     LSKFTPVRHQSFLNLELRAPSTEPRPLRRKQRYTRC"
     gene            complement(1160739..1162824)
                     /locus_tag="THITE_2111805"
                     /db_xref="GeneID:11520459"
     mRNA            complement(join(1160739..1161197,1161270..1162824))
                     /locus_tag="THITE_2111805"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651418.1"
                     /db_xref="GeneID:11520459"
     CDS             complement(join(1161045..1161197,1161270..1162547))
                     /locus_tag="THITE_2111805"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651466.1"
                     /db_xref="GeneID:11520459"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2111805"
                     /translation="MTTSASEKIFGGRPSSLTRAGPPPPFLSDSSTPVPSFSNSTSTR
                     ETTSAPGAPSTSILTPSGAVSDGFPPSGSHGSGSQSSQPGGQPLYYSGHMTGSWPTPG
                     LSQPSAYTYTNSNPGNPSSGPLSQQTYSRAPAPYPSASSPSLQHFPGRSASSAPNGET
                     LPATQSYQEQQQAFPSPVSAGAGAGGGGGSLASPLSTQGHSGNQPPGLAQPILGNHST
                     SLARQPASAQNAPGGGTGTTQEGSSYRQPPTPNNYYPPSSAPQQQPFPSYVSPATQPS
                     PTTVSPTAASSAVPRGPSSIPPMAPPVQFSGGRAHPVPSMASYASYSPVPGPVLSNMH
                     HPGAPLAMVGGMAGLPSYSHHPGLAPHHPHHLYVHHSGAPPPQSERPFKCNECAQAFN
                     RNHDLKRHQRIHMAVKPFGCSDCEKRFSRKDALKRHRLVKGCGGSTTSEITGATAGSK
                     DGSSHNRGAIAGGDREGSPREPEREV"
     gene            complement(<1175250..1175924)
                     /locus_tag="THITE_2169893"
                     /db_xref="GeneID:11520460"
     mRNA            complement(<1175250..1175924)
                     /locus_tag="THITE_2169893"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651419.1"
                     /db_xref="GeneID:11520460"
     CDS             complement(<1175301..1175801)
                     /locus_tag="THITE_2169893"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651467.1"
                     /db_xref="GeneID:11520460"
                     /db_xref="JGIDB:Thite2_2169893"
                     /translation="MSPASPFSPDGLPGAVGHQRHQSLQFPALAHQFQPPVRASPRLQ
                     ELREVDEENMVEGPQETAREPGFVRHNASDSLQKEIDEAEYHLEEQMRSQLDNDEDYS
                     PHNDNGKTDTRPMTSGLGHPADPLVQLAPQPPRFAGDADGIVLHHPRPHSRGHSLSQK
                     YFTEDDA"
     gene            complement(<1179097..>1179741)
                     /locus_tag="THITE_2048092"
                     /db_xref="GeneID:11520461"
     mRNA            complement(join(<1179097..1179197,1179287..1179401,
                     1179508..>1179741))
                     /locus_tag="THITE_2048092"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651420.1"
                     /db_xref="GeneID:11520461"
     CDS             complement(join(1179097..1179197,1179287..1179401,
                     1179508..1179741))
                     /locus_tag="THITE_2048092"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651468.1"
                     /db_xref="GeneID:11520461"
                     /db_xref="JGIDB:Thite2_2048092"
                     /translation="MRCTAFCLVAAWAAASAAASANIDVAGQSEFHGGVLLPRQQGRV
                     NLQAFTGALGGAKAPAITNSGDPQRPFEVDGDTFTDFESASNRACDNQKNVCADIANN
                     GTGSFTVGDCDQQNQQCKSAASSAATKTFPPPVLVSSNDQFDIFCDA"
     gene            complement(1180240..1182061)
                     /locus_tag="THITE_2169894"
                     /db_xref="GeneID:11520462"
     mRNA            complement(1180240..1182061)
                     /locus_tag="THITE_2169894"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651421.1"
                     /db_xref="GeneID:11520462"
     CDS             complement(1180791..1181594)
                     /locus_tag="THITE_2169894"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651469.1"
                     /db_xref="GeneID:11520462"
                     /db_xref="JGIDB:Thite2_2169894"
                     /translation="MQLTRALGIFALGLSAMSAAEATLVNVNMVGRDGEGIQRRQLLD
                     DLPNTSDATSSTNTSPSPTETPSSSTAEPTTSSETSPTKSPTPTHPTPTPTSRESTSS
                     SPSPTKEAPTDHTSSSTSAQPTTSSSAAGDNSSSATVITTLVVVTTTAADGSQTTLTS
                     ETLTTATPGLAGDNSSGQNSGMSPQTRNTVIGVVVGVGGAIILGGLALVAWRIWGRKK
                     HQEESDGLMDYGSTAEKPESGGSMTGRTPFQSTLESYHAPTQVNTAANF"
     gene            1186930..1190012
                     /locus_tag="THITE_2111816"
                     /db_xref="GeneID:11520463"
     mRNA            join(1186930..1187642,1187701..1190012)
                     /locus_tag="THITE_2111816"
                     /product="glycoside hydrolase family 18 protein"
                     /transcript_id="XM_003651422.1"
                     /db_xref="GeneID:11520463"
     CDS             join(1187090..1187642,1187701..1189871)
                     /locus_tag="THITE_2111816"
                     /note="CAZy_ID 270175"
                     /codon_start=1
                     /product="glycoside hydrolase family 18 protein"
                     /protein_id="XP_003651470.1"
                     /db_xref="GeneID:11520463"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR002482"
                     /db_xref="JGIDB:Thite2_2111816"
                     /translation="MLTKTVAVAALAAVPALATPAVNVYWGASAGTDRLRDYCDSTGF
                     EYVTLGFVNNSPENDPSSLKYPGTNFANHCIAAKYTDPNGVSSQLLSECGLISADIRY
                     CQSKGKKVLLSIGGTWNPPDANYTVSSPPEGEYFANFIWAAFGPYDASQPHVRPFDDF
                     YQGAEPGQEHFVFDGFDFDIEYKFDDQNGYVAMVNRLRYLTSQDTSKKYLITAAPECP
                     LSDQWFKMKNIIQSSQFDALFVQFYNNIGCEGVDGNNFDDWATYLQSTASKDAKIFIG
                     LPGSPNAAGTGYLAPDDAAQLLNKHKNKPAFGGVMVWDAYFGSQNVNNGQTYYEYVHD
                     VACGPPTSTTTATGPTATPTACVRKYEVVSGDNCFDIGNRYGLDVATLKLLNPSLDAN
                     CDIWPGQILCVELGFPPTSTSTTVSATSTSTTSTPTASPSTTTSPSTTTSPSTTTSPS
                     TTTSPSTTTSPSTASTSTTTSPSTTTRPSTTTSPSTTTSPSTTTSPSTTTSPSTTTSP
                     STASPSTTTSPSTTTSPSTTTSPSTTASPSTASTSTTAEPTSTTTTSEGPTSTATSTT
                     LVAVTSAPGTTTTTTTDAATSTSTEDDSCPDDETTTTPVASSTTTGTPTVTSAPGTTT
                     TTTTNAATSTSTDDDSCPDDETSTSPVATATSSQPVITSTSTGDNGAYPTTVSPTSDN
                     SANPTTASQGYTTSTIYTTTTRTVTSCPSTVTDCPARVVTETIAVSTTVCPVTATETA
                     APQPTSSLPAGWTTSTVYSTTTYTVTSCASTVTDCPARIGQVTTEVIAVSTTVCPITE
                     VASPSPSASASVSGPAPASQASEIDSTSTTQITTTRFTTLTVPKPGSTAPVAAPSNPP
                     SSPIQSAPSAGFSTTQGGASPSGTLPVTAGAGRSVVALGLPAVLAALALAI"
     gene            1190315..1192543
                     /locus_tag="THITE_2111819"
                     /db_xref="GeneID:11520464"
     mRNA            1190315..1192543
                     /locus_tag="THITE_2111819"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651423.1"
                     /db_xref="GeneID:11520464"
     CDS             1190759..1192393
                     /locus_tag="THITE_2111819"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651471.1"
                     /db_xref="GeneID:11520464"
                     /db_xref="InterPro:IPR014778"
                     /db_xref="JGIDB:Thite2_2111819"
                     /translation="MATIEPWLTNLLNKPKTSELPPLQLMPLGAAPGQSLSLPPLGPE
                     LAGEHRADRCAPTQAISLCAADDGRIGKPPAQVDDNGVLHTVSIRPLQLLLREPEPAP
                     QGIPLRKIVHDVPKSPEGASTKKRHRALTAKEDLVQLPKLPKKQKSTQQVVPPIIAGL
                     HEPPPDPAVFPPITSASFDDSETFGLGSWKDLGSSLEDRSAPSSAVDAEPANPPPKPK
                     RRPMKPRRKWTEEETKNLLLGVSRHGVGRWTSILEDPDFQFNGRTAGDLKDRFRTCCP
                     EELRMTAVDELTGHGEAAASAALEGTTRPKNGLHLEDILIPVGDGVTDHDGASPPAQH
                     DTDAAPKRRRTRAHRKKLEDLAELGIHGPFEQSNRRKRRPFTKQDDEAILDGLKQYGP
                     SWTRIQRDPRYGLSSRQPTDLRDRVRNKYPEIYANIEKANLLKEAAREAARGKASTLE
                     PSVKLSTENLRGSVVLPSLEPQLSRSGSREDMLRRTATPSAYESTESLPALADIFDMT
                     DSHGMSLLGAPPEMDLSHLILDDSHIGGERRLGQGR"
     gene            1193237..1194676
                     /locus_tag="THITE_2111827"
                     /db_xref="GeneID:11520465"
     mRNA            join(1193237..1193372,1193546..1193968,1194113..1194466,
                     1194520..1194676)
                     /locus_tag="THITE_2111827"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_003651424.1"
                     /db_xref="GeneID:11520465"
     CDS             join(1193359..1193372,1193546..1193968,1194113..1194464)
                     /locus_tag="THITE_2111827"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_003651472.1"
                     /db_xref="GeneID:11520465"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="JGIDB:Thite2_2111827"
                     /translation="MGRGPKKHQKRLSAPSHWLLDKLSGAYAPRPSPGPHKLRDCMPL
                     IVFVRNRLKYALNYRETKAILMQRLVKVDGKVRTDITYPAGFMDVITIEKTGENFRLV
                     YDTKGRFTVHRIQDEEAKYKLGKVKRVQLGRGGVPFLVTHDARTIRYPDPLIKVNDTV
                     KIDLETGKITDFIKFDTGAIAMVTGGRNMGRVGVITHRERHDGGFGIVHLKDAIDNTF
                     ATRESNVFVIGSEKPWISLPKGRGVKLTIAEERDRRRAHALAGH"
     gene            1200508..1203005
                     /locus_tag="THITE_2111834"
                     /db_xref="GeneID:11520466"
     mRNA            join(1200508..1201091,1201168..1201567,1201641..1202258,
                     1202316..1202620,1202684..1202721,1202812..1203005)
                     /locus_tag="THITE_2111834"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651425.1"
                     /db_xref="GeneID:11520466"
     CDS             join(1200774..1201091,1201168..1201567,1201641..1202258,
                     1202316..1202620,1202684..1202721,1202812..1202845)
                     /locus_tag="THITE_2111834"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651473.1"
                     /db_xref="GeneID:11520466"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="JGIDB:Thite2_2111834"
                     /translation="MSATRLLRAGRPLRRSLTALDKPCAAGRQPFATSSARRAGPGAG
                     SGQSARASSATWSLSSVLSVAAVASFLGWSVSEFQHRGFPGAFLLDGAFPASRYASMR
                     EMEQALREIRQEIEGEDIISTDPDDLHAHGYSEWSTTNPEGLPVAVAYPRSTEQVSTI
                     ARICHKYRVPIIPYSGGSSLEGNFSAPFGGISVDFAYMDKIVQLNKDDMDVVVQPSIG
                     WQDLNEQLAKMGSGLFFPIDPGPSAKIGGMIGTNCSGTNAVKYGTMKDWVINLTVVLA
                     DGTVIKTRRRPRKSSAGYNLNGLFVGSEGTLGLVTEATLKLAVIPEEVSVAVVTFPSI
                     RDAAAAATEVMQRGIPVAAMEIMDEVQMKVVNMGGATAPRVWKEMPTLFFKFSGTKAG
                     VKEQIRLVQKITKANKGSNFEFAKDEREQKLLWSARKESLWSMLALRKEGEEVWSTDV
                     AVPFSRLADIIEVSKKEMDDLGLFASILGHIGDGNFHESIIYNGRDKAERDRVEACVK
                     NMVKRALEMEGTCTGEHSIGWGKKESLVWEVGHDTLGVMKAIKSALDPHWIMNPGKIF
                     DRQG"
     gene            <1204430..>1209408
                     /locus_tag="THITE_2048877"
                     /db_xref="GeneID:11520467"
     mRNA            join(<1204430..1207502,1207568..1208943,1209322..>1209408)
                     /locus_tag="THITE_2048877"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651426.1"
                     /db_xref="GeneID:11520467"
     CDS             join(1204430..1207502,1207568..1208943,1209322..1209408)
                     /locus_tag="THITE_2048877"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651474.1"
                     /db_xref="GeneID:11520467"
                     /db_xref="InterPro:IPR007855"
                     /db_xref="JGIDB:Thite2_2048877"
                     /translation="MTEPFGGNYQQLLLKGAENGRLKAHLQRTDARPASGDRSRNGGT
                     VPLRREPGPAPRPFRQVPSGAPPSRINNPQGSRSFFASQPAAVVPPAWSTQKSATVII
                     RGVPPKATPWDIRQFFEQFGKVVWVELDDVSRGGVRSAKVRFEPPPTDLSFFQQGECR
                     LGIGGTVSRTRVEFPKQYPDEPMLTTPLGNSCPALLVLKPNKLTFGLLTQPTTFMRKK
                     EVLGLSGEFELKFTADFRRKRLVIHFPLLVHCEQQCYRIDIKFSIIRSIHRITTGKER
                     SALVISVVDPPLVRRKHMDPDGHAWADRLVWGEDELWQRAVEIKLQSQNPRAKAVSLD
                     EEPNIIDLGRWTTYWIDLDQPAEEMWSAIQTHLHDWNIHTHLDASFAQVESKSAKLWE
                     LLDDPPAGASTETASPWNNDLALLSPTGKISLPFDVRYQLEVCISHEILCEYNIQRDF
                     LEKLLELGPNRARLILEYAADKGETIYNPLELLKDPGALTYYPTTLHIPDYCALVRKV
                     IVTPTRIYFNTPTVETTNRIVRRYKQVQDHFIRVQFTDELLEGRIRACEVDRDDELYT
                     RVYRVMMQGIRMGRWHWKFLAFGNSQIRENGAFFFCQAEGYPDITCDTIRQWMGNFSH
                     ISTVAKLAARLGQCFSTTRLLRCISSPWIVKIPDVEKGGFCFTDGVGKISMVLASLVS
                     QDWKIYPPPSAFQFRMGGCKGVLVTWPDAKGMEVHIRPSQEKFSAEYNGLEIIRCSQF
                     SCATLNRQTILILSCLGVPDDVFTSMMDEQISNYDAAMTDKDKAVELLSSYVDENMTS
                     TTIARMVLNGFMHTQEPFVRTLLQLWRSWSIKGLKEKARLIVDQGAFVLGCVDETGSL
                     RGHSKATEGRKKIAQHHLPQIFLQVPDPRDRGAYKVITGLCLVGRNPSLHPGDIRVVE
                     AVDLPQLRHLRDVVVFPLSGDRDIPSMCSGGDLDGDDFFVIWDPKLIPPEWSHPPMNY
                     SAPKSLTEPRASTAKSLATFFVLFMKNDRLPLIAHAHLATADYEVEGAKHRKCLQLAE
                     LHSTAVDYVKTGVPAEWNKKLDPRKYPHFMEKPKSKSYHSTSVLGKLYDMVDRVVFDN
                     SDNYKLPFDDRILSRFHPLGSNILKEARKIKTQYDIAMRRIMGQLEIRTEFEVWTAFV
                     LSKPRVGTDYKVQEKVGREAAGLKKQFRDLCLKVAEEHHFDRLEFAAAMYRVTWEETR
                     IALYEARQPHVLPDGTVGLRRISARSMPLISFPWLFPNELGRIAIGAERLSSLNDFVA
                     RPAASAKQPKLKGSCGISQPSDAEVDLAAMEYTRTSDGQFIHRGEILHLFRHDDEREE
                     DFDCGDGVVGSGSPPDSDSEEASEKKFSEDLPTNGKHRNDFPVLVDAGTVLDCEDSTA
                     ASSSSTTSAAQEMTVNKQWALPLKTVVKGGDSPVPDLLSSDTDTQSEWSPCLTPDRIA
                     AQQLDSQTETTNQQEKTTEEAQSTAGVGKDDAEPQEEAPFQRESGKKSGEEAEYEEEV
                     VEIETETALERAAARFA"
     gene            complement(1210480..1211446)
                     /locus_tag="THITE_2111836"
                     /db_xref="GeneID:11520468"
     mRNA            complement(join(1210480..1210782,1210867..1210943,
                     1211023..1211446))
                     /locus_tag="THITE_2111836"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651427.1"
                     /db_xref="GeneID:11520468"
     CDS             complement(join(1210517..1210782,1210867..1210943,
                     1211023..1211387))
                     /locus_tag="THITE_2111836"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651475.1"
                     /db_xref="GeneID:11520468"
                     /db_xref="JGIDB:Thite2_2111836"
                     /translation="MAKDKRSKAPGPPATASAAPAAVPPSWPPFKPALPVVDLALESL
                     VQDKVVVLRSFFPRSLCKDYVSFLRELPLVTTPGKPKRGEALRVNDRYQIDDARFAHR
                     LWTETGLKEALLSKDVARLWGGEVVGLNPNIRIYRYSPGQFFDAHYDDSNNVTLKPET
                     GPALPARTTWTLLLYLTSSADGWYVLSPVTPHHTAPDQLPPPFPPLRRNPIITGQHPQ
                     PGHHFPPFLRPLRKGAT"
     gene            1211667..1212570
                     /locus_tag="THITE_2111837"
                     /db_xref="GeneID:11520469"
     mRNA            1211667..1212570
                     /locus_tag="THITE_2111837"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651428.1"
                     /db_xref="GeneID:11520469"
     CDS             1211865..1212491
                     /locus_tag="THITE_2111837"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651476.1"
                     /db_xref="GeneID:11520469"
                     /db_xref="JGIDB:Thite2_2111837"
                     /translation="MVSLSWLFGSSKPASDGDNNSTKQTPAIAQTQALPPPPEPTPAP
                     PSTTLPQEPPPEPNHFFSKRSLRQLGLFFGGAGFFYWSLLLSRRAITRHQLAAQLKFY
                     QPNQFGGRAQLGSPGRRDPLVAVEALNLATLNTISFAIMAAGGVSWAFDISTMDDLRR
                     ITRRSLEAAAGGTIDEAAEQEVAAWFAKTLGIVEKEKEKGQFEGNGKR"
     gene            1212571..1213531
                     /locus_tag="THITE_2111839"
                     /db_xref="GeneID:11517823"
     mRNA            join(1212571..1213178,1213262..1213531)
                     /locus_tag="THITE_2111839"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651429.1"
                     /db_xref="GeneID:11517823"
     CDS             join(1213094..1213178,1213262..1213467)
                     /locus_tag="THITE_2111839"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651477.1"
                     /db_xref="GeneID:11517823"
                     /db_xref="JGIDB:Thite2_2111839"
                     /translation="MKSQQEVEADVRSWGFSHVFTWSDAPNAYYPPHSHAGLTTHVIL
                     RGQLTIAYPQDGDEEQRGKKTTHGVGERIDVDAGRVHEVWIGSEGCTYVIGE"
     gene            1216963..1221176
                     /locus_tag="THITE_2111841"
                     /db_xref="GeneID:11517824"
     mRNA            join(1216963..1217960,1218028..1221176)
                     /locus_tag="THITE_2111841"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651430.1"
                     /db_xref="GeneID:11517824"
     CDS             join(1217500..1217960,1218028..1220971)
                     /locus_tag="THITE_2111841"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651478.1"
                     /db_xref="GeneID:11517824"
                     /db_xref="JGIDB:Thite2_2111841"
                     /translation="MGNAQSIEAPRRTRASQKLSKPKTGNHATAGLLSPSSFSYSSRR
                     LSSAQLPNPPAAPSLPVVSTPTTSSAVEGSGAFVRRADSGASLHSSPSLPRESRRRSL
                     FRSRSSRAVADSLEPSHNAAASGAWIVDRFTRTNSMTYESAIAHYGHVGPDNWPFEPE
                     SRTSWNYNLSSYEAKRLLNLDEQPGLERVAAMAENKMTVITETTWKSSNPAQPPSALI
                     TRTSSDASLCMPVRRRSIVQTPGVATRSNSVRDLPPLPQLNFRHSHPPTPSLSRQPSV
                     ESYRSGIRSMPPPIQDPDAQPRAVTPCEDKYLSIGAFKLGSLRITNGSPSTVTSENQR
                     SQKEERSSAGNDAPQDGYFSGAQGRETCVTSTAATRDLPQSPPFLPEISRSPPWSPIQ
                     SDLASPSLQTTSKVTALEDKLFDDEAQPEYSSPEVLDIRLDPNAKPLRPPLERDTGST
                     ITRTDSGFVSTSSPTTEAPHKPLAKADSGYSSNVSLRSFQAGPQASENQVIPVSVDKQ
                     LSQSSSHQDTRVDSEPLGLGQTEISYPEMPGRESPPPPVPPKDIASRQPRLSAVASTG
                     VSARGLVDENRTNSPKTTRQVPNPRISIPAVGRGPLSPGSLLQSPGSIKSSTSDNSSR
                     ALSIGGGSQRPGRLQRLISGARRSVAGPPTVHATHAVEQSTIPPVPREVENKLQEHAR
                     RFPTAAKRLALKPRASLDTLKTIFSMGSMEARLDAVNSRKTVPAVAESDIKAGAWKQT
                     LNSVPASIANVAAHVIPRKPISRKPVPVRQDSAKEGDQEASGSRGNGVRSAMPASPVD
                     SNSSLRSPKPRGRTVSLTSFPGERGTQLRRPASDFDLARSTLDLPSPPLPSPVAKAMS
                     AESKARTSRPVTAARRPESLRIPPPLRPRSSTASLTRKDSRDSIQSYAAMQTLASKTS
                     VDSLRSYASSQPGVGNSSVHSRLPSVVSMDPRRLQSFRQRHSPQSPPYDSPNWEVQTE
                     NGMVRSRSQTSAASGSRRNSISSVHSEGIYRPVSIQEWQFRAAQQQPLRHRASYDGYS
                     YQQRFPQRGYPPSMSNGYTAPVKPAYDPRSRRQLDAAATWSRSQVDAAAGQWYQDGRL
                     PPYAPVPRGHYRNRSVGAWSVYGVNPPYRVLHSYNSPAYRNVPIWG"
     gene            <1223511..>1225812
                     /locus_tag="THITE_111761"
                     /db_xref="GeneID:11517825"
     mRNA            join(<1223511..1223522,1223594..1224115,1224182..1225545,
                     1225638..>1225812)
                     /locus_tag="THITE_111761"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651431.1"
                     /db_xref="GeneID:11517825"
     CDS             join(1223511..1223522,1223594..1224115,1224182..1225545,
                     1225638..1225812)
                     /locus_tag="THITE_111761"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651479.1"
                     /db_xref="GeneID:11517825"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="JGIDB:Thite2_111761"
                     /translation="MCLKLRRQKPKKKSNFIRRMTTFKRGSPDTPSQGRNAILNLIIT
                     AGLAVNLKYFTDVNLTLDGPSKTSHECLKRHVKHVYDMARGRDRLLSHDKLVIFLKAT
                     QGVEHVGPLKLEHYKFQEFFWLWCNHESAWRAEGRKQVEELDVTRPISNYFISSSHNT
                     YLEGNQWSSDSSADAYRAVLRNGCRCIEIDVWNGPAPRSPSKSPSVGQRRHFSSGSLP
                     RVAGETLDAIMSVRASRQHSRSPSAAQTASLAPDPRESGTTLDPKDLSERLQKSRDSS
                     RSNHQVEPVVHHHGTWTSTVGFREVCRAIRESAFENNPLPIIISLEVGAEREQQEVMV
                     DIMKEEWGELLLDKPLESCDPDQRQPRLEELYNKILIKVKRLSDCRLVNEIERGRSIG
                     IPTIRSKPPICKALASLAIYTHSEHYEDETSLALRTPSHVFSLSEDSFRSLAEDSTKV
                     HKLLAHNREYFMRIYPQGWRVDSSNPDPTFPWRRGAQMVAMNWQKPDDGMMLNDAMFA
                     GTNGWVLKPPDLRSDSSASDLSNVLNVRKRTLDLRITVLAGQCLPLPEDRRRRRGGGG
                     FGFGFAGDAKLRPRVKVELHVDKPHKPSEYARETAPAFTDNPDWGLYPPSLDFLDVKD
                     VVEELSFVKFKVEDTSSNLRGGLVAWACIRLDRLQLGYRCVDLMHPATRQPCNAQLFV
                     KVEKILRE"
     gene            <1227905..>1228060
                     /locus_tag="THITE_33145"
                     /db_xref="GeneID:11517826"
     mRNA            <1227905..>1228060
                     /locus_tag="THITE_33145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651432.1"
                     /db_xref="GeneID:11517826"
     CDS             1227905..1228060
                     /locus_tag="THITE_33145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651480.1"
                     /db_xref="GeneID:11517826"
                     /db_xref="JGIDB:Thite2_33145"
                     /translation="MLRLANPSVRSVYGAHAQLMPGVRCPTCASNGVEVWVLEGRRCA
                     KCGTACL"
     gene            complement(1229665..1231221)
                     /locus_tag="THITE_2111847"
                     /db_xref="GeneID:11517827"
     mRNA            complement(join(1229665..1230027,1230110..1230215,
                     1230290..1230335,1230419..1230596,1230677..1231051,
                     1231133..1231221))
                     /locus_tag="THITE_2111847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651433.1"
                     /db_xref="GeneID:11517827"
     CDS             complement(join(1229840..1230027,1230110..1230215,
                     1230290..1230335,1230419..1230596,1230677..1230914))
                     /locus_tag="THITE_2111847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651481.1"
                     /db_xref="GeneID:11517827"
                     /db_xref="JGIDB:Thite2_2111847"
                     /translation="MATEEITKKRRLQDDDKPRKKQKKQKKMREDEGDLDVEAGLNRA
                     FERMDGQLLADHLAQKTRRFGTDLSPVELSDLYISANAIRDSTSWEKPRSLENLPSFL
                     EAFSGASAKLDEAPKKTGSPHTLIVAAAGLRAADLVRAVRKFQKKGCPVAKLFAKHFK
                     LEEQVSFLQKTRTGIAVGTPQRLIDLIENDALSLDSLKRIVVDASHIDQKKRGIVDMR
                     ETMLPLAKLLCRSALKERFTDEDPGRHVDLIFY"
     gene            <1232226..>1233417
                     /locus_tag="THITE_2048922"
                     /db_xref="GeneID:11517828"
     mRNA            join(<1232226..1232313,1232376..1232499,1232575..1232662,
                     1232716..1232850,1232904..1232955,1233018..1233066,
                     1233120..>1233417)
                     /locus_tag="THITE_2048922"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651434.1"
                     /db_xref="GeneID:11517828"
     CDS             join(<1232226..1232313,1232376..1232499,1232575..1232662,
                     1232716..1232850,1232904..1232955,1233018..1233066,
                     1233120..1233417)
                     /locus_tag="THITE_2048922"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651482.1"
                     /db_xref="GeneID:11517828"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Thite2_2048922"
                     /translation="FQLVPQIWANWRTKRTEGLPSFMMFLWALCGVPFGVYAIAQNFN
                     IPLQIQPQMFMSLCLVSWAQILVYGKKWPTWKATLVAFTVAAVFGGVEVALVLTLRPI
                     YEGGNEVPVLVIGIIAAILLAVGLLPPYGELWKRRGRVVGINFVFLAMDWSGAFFSLM
                     ALAAQNTFDVLGGVLYIICCVLEIGIFSSHLIWLVRTRKIRRAAAAEGKTFDDIAAEH
                     EAQGIPFRFAERKQRKFRRGSLDGVEANDRAAECRESSSSGAQAPCAEPDSTPSTDLA
                     E"
     gene            1235635..1237270
                     /locus_tag="THITE_2111856"
                     /db_xref="GeneID:11517829"
     mRNA            join(1235635..1235752,1235935..1235966,1236062..1236088,
                     1236170..1236249,1236315..1236337,1236404..1236432,
                     1236488..1236745,1236836..1237270)
                     /locus_tag="THITE_2111856"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651435.1"
                     /db_xref="GeneID:11517829"
     CDS             join(1235724..1235752,1235935..1235966,1236062..1236088,
                     1236170..1236249,1236315..1236337,1236404..1236432,
                     1236488..1236745,1236836..1236996)
                     /locus_tag="THITE_2111856"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651483.1"
                     /db_xref="GeneID:11517829"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2111856"
                     /translation="MPSKFRYQPCREFNVVVLGAGGVGKSCLTAQFVHNEWIESYDPT
                     IEDSYRTQQSIDGRQVVLEILDTAGTEQFVAMRDLYMKSGQGFLLVFSITSKSSFEEL
                     EMLRDDIIRVKDDEDIPIVIVGNKADLEDQRAVDRAKAFALSQRWHAPYYEASARTRT
                     NVDEVFIDLCRQMLRRDDSHDDSRDEPTSNRADEWGAKRRRRKKRKERCIIL"
     gene            1240395..1243659
                     /locus_tag="THITE_2111862"
                     /db_xref="GeneID:11517830"
     mRNA            1240395..1243659
                     /locus_tag="THITE_2111862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651436.1"
                     /db_xref="GeneID:11517830"
     CDS             1240744..1243413
                     /locus_tag="THITE_2111862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651484.1"
                     /db_xref="GeneID:11517830"
                     /db_xref="JGIDB:Thite2_2111862"
                     /translation="MDRPMPGSVKRARERAAAGLPREAIPPQEPQMARPSAPRQPAAR
                     QQAPFALQTKDGQIGVPISRPIPAPQWPLQEPIIAPAQVDGESFRSPSGTSRPPQRPP
                     RPSRVPSILDASKVQDHTPVFQYRPRSGRESAGQELLAVPETPSSSLSRPSTLSSVAS
                     IPDFPLPSSQLPSGPPRRSVNLGPPPSARRGASSFYSNASFVSPIPEESPRTRSHASF
                     ASSAAMPENWGSPSPGPSPDYPDPVYGEAISDEREDADDDTDRLVRSASLGKRAKPTL
                     VSTAAPRGIDSKDGEQRSGPQPLQAPFRNGTGYLESSSSSATIPAVTQPAIGTAISAD
                     TMLGAYTSASADDPSDPSRGATPSPNPQVAGRPYSRLSAIRRPPRLDIDAVRKAEARG
                     SLTSLPDLIRRATRLAASLEKGRRPASRFDDLEDLPDNRVDSDPEKRRSGLSDMLAAF
                     PPPAHPPANQNQRSIRNSIREQIQSWPLPINVNRTPNTSQEAAANSDSQREDEKRRGR
                     RCCGIPLWAFILIVIVVLILIAAAIVIPVEFFVVHKQNGKDNDPQAELQRCMQQLSCA
                     NGGTNVVNQGICSCICTNGFAGQDCTVNDKAGCTTISLTGSDNISNVTIGDAIPRLLQ
                     QAQANFSIPLSAGEILVKLNSGNLSCSAENALVTFNGRATRQAATVRQASTPDTVNAA
                     VVDGVFFTTITVVVEPQTTFTLGGATTTAPPVGGGTSFTTSITSGFFATTFSLTRQSS
                     GSTLSPTATRMVTTTMSMSSGAAMPTATGSSFVVSEDVLDFSRVAVLAILQADSLADA
                     ITAQMALQKFFGDSSSSTDASSSSGISVDAARNVTVGDGKSVDLVDFTVDLGGSKGKV
                     GRLSSVAARAWIGGGVVRRWYCPSVILGWAETP"
     gene            1244388..1246204
                     /locus_tag="THITE_2111864"
                     /db_xref="GeneID:11517831"
     mRNA            join(1244388..1245743,1245812..1246204)
                     /locus_tag="THITE_2111864"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651437.1"
                     /db_xref="GeneID:11517831"
     CDS             join(1244755..1245743,1245812..1246028)
                     /locus_tag="THITE_2111864"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651485.1"
                     /db_xref="GeneID:11517831"
                     /db_xref="JGIDB:Thite2_2111864"
                     /translation="MLLKPLTVAASLLAAPAAHAFLIPPELSPADIQAANTIESIASQ
                     VAGSRVVELELECPDCPVLVQDKHGRPIEVQLHRPSRLGLNFTVETQPEHDRLLVNGF
                     ELYPSVDPLEVLSAPQTVDWKDKDRRRHGERSHHDGKRRKRRHHLTPQPQRLGFAVNV
                     GPAKKDAEGMLELVEVELQIIEVGMTFVDDVPNLTIKLIKDQEGHLLLAKIGKSASKK
                     LTVPSEDVPQECTSTMCKLFEMARERLKSLRPFRLCHGPPMAMHGPGGAPGSHPDHPH
                     HHHPHHHHHPHGPQADSWRGPFREHRWGKLFKHVVSHIFLPVLVGIVAGVSISLIGMA
                     VGTVLVSLWRFFFRRNCHRRHHRRNSRAHLKAAHSEVALDDEKAGLMEYQDPPPSYEE
                     EEAAKTEAA"
     gene            1246778..1248237
                     /locus_tag="THITE_2111868"
                     /db_xref="GeneID:11517832"
     mRNA            join(1246778..1247646,1247848..1248237)
                     /locus_tag="THITE_2111868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651438.1"
                     /db_xref="GeneID:11517832"
     CDS             join(1246898..1247646,1247848..1248061)
                     /locus_tag="THITE_2111868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651486.1"
                     /db_xref="GeneID:11517832"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2111868"
                     /translation="MTKSAKKRARTADDDVVDAPDGKPVVKKSKLDSTGEAKVTKRST
                     KVKEPKNESVAAGKPPKSKKEKKDKMAKKSKSKAAEPAPEVEEEPAPAPSDSQPANGE
                     AAATADASSADKQTSAKKKKKKDKKKKQAQTVPTESQPQPDAPIEEEPTTTSVTNGDS
                     TSGKPARFIVFVGNLPFSATADAVRAHFASLHPTSVRLLTQRDDPTKSRGIAFVEFGR
                     YDHMKTCLEKFHHSEFDDGTGAPRRRINVELTAGGGGKTAKRRDKIKQKNAKLNEERA
                     RRLKKEEEAKREKAAQAAKTQEQRDRDAIHPSRRAQVPYGRQQQ"
     gene            complement(1248850..1250184)
                     /locus_tag="THITE_2111869"
                     /db_xref="GeneID:11517833"
     mRNA            complement(join(1248850..1249018,1249093..1249325,
                     1249429..1249609,1249683..1249741,1249813..1249845,
                     1249933..1250184))
                     /locus_tag="THITE_2111869"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651439.1"
                     /db_xref="GeneID:11517833"
     CDS             complement(join(1248952..1249018,1249093..1249325,
                     1249429..1249609,1249683..1249741,1249813..1249845,
                     1249933..1249965))
                     /locus_tag="THITE_2111869"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651487.1"
                     /db_xref="GeneID:11517833"
                     /db_xref="InterPro:IPR013753"
                     /db_xref="JGIDB:Thite2_2111869"
                     /translation="MAAQGTVQSIKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFD
                     NYSASVTVDGRPVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLISPPSFDNVKAK
                     WYPEIEHHAPNIPIVLVGTKLDKRDDPETVAKLREQRMEPISYAKGIACAKEIGAYKY
                     VECSALTQVNLKSVFDHAIRAVIEPKPPAKQQKPKSKCTIL"
     gene            1252437..1254451
                     /locus_tag="THITE_2111872"
                     /db_xref="GeneID:11517834"
     mRNA            join(1252437..1253402,1253458..1254042,1254105..1254451)
                     /locus_tag="THITE_2111872"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651440.1"
                     /db_xref="GeneID:11517834"
     CDS             join(1252603..1253402,1253458..1254042,1254105..1254258)
                     /locus_tag="THITE_2111872"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651488.1"
                     /db_xref="GeneID:11517834"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="JGIDB:Thite2_2111872"
                     /translation="MASEGQQPDATPASRRASSAEPLASINRRPILRTPGSHARGLPP
                     RPQGLSASGRKAAPPTATPHARAAFRAIDSRRAAIFTPHRARRKSLREVRDSPRDFLL
                     SLGRVLARTTQVITTSSSSSSSPGDGGGKDRRESDGAGNETTLGGISVVDDEDDDEEL
                     PKRPRLSLPIDEEDDDDDSDDLQPHRSVLIDDENFTMQSIEMPRRAISEQPGGRLSLG
                     STRMSDYFNVNDMLHSEDVGIDSGFFPPTAVLDEGNLTVGPEELPSPERLDSEADRRD
                     FGRESDLGIEVPVGDVNDSTFVIAPQVQESPDRPLFADGEPGLDNYAPLVDQRSDDYD
                     DEELLGEVPPLEEEQMEDPSLRPRDETEIESVAVQRAEVRDGSKKKSIKVSKYGIEYP
                     SLPPAVVKRLAQNFAKANGAKGQITPDAMKAIMQASDWFFEQLGEDLQAYAKHAGRKT
                     IDESDVLTLMRRQRQINPNITPFALAQRHLPRELLQELRMTPPAVPKKRSRAKGAADD
                     EDVT"
     gene            complement(<1254483..1255663)
                     /locus_tag="THITE_2076347"
                     /db_xref="GeneID:11517835"
     mRNA            complement(join(<1254483..1254592,1254679..1255224,
                     1255326..1255663))
                     /locus_tag="THITE_2076347"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651441.1"
                     /db_xref="GeneID:11517835"
     CDS             complement(join(1254483..1254592,1254679..1255224,
                     1255326..1255611))
                     /locus_tag="THITE_2076347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651489.1"
                     /db_xref="GeneID:11517835"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="JGIDB:Thite2_2076347"
                     /translation="MAAARVFTCVLRPLQGQQRPIGRALSSWPRPGFPSPSTTTTTTT
                     ARLLPPLRRTISSTPRRPKQAADEHDFTSIVDNPPELVRVGRKHGPGLIILALIPATA
                     FILGTWQVQRLKWKTDLIAKCEDRLVRPPLPLPPRVDPDAVAAEFDYRRVYTTGRFRH
                     DQEMLVGPRMRDGEQGYLVVTPLERGGGGKGDDGEEEASKILVNRGWVAKKFADQSKR
                     APAALPTGEVTVEGLLRQPWKKNMFTPENRPDKGEFYFPDVKQMAELTGSQPVWVEQT
                     MEPDYIQFLDHQDRGIPLGTPAEVNLRNNHAQYIFTW"
     gene            <1256120..>1257821
                     /locus_tag="THITE_2044263"
                     /db_xref="GeneID:11517836"
     mRNA            join(<1256120..1256201,1256259..1256327,1256560..1257728,
                     1257798..>1257821)
                     /locus_tag="THITE_2044263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651442.1"
                     /db_xref="GeneID:11517836"
     CDS             join(1256120..1256201,1256259..1256327,1256560..1257728,
                     1257798..1257821)
                     /locus_tag="THITE_2044263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651490.1"
                     /db_xref="GeneID:11517836"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="JGIDB:Thite2_2044263"
                     /translation="MVFFQGTLQEGIAAALQQGKSVVCFVTDGEAESQQWEDDFFAEE
                     EASFSQTLKEYIAAGVSKDEFVRRMKAALTTPQPPAAQPAAPEPQPAAPPVAAAASQP
                     SHAEESSASSSGQATPPSPTDSRVRALLAERAARLQQQKNAEEEAAKRQRAEKAKAAA
                     EAEASGRKQPSEQSKHAAALRKRQQEAREERQRILKAIEDNKAARRAERASAEAARKA
                     AAAEAEAAASEQPASAPFAPASPLLPSTNRLSEHCSIQVRLLDGSTIRSRFSSDETLA
                     DVRRWVDETRRDGPAPYAFKVLLTPLPSRTIDAAEERKSLRELELAPSATLILLRAHK
                     PAATAAAAAAYPSSAGGAALAEGNIFQRLVAYILAVISGVFGTIYAFFSTFFSTAGPA
                     AAPPEAASAQTSQSRPAGDAARRRGGRIAGLVQADEPRNDQQFYNGNSPRADDGE"
     gene            complement(1257889..1258838)
                     /locus_tag="THITE_68576"
                     /db_xref="GeneID:11517837"
     mRNA            complement(join(1257889..1258074,1258160..1258391,
                     1258535..1258838))
                     /locus_tag="THITE_68576"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651443.1"
                     /db_xref="GeneID:11517837"
     CDS             complement(join(1258042..1258074,1258160..1258391,
                     1258535..1258752))
                     /locus_tag="THITE_68576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651491.1"
                     /db_xref="GeneID:11517837"
                     /db_xref="JGIDB:Thite2_68576"
                     /translation="MPRQSRSTARPAPARPSVPARSAPAPTQQQQTRPATTYAAPPPS
                     APAPTATAPTAQPVSQGPGLLGQMASTAAGVAIGSSIGHVVGNGISSLFGGSSSAPEP
                     AQATQAQAAQPSNNSWGNNCAGATEQFTRCMDEQGGNMQICGWYLEQLKACQAAARQY
                     "
     gene            complement(1259099..1260259)
                     /locus_tag="THITE_2064729"
                     /db_xref="GeneID:11517838"
     mRNA            complement(join(1259099..1259719,1259771..1259937,
                     1259988..1260259))
                     /locus_tag="THITE_2064729"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651444.1"
                     /db_xref="GeneID:11517838"
     CDS             complement(join(1259534..1259719,1259771..1259937,
                     1259988..1260165))
                     /locus_tag="THITE_2064729"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651492.1"
                     /db_xref="GeneID:11517838"
                     /db_xref="InterPro:IPR011082"
                     /db_xref="JGIDB:Thite2_2064729"
                     /translation="MDVTDVTPQLDRLEEGLNKAQETLQPLLGDIGDISSKLPLLDKA
                     KLYVLLSYTIESLLFSALRLNGVDTKNHAIFTELTRVKQYMEKIQKLETPPAERENKV
                     NAEAAARFLKSDLGDNKDIKAKLEELIAKEREKAAAKASEKKRPAEESAAESSAAEAG
                     EKLVKRPKRNGGKKKK"
     gene            1260523..>1262905
                     /locus_tag="THITE_129237"
                     /db_xref="GeneID:11517839"
     mRNA            join(1260523..1260773,1260998..1262302,1262801..>1262905)
                     /locus_tag="THITE_129237"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651445.1"
                     /db_xref="GeneID:11517839"
     CDS             join(1260762..1260773,1260998..1262302,1262801..1262905)
                     /locus_tag="THITE_129237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651493.1"
                     /db_xref="GeneID:11517839"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="JGIDB:Thite2_129237"
                     /translation="MRSQPVNLLGKAAPFQPLTSVKEDGRSAKEPATAERSPASAEPA
                     VPAEQEMSGELGELRRIQSKVALWDAEERRADGRQLRLADGPPVRRSDQIHVMGLNLA
                     GRYIAHTLAGCQTIPPVRYILHSRSLYGRWRDANKQLTLIRGNDIIVRRRVVGEYISE
                     ELEGTPGEAVIENLIVTVPAGQVLQALQTIRNRLDHRSTICLINDCLGVAEALIEAYF
                     PDESRRPTFLLGHFTTALGHTDDLFSVSEVRPGRLYLSLFSPQGQQADGRFRIKRHPP
                     LERTERATSFLRLLTAMPGLKATGHPMADFLRLKLPTVAFRTVVDPLAALFDCRYDHL
                     LQNTYARQLMDRLVGEVSRVVSLLPECRDSPKFRQLAIASSLRDEVRRKLMLQRTADS
                     RMRAQIGHGWDTDIDFLSGYFVRRGRELRAGVTALDSIMWAVKAKGVIRKARLEQLKA
                     QSQAKASSSSAGGGNGQDQAQRQ"
     gene            <1263100..>1263378
                     /locus_tag="THITE_37681"
                     /db_xref="GeneID:11517840"
     mRNA            <1263100..>1263378
                     /locus_tag="THITE_37681"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651446.1"
                     /db_xref="GeneID:11517840"
     CDS             <1263100..1263378
                     /locus_tag="THITE_37681"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651494.1"
                     /db_xref="GeneID:11517840"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="JGIDB:Thite2_37681"
                     /translation="AEARRSLLEQILEPEAADRLGRIRMVKEQRATDVENRLIMLART
                     GQLRQKVTEEQLKELLSAVADTHEEEKIVVSRRKGWGGLDEDDDLLDL"
     gene            complement(1263458..1264620)
                     /locus_tag="THITE_2169904"
                     /db_xref="GeneID:11517841"
     mRNA            complement(1263458..1264620)
                     /locus_tag="THITE_2169904"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651447.1"
                     /db_xref="GeneID:11517841"
     CDS             complement(1263573..1264172)
                     /locus_tag="THITE_2169904"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651495.1"
                     /db_xref="GeneID:11517841"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="JGIDB:Thite2_2169904"
                     /translation="MLASPTGRRILRDRPRITSTSLNLPRLRALPAGTVGRTYVAWLD
                     REGVSPDTRAAVRYIDDEECAYVMQRYRECHDFYHALTGLPIVREGEVALKAFEFANT
                     LLPMTGLSVFAAATLKRSERRRFAAIYLPWALRNGLRAKELINVYWEEQLERDVDELR
                     RELGVEPPPDLREIRRQEREERRRRKREEETKAARGTQA"
     gene            1264722..1266661
                     /locus_tag="THITE_2111880"
                     /db_xref="GeneID:11517842"
     mRNA            join(1264722..1264884,1264965..1265199,1265287..1266661)
                     /locus_tag="THITE_2111880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651448.1"
                     /db_xref="GeneID:11517842"
     CDS             join(1265080..1265199,1265287..1266300)
                     /locus_tag="THITE_2111880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651496.1"
                     /db_xref="GeneID:11517842"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Thite2_2111880"
                     /translation="MEAYDELLRWAQDRGVEIHGIAPREIPGKGVGMVATKPLKANER
                     LLHVPTSALRSLETIRPKVKKALPADTRVHALLAADLALDKPTTKKYAPWNAIVPSAA
                     DLATALPLAWSSPVLHNYLPPPARALLRAQQAKFARDWAAVSAAFPALAPDAFRHAWL
                     LTNTRTFYHETARTARLPHDDRMVLQPVADLFNHAADGGCEVAFTPASFAITADRAYA
                     EGEEVLICYGRHSNDFLLVEYGFVLEQNRWDEVGLDEAVLPELGEEEKRLLEEKGFLG
                     GYVLDAKAVCYRTLVALRLLCVPRAEWERLVAEGEDGGEKVQAKVDRLLLRILCKYRR
                     TVEGTIKELEGLEDGEPCQREILRVRWQQIRALIDQTIERLEY"
     gene            complement(1266832..1269248)
                     /locus_tag="THITE_2111882"
                     /db_xref="GeneID:11517843"
     mRNA            complement(join(1266832..1267473,1267565..1268241,
                     1268305..1268853,1269076..1269248))
                     /locus_tag="THITE_2111882"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651449.1"
                     /db_xref="GeneID:11517843"
     CDS             complement(join(1267364..1267473,1267565..1268241,
                     1268305..1268744))
                     /locus_tag="THITE_2111882"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651497.1"
                     /db_xref="GeneID:11517843"
                     /db_xref="JGIDB:Thite2_2111882"
                     /translation="MADEEFEIDVYGDSANDHGDIDQGSHDQGNGDHQGYEGEEAQDG
                     DGDHHHDDYPNGHREENMDEGGASRTQSGSPAPQQRPQQGVKRKEGSDERPVDPGATT
                     ALLVSELNWWNTDDDIRGWVRQAGCEHELKEITFSEHKINGKSKGQAYVEFTTQQAAT
                     ATKHRIDALANETNQPGQKRHSVIYSSPSHNPFRTLPKDAPNRAAKDAQGRAPVGQVY
                     NDRVGNFAGNNNFGGFRGGRGGFGGPRGGAGMNQNFNRNFAGNNMNAFNANNMGFNNP
                     MGGAGGFGPGFGRGGMMGGGMRGGGGMRGGRGGAMNMMGGMPMGGGMPGMGGMGGPMG
                     GMGMMGGPMGGGMGGGMGGGMGGGMGGGMGGGMGGGMPGFQGMQPGFNPGFFGGAGNQ
                     STEWQNPHGAKRARGE"
     gene            complement(1270123..1272887)
                     /locus_tag="THITE_2111886"
                     /db_xref="GeneID:11517844"
     mRNA            complement(join(1270123..1271650,1271720..1271824,
                     1271880..1272397,1272478..1272887))
                     /locus_tag="THITE_2111886"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651450.1"
                     /db_xref="GeneID:11517844"
     CDS             complement(join(1270364..1271650,1271720..1271824,
                     1271880..1272397,1272478..1272745))
                     /locus_tag="THITE_2111886"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651498.1"
                     /db_xref="GeneID:11517844"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2111886"
                     /translation="MSGSHVAGHGDHEEHEHEYEDDYDNEHYHEHDQEHDHDDDDDDD
                     DDNNDHGREHDHTHPPTDWLDWLEAHANDDDEEEADEDEDDGVFGGRGIEVEVVIEEV
                     MDQNEQGESSQGAAAGGGQGAGQGRQTRVIRLGRGTLTAHQPQPSLNALTEPPGGRVG
                     GPYMTQREVLALLRGQYINPTIVDDGDGRGERFSWNIGSFDGPKPFPKVPSEEGRKLM
                     QSGVFGAYDRRQLKPKALARRLLDRELGLDGWSGQKVNRGLMAQSMLPSTKPEMVIHY
                     DDPVCCGQFSDDGNFFYACVKDFKVRLYDTSSPYNWRHYKTVRYPFGQWTMTDADLSP
                     DNKWLAFSSLQPHVGIAATDPNDTGEPYSLDLSDGSRRTGGEYIFGGFAIFSVRFSGD
                     GRHLVAGTGQSSIVVYDIERRKTVHHVVGHRDDVNAVCFADKGSPHILYSGSDDCTVK
                     VWDTRSLGDGREAGAFVGHIEGLTYIDTKGDGRYVLSNGKDQSMKLWDLRMAMSTARF
                     EELDPTAVTRRRDYEYDYRWQDYEDYQWFPHPHDNSLVTFRGHKVQRTLIRCHFSPPN
                     STDSHYVYSGSYDGFVYVWNLDATLAAKIDVRSATRGAVARPPRSDRRHRLHLHPRNA
                     AGWEALVRDVGWHPNAPMLVGKYLLVIPPQHLISLYIPFWRERERTHADALQASAWSG
                     PAMDAGTASLHSFNEGESDEAEPPMGIPLTEKLGPLPEWSSSR"
     gene            <1274339..>1275651
                     /locus_tag="THITE_2046735"
                     /db_xref="GeneID:11517845"
     mRNA            join(<1274339..1275172,1275229..>1275651)
                     /locus_tag="THITE_2046735"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651451.1"
                     /db_xref="GeneID:11517845"
     CDS             join(1274339..1275172,1275229..>1275651)
                     /locus_tag="THITE_2046735"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651499.1"
                     /db_xref="GeneID:11517845"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2046735"
                     /translation="MLKDRSRPSSPAPWNGPDTSDDAYNDGYDDHSRDDSDCDQESDD
                     GTNNGANNDAYSPCLQLRFDHSRKNEEGFVLGTSRNCDIVLPKRNTLAGLAPRQCVIT
                     FDVHGRLILRDLQPRKLNNSGGTAVTYKDQGGQRRRSFTWILSGHRFTAANVPIRIHL
                     HDNLSFRVVVCQHDISSVWYQQNVALFRSRFASSVNSVSLGGLGLKSLDSTAAPSGAQ
                     TPGTDAILLKDRELGRGAQAVVARVWDASTAIEYATKEPLRQHFHERLKREIRLLRHI
                     NHDCVVRCIPELSMMEPVPRLVLEYIPLGSLEDQDEENQISIHETFEVLRQGLSALRH
                     LHERETPIVHRDIKPSNILVQSRTPVIHIKLSDFGFSGENEDYLKTCCGTPLYTAPEV
                     FRGEPYNAAVDIWSLGVVVFQYAYGLP"
     gene            1277404..1279619
                     /locus_tag="THITE_2111890"
                     /db_xref="GeneID:11517846"
     mRNA            join(1277404..1277866,1277936..1278716,1278792..1279619)
                     /locus_tag="THITE_2111890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651452.1"
                     /db_xref="GeneID:11517846"
     CDS             join(1277744..1277866,1277936..1278716,1278792..1279414)
                     /locus_tag="THITE_2111890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651500.1"
                     /db_xref="GeneID:11517846"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="JGIDB:Thite2_2111890"
                     /translation="MASLQSASSAAPSPASHKGYDPEIVDIADYVHNKTIDSELAFDT
                     ARWVFLDTLGCGLEALRFKECTKLLGPIVPGTVVPSGTKVPGTDFQLDPVNGAFNIGA
                     MIRWLDYNDCWLAAEWGHPSDNLGAILAVADWATRTNKAGQRKVAGGKIFTVRDVLEA
                     MIKAHEIQGCLALLNSYNKVGLDHVVLVKVASTAVVSKMLGLSEKQTADAVTQAWVDG
                     QSLRTYRHSPNTMSRKSWAAGDACQRAVNLALKVLKGESGIPTVLSAPTWGFYDVLFK
                     GKKFEFQRPYGSYVMENVLFKVSYPAEFHSQTAVEASEKIHAQLKAMGKSAADIKAVT
                     CRTHEACIRIIDKQFKPMDNFADRDHCIQYMCAVMLVFGRLTAGDYVDGSEAATSELV
                     ESLRKRIKCVEDPQFTADYHDPALRTISNGLTVELNDGTVLPEVVVEAPLGHRLRRDE
                     AKPHILAKYKRHLEPHFSADKVRQLVELGQDPKRLESMAVDEYVDLYVCKDSQFFKEQ
                     "
     gene            1281894..1282813
                     /locus_tag="THITE_2111892"
                     /db_xref="GeneID:11517847"
     mRNA            join(1281894..1282062,1282134..1282193,1282265..1282813)
                     /locus_tag="THITE_2111892"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651453.1"
                     /db_xref="GeneID:11517847"
     CDS             join(1282021..1282062,1282134..1282193,1282265..1282606)
                     /locus_tag="THITE_2111892"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651501.1"
                     /db_xref="GeneID:11517847"
                     /db_xref="JGIDB:Thite2_2111892"
                     /translation="MTPYPSFCYCANFYCSVRCTNTVSKFGERCLLCTVARCGVSLTR
                     GMLPEESLWLVFNTEDDEDWDNSRDSNNNNRQGVRLDSDQPSHSASSNSDSDSSSNKS
                     SSSRSWRATWPFRGAFSLPSLSPSRKPPQDGPGVCRNGPRGSRAW"
     gene            complement(1282842..1283883)
                     /locus_tag="THITE_2111895"
                     /db_xref="GeneID:11517848"
     mRNA            complement(join(1282842..1283177,1283235..1283531,
                     1283657..1283883))
                     /locus_tag="THITE_2111895"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651454.1"
                     /db_xref="GeneID:11517848"
     CDS             complement(join(1283020..1283177,1283235..1283531,
                     1283657..1283705))
                     /locus_tag="THITE_2111895"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651502.1"
                     /db_xref="GeneID:11517848"
                     /db_xref="JGIDB:Thite2_2111895"
                     /translation="MLLTSAQVSVAVSSGIVILCTAALFLSGYALQQRTLRELRAAIK
                     PSPEPSPKIFLPDRFKESASELEDGTVVTLDDEGDEGDTGQKDGQVIEVKPTLPDQTP
                     SQKHLSPGRGAAWGRRKGNGAPQEHDRQQPQKPMSRAERRRRIREEIMKMGQGEDPVG
                     YHQRKQW"
     gene            1283965..1285020
                     /locus_tag="THITE_2111896"
                     /db_xref="GeneID:11517849"
     mRNA            1283965..1285020
                     /locus_tag="THITE_2111896"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651455.1"
                     /db_xref="GeneID:11517849"
     CDS             1284112..1284987
                     /locus_tag="THITE_2111896"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651503.1"
                     /db_xref="GeneID:11517849"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="JGIDB:Thite2_2111896"
                     /translation="MSKPAVHRADERRFLDERGTTGPLAPNGLNPATIMEKAVRERIV
                     ESYFYKEQCFGVNEADIVDRVVEHVHFIGGVYGSGGQRPTPFLCLAFKLLQLAPGDDV
                     LREYIGFGGDKFKYLRALALFYVRLTRPDKDVYMTLEPFLEDRRKLRRKGRNGTSLTY
                     MDEFVDDLLTKDRVCGTSLWKMRKRDILEDLEILEPRVSPLGTLEDLLDEEDEAMQNG
                     DGANGDGHEGDSGSVRSRSRSRSRSRSRSRSRSRSASQPGSKSRSRSPGERSDHDRMD
                     IDGSEGRRSAGGRSP"
     gene            complement(1285451..1287430)
                     /locus_tag="THITE_2111897"
                     /db_xref="GeneID:11517850"
     mRNA            complement(join(1285451..1287204,1287280..1287430))
                     /locus_tag="THITE_2111897"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651456.1"
                     /db_xref="GeneID:11517850"
     CDS             complement(join(1285568..1287204,1287280..1287376))
                     /locus_tag="THITE_2111897"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651504.1"
                     /db_xref="GeneID:11517850"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="JGIDB:Thite2_2111897"
                     /translation="MSARGRPRCLRLRHGPGPSVQQRRPLNHFISQAPEPTESAEPPP
                     PPPHRFTLAVKDNIATSAPHPTTCASPFLAGYHSPFEATIVTQLRARGARLVGTTNLD
                     EFGMGSHSTHSAFGAVAQDPSASASASASASASASNRSTTDTNDNNNARDDGPPPLFS
                     AGGSSGGSAVAVASGAADVALGTDTGGSVRLPAAYCAVVGFKPSYGMLSRFGVVPYAN
                     SLDTVGLLARAVGVIRRLVVGSGQQQQQQQQPQPQGRGLEGGEEEVGGLWREGDPRDP
                     TALSVAARERCASVREGYAGELDGDVAAQRLRGLRLGIPLEYNIAELDPRIRDAWAAA
                     AKVLQDGFGARVVPVSLPSTRHALSAYYVIAPAEASSNLAKYDGVRYGTRDTESGSDA
                     AGGVLYAASRGRGFGDEVKRRILLGSYTLSSEAMDNYFIQAQRVRRLVRRDFNRVFAL
                     DNPLHERETFDLADLDEGVAMEDKWGPEEVDFLLCPTAPTLAPTLEDVMSQTTVDAYM
                     NDVFTVPASLAGLPAISIPMPIKGETGVDVPQRPAAAGLQLIGQYWDDARLLAVAEAV
                     SNVLGDAALAR"
     gene            <1288269..>1289195
                     /locus_tag="THITE_2047627"
                     /db_xref="GeneID:11517851"
     mRNA            join(<1288269..1288401,1288480..>1289195)
                     /locus_tag="THITE_2047627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651457.1"
                     /db_xref="GeneID:11517851"
     CDS             join(1288269..1288401,1288480..1289195)
                     /locus_tag="THITE_2047627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651505.1"
                     /db_xref="GeneID:11517851"
                     /db_xref="JGIDB:Thite2_2047627"
                     /translation="MSSKLIPPRPDEVMVIRDVAPNVVTFSVPFLRFGRFPIGGRGTL
                     VRLTSGALAVFSPVALTDAARAKVAELGGDVRYLVATDIEHHIFLSEWAAAYPGAKLV
                     GPEGLPEKRRKAAAKGNDAKIGAEPFAAVITKENCKDVSRIGEDFAADFDMEYVHAHP
                     NRELVFLYRPGRVLIEADLMFNLPAAEQYSRVPAAQRPRPGLLARLFEGLQSTEGEAL
                     AMKRFLWHAVSRADRAAFNESVRRIAAWDFDTVVPCHGETLVGDGKAVFQKVFAWHLG
                     GKGARR"
     gene            complement(<1289626..>1293600)
                     /locus_tag="THITE_153327"
                     /db_xref="GeneID:11517852"
     mRNA            complement(<1289626..>1293600)
                     /locus_tag="THITE_153327"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651458.1"
                     /db_xref="GeneID:11517852"
     CDS             complement(1289626..1293600)
                     /locus_tag="THITE_153327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651506.1"
                     /db_xref="GeneID:11517852"
                     /db_xref="JGIDB:Thite2_153327"
                     /translation="MAESDPWVDPTPDPEPEEAPSPDAASSDDAEEPLGRVPSISLGP
                     PLTETAAGGEDAAAGDEVVFEGVGSSGRGSSISPTSERFFSPTRERFFSPTRQTFGAA
                     IRRVPSSTHGDVGSPLLGPSAGPMSRPLSPWRARRRPDLLRRSSASSASSSGAGVASG
                     VASPRFPSPSLEARDIYSANPEFPAWDDSENGLRYEPWPPGLDSRIAVILTDVSEPPR
                     NGLFERIDHRGVLQKHMEQSPEGIQKLWEKLLGAYDIAMIGKCAALHALAGAHKRIRE
                     DDNRVREVDESYYRLVEQNADLTATIDRLEELIMKQQRQLDDLKQDNRVLARDKAVFE
                     GMYTKIATVQETELGFLEEVVAGWGTFDEARAIHSTSAGRDDLAARFQYVRETLEEAR
                     EEAQMAKRRCKQLEDKCKALEKEVEEAAMGRTSQGEPSPGAQSAWQFRAEQLELENQA
                     LESELEAERAHAAEMAKEHAQLLAELHSDGILQAQDYLAAMERLKKELVLYKDKCASL
                     QRTVDELKKRLASQVVEATHEKKEYESNMDDLEAQIQDTTARLSDVISALEGDTGAAS
                     RASDTQHSPQAGEAVREPEATPRFNMQSSRAAVDEIAATIDAVVKQISQDIAENKAIQ
                     AEEAWRISEELKKLAASADTLVEGHELMEEAQEVIDAQLDRLREQIRSHKRTFQDVRQ
                     QVCQQRAQVQATRASFHQGVPGAFGPAPFGAGDSEMQCLRHARELIAQLKQNSGQVGT
                     ENAALQCLEQLTPLLGTLRLMDPDPSEEEAILALVKFLEESVMQGVGHDTGSFYATLD
                     EHDDRLRSLLDPGNLALHQSSEAERELLRGIQQKLEAAEALQKVQEEQMRKYEAYRAQ
                     HIAGGLTSAQSEELLRIAGSAVDTAGGKWTWPTPMSQKGAAGVDDLVAQVQKLTADAY
                     LSDRRSELEDGNALQKAQLAELEEEIARALKLADNAQKQLEALARVQAKGKAPATAEE
                     GESLQAFQDALQKREGRLRREQHLNLAQLERLQARRARAAAFLENEAASDRRRAETLL
                     TEALLKLQAAGSPSHHGEAACFCTLLRFLFPHIYYSAVSGGCCAGGKLVASAAATSPG
                     SAAQSGPAAAAAPACQGHHGHGLLRASGRLSTAVCRFCTALAWIVLLILIQPYNLYAA
                     AAFLLSLLLHLPRHLYRLLASAASYAYARLRHRRQDDDRGSAAPAESSTSTSPSTPLS
                     KSESFKLNLKPLLDANAWQTSLPLSLTQHLPQPPPPSVLVGAGLTLFLAYAWLTYVAL
                     LVERRVWAGANDWRWAYALDLAAAGQPLPYPGWAPLRVDYRLVGDGAWVWFASWVHSL
                     FYGR"
     gene            complement(1294057..1295800)
                     /locus_tag="THITE_2111901"
                     /db_xref="GeneID:11517853"
     mRNA            complement(join(1294057..1294330,1294383..1295800))
                     /locus_tag="THITE_2111901"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651459.1"
                     /db_xref="GeneID:11517853"
     CDS             complement(join(1294140..1294330,1294383..1295484))
                     /locus_tag="THITE_2111901"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651507.1"
                     /db_xref="GeneID:11517853"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="JGIDB:Thite2_2111901"
                     /translation="MENRRSLAVRSGDAPGAAASSARKRTSDVGSEPSTSRRRTRDPS
                     PPERDDASDADEYDPEQSMHERRAIQRDLREMQRQMRENPDEFLQADPKALLDYLDQS
                     DRIIRNVKQTAEAAIDSRGLVIAADLSARRVQRLTSGNVGNGIDVDEFVSKCITYMLH
                     GRGIEDDEAEELSSTQRRRRQPNRGALGSDDEFEIGDDGDMMNWAHLGRFACIPAVRR
                     PALPGFLLGPLSIEKKARKVTKRSAPFRLNSLREVRPEELRAEDLKKSDKNDLPSICK
                     KIHVQLEAAQQQAQDAVEDAFDKLGDDLPPEEQRALMERHALRSTGGIDLLRFVINPR
                     SFGQTVENMFYVSFLIREGSVKLEFDEDGLPAIAPVRKNSSAEPSRPKATTRHQAIMS
                     IDMATWRDIIDAFDIKEPMIPHREEEAQQGPGARGWYS"
     gene            complement(1296039..1297602)
                     /locus_tag="THITE_2111903"
                     /db_xref="GeneID:11517854"
     mRNA            complement(join(1296039..1297345,1297424..1297602))
                     /locus_tag="THITE_2111903"
                     /product="glycosyltransferase family 69 protein"
                     /transcript_id="XM_003651460.1"
                     /db_xref="GeneID:11517854"
     CDS             complement(join(1296183..1297345,1297424..1297562))
                     /locus_tag="THITE_2111903"
                     /note="CAZy_ID 269932"
                     /codon_start=1
                     /product="glycosyltransferase family 69 protein"
                     /protein_id="XP_003651508.1"
                     /db_xref="GeneID:11517854"
                     /db_xref="JGIDB:Thite2_2111903"
                     /translation="MRRPRALLFVQLSVLALIAVYFLHFRFDTLGSVRSDAPGSLALT
                     PNATLPLQNLTAYTRAILDPSDASLPKVECPRPDLSRYAHLRAKSHAGPSSLRYFFAL
                     NLRNCLPLLPQLLGSILEVIRFLGPEHCALSIVEGNSPDGTAEVLAALEPELIRLGIR
                     TYFTLNNQIDPLAEGSDRFSSLATLRNLAVAPLLAAFSNPPTITTTAAANASVLFIND
                     VAICADDLLELAHQRARQGADMACAMDWTGATDDDDDDDDAQPGPAFYDVYIARAING
                     DLFFDVPPATVSWDRAADLFWNEPIARARLERHAPFQVFACWNGAVAFTARPLVEGKV
                     AFRGARADKGECWQGEPQAFCKDLWLNGYGKIMVVPQVNLAYSIEEGRTIKKLKGFAS
                     RWAAEEDEAEPRIEWLPPPDQVKCMPTFQDQTWRPWNETFG"
     gene            1300537..1303314
                     /locus_tag="THITE_2111906"
                     /db_xref="GeneID:11518622"
     mRNA            1300537..1303314
                     /locus_tag="THITE_2111906"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651461.1"
                     /db_xref="GeneID:11518622"
     CDS             1300542..1303181
                     /locus_tag="THITE_2111906"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651509.1"
                     /db_xref="GeneID:11518622"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="JGIDB:Thite2_2111906"
                     /translation="MSHVCSLFGDAHAHYDTCPACSPHSDLYVTVQVWAGSKPLTVPV
                     QTAYKSFRTERRWNEWLTLPIPYSSLPQNSRLAITIWDLSPAGGDGAKGHAVPFGGTT
                     LPLFDKDNQLHKGRQKCHVYRHREADGNDDSRTPSFLPRRQAVKGAPEDREADELDRM
                     EKLFKKHEMGEIPRVDWLDQLVFRGFEKRGLQSARSSRKAAQRRQAAQADGVGEKADT
                     EADSGPQPSSFMLNVELPRFDFPVVFADHEYPPPPVSSYLQLSSSQSNVILKPPPEVQ
                     FGPGINAVGDDEGYGGRLIPVYDPEVAAKDNPAETKHRRLVRSQHRSGNMDKDLKPNA
                     KVRDELNTIMAYSPTHTLTPEEKDLIWKFRYYLTRNKKAVTKFAKSVNWQDVSEARHA
                     AQILGMWTDIDVDDALELLGPTFDSPAVRAFAVDRLRKADDHELLLYLLQLVQALKYE
                     HISPQSGHEVTQDSSLARFLISRAVSSFTLGNYFWWYVMVECDDKSQDQGPHNQAVYG
                     KIAYDFMTELVKQPGGEETRATLRRQAEWISILSKISGEIKASNESIAKRTERVKHFL
                     ADPKNELVTIDPPLPLPLDPSVEIIGVAPEETVVFKSSLHPIKVSFKTTAGRKYPIIF
                     KTGDDLRQDQLVIQIITLMDDLLRKENLDLKLSPYKILATSTSAGLSQFVHSMSFQAI
                     TSKYRNNPALSYLKQNNPDSHGPLGLRKETLDTFIKSCAGYCVITYILGVGDRHLDNL
                     LLTPDGHFFHADFGYILGRDPKPFAPAMKLSKEMVDCMGGANSEHYRQFKQYCFLAYS
                     ALRKNCNLILNLFSLMANANIPDIKLEPDKAALKVKERFHLELSSEEDAIRNLERIMD
                     DNLNALVPVVIDKLHELVQAFRA"
     gene            complement(1303315..1305348)
                     /locus_tag="THITE_2111907"
                     /db_xref="GeneID:11518623"
     mRNA            complement(1303315..1305348)
                     /locus_tag="THITE_2111907"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651462.1"
                     /db_xref="GeneID:11518623"
     CDS             complement(1303484..1304815)
                     /locus_tag="THITE_2111907"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651510.1"
                     /db_xref="GeneID:11518623"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2111907"
                     /translation="MASALNPRHLPLRLALRPRLPLLPSTSSTTTTTTPPSCLPIPTS
                     IRLPPRRHKSGPYGYTLAKTLVFSRFGEPRDVLSLHTHSISPALPDGAALLRALAAPV
                     NPADVNTVQGTYGAKPAFERLLGTPEPAAVPGNEGCFEVVAIGGGAGGGGGLKKGDWV
                     IPAQSGFGTFRTHALVEGAERKLIRVGGAKGREGLRAAQVATVSVNPCSAYRMLRDYV
                     DLVDLSVQSFARGDGATGGAWFVQNGANSGVGRAAIQLGRLWGLRSINVVRERATPEE
                     TAALKRELAELGATVVVTESEFLDRSFADRLRDEWTRGGREPVMLGLNCVGGKSAAAM
                     VKALSPRGCMVTYGGMSRQSFPFPTGQQIFKRLRFEGFWLSEWAKENPAAKRDTINEI
                     LELMREGKFKEAPLQEVEWNWDTEESVLKDTIQGTLEGFRPGKSIFVFKDT"
     gene            complement(1305350..1307055)
                     /locus_tag="THITE_2111908"
                     /db_xref="GeneID:11518624"
     mRNA            complement(join(1305350..1306056,1306132..1307055))
                     /locus_tag="THITE_2111908"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651463.1"
                     /db_xref="GeneID:11518624"
     CDS             complement(join(1305879..1306056,1306132..1306808))
                     /locus_tag="THITE_2111908"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651511.1"
                     /db_xref="GeneID:11518624"
                     /db_xref="JGIDB:Thite2_2111908"
                     /translation="MTSQRNTSAATPANRSATTNKRFELPALEFKFGSLTDGTDIPPP
                     LPSPVQEDPVAATPPDTPELEKEQQEGASATNGKPDTASSPNSQPASASPTGTKRRAE
                     DGPASPTLSNRPGSIRRLFSRGLLNTAYANGDGAGQQGGRPPSRGAGSVTDSRRAKRS
                     SGWFGRLLTNEGVANKAAVPLSPPATDDKKPTGPPPPQIPELSELNSKLGIPNDSGFG
                     TDLFKDINGECCGGADARYPALSFFSLPYPYLTRTSTFSSDEGFFLVRFTTYALWLLW
                     CPQCFSCF"
     gene            complement(1308493..1309882)
                     /locus_tag="THITE_2153916"
                     /db_xref="GeneID:11518625"
     mRNA            complement(join(1308493..1309144,1309204..1309335,
                     1309402..1309490,1309558..1309882))
                     /locus_tag="THITE_2153916"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651464.1"
                     /db_xref="GeneID:11518625"
     CDS             complement(join(1308966..1309144,1309204..1309335,
                     1309402..1309490,1309558..1309610))
                     /locus_tag="THITE_2153916"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651512.1"
                     /db_xref="GeneID:11518625"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2153916"
                     /translation="MALPKRIIKETERLMAEPVPGISAVPHEDNLRYFDVEIHGPSSS
                     PYEGGIFKLELFLPDDYPMAPPKIRFLTKIFHPNVDKLGRICLDVLKNNWSPALQIRT
                     ILLSIQALLGAPNPDDPLAADVAKSWKEDEQAAIATARAWTQQYAVPK"
     gene            1310205..>1315317
                     /locus_tag="THITE_68540"
                     /db_xref="GeneID:11518626"
     mRNA            join(1310205..1310628,1310910..1312578,1312781..1313063,
                     1313249..>1315317)
                     /locus_tag="THITE_68540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651465.1"
                     /db_xref="GeneID:11518626"
     CDS             join(1310465..1310628,1310910..1312578,1312781..1313063,
                     1313249..1315317)
                     /locus_tag="THITE_68540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651513.1"
                     /db_xref="GeneID:11518626"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_68540"
                     /translation="MPSSFVRLADAPRKGKSIKSAFESESFDADVTIHVDGLVGSATI
                     SPCGRDVALASRAITDINFSAHHPDSLATCSVDGYVYCWDLRRPRQPALAFCDWFAGA
                     TQVKYNRQDPYVLASAHDRWLHIWDTRRAVEPLKTISAHTSKIYGIDWNRTKSTCVVT
                     CSLDKSIKFWDYGQDDETPQRVIRTDFPVWRARHTPFGYGLLAMPQTEPGNLYLYDQR
                     AGPETPVDGAVQPTAVFPGHGSHKAKEFLWRSRGGVSNEGIDNREFQLVSWGEDKELR
                     LHKVEPELLESVGHVRGTPLMENLNVTRRGATYKTFRTVNDAIHRDRRIPTMSDRPGS
                     GGQFRQSALSIGLNSSLRRVGPSWRPTSMKAKTNTSRHVDKTQLQIGWMKGISMSKRK
                     PSSDSPGRVHSSLFSPGFDAGWGEPEAIQDEFLRISNQLPNVKWDNIDMDSLTLNASL
                     KGPWGVNRETIFIKVRVDIPTGYPKTKAPRFYVEKSSFMPEETHRKIELELYELANRF
                     LQRKQNCLYMAFSYLLGETDLESSTAFFENVRDLDDDLDALADESSSEEDENDIPTGG
                     SASMSQELSASTELDPSATLASAQRQAVTPLPVYCGARFSNDGRLTRRHRPTLNPRRC
                     TRSIYGTSPGAGSARAGARTSPHGPAAAVPGPVPERGPAQGPAGGGRANRRTSSPYIT
                     CKAKSPQRNSSLRSTPFLAMGPMYDSQATTPGSNLAGRVRWGYHPLARDLINDLFDYY
                     EKIADIQMLAMLACIFGDYSMEEEAAIAASHLPQPKTPLPMKAPSFSLEYFPTDPALW
                     NLNYRSQASSAITTPRTANTPALYSDPPSSDETAGFAEPRSHHSYSCGETPPNASREH
                     LREVSQTQSLSTSPSNRLFHRSNSTVAAAIAASLPRALAGIVSGSPPDPIRKRPSPAE
                     AMLNALTPHALVWAGSSTSGAGPDTPGTSRTSFSDDEPLKDDLMAMVPIAVSCVPENQ
                     GLFDDDGWISGPLIDRSRFKLYSNYRYAYAEMLQMWGLPLSRLEIMKFDVLKEDALSP
                     AAASKEGSVPNNTPLYPTGAASPTSPFVDRRSMFHELATSGRGLDVTGFCRVHPGVPL
                     EPVEYLRPTNPNLGYGSNPQVVNGSNGVCHRCSAERDGADLVPQTEMRCVYCWEPVTG
                     LFAPCLSCGCVSHEACLADWHAMGGGECPAGHDCYCLEDASNATPDSWAGLQVAVPIW
                     FHGDVERVGPTGQTPRSGTPTTIASARSARSRRKSAPADAARFHMLRRTHTDSSGTTG
                     TEGYGTEAVPHTRPSLGRNPGGGSSRRHNNSYRGHRHDNGYNDDDDDLDHHSHHSHHS
                     RSHSSHRNRPDRDGGGGLLLAGVKPPPRGEEPVSAAQLSLGKRLKKQLEESGRPGVPR
                     RNSGGLAMWKAAGGGG"
     gene            complement(1315682..1317265)
                     /locus_tag="THITE_2169909"
                     /db_xref="GeneID:11518627"
     mRNA            complement(join(1315682..1316262,1316378..1316525,
                     1316593..1316761,1316830..1317265))
                     /locus_tag="THITE_2169909"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651466.1"
                     /db_xref="GeneID:11518627"
     CDS             complement(join(1315927..1316262,1316378..1316525,
                     1316593..1316761,1316830..1316947))
                     /locus_tag="THITE_2169909"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651514.1"
                     /db_xref="GeneID:11518627"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="JGIDB:Thite2_2169909"
                     /translation="MSTMPATHGHNEACCNIPPVVSTGYSAKGSYDEVDGLKTYVTGP
                     ADANKGIVVIYDIFGYFDQTVQGADILATSHHQKYKVFIPDWFKGEPCPIEWYPPNTP
                     EKQKNLGAFFGKNPPAGVASKLPEFVKALQAKNPSVKSWGIVGFCWGGKVVSLVTSSD
                     ANPFSIGAECHPAMVDPKEAETIKVPLALLASKEEPHDKVKQFEENLKTSAKHVETFG
                     DQIHGWMAARADLSNDRVKAEYSRGYKTVLDFFGKHWP"
     gene            complement(1317563..1318891)
                     /locus_tag="THITE_2111924"
                     /db_xref="GeneID:11518628"
     mRNA            complement(1317563..1318891)
                     /locus_tag="THITE_2111924"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651467.1"
                     /db_xref="GeneID:11518628"
     CDS             complement(1317812..1318441)
                     /locus_tag="THITE_2111924"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651515.1"
                     /db_xref="GeneID:11518628"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="JGIDB:Thite2_2111924"
                     /translation="MVRQQPPPNCDQSELDLWLDEVDESMIFRPACALGMSCGTVTVD
                     LARAMVLVIWNNRLKLWQLPKGRRNLNESMLAAALRETHEETGIRVTPLRLDIETRAT
                     PPKSERADTSSKPPNITKGYPSTEFVGACMYPDPQSETEALKIVYFFAATADCTVARD
                     SGTQEEWEKLDAKWIPLSEIPSKLRFNAEVRTVMKAVDDMRRSGYKIGV"
     gene            complement(1321673..1323270)
                     /locus_tag="THITE_2111925"
                     /db_xref="GeneID:11518629"
     mRNA            complement(1321673..1323270)
                     /locus_tag="THITE_2111925"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651468.1"
                     /db_xref="GeneID:11518629"
     CDS             complement(1321799..1323142)
                     /locus_tag="THITE_2111925"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651516.1"
                     /db_xref="GeneID:11518629"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="JGIDB:Thite2_2111925"
                     /translation="MSSSTITRALARATRPNRASLARCGHLGIGSGATPSRASALPIP
                     FQQQKRNASSKHPKGFEPPTPADLAELRERVQEFTRRELTEEVAAATDKSNSFPPGMW
                     AKLGEAGLLGITADEDVGGLAMGYQAHCVVMEELSRASGSVALSYAAHSQLCVNQLQL
                     NGTAAQKQKYLPDLIAGRKVGALAMSESGSGSDVVSMRTRATAVDGGYLLNGSKMWIT
                     NGPDADVIVVYAKTIPDGGSKGITAFIVDTSAPGFTCLRKLDKMGMRGSNTGELVFED
                     VFVPRENVLGPVNGGVRVLMEGLDLERLVLSAGPLGLMQAALDVALPYAHARRQFGTP
                     IAQFQFVQGRLADMYTKLQASRAYTYATARAVDEQGLIRTQDCAGAILYAAERATECA
                     LDCIQVLGGMGYTEEMPASRILRDAKLYEIGAGTSEVRRMVIGRAFNKEYAHLSS"
     gene            1323434..1325626
                     /locus_tag="THITE_2111926"
                     /db_xref="GeneID:11518630"
     mRNA            join(1323434..1324124,1324199..1325234,1325321..1325626)
                     /locus_tag="THITE_2111926"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651469.1"
                     /db_xref="GeneID:11518630"
     CDS             join(1323559..1324124,1324199..1325234,1325321..1325443)
                     /locus_tag="THITE_2111926"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651517.1"
                     /db_xref="GeneID:11518630"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="JGIDB:Thite2_2111926"
                     /translation="MLLFPRQLSRQCIRTRPLRPRCRDPGHPGLPGCAARRTVATFNA
                     PHHASAISVIKSNVDPSSDEFKENERLMGEAMARLDELTRRVQQGGPAKAREKHLARK
                     KMLPRDRVTALIDPGTTFLELSPLAGHELYPEAEVPAGGIITGVGVVEGVTCMIVAND
                     STVKGGTYYPITVKKHLRAQAVAQENKLPCIYLVDSGGANLPHQADVFPDREHFGRIF
                     FNQARMSAAGIPQISVVMGPCTAGGAYVPAMSDESIIVQEQGHIFLAGPPLVKAATGE
                     VVSPEDLGGGKMHSSVSGVTDYLAVDDAHAIVLARRSISNLNWPSGAASSTPAFSEPL
                     YDPSELLGIASTNLRKPLPIHEVIARIVDGSAFAEFKRDYGTTLVTGFASIYGHRVGI
                     VANNGILFSSSALKGAHFIELCAQRGIPLVFLQNISGFMVGRDAEREGIAKNGAKLVT
                     AVACADVPKFTVVVGGSYGAGNYGMCGRAYSPRFLWMWPNARIGVMGGEQLASVMETV
                     GQKVDTGLKERIERESDAVFSSARLWDDGVIPPAQTRQYLGLGLNAALGGRNAVAPGQ
                     TKFGVFRM"
     gene            <1326283..>1327965
                     /locus_tag="THITE_119905"
                     /db_xref="GeneID:11518631"
     mRNA            join(<1326283..1326457,1326500..1326739,1326812..1326859,
                     1326928..1326997,1327084..1327314,1327571..1327687,
                     1327785..>1327965)
                     /locus_tag="THITE_119905"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651470.1"
                     /db_xref="GeneID:11518631"
     CDS             join(1326283..1326457,1326500..1326739,1326812..1326859,
                     1326928..1326997,1327084..1327314,1327571..1327687,
                     1327785..1327965)
                     /locus_tag="THITE_119905"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651518.1"
                     /db_xref="GeneID:11518631"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="JGIDB:Thite2_119905"
                     /translation="MSHPVWQVLRGAAGRTSAARIILGKPPVSASTTPARLVRARCPA
                     SAASASGFHTTPAGLSAKNKTADEELASVAGSYARTDDTITVEYPPDEQLPASKPVAG
                     AGRAGAHVFPTLATFSLQGKVGVVTGGARGLGLVMGQGMVISGADLAIVDINKDEAAR
                     QAQNIVETFRKEHPEAKKLPKVTAHYADVSDPASVEACIAEIVAAHGKIDNLVTSAGF
                     TENFEAVAYPIDRMRKLWGVNVDGTYLFATAVARHLVPYNAAKAAVRHLCASLSVEWA
                     EAGIRVNCISPGYMMTALTKKILDDKPDLKKRWTSLIPQGRMGSPEDLMGPVTFLLSD
                     ASSYVTGADLRVDGGYTVT"
     gene            1331525..1334250
                     /locus_tag="THITE_2111929"
                     /db_xref="GeneID:11518632"
     mRNA            join(1331525..1331560,1332092..1332381,1332443..1332636,
                     1332693..1334250)
                     /locus_tag="THITE_2111929"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651471.1"
                     /db_xref="GeneID:11518632"
     CDS             join(1332273..1332381,1332443..1332636,1332693..1334024)
                     /locus_tag="THITE_2111929"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651519.1"
                     /db_xref="GeneID:11518632"
                     /db_xref="JGIDB:Thite2_2111929"
                     /translation="MNAAMPMGFFANTQEIYDEVASYPVVPPEKIKEYWNAYTTTFRR
                     LFDPSAFRLEYFWWHVWGSDRLRNLSGPALARLFREFSNGPTFVPLPSPASRNAAQLA
                     HGAAATQMTGHEPEAGPARSVQSGQGSAPGEGKKEPTPSSSRPPPPHPILKKARGPST
                     SGRRPTARFLSPPASGDEAVHDDEAASTSTAAAASEMSSPPLPSSSKQEQIVAPTTAP
                     PATSSTALPPEAQSVASPTTGSAVSEGTMRPPALISSSRGEKSAGNNSRKVVAVAAAS
                     RRKPVMMARRPSSHSSDGSDTGLRVPGFYTASKRSVSRPSAPTPSQLLGESSLSSQSS
                     EPGISAKAAGKRPEMAPTSKLPDPGSNPSQLNSRVGQVDGTQQQAQPIGPQRRSTWDV
                     RDSVASQGTRLQLAAPVSVASPIAGFVAGQAIRPETPPMLLPSRVNPAEGPRRLREPS
                     AVLLPSQATSSVATSTTTARGQFGSEIVTTQPIVPESRDIPDQGSFGPRLVPSVLDKR
                     FKPTPPNPAPPIPFGRSRSELTLLLERGKPKKNEGT"
     gene            complement(1336303..1341655)
                     /locus_tag="THITE_2111934"
                     /db_xref="GeneID:11518633"
     mRNA            complement(1336303..1341655)
                     /locus_tag="THITE_2111934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651472.1"
                     /db_xref="GeneID:11518633"
     CDS             complement(1336350..1341575)
                     /locus_tag="THITE_2111934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651520.1"
                     /db_xref="GeneID:11518633"
                     /db_xref="JGIDB:Thite2_2111934"
                     /translation="MLTSPCRSLQPQPLTAATANPNAATAAAAVFKRHESNASLPAAA
                     AAAALRARPTTPTRVADVQTKRTLRRSLSVASSGTASQPGPDQPALRRRGSSGSMAER
                     TFRTPSPHRPSSSSGSGAPRSQPFADEMPPVPALPRDVGASSALRGGGIAQQDSQLRR
                     ANSVTVGSTPLRLASQKLASGEGPSWFGAAKLGDLGSVRRTDPAMASPPSSPLQLSAR
                     DEDPPEGQRPGSQASSINFSYPTRARLGSPNVAQQPKPSTVSPTSAHTNQPRPSTEDR
                     QTAQAPRVRQQPKEQMRTQSVTSYAADQILVYDPNSRRMVPQADLLAVEQAVRNASQQ
                     RTGSKKKVRAPQGVGSHLAAGTMSRTKSEASHTAPPAKTQPPRPVAPVQLERRDQPPP
                     AADAVPARNTRADVEEPAVKMVISSPRIEEKRLEQQHEQNAKASLRISTPGVPTSVPA
                     APVAARLAVRRQPSVVQEEPEPQDSEGERKAERVVSDASDAVPARQRMRRAALPENQP
                     PAAPQQQATLPSSGFPESRATNLADQGPKEDFPDVSENRQSKPGAVALVSRERTHSSS
                     PPRQAHFGPVQDNLTVKHSPPPRSISPRKSAMKHTSPPRGPSPSGDTSETSGSVSQDP
                     PVSRKKSVRVSFEDGSTAGVGNESAKRTDSPSTGSPQPTHRHSWLSHLGRPHVDLPPL
                     EVDEVMKPRPALPSFGSVRDRKPRDTSLDQTERPLVRPKADTRHSWQALPSAPLGASN
                     DHAIGAVLSREQQVSREKHGHAEHTSTPGEPLPPVVTSVEGPAYFSDSSDSSSIISSE
                     FEHPEVVLPTTAPGPPPEAKGGLQSAPPVNGAAASTGRDDLPSHEVKVQDKTAEPQIP
                     TISVSQATPLGGENKSLGQSFMDVPGGFPEDESDQSAASAARKAQGPTVVQPAEATLP
                     DSNSAQTIVHTGQHSTAQDETDSESSIYSDAYEDLSDIEGDGFQSLDAVVEGPLQASP
                     LQQNQPRRDLPEHSLPETSSLQPKQEAPALHTEISSATTAVETSPAETPQDEWERAKA
                     YLKSLTAEKRAQLAREAMEEAGIEADMDEVEREFKVKKKKSVERRNSERKALALHMAQ
                     QMMAQQEKETATNPDRSYMIQPGEGLAGAGLDIPPMRKTMRGEAEQPTSLPAVERPRL
                     RKSMRTSGPADGSQELRATTANRAAAKRQVSSPPVTGDPTETAGHRRSVTQVEPAAAV
                     ARPLQSTIQRRGSTGSESSFKRARPARAQGFGFRHSLRPTSPPSPRSDDNRSSKRFSL
                     RTLSPARSSLASTSAPAPAPMRTTLRGQPPAKKSPTGIRMPSFSLSYGGGKKSSSGAG
                     PGGSRFTSRLADSSDEDDGGFSSRFHSRFADDSSDDEPARPLPLPLPKPAAPAAPAGL
                     PHALRKESSIASTALPEELESSDDTRDAATSLAVHPDNQGKPLLAPAANSTVTTATTT
                     AKTDLSLRRIRSGRGTLLPTTTTTTAAAPASSLSQPATAATTAAENATTAATAGPSRR
                     RNSLLLSVLRPRRGRQGQGGGAIARPEVSESAARRDTPLERSVGQLERIRSRGARRSL
                     GAGAGVGAALGAGAAAATAADGDEDGEDGDNGEEGVGQGVVAVQQQRSPRLRLQKRGS
                     RSAAVGGVNATSGSGTAAGRVSGAVVPLTQPQPRSSGLDHSGDAGLLVQQLHLTRSAT
                     SEKNLGTRTLSSGGDGGSGGGFLHLRPQPPPRVSSLGGGTADLTSVDGSVAGASSTTR
                     KKRFGALRRMFKIED"
     gene            complement(1343208..1345553)
                     /locus_tag="THITE_2111935"
                     /db_xref="GeneID:11518634"
     mRNA            complement(join(1343208..1344153,1344207..1344995,
                     1345281..1345553))
                     /locus_tag="THITE_2111935"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651473.1"
                     /db_xref="GeneID:11518634"
     CDS             complement(join(1343249..1344153,1344207..1344963))
                     /locus_tag="THITE_2111935"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651521.1"
                     /db_xref="GeneID:11518634"
                     /db_xref="JGIDB:Thite2_2111935"
                     /translation="MASEPASSLFPNRPIRPLPKRRLRERLSPEVADSIQYPPVPQNA
                     APLFRYPYPLMEAHSDPGSPPVREVGSHFEQRQPQNNGAGTEEEEGDNAASKNGATSR
                     ATLQHANLVARPKGEQGRSADLPPLPSTTSSPEGYDLFENTNNKKRKIPTAGDSVPSG
                     VHTVHDAATGTSSGAAGIQSVEGQGEALNHTSTPYYGSGSFASGVHNVPGPGRGRYGR
                     PRNGKNPLRPLYDSTNSWAGRMNRPRSGQWGSGPNESTGIISTAIANAEKLPPHQGQE
                     NISLLHQQSAVKRSPASAQFTFTCDSQVPGSLAWPGSDQRVAVQPHQQPAARAAQPAQ
                     AGTTPSALPQAADAATREAASRAGPSGSNQQAAAPPKPPRRSAEERYLAAARARRHET
                     QLYNKRHPPKPEDVWICHFCEYEAIFGTPPKALVRQYEIKERKQRRLEAQRRAQWERM
                     KKGKHKSKKNSKLPAKHTGAAHDAHHPADGRGAPGDHYDHGADGEAYYEDEYYEDEEY
                     DPDDPGDPGVPVPHDGNPGSSGRGTDPWNGKDGNDGTNGEARGGS"
     gene            1347295..1349799
                     /locus_tag="THITE_2111943"
                     /db_xref="GeneID:11518635"
     mRNA            join(1347295..1348023,1348220..1348824,1348877..1349799)
                     /locus_tag="THITE_2111943"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651474.1"
                     /db_xref="GeneID:11518635"
     CDS             join(1347431..1348023,1348220..1348824,1348877..1349580)
                     /locus_tag="THITE_2111943"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651522.1"
                     /db_xref="GeneID:11518635"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Thite2_2111943"
                     /translation="MAGPDPRRSSRARTTQSQSQNSSSASSVSGRPERSSRHFNKGGS
                     PQKSTTTDSLPSEPPEDSITAEDPFGTRRRTRGQAEERERSGAKAEAIEMANGGGDTQ
                     EEDEAVRCVCGNEEYQGPPPFDEDSKHGLKHASDLEPFFSADVTDDTAGLFVQCDICK
                     VWQHGGCVGIMTEESSPDEYFCEQCRQDLHKLWTASNGSVYSHYLPLKRQARTTSRAA
                     SLNKDTARSPTKEKDNRNGRTTSTTQTSKRRSTLNSREAGYDEAEALRRAIEASKEEA
                     LAEQAENGNRRPKRGRSDSQEYVGSPCSKHDAMSDVLVCRKPENSKRQKTSSRSASPV
                     SDKNADDSDDAGASGRNAASKSKSRNGAAARNQRPEKASEKEERERQRAETANKRKGR
                     ADRRRADDSDPSEELPLAARAVQSKTAQAQATGNSNAASVTTEAVQPPAAAEPPPSSN
                     PAPDTPPQVTVQSKSDKKRSHKKKGRNQYTRDRDGHDEDSPARSQSRDIQKDDHGPPS
                     GGKAAGEGGGGKASSKSKGGMSSKITMNDMKRRAAALLDFISRTQVELAGESFTGPTA
                     GTGSSTLGSVAAASKDAQSGAGGDAPVSAPDENGEGRQEKEFTELGCMEMMDSLTRRL
                     VKWQQQYAS"
     gene            complement(<1350117..>1351289)
                     /locus_tag="THITE_13135"
                     /db_xref="GeneID:11518636"
     mRNA            complement(join(<1350117..1350761,1350801..>1351289))
                     /locus_tag="THITE_13135"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651475.1"
                     /db_xref="GeneID:11518636"
     CDS             complement(join(<1350117..1350761,1350801..>1351289))
                     /locus_tag="THITE_13135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651523.1"
                     /db_xref="GeneID:11518636"
                     /db_xref="InterPro:IPR002917"
                     /db_xref="JGIDB:Thite2_13135"
                     /translation="FQPRQTFDVSPNIPRSFYLGHHHAGLARMRQTLSNIGLIIECRD
                     FRVPLTSWNPLLERSLAAAANPSERARIIVYTHRDLAPSTRAAATAAARLRDFHLAHR
                     HAAAVLFTGAGPSHARATRDLLDAIKHVARARDALTGTRALVVGMPNAGKSTVLNALR
                     RRASTSTSKKVAKVARTGANPGVTRRLSSPVRIVGPEGSEEGDAGVGEGVFLVDTPGV
                     FVPYVSDPERMLKLALVGCVKDGVVPKETLADYLLFRLNLAAAAGAGGCADDGSAYVS
                     RLGMDGPTNDVGEFLEAVARRVGKVAKGGRPNYEAAAEWAVQEWRGGGLGKLLLDEVT
                     PETLAREVEASKEETLSLNQARKREKEARKARKEARRLGISGGE"
     gene            complement(<1355564..>1357259)
                     /locus_tag="THITE_21868"
                     /db_xref="GeneID:11518637"
     mRNA            complement(join(<1355564..1356463,1356532..1356827,
                     1357066..1357145,1357228..>1357259))
                     /locus_tag="THITE_21868"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651476.1"
                     /db_xref="GeneID:11518637"
     CDS             complement(join(<1355564..1356463,1356532..1356827,
                     1357066..1357145,1357228..1357259))
                     /locus_tag="THITE_21868"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651524.1"
                     /db_xref="GeneID:11518637"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="JGIDB:Thite2_21868"
                     /translation="MPVPFLGRLNPSEYVALVGSFLLVGLEAFIRVFTLALPISTSIR
                     NASDFVDLCATFGYTAEEHVVQTKDGYLLGLHRLAWRKGEEDTKVNSGPKSVKKRVVY
                     LHHGLLMNSEVWVCLTDEQRALPFVLVERGFDVWFGNNRGNKYSKKSIRWSPTSLQFW
                     NFSIDEFAFHDIPDSIGYILETTGQKSLSYIGFSQGTAQAFASLAVHPKLNDQVNVFI
                     ALAPAMSPAGLSNGVVDALVKASPQVLYLLFGRRSILSSATMWESLLYPPLFTKLIDL
                     GLSFLFNWRTENISTSQKLAAYPHLYSFTSTKSVVHWFQIIRTKSFQMYDDDVHPPTL
                     LSSPSSNKYTKVARYPTRNIKTPVVLVYGGSDSLVDIKAMRRALPAQTIANEIPHYEH
                     LDFLWARDVHEQVFPHVFDALESFTGAEPMREEFARYRIARENS"
     gene            1357627..1358881
                     /locus_tag="THITE_2111949"
                     /db_xref="GeneID:11518638"
     mRNA            join(1357627..1357883,1357958..1358881)
                     /locus_tag="THITE_2111949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651477.1"
                     /db_xref="GeneID:11518638"
     CDS             join(1357859..1357883,1357958..1358334)
                     /locus_tag="THITE_2111949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651525.1"
                     /db_xref="GeneID:11518638"
                     /db_xref="JGIDB:Thite2_2111949"
                     /translation="MPSSCKDLRAALAQCLQESECVMVQRHTAAECLREPLVSTLPLR
                     CQQLKKGFGECRRGMIDMRKRFRGNQPVAFRQLEQTEKTGENYQLYAGKSAFAGARGE
                     TDGNEKAPQDWREAENEKYRAALARGDKTKP"
     gene            1358882..1361177
                     /locus_tag="THITE_2111951"
                     /db_xref="GeneID:11518639"
     mRNA            join(1358882..1360492,1360584..1361177)
                     /locus_tag="THITE_2111951"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651478.1"
                     /db_xref="GeneID:11518639"
     CDS             join(1359435..1360492,1360584..1361058)
                     /locus_tag="THITE_2111951"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651526.1"
                     /db_xref="GeneID:11518639"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Thite2_2111951"
                     /translation="MTSLGAAPAAPPAAAAPHSATLDDLEDKASQEEEEEEENEDEEG
                     LSGLQTLFGIIAEQAEALGNMEYGANRHPPFKDDPPQLVADLPPEHIPTYTPPSQIEG
                     PGGDKNKKTQGKRLVVVGDVHGHLVALKALLRKIGFDNNNGDHLVLAGDLVTKGPDSR
                     GVVQLAMDLGASAVRGNQDDRVLVAARELRRASVDDQSRLVGYISDADAEADADAEED
                     DEAQTHIRKRAHVRKVARSLTRAQLDWLSTRPIILRIGRLPDATSPPWNASILAVVHG
                     GLVPGTPFEKQDPWAVMNMRSLLYPGRGKHHISKDTPKDDPDNNDENSPSTPIPTPAT
                     EAVAVPIDGRKGEPWSHAWNRYQNHLPPTAPHTVVIYGHDAKAGLQVDLEADISAYDP
                     SSSSRRKGRKPKHSNRNDNVKGNGNGDGSPEVMEDRENEENEEQQQQRKKKEREKGKQ
                     ETGLRYAFGLDSGCGHGRQLSALVVEAGPAGVSHTVVQVDCSEVDRRKGKGKGKKGAE
                     RG"
     gene            complement(1361754..1363385)
                     /locus_tag="THITE_2111952"
                     /db_xref="GeneID:11518640"
     mRNA            complement(join(1361754..1362047,1362117..1362500,
                     1362565..1362848,1362931..1362961,1363159..1363385))
                     /locus_tag="THITE_2111952"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651479.1"
                     /db_xref="GeneID:11518640"
     CDS             complement(join(1361811..1362047,1362117..1362500,
                     1362565..1362848,1362931..1362961,1363159..1363197))
                     /locus_tag="THITE_2111952"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651527.1"
                     /db_xref="GeneID:11518640"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="JGIDB:Thite2_2111952"
                     /translation="MSNSLEQLKATGTVVVSDSGDFASIGKYKPQDATTNPSLILAAT
                     KKPEYAALLDAAIARAKEEGGDLQHQIDSALDHLLVQFGKKILEIIPGKVSTEVDAAF
                     SFDTQASVNKALHIIKLYEKEGISKDRVLIKIASTWEGIKAAEILQRDHGVNCNLTLM
                     FSIVQAIAAAEAGAYLISPFVGRILDWFKAATKKEYSKEDDPGVASVKNIFNYYKKFG
                     YKTIVMGASFRNTGEITELAGCDYLTISPALLEELLNSDAPVPKKLDAAAASSLNIEK
                     KSYINQEANFRFDFNEDQMAVEKLREGISKFAADAVTLKGIIKAKLQQ"
     gene            complement(1364481..1368246)
                     /locus_tag="THITE_2111957"
                     /db_xref="GeneID:11518641"
     mRNA            complement(join(1364481..1367012,1367093..1367381,
                     1367669..1368246))
                     /locus_tag="THITE_2111957"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651480.1"
                     /db_xref="GeneID:11518641"
     CDS             complement(join(1364572..1367012,1367093..1367303))
                     /locus_tag="THITE_2111957"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651528.1"
                     /db_xref="GeneID:11518641"
                     /db_xref="InterPro:IPR006021"
                     /db_xref="InterPro:IPR008191"
                     /db_xref="JGIDB:Thite2_2111957"
                     /translation="MAFFANVKSVLSGDTLVLTSPNNPAAERTLSLAYVAAPRLSKDG
                     DEPFAFQSREFLRTLTVGKPVKCSVSYTIPTSGREYGKAVLQDGTELPEAAVRAGWLK
                     VREDAGRKEESEEVLEKIDNLRRLEAQAKEEGKGLHAGTGGVIEVQNDLGGPEFMNEW
                     KGKTVEGIIERVFSGDRLLVRLLLQEKKHWQVMTLLAGVRAPSTERVNQSNGQTQPAE
                     EYGNEARAFVEQRLLQRAVQIKIVGASAQGQLVASVIHPRGNIAEFLLKEGLARCNDF
                     HSTMLGSDMAALRAAEKEAQAARRRLHKAYVAKATDSKEVEAVVTKIIGADTIIVRNK
                     AGAEKRISFSSVRGPRSGEASEAPFRDEAKEFLRKKLIGKHVRVAVDGTKPASEEFEA
                     REVATVTHGGKNIGLLLVQEGYCSVIRHRKDDTDRAPNYDELLAAQETAKEEKKGMWS
                     GKPPKAKQFVDMSESVQKAKIQLSTLSRQRKVPGIVDFCKSGSRFTILIPREGVKLTL
                     VLAGIRAPRPGRTPQEKGEPFGQEALDLANRRCNQRDCEIDVHDIDKVGGFIGDLYVN
                     RESFAKVLVEEGLASVHEYSAEKSGNATELLAAQRRAKEGRKGMWHDWDPSQEAQEDG
                     EAGAAESTADASVTIEKRPEDYRDIMVTSVDSNGRVKVQEIGKGTAALEALMEQFRQF
                     HLNPTNSAPLKEAPKAGDYVAAQFSEDGEWYRARIRSNDRAAKVAEVVYIDYGNSEKQ
                     PWSKLRPLTQPQFTVQKLKAQAVDTQLSFVQLPTSQDYLDDAIHYLHELTDGRRLVGS
                     FDYVDAKEGINYVTIFDPEAEGADKVTESINRKMVLEGHAMVARKLKAWERSKVFEPV
                     LKSLREAEAEAKANRRGMWEYGDITED"
     gene            complement(<1368302..>1369237)
                     /locus_tag="THITE_2142959"
                     /db_xref="GeneID:11518642"
     mRNA            complement(join(<1368302..1368324,1368387..1368483,
                     1368548..1368699,1368775..1368954,1369225..>1369237))
                     /locus_tag="THITE_2142959"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651481.1"
                     /db_xref="GeneID:11518642"
     CDS             complement(join(1368302..1368324,1368387..1368483,
                     1368548..1368699,1368775..1368954,1369225..1369237))
                     /locus_tag="THITE_2142959"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651529.1"
                     /db_xref="GeneID:11518642"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="JGIDB:Thite2_2142959"
                     /translation="MVKAVAVVRGDSKVTGTVTFEQESESSPTIVSWDISGHDPNAKR
                     GMHIHAFGDNTNGCTSAGPHFNPHGKTHGAPTDENRHVGDLGNIETDAQGNSKGSVSD
                     KLIKLIGPESVIGRTVVVHAGTDDLGKGGNEESLKTGNAGPRPACGVIGIAQ"
     gene            <1371148..>1376537
                     /locus_tag="THITE_2044885"
                     /db_xref="GeneID:11518643"
     mRNA            join(<1371148..1374855,1374900..>1376537)
                     /locus_tag="THITE_2044885"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651482.1"
                     /db_xref="GeneID:11518643"
     CDS             join(1371148..1374855,1374900..1376537)
                     /locus_tag="THITE_2044885"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651530.1"
                     /db_xref="GeneID:11518643"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="JGIDB:Thite2_2044885"
                     /translation="MSFRSDDSRRYGHVPPAQYPVATPPQEPVGYPARRQSFNNGDDA
                     SFFDPPNANRAQPLYTGSTGRADEELFIASPSAERQPAANRASYIPQNAAAAAYQRQY
                     QVQIPPPPPPPPPSHSTYNPQTFARSQSTSLPYHPAQGARYTPSTSPTYTTPPTTTYT
                     PQAYNPAAYANTSSAAAPQRHSTVAGYNGYSYGHYSAAAVPHVSTAYAPPPSSTYGGS
                     QPASATTPSSAQRYEPGLHSPQYAPSAAPSAASPQYDQPYPASYGAQQYSGSYATNGV
                     TAGQSPTYPAPSPQAPYPAHSQIPVGPNYALESISSANRASRSGSQSSAAPSPPIRTQ
                     ASSQLQRHPTNAPLPSRPMDDLPEEPDWRINGDNESDFQVTQESLIQDIVSDLGVPSH
                     TQWPQPANDTVSGDDLNKAQRYNSTSSRTTADTGVNRYPSNASSAMNHTIASTNTTYN
                     WDSDESDPEGAAGLLAMQDDMDDRRFGGLTFPAYMEPPAAAQSPSSAPQPPSSAAQAP
                     PPSEEYVSTDSDYGGMDLGMYGGGYAGNLQYGNEVGSPPPTAPTQTTAPVQETPRPLP
                     TPQGQGTEYPPFSEVSVDYGGTGGLLPPQTHRLSFDEGDEQVSVHSRQSGSDSPSKED
                     YPYDQMFWHPGLSNRPLPALPPTPDSNTLLSAQPPNRSAYQHHYSLSADSRFPGPSDS
                     HETYPGQSISQQHVERSISVSEHSNTPHVQAPARSRTDATEERRRAMKHMSHPHAQAY
                     QQGTSTPYEGFDAGTPSPLAAYDMITLPTGRRKKFVPSKLTAADFKRCAEPWALSGIT
                     AWVREMAEGEPDLKRKTIEEGVLKLFCAKVPTMNVADAELLSAKVVDSMFAAGILIPE
                     EEWVKFGTGQLSGVLWQLTGSGCYAPKLHEDEGVSPRLHDNGIPVRCYSHHCGRTLKK
                     VNLDNMMSEEDVVILDWATFHGVTMEEIKSKPKKEVERQNVLHEIVTGEEEYMGQLDV
                     LRLLYRDWLRAWQPPIIAANRMDKFIDAVFGKVDAVQQINKEHLLAQLKYRQQEQGPW
                     IVGFSDLFREWIRKARPIYIEYCSSYPYASYLIRKEAARNLLFRQFLDVVRDHKRSKR
                     LEWTTFVKAPITRLQRYGLLLETVKKNMLGESEEKTNLERALDEIKKVTHECDEKVAE
                     MTKKVELLELQSMLVLRPGFQSVLNLDHLGRELLKQGDLQRQGSKGVRWVDTHALLFD
                     HYFILAKTVPSKDGRSDKKYDVSKEVCFRLDSPIPMPLLFIESMNDDPVAKQKSLTAP
                     LTRTTAATGSGTQLNKVTTNSSERPGLEHTGTSSSVGSMTTVSRLTPAGSEDGKIIYP
                     FKIKHLGHEIYTLYASSAQERAAWCSAIIEAKTRHARALHAQNAEPFRLRVLSDGAFA
                     YDSASLLGRQPNVPIRGTPLDRAIREMEQVYGPGRGPPPVCRATVNCACAFTSGGKSL
                     IAIGTDYGVYISEASNPRGWTRSVQISKVTQIAVLEDFAICLLIADRSLISYPLDVIA
                     PVSNFPAPSHDNPRRAPQRLAKDVAFFATARMKDRMLLFYKRKEGMHNTFKVLEPVFQ
                     KATEKKSRLFGGRRGGSSGTTESFRDFDEFYIPTECYSLNLFQNYIAVATAKGFELLT
                     LDKKVTQSIPRDLGQPATANIAARIKEPHPLGMFKLNDQEFLLTYGDCAVYVDKHGEI
                     SRTLIMEYSGKQRKARAATMFGQYLLLFNDDYVEVRNAENGRLRQIIAGRDLRCLDYG
                     FRGPTGGVAGAGGGAGLAGVHVADSKGSVKICMSHPEVPGGQIVLEMVLNDGHAE"
     gene            complement(<1377591..>1378865)
                     /locus_tag="THITE_2127426"
                     /db_xref="GeneID:11518723"
     mRNA            complement(join(<1377591..1377758,1377890..1378045,
                     1378095..1378514,1378727..1378738,1378830..>1378865))
                     /locus_tag="THITE_2127426"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651483.1"
                     /db_xref="GeneID:11518723"
     CDS             complement(join(1377591..1377758,1377890..1378045,
                     1378095..1378514,1378727..1378738,1378830..1378865))
                     /locus_tag="THITE_2127426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651531.1"
                     /db_xref="GeneID:11518723"
                     /db_xref="JGIDB:Thite2_2127426"
                     /translation="MQNQLLRMFSSPFCQVLMAFAIYAKEFVVQVEKGPSLPPSLPPR
                     RQEGCSISQLEMQIVWPVRSRRRRPSTTPSPPLEGIAMLVAWLSIVTVQRAKSKPLTG
                     YKSGDEDVEDEDVEDEDVEDEDAEGEDVGDGDASTSDSVTIPRSRRRGTTSNASGEEV
                     EDGVAAKDAYRKGRSPEDMWEEISFIPPDMEESIQAEIKKRLELQEHPPYGKLIFSKL
                     LSMTRSEQSATVNMVKEKADKNLDSVIDKALFESDKHVQIPLLQL"
     gene            complement(1380152..>1382133)
                     /locus_tag="THITE_162029"
                     /db_xref="GeneID:11518724"
     mRNA            complement(join(1380152..1381738,1381827..>1382133))
                     /locus_tag="THITE_162029"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651484.1"
                     /db_xref="GeneID:11518724"
     CDS             complement(join(1380408..1381738,1381827..1382133))
                     /locus_tag="THITE_162029"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651532.1"
                     /db_xref="GeneID:11518724"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="JGIDB:Thite2_162029"
                     /translation="MAPPSGLHHSAVPSDFETPYPPLVRSSTVPASLRSHRADPSHLA
                     PEDAYAPLSPHRHPGAYVRGGDGSGTDARPRRVRRDDTSRSRSRRRKRFQKLLWVKQS
                     YPDNYTDQATFLENLQRNPRVRPYDFWPLVADSTVIVQHVCSVIIFVVCFVGIFQERV
                     SPVSVVGWGSFATFLGWLLWDWWVSHETHEGSGDDGARGRIMRGGSRTYREYRPPLQQ
                     DSSGLGQSMPNVSTVSISSTSNLPSATSSTSNLLQDQLPPHRPLQAPSSAAGSSTLLV
                     PGHAPSRSVSSVNSIASQGTNPNSPTTTTTTTHRLGPDGPDQPPTPSPTARNSRAYVR
                     VSTIKSAILIYFTLLGLSPILKSLTRSTSSDSIWAMSFWLLVINIFFFDYSGSSWVGS
                     GSGGGGGTRGKRMPVASLSTNAALMASTVLASRLPSTGQVFSLTLFSIEVFGLFPVFR
                     QYARHRSRRYHVSLTVLLVLGAGAGVGMVLGDDDAGGWPWKRGLLGMLVGCLIAVLAM
                     GGCAWWLIGLQKYKNEIYGPWDPARPIIISRRHWDDD"
     gene            1383977..1384827
                     /locus_tag="THITE_2111968"
                     /db_xref="GeneID:11518725"
     mRNA            1383977..1384827
                     /locus_tag="THITE_2111968"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651485.1"
                     /db_xref="GeneID:11518725"
     CDS             1384058..1384684
                     /locus_tag="THITE_2111968"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651533.1"
                     /db_xref="GeneID:11518725"
                     /db_xref="JGIDB:Thite2_2111968"
                     /translation="MKPSSLYVALGAAQLAICAPLPLVMTERLYELPATAHHIAAVAR
                     TRTTYWVREPDSDRQHDTPTRSTMPQPFHAQLLPPLFKHRPSAHGESQPGQPTGGRRR
                     HRKIDLIPLRLTVSKVDDSTEVVDLGVPAQWLPFGMRHQHHGRQDHLLLLSYGGRYFR
                     EQQNDVLVVVLVAAFVVIVVLMETWGSISRRLVALRQAVSRRTQEAPS"
     gene            complement(1384828..1385413)
                     /locus_tag="THITE_2111970"
                     /db_xref="GeneID:11518726"
     mRNA            complement(1384828..1385413)
                     /locus_tag="THITE_2111970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651486.1"
                     /db_xref="GeneID:11518726"
     CDS             complement(1384971..1385138)
                     /locus_tag="THITE_2111970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651534.1"
                     /db_xref="GeneID:11518726"
                     /db_xref="JGIDB:Thite2_2111970"
                     /translation="MLQKPRSLTPATVLPAFPSRWADRRSQCASQEEKLLKRPPPLHP
                     TMRPSHNQTKR"
     gene            1386146..1388682
                     /locus_tag="THITE_2111972"
                     /db_xref="GeneID:11518727"
     mRNA            join(1386146..1386696,1386754..1388179,1388281..1388682)
                     /locus_tag="THITE_2111972"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651487.1"
                     /db_xref="GeneID:11518727"
     CDS             join(1386419..1386696,1386754..1388179,1388281..1388601)
                     /locus_tag="THITE_2111972"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651535.1"
                     /db_xref="GeneID:11518727"
                     /db_xref="InterPro:IPR001464"
                     /db_xref="JGIDB:Thite2_2111972"
                     /translation="MSLQVDDGGRRARSRSPAGRRADDDRDRSRTRVSPNIVDAVPYP
                     SSSEAFRDPSSTAYEYERLSKWPSAAEDDSPDYYRGPPRGKPADAREDPDQNRDRDRG
                     RNRDSDSDRETTRQRADLYLPNKYAHIKTVEPGSPRQSRDSVRDRDRESDKEHERRRK
                     KEQLEADLAYGKLPGPSKHERPASPPAVTYGYDQPKQWEYAKPEDPRYSATHLDPHGP
                     GARPAGRPPSPGPAAPIKSAMKRDRSPQPPTGRMSTLTVQTPHHAASLSVASAPASPL
                     LEAYHGTYQSMPPMPSPMLLPTGAPHVLEALSPIGSDDERAGDKRRARRARFNDPADD
                     AARLAKALKGEKRPPDTEPLVEILPGLTHDQVMELRAEYKRLVKTGTERKGVNIAKHI
                     RARLKDEDPNLMKACYATALGRWESEAYWANFWYHGDKTRRELLIESLMGRTNDEIRR
                     IKEGFSDKKYANSLTKCMRTELKEDKFKKAVLLVLEEQRMEEEDVHGRPLRIDYDLVD
                     DDVRQLRHAVRSEKGGESLMISIVTQRSDAHLREVLREYKNKYKGANFAKDALRKSGN
                     LVGEVLAHILNGIINKPVRDAMLLHHALTASRRDELRRELLISRLVRYHWDAAHMALV
                     RRAYREQYGRELQDAVREATSGEWGEFCVALCIVRMPDDVRRVERVDIHR"
     gene            complement(1393851..1395822)
                     /locus_tag="THITE_2111974"
                     /db_xref="GeneID:11518728"
     mRNA            complement(join(1393851..1395297,1395366..1395822))
                     /locus_tag="THITE_2111974"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651488.1"
                     /db_xref="GeneID:11518728"
     CDS             complement(join(1394356..1395297,1395366..1395593))
                     /locus_tag="THITE_2111974"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651536.1"
                     /db_xref="GeneID:11518728"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="JGIDB:Thite2_2111974"
                     /translation="MDSLPTPPNEELGRPHGPKRPHTTSKPVKTVHRSLKRTSTHQHP
                     PSPSRESQSQQGDARHKRVWKACERCRMKKTKCDGEFPCKRCKDDGLICTAGTRKKTE
                     YKQLPPGYAEVLENTQFVLIATVQKLYSMVRNGEPWEFGEPALNERGQPIVHNVAAKL
                     GCLRPNNDLDLPIQSIFPEDEAGMAELARQLREQQQKEAAGNASQSSTRQETESSTSS
                     GGYNRTDRASSSAASDLEHSDFEFDTDYRKAAFGGAASALSMSPASLSYGGDFDIAPP
                     SADGFPPPSLPSPTMPTQNHHNPTAAAAGGFQPWTGTVSRPPSVDFTGAPPLWMGQSL
                     LEPSSLMNANSLLGANYEMKPQVFSSSCRNPEIMMGMSDPTIFSGFDDDTLRPAF"
     gene            complement(1401108..1403821)
                     /locus_tag="THITE_2111975"
                     /db_xref="GeneID:11518729"
     mRNA            complement(join(1401108..1403021,1403088..1403821))
                     /locus_tag="THITE_2111975"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651489.1"
                     /db_xref="GeneID:11518729"
     CDS             complement(join(1401159..1403021,1403088..1403138))
                     /locus_tag="THITE_2111975"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651537.1"
                     /db_xref="GeneID:11518729"
                     /db_xref="JGIDB:Thite2_2111975"
                     /translation="MKNFVPILGLAAGVSATQFNLAPPFTCPGNTDNKCTDKQASGFS
                     FGDLGLGPFSEYGGFVFNGWQCEAGFQKRGRHVARTSSKVIGGSCSSDKSSSPSFGCG
                     SSIDKFTLGSIHVIPEFDCDLEFHYDMPDGSTCKQRSACKHSGTTVPNTQCGGAKNVT
                     IVYPHQPGKPKSTCSVQVPTISFDCSTASSTKPPKTTKHATTTAPPAAGTTSASETGN
                     SPTSVAPPAETSTPSTAAPGASGSSTSPAATGTPTTVPSGQQSSGSPSETPATSSAVT
                     KTITTSYDSTSTIFTTSTQTITQCASTVTNCPAHSVTTTVVTIAVSTTICPVTETRTT
                     VETSAAPSTAASSPAEAVTSSSPVAAGGSTTTAAVSSASPVETLPCPSVVPSCLNTFL
                     FLVSCADNTDAACYCPNATFVKNVFDCLYAHGETDQIIAEAVAYFQGICGQYVSQNPG
                     IATGATVTTYISATAAPTIAPVYTTVTVDVTTVVPCTNSAGEVIPSSSSTVTVSTSMT
                     VPQVGFTTGPSGGVGVVPVTSSSAAAATTAPVAATTAPASGSGSGSGSGSGSGSGSGS
                     GSGSGSGSGSGSGSGAGSGAGSGSGSSVVVPTGTGSLRPPTTSSPVVIAGSGRVGASF
                     GLIAAAVLAALAL"
     gene            complement(<1407438..1409773)
                     /locus_tag="THITE_2149790"
                     /db_xref="GeneID:11518730"
     mRNA            complement(join(<1407438..1407513,1407677..1407691,
                     1407740..1409773))
                     /locus_tag="THITE_2149790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651490.1"
                     /db_xref="GeneID:11518730"
     CDS             complement(join(1407438..1407513,1407677..1407691,
                     1407740..1409733))
                     /locus_tag="THITE_2149790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651538.1"
                     /db_xref="GeneID:11518730"
                     /db_xref="JGIDB:Thite2_2149790"
                     /translation="MDKQQDPLLGRPLYLYDLPPEILDSLALKPEAGLPGQNDQASAD
                     SVPPSGGQSPGPIPNSAGPENVLGSQACSLCGLSFVTVQEQKDHLKTDLHYYNLKQKM
                     HGLKPVSEAEFEKLVEENDVSISGSDTSESEDEEAETARRDTTLSALLRKQASLAEKR
                     APVDRDEDEEPKKRRRRGTGKPPLLWFSSPKLPDNTYFGIYRAMFTPEELDEEDKIVD
                     AIKQRQLPPISMPKAPKDGDAAPPAYNGKHIFLCMIGGGHFAAMVVCLAPKRSKHGTL
                     GPLNREAIVLAHKTFHRYTTRRKQGGSQSANDNAKGAAHSAGSSLRRYNEQALVDDVR
                     GLLKDWKALIDTSDLLFIRATGTINRRTLFGPYDDQVLRADDRRIRGFPFSTRRATQN
                     ELMRSFIELTRLKVKEIHPPSAAAAPPPDEAAKAAKPKQPEPKPARPRLTEEEETALL
                     HTNQIQALVRRSKLPALLSYLSTNNLPASFLFHPPDAQQNHHAPTALHLAAAQNSAAL
                     VAGLLARAGADPTLRSREGRTPFELAGDRATRDAFRVARAELGEAAWDWDAARVPGPL
                     SRAEAERRAESEREQERSREEERRRAEVERLRAEGPKVDERPAPGRKVGGILNAGPPK
                     TAEERRWEEARGLTAEQRMRLERERRARAAEERIRRMQGGGNYQQSRQIILQKERAES
                     SQLTQHLRSTTL"
     gene            complement(1410052..>1411667)
                     /locus_tag="THITE_162024"
                     /db_xref="GeneID:11518731"
     mRNA            complement(1410052..>1411667)
                     /locus_tag="THITE_162024"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651491.1"
                     /db_xref="GeneID:11518731"
     CDS             complement(1410294..1411667)
                     /locus_tag="THITE_162024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651539.1"
                     /db_xref="GeneID:11518731"
                     /db_xref="JGIDB:Thite2_162024"
                     /translation="MCYITKHVYTVCAHTAVGELVECREQKSRNEQWREGGWCAGWML
                     ALSRCRPAERVQLKYWFCPDCRNFYRGYDTSTVDAVLNYWAYKNARGYAFSVSPQLVP
                     APLVFGRPASELGDPKLARGELVALDKALPRRCFETPAEWLFRLEDARARTLALAEEW
                     TRGRALSARRRQARESASGGGGAVRMQPRLSAPMSVYPYEHALSAITEQTEPQSEPQS
                     ARETGAAAAAAATADAPPPEAQESRNPTPQVHLETLRKLCGEAEVPLQAGEAEAPSHA
                     GEAEGPSHEMSSPVGHEGAAAQASSPDSEQAVDSQSPDPAVPAPSHPFPTPRRLTTPQ
                     QEQQQQEQQPEEQRQQQQGDQNESEQQQQPRSTSTPRTEDLPKPATPPATPEKAEATS
                     EPEGEKDMRTSHGKNSSAIPPPSPVSTAGEEPNLVSRFSVSDIGPEDAIELANVAYGL
                     QPLAGTA"
     gene            complement(1412544..>1413423)
                     /locus_tag="THITE_162022"
                     /db_xref="GeneID:11518732"
     mRNA            complement(join(1412544..1412751,1412818..1413184,
                     1413250..>1413423))
                     /locus_tag="THITE_162022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651492.1"
                     /db_xref="GeneID:11518732"
     CDS             complement(join(1412696..1412751,1412818..1413184,
                     1413250..1413423))
                     /locus_tag="THITE_162022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651540.1"
                     /db_xref="GeneID:11518732"
                     /db_xref="JGIDB:Thite2_162022"
                     /translation="MASITQRASAVETHGPKVNIVIWLLMALSAVFLGLRVFCKLATH
                     RRLWWDDHILIVGWTLQLAAVSLITVNITLGFGRHVIDIDPANISQIALISNVVTTLS
                     MLAAVLTKTSFGLTLLRISDGYMKLFIWVAICIMNIAMGLGALFQWVQCTPARKVWDF
                     SVPGTCWDQNAMTAYAIFAAAISGAMDATLSLLPWKII"
     gene            1415115..1416242
                     /locus_tag="THITE_2111977"
                     /db_xref="GeneID:11518765"
     mRNA            1415115..1416242
                     /locus_tag="THITE_2111977"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651493.1"
                     /db_xref="GeneID:11518765"
     CDS             1415321..1416190
                     /locus_tag="THITE_2111977"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651541.1"
                     /db_xref="GeneID:11518765"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="JGIDB:Thite2_2111977"
                     /translation="MSGTLRHATIKLHRSAARGHANHGWLDTYHSFSFAGWYNPDFTH
                     FGALRVLNEDRVQPGTGFPAHPHRDFEIFSYILSGELTHTDSTHTGAGSSNSDKPESE
                     LFCRVRRGDIQFTTAGSGVTHSEFNRHAREPVHFLQIWAIPWKRGLPPRYARATSSDA
                     DKRRGFVSLLSPLRGGADATAAQERAAAPSIPGTIAIHADFVMAAGIIAPGARFEWTV
                     GAEATEAVQRKVYVHLPMTKGGKAKIRLDGREESVMMEGDGAFVEGVSAGDKLVVESV
                     GDAEAEVVVLDTA"
     gene            complement(1417304..1419828)
                     /locus_tag="THITE_2111980"
                     /db_xref="GeneID:11518766"
     mRNA            complement(join(1417304..1417741,1417842..1418176,
                     1418236..1418398,1418452..1418709,1418777..1419142,
                     1419200..1419435,1419489..1419828))
                     /locus_tag="THITE_2111980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651494.1"
                     /db_xref="GeneID:11518766"
     CDS             complement(join(1417403..1417741,1417842..1418176,
                     1418236..1418398,1418452..1418709,1418777..1419142,
                     1419200..1419435,1419489..1419531))
                     /locus_tag="THITE_2111980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651542.1"
                     /db_xref="GeneID:11518766"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="JGIDB:Thite2_2111980"
                     /translation="MVFYPPPWVPKLPFDPPDSITIGEFMRSEIYGRRPIAKSRNPFT
                     CGLTGKTYTVAESHQRSDCIAKALSKILGWEPNADSPWDKVVAVFSFNTIDYISVLHA
                     VHRLSGIATPANVAYSASELEHQLRSSGAKALFTCVPVLETALKAAKAVGIPEDKVFI
                     MDLPHHAPKPSFKTVQDLVELGRTVPDLEPLRWVKGQGERQVAFLCYSSGTSGLPKAV
                     MISHRNVIANTMQLCIHEDVGRRKCGVETQAELGLLPFSHIYGLVVAGHAAIWRGDEV
                     IVLPKFELNDYLRAIERYRINHLVVVPPIIIRMLSSKDLLKKYDLSSVRLVFTGAAPL
                     GKETAEELLRLYPNWKIGQGYGMTESSTVVCSTSEHDICLGTSGSLIPGTRVKVIDPE
                     GKEITEYGKPGELFVQSPSVTLGYLNNEKATAEAFVWDEDGRWLRTGDEVMVTKTPSG
                     YEHLTIVDRLKELIKVKGHQVAPAELEAHLLTHPAVDDCAVIAVPDERDGEVPKAFVV
                     TPASMAASGRTDAEVAAEIVKHVQDHKAHYKWLRGGVEFVDAIPKSPSGKILRRLLRD
                     REKEARRARGAKI"
     gene            <1422804..>1425473
                     /locus_tag="THITE_2047514"
                     /db_xref="GeneID:11518767"
     mRNA            join(<1422804..1423396,1423484..1423614,1423718..1424445,
                     1424482..1424614,1424669..1424709,1424757..1424993,
                     1425048..1425266,1425321..>1425473)
                     /locus_tag="THITE_2047514"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651495.1"
                     /db_xref="GeneID:11518767"
     CDS             join(1422804..1423396,1423484..1423614,1423718..1424445,
                     1424482..1424614,1424669..1424709,1424757..1424993,
                     1425048..1425266,1425321..1425473)
                     /locus_tag="THITE_2047514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651543.1"
                     /db_xref="GeneID:11518767"
                     /db_xref="JGIDB:Thite2_2047514"
                     /translation="MAEALQTPSHQASVAAGAEESPDGPHPVAAMRTSSRLAAQRAQA
                     AIKRTYENPEPTESERTIKRSRRAVLSAAENEAATDTESESSQSSQVTTDSGHAEDSQ
                     ATSTLTILVSMDDATENGANGSPQIAVAKDAVVRPPAAGRPLVWANGRGSLCEALPYF
                     KAHKGSLYSSGLVAQGMLVDREVDRLDVFGSQVVISGIGGGRVKDPQTGTMIRSKDTS
                     DTAVSFKTAMNAFQAKSLVALIAVLGYFHITDMWKEKMIPEGAKSPVTVWRMRFEKAD
                     LTEPSWWMPAVEDATVSDTSVDLNVKAPVITCGTCETPSKEIFTAGWVCLNHKCEKFF
                     QLRNGHAVDIKSLAYTESFLNERTPFAGEVPSVVPPLPDHTGLHGTEISLRRGFVCPD
                     CGCCNRRVYWNRWVCENKDCQYARDAPMLPYPDALLEEENAKFEDMVMDRRARNGVNE
                     NPLNKESFVFDPFATIYQRGYLRYSQTLDLDGYLVLGSFSIFSAKDEIKSVPHGPDDL
                     FRTLELTDIGLRRNPAAVFGHKLEGYTRHFQQNFGARYKFGVTVQSRGFSQAPDVILR
                     ALHRLIWAKTVAVAASNAFIRTLDRGTRGQDSLVTNARDFNELLALGYMEDDKINYHD
                     DGEEELGPVIAALSLGSPSTMRFRPKRGTGFFLPTHKQLGKVCYKEVLEVPMKHGDMM
                     VMVGTNIQKVYEHTVDPHGKRRFSLTARYIDPEKMTSQADRDDAIIKGAIPAHAQAFV
                     YDGM"
     gene            complement(1426033..1427468)
                     /locus_tag="THITE_2064808"
                     /db_xref="GeneID:11518768"
     mRNA            complement(join(1426033..1427049,1427137..1427468))
                     /locus_tag="THITE_2064808"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651496.1"
                     /db_xref="GeneID:11518768"
     CDS             complement(join(1426217..1427049,1427137..1427296))
                     /locus_tag="THITE_2064808"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651544.1"
                     /db_xref="GeneID:11518768"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="JGIDB:Thite2_2064808"
                     /translation="MLRQAGDLKTLRQQQQQQQQGSGSAGAKTTQTASAGGRLKRRFW
                     KDVHVREVNGALEIHLDTRPLRHPTTKSIIRLPPSKPHLAHALALEWDSLTSASQATK
                     QHMIPLTSLVCRALDLTADASLRPGVAQTLLRYLDTDSLLCFCPAPSPEESDDHDHDD
                     PAQQLHERQRQAYAETAAYVTARLWPGVRVEPVLEGASIVPRQQAPGTREAVQDWILS
                     LSGFELAGLERATLAGKSLLAAARLVAEWSEEGAAAAGPANGQAGVEEEKNRKRFGVE
                     EAAQAVSLEVTWQTRQWGEVEDTHDVEKEDLRRQLGSVVLLVSGTRKGSESKSS"
     gene            complement(<1428275..>1428433)
                     /locus_tag="THITE_2018296"
                     /db_xref="GeneID:11518769"
     mRNA            complement(<1428275..>1428433)
                     /locus_tag="THITE_2018296"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651497.1"
                     /db_xref="GeneID:11518769"
     CDS             complement(<1428275..>1428433)
                     /locus_tag="THITE_2018296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651545.1"
                     /db_xref="GeneID:11518769"
                     /db_xref="JGIDB:Thite2_2018296"
                     /translation="KPKKTYNTRDSLVVTDPTTNLAVSSLSRGERTGSRVFYCVWSYV
                     AGSYSSPDY"
     gene            complement(1429210..1429581)
                     /locus_tag="THITE_2111984"
                     /db_xref="GeneID:11518770"
     mRNA            complement(1429210..1429581)
                     /locus_tag="THITE_2111984"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651498.1"
                     /db_xref="GeneID:11518770"
     CDS             complement(1429347..1429547)
                     /locus_tag="THITE_2111984"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651546.1"
                     /db_xref="GeneID:11518770"
                     /db_xref="JGIDB:Thite2_2111984"
                     /translation="MDADGDKTAAPAMDLRALLRGIDPRAGEQQQQQQQQPAAAWLGQ
                     GQGLGQGRDEGQGYEGVARPPY"
     gene            complement(<1430115..>1433194)
                     /locus_tag="THITE_56645"
                     /db_xref="GeneID:11518771"
     mRNA            complement(join(<1430115..1432896,1432980..>1433194))
                     /locus_tag="THITE_56645"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651499.1"
                     /db_xref="GeneID:11518771"
     CDS             complement(join(<1430115..1432896,1432980..1433194))
                     /locus_tag="THITE_56645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651547.1"
                     /db_xref="GeneID:11518771"
                     /db_xref="JGIDB:Thite2_56645"
                     /translation="MNAIEQKCRPKHQVLVLKCYPRTTKGAVDVKPNSSELSYLLFYA
                     QSRRSKIQKVGSFLEKKTASDVYRQRIGNVQVTLQILTALIEKTPKDLPLFASCVLHI
                     LEQILKSRDITMVESSVPTFEAFCAHHDPTSLLGDQAYLRQYLHVFQQYASLASTRAF
                     PGKLEPSQPIALRWRNTGLKAIKSVASSDALSSATTQQYDLAIPVILENLWTDNEDFL
                     DVLHQRAEMGEKLGAALLRRRTSVATVQTAESESNANPIALADTAVDMDKLAEEDTGV
                     LAMECLRQIFVAPNRSQAHAATVALLKFVQERVSQHEEVVKTDANGRDGGWAIKMFLL
                     AARWAPVADRFTILVTAVEALAQLPLTDESLRQHIVLAAMIGALLRSDINLIGLSVMD
                     VLLQFTAHIRRLVHMPGDPNVMRCDPPLPGRPDPRAPTGAPFADKAEQAVAERKNLLF
                     RLQECIGDLATHVYYADQISDMISTILQKLKPPHSGSASGSPHGDKADGTPKSSAHAL
                     VTDEHHVDSLFSLSVAKMAALRAIKSVLLVANPQTKMSGNLAALSRSPVPVEVWDGTQ
                     WLLGDSDGLVRKAYVDAVVTWLDRETTSADRTIRDEVARPMPKNRELPGGASLARRAV
                     SSTSAREKPAKVPRSQFLQLLHLAVYDNAIQYIDYESDMVLLHVLLAKLVDKLGVNAV
                     RYGLPMIFRLQEDIQDAETPIQKVRLGSLVHGYFWVLTEKFDFEGSMIGRAIHNEIVR
                     RRTKNFWVEGVSVPAPRLDLVGTPGTVRSEPRLPLKEIESEALLPFDERLALVDCVCT
                     AYEEQTASPPQSPAASPGRSFSHPILGSTLSTGLTAEPEQEVPAHFREQMLGDWSREA
                     VLAAVQTASKSASLNGSRSGTTGTNWANGGPTANGHSLRPDRPSPHGSKANLRPSASP
                     AGDLAKARKTSLRSGHSPAPPTHAEGREQVTSVEQLKLVLSGQLQPPPPPPTVHGPAF
                     QHDDSSSDSFVSYDMTASELSFNPAAA"
     gene            <1435451..>1437811
                     /locus_tag="THITE_38252"
                     /db_xref="GeneID:11518772"
     mRNA            join(<1435451..1435916,1435993..1436414,1436484..1437114,
                     1437219..1437358,1437450..1437493,1437691..>1437811)
                     /locus_tag="THITE_38252"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651500.1"
                     /db_xref="GeneID:11518772"
     CDS             join(1435451..1435916,1435993..1436414,1436484..1437114,
                     1437219..1437358,1437450..1437493,1437691..1437811)
                     /locus_tag="THITE_38252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651548.1"
                     /db_xref="GeneID:11518772"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR012951"
                     /db_xref="JGIDB:Thite2_38252"
                     /translation="MSSPSPWRGRLVCALQLAAPLLSAAAGLTPSLQLQPRHDGPSSS
                     CKAVPGTPGWPSPQDWARFNESLAGRLLQPPPPGAVCHSGQASYNATECPAVRTAWST
                     YEFHAADPISVDWNQWANDSCLPQEGAPCSRQGYPVFVVNASEARHVQLAVQFARKHN
                     VRLVVKSSGHDYMGRSNAPNSLSIWTHNLRGLQTHNSFRPSRCNVTIEGTAVTAGPGT
                     SMWELYSALDALNQTVVGGGGKTVSLGGYLTGAGHGLLSPWYGLAADQVLEMEVVTPT
                     GEIVTANECQNEDLFWAMRGGGGSTFGVMTSVTMKTFPTPRLETVDLIILTTNVSDPR
                     PVLDMIAYVLSNFPSFGDQGLSGYSYFSPAITDPDLGGNTTIGGFIMSAALRDSSPEA
                     MSRLWDPVLAHINATWPGLFRAIPRPASYPSFLAWYRDHYDQSTAGADIYLGSRLLDK
                     AALTADPAKTAAALQRWCNGSVAEAFLVSGKGVFDARPRGGGNAVLPAWRKSYVHAPF
                     GAEAPPLDPAAALAVLEQINTRVQALRELAPDTGAYVNEASLLLPPDWQHAFWGSNYP
                     RLARIKRALDPDDVLWCTPCVGNERWRQVGDRLCRVSGHQH"
     gene            complement(1438779..>1442385)
                     /locus_tag="THITE_133372"
                     /db_xref="GeneID:11518773"
     mRNA            complement(join(1438779..1439099,1439169..1440024,
                     1440058..>1442385))
                     /locus_tag="THITE_133372"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651501.1"
                     /db_xref="GeneID:11518773"
     CDS             complement(join(1438954..1439099,1439169..1440024,
                     1440058..1442385))
                     /locus_tag="THITE_133372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651549.1"
                     /db_xref="GeneID:11518773"
                     /db_xref="JGIDB:Thite2_133372"
                     /translation="MLRRRSLKSTPDLRRRKSTSSTRGVVLEHINPALAQRDAHIAAW
                     EAYSRAQSRATTDMSLFPPPPESSPCRLSERSATSQGDSIENDEDLRRRQSVRFVGPC
                     FVPPRRRNTREGSDTHSADGRDGAGPMSPQRHALGRSEAESAGQPASAPRRAPLPVSF
                     PKIATGHLDALAAGEEYYTLEDDIASAPSSYRRLHRSRSMWAVPQDARRSHESGQALG
                     SRFSKSTFPSMSASRRFFRSEPTEVQSPREMPTLRAPKSMSFLTHRTCRSRSSTSRDE
                     STREPQSSRLPGLLEDGSAVIEDKARRPRYKSSTLFGSRSRRTDLKLRKSLRSSSTTE
                     DLAASSSGPLNYPAEQKTLSLKTRKASMSLRLKIKNFFSGTKPDEGAASIPCQHIESQ
                     RSRVTVIPTPSDDAEAPADQDREVIRGPPARVPSLQIVSPGLVHSSRASVVSLKSERD
                     RNVSDGSSLTSWVHSGPSTLTSQEQQQWREWERQRLSIIRENGARTPSTSLPRQPHGS
                     GLFQPPESAAGRPVASRPVVDSQRIYSALVKRMHALGLKMKEKTAEERSEAVESDRSA
                     PPKEHPDRSASNTPDTIRRIRPGRKDPEAPDSIITPTCSSKGENLSRFRESWDEKETN
                     DHEVTPTPLNRRRDRVGGVSGSLGPIDRGLADVASGQAGDEEQAVSGHNGIFAQDDAQ
                     SDWRSRVVDSPASYLFRTASSYRRALRKSMQEEQNAWAQQSSASEQDSDTGTQVRHSS
                     QFTGLLASESNSAKDLDYAESIYSSDDGVFGSALPSTPAMYRAGGCREASAASSIEWK
                     TWLSANIGKFEPSPTPSKPAEAVFGQPTMPRSVLSGHFASTRRHVREQAQIHDEDDHM
                     DDDKGGDVFSSAERKPALPAISTPTPLSRRRRTTTTTAAAVAATRTATPLSQLEPNVL
                     KPPPPAPPYPPPPSPLRRSTKGISPSPSTATTATTHGTLTSTAATTLPSISGAAVLTE
                     NESPTRPPPPPPPVPPRSKLRPEPLRIVRPSLTKGQAGAGAGSDSMSLLSSPGLSEAV
                     LRQFGPVSFHPSSSASSSSAACGKPSYGNHSEKGTGNWRAGIAEVLLAGDAASGDGDG
                     EGQQRGREVAAVGCDESVAFL"
     gene            complement(1442733..1445002)
                     /locus_tag="THITE_2076439"
                     /db_xref="GeneID:11518774"
     mRNA            complement(join(1442733..1444413,1444477..1445002))
                     /locus_tag="THITE_2076439"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651502.1"
                     /db_xref="GeneID:11518774"
     CDS             complement(join(1443178..1444413,1444477..1444848))
                     /locus_tag="THITE_2076439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651550.1"
                     /db_xref="GeneID:11518774"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="JGIDB:Thite2_2076439"
                     /translation="MRGLVALSFAACAAAAPRVSFETIHGDAAPILSSSNAEVIPNSY
                     IIKFKKHVTEDSASAHHSWVQEIHTSREMERADLKKRGQFPLVDDVFRGLKHTYKIGQ
                     DFMGYSGHFDDEVIEQVRRHPDVEYIERDSIVHTMRVVEDAKCDSELEKAAPWGLARI
                     SHRDALGFSTYNKYLYAAEGGEGVDAYVIDTGTNIEHVDFEGRAKWGKTIPTGDADED
                     GNGHGTHCSGTIAGKKYGVAKKANIYAVKVLRSNGSGTMSDVVAGVEWAAKSHIEQVK
                     AAKAGKRKGFKGSVANMSLGGGKTKTLDDTVNAAVAVGIHFAVAAGNDNADACNYSPA
                     AAERAVTVGASGIDDSRAYFSNYGKCTDIFAPGLSILSTWIGSKYATNTISGTSMASP
                     HICGLLAYYLSLQPASDSEYSVAPITPEKMKSNLLKIATEGALTDMPSGTPNLLAWNG
                     GGCNNYTAIVEAGGYKVDRKTKAGSSDIAESVSKLEELIEHDFEVVSGKVAQGVSSFA
                     GKAEKFSEKIHKLVDEEIKEFLEEIAA"
     gene            1447520..1456127
                     /locus_tag="THITE_2111994"
                     /db_xref="GeneID:11518775"
     mRNA            join(1447520..1450264,1450348..1451292,1451353..1454790,
                     1454845..1455005,1455064..1455891,1455976..1456127)
                     /locus_tag="THITE_2111994"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651503.1"
                     /db_xref="GeneID:11518775"
     CDS             join(1447672..1450264,1450348..1451292,1451353..1454790,
                     1454845..1455005,1455064..1455891,1455976..1456008)
                     /locus_tag="THITE_2111994"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651551.1"
                     /db_xref="GeneID:11518775"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="JGIDB:Thite2_2111994"
                     /translation="MLPVRSRRFRASTSASTVQTSKATEVLQALLDRLSETARSAPAG
                     SYPAISDLLDQIRQIHQHVAALPPPSPPQDDFRYLRGFQTLLGVLRAFSGFYDPHRRS
                     QAEKGAVFDLLHAVLATLSAAFRGHPGNRRYFQDRVEGGGWEALEQIIASIGVGGGDS
                     DLWTNCQLFGKLLSFALDDQRLDELCRSVASQATPSVTPEATPDGEEDKKDEPDLARG
                     VDAVDVRLREIIRPHTAIQNPEIIRTVVGFCESVPRDPGAASSLVSMVVLDVLSSIAS
                     ASFFNLCALHGTGLLSRLLRLLFAQDGRLTAPERERALPLCAALMRLGIDDLADAQFL
                     LNRSDAAASEFCLAMVKRYTGPPFIQFDLSLHGHSSIELSNLGRSFPPQTAPGYTFAG
                     WVRIDKFDPESHTTLFGVFDSTQTCFLLAYLEKDTKNFILQTSVTSPRPSVRFKSVAF
                     EENRWYHIALVHRRPKTMVASKASLFVNGEFAEQMRVAYPNPPPPSNASTESFVSFSS
                     SSTKTNPVQAFLGTPRELAAQLGPGLVHSKWSLASAHLFEDVLSDDLLAVYYRLGPRY
                     QGNFQDCLGGFQTYEASAALGLRNELFHPGKDENSDILKAIRDKAGSILPEHKVLFSS
                     FPRAIFSADGRFMDSSLFRSLSKNAASNLFHTTVKSGTAVAVNGAVPCVNEALVRMNG
                     VSLLTGDPVVAAPYHFDDNLWRLGGFTPVGLKLVERSSTAEELIRSVELMFYSISNSW
                     RNSEAMERDNGYAILSMLLRAKLGHGVPGSDTQSQTWRLALNNEARDQLSLRLLSLVL
                     HFVGYKHADPIESFIINPLAYRVLLIDPDTWRRSSTHAQELYYKQFITFAVRSKHHQF
                     NSRRLLRMRIIKRLLDALKAEAISEEILPHFMASFESLVKCNYTAEVHRSIALFITYA
                     FHTPSGSVSRTPKPASVSSRSTTPGLGLLRRTTLETSSPSSAAGSSRVLTKKQLGRKL
                     LEMYTRLLCEKSNVVDIRKFAKTVTNKVIYAAGPKKKKIEFVLTTGQWLLYLLAEDDP
                     EVVVLGCKILARLLVTQPSGYTAKFASKTGGFWIMASRLKQWWDISTLWPILFSILFG
                     YDVANIDFDKSFDFFSLLEIFGDSRVAFPDVLPVITSMLQHGLRDVLRHQEDPDSPAA
                     EPSAIKTMQETLDIVRTRPRARSMELGQALEPRRTQLPDRERVATNAAVLQTVVRFLA
                     DMHARSVNFRDFALSSDYIRHLFSALYPVIVTSDPVTAETELKSSDTLNFEGGDVIIR
                     PVPGSSSTAIPIIRTTTSGQSDAQPPSPSPGRGTPLRRPSSFILVSSQSPPSAPSPAR
                     LNHVVSPTKRVAARNISNAVLEGILELIIGVFTDQILVRKEFSGFNLFLKVPPGFQEH
                     RAYFETYVLRNVINHLKNAIQLDQKVLTEPKVLQNLARLNFHVLEAVFEGSFMNGAET
                     MIEFTGTVLEYLQRPDVAALKSVRLCSSAVASIRACFLKATLLRLSDMDDPETKDSEA
                     LSTMEHLLYWQTVLLSCLSAEDDYMKLLWYQLYNKLVDSRPAIRFVAATLWRIMLVQK
                     PDESAAIFRQTMRPDQRPLARGFGKLTELDDATFLEWVDQHRPSLDALFFGGMSKTWE
                     EFVASENQRTADSARARVKSRKEKLKQWHTESLERDNVLLRHEMANSAWMKSIYFTEH
                     FKHQRLLQDQQDDNAFMASTFAKMERDLCRPGGVFSEPQAIKWKLDRTEGRNRMRLRL
                     LPEYPNQRRQEFQPKRSNTSAAATPVPRPSTSAGNLSATRQAPTPPVEIGANGNAEDL
                     DISAEPETVAGDADQQSVAPEEDFELVEDLNEPEADDTFEDKNRKVMRRLQQGDAVRN
                     VFNISRIIGVDASEGILIIGKEALYIMDNLFQCADGEIVNVWQAPAEERDPFSMIITG
                     GSPGERRPQNQGRPDQESRSWRWQDVLSISKRRYLFRDVAIEIFFTDGRSYLLTAINP
                     AMRDEIYARLTAMTPHTTNPSLLPNPEDAWRLESLKFAEDAPQTFGAKFGSIFNSSAW
                     NPMMRRWQRGEISNFHYLMLVNTMAGRTFNDLTQYPVFPWVLADYTSEELDLNNPATF
                     RDLSKPMGAQSPARAADFASRYKSLAEIGETPFHYGTHYSSAMIVSSYLIRLPPFVQS
                     FVLLQGGTFDHPDRLFFSIEGAWTSASRDSSTDVRELIPEFFYLPDFLTNINGYNFGV
                     RQGGGGRVDNVILPPWAKGDPKIFIAKHREALESPYVSQRLHHWIDLVFGFKQRGEAA
                     VENLNVFHSLSYKGAIDLDDIKDPQERKITTGIIHNFGQTPHQIFTKPHPPREYDRCP
                     IRRLDTSVGALTRLPHPLLESRERVASLIYVPKLDRLLCSSPFRLNLPPHYDKYLEWG
                     YTDNSVRFFLSDSRKPAGLFENLHIGQISTLTFADSKTLITAGEDCVVSVYMVHSSPG
                     KPVVELQPRSSLFGHKTPVTHIAVSKAFSTILTVSQDGAAFLWDLNRLEFIRKLPFPL
                     ARGGGGGGGGVECARINDVTGDVMLCAGQHVVLFTLNGELILDQNVCNTAAGNGTVGS
                     SSSSSSSSNGNGSGSGSSHSHSHDPDDYVHACAFYEGSPGGSEWLENQLVFTGHKRGV
                     VNVWRKMVDPRTGKWALGFLRRLDHVNPKSEVGANIEAAITCVTPLSGLVYTGDDDGR
                     VWEWNIVQRER"
     gene            complement(1456257..1457251)
                     /locus_tag="THITE_2111995"
                     /db_xref="GeneID:11518776"
     mRNA            complement(join(1456257..1456588,1456701..1457251))
                     /locus_tag="THITE_2111995"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651504.1"
                     /db_xref="GeneID:11518776"
     CDS             complement(join(1456536..1456588,1456701..1456890))
                     /locus_tag="THITE_2111995"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651552.1"
                     /db_xref="GeneID:11518776"
                     /db_xref="JGIDB:Thite2_2111995"
                     /translation="MSAITPRFWAGPLRYCRWAARERPGLFWSVFIGALGPVTLVTVP
                     PIRRMIGDYDAAPIPMTYPVPSGPRKKLTGYDDDTE"
     gene            1457343..1459187
                     /locus_tag="THITE_2111999"
                     /db_xref="GeneID:11518777"
     mRNA            join(1457343..1457622,1457691..1457801,1457886..1458616,
                     1458706..1459187)
                     /locus_tag="THITE_2111999"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651505.1"
                     /db_xref="GeneID:11518777"
     CDS             join(1457481..1457622,1457691..1457801,1457886..1458616,
                     1458706..1459164)
                     /locus_tag="THITE_2111999"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651553.1"
                     /db_xref="GeneID:11518777"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="JGIDB:Thite2_2111999"
                     /translation="MRSLISFFVFLFAAAVSALSTTGNRLLVILDDVVEKANYSKFLA
                     DLESRGFQLSFETPKSESLALFHLGERSYDHIIFFPTKTKGLGPKLTPNLLVDFLNAK
                     GNLLVTLSSGVPTPNSLVSLLAELDIQLPAERTGLVVDHFNYDASSAADLHDVLLLPP
                     PGPIRPDVKDFFAAGAPKDSLLAFPRGVGAVLGPGELLTPILRAPRTAYSYNPKEQAE
                     TVDELFAAGEQLALVSAFQARNSARLTLVGSAEMLQDKWFDAEVSQPSSGAGKKAAAA
                     GKTFNREFAKRLSGWTFNEIGVLRVNWIEHHLDEPGAANQSNPAIYRIKKDVKYTISL
                     SEHAWTAWTPFTLPSASDALQLEFSMLSPFHRLPLQPDPALSTDDAAAYSAAFRLPDQ
                     HGIFNFRVSYKRPLLSNVEEKNTVSVRHMAHDEWPRSYVISGAWPWIAGIGVTVAGWL
                     AFCALWMFSAPVPAPGGAAGAARAETKKTQ"
     gene            1461522..1462680
                     /locus_tag="THITE_2112000"
                     /db_xref="GeneID:11518778"
     mRNA            join(1461522..1461681,1461791..1462680)
                     /locus_tag="THITE_2112000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651506.1"
                     /db_xref="GeneID:11518778"
     CDS             join(1461679..1461681,1461791..1462525)
                     /locus_tag="THITE_2112000"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651554.1"
                     /db_xref="GeneID:11518778"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="JGIDB:Thite2_2112000"
                     /translation="MARNSEKAQSMLFRFREAQAADLGIIDAGRSRRPRAITEQDSIP
                     ACERWRGQVLKEISRKVSRIQDPALSDFQVRDLNDEINRLMREKHMWEVQIRNLGGPN
                     YMRAGGKVYDEAGREIPGGGKGYRYFGRARELPGVKELFEAAAKARVEEEKPLEERAD
                     LRRQVNAAYYGYAPGEEDDELLEYERAREKMAFEALAKAGPAEAPPGWEPLPGDVGDG
                     RVWELPTLDEVQQELIERRRQRLLDQL"
     gene            complement(1462680..1464844)
                     /locus_tag="THITE_2112001"
                     /db_xref="GeneID:11518779"
     mRNA            complement(1462680..1464844)
                     /locus_tag="THITE_2112001"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651507.1"
                     /db_xref="GeneID:11518779"
     CDS             complement(1462835..1464691)
                     /locus_tag="THITE_2112001"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651555.1"
                     /db_xref="GeneID:11518779"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="JGIDB:Thite2_2112001"
                     /translation="MGWKAAAIGIGRAVAAAALVRTAAAAQPGAAEPVPAPMRDLVWG
                     RLNFLHTTDTHGWHAGHLQEPQYSADWGDYVSFAHHMRARADERGVDLLLVDTGDRVE
                     GNGLYDASNPKGKYYYDIYKEQHVDIICTGNHELYQASTADGEHLRTVPNFKQNYIAS
                     NLDYIDPVSGKRVPMAQRYRKFQTKNQKLDIVAFGFLFDFTGNANNTVVQPVHETVRE
                     QWFRDAIREQTDVFVVIGHVGVRMPEFKTIFNAIREQNPLTPILFFGGHVHIRDATAY
                     DARSFALASGRYFETIGWMSVSGELERSAQSEAAPLSFHRRYIDNNLLGLYHHAGGLN
                     ANTFPTEHGRNVSAMITRARQALDLDYAFGCAPKTYWMSRSPYPGDDSIYSWIETEVL
                     PDIAVNASRKHVPRLAIVNTGTIRFDIFKGPFTRDTTYIVSPFTSMLAYIPDVPYAVA
                     KQVIKLLNNAGPIFASAGPLHNRFMAIPEQLAIHESIVNAAPPGSTGHQWEGEAAQQR
                     PLADGSDGRTRLTEGYTTKDDIGDDGDDTLHAPVNFYVVPNCIQAEVGFPPAGEPETV
                     DLVFLDFITPWVLIALKFFGGDYSEKDVQLYVEGSFTELMAGWIEKNWPKHC"
     gene            1465402..1466260
                     /locus_tag="THITE_2112002"
                     /db_xref="GeneID:11518780"
     mRNA            join(1465402..1465804,1465888..1466260)
                     /locus_tag="THITE_2112002"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651508.1"
                     /db_xref="GeneID:11518780"
     CDS             join(1465523..1465804,1465888..1466247)
                     /locus_tag="THITE_2112002"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651556.1"
                     /db_xref="GeneID:11518780"
                     /db_xref="JGIDB:Thite2_2112002"
                     /translation="MESLLSISSLEHRHRDTFIHAVTNVLSSPIAEATYTQIVDGLPL
                     ADVARDVYHGCVCSTHPLLDKHRELCPGVAEQFQQLRAGFDVATLQMDSQLVHDYQSA
                     PPGSSLFTMRLIELVARAVHQFGVWLYQQDTNHHKNDELGLWRPSETKLRFYPRTYPS
                     TLFCHEWYRDYDQYPEGIADCVGYWAEARIFGGVVLFDRRDPGVVPNAEACTR"
     gene            <1467117..>1467627
                     /locus_tag="THITE_2086706"
                     /db_xref="GeneID:11518781"
     mRNA            join(<1467117..1467206,1467240..1467452,1467547..>1467627)
                     /locus_tag="THITE_2086706"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651509.1"
                     /db_xref="GeneID:11518781"
     CDS             join(1467117..1467206,1467240..1467452,1467547..1467627)
                     /locus_tag="THITE_2086706"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651557.1"
                     /db_xref="GeneID:11518781"
                     /db_xref="JGIDB:Thite2_2086706"
                     /translation="MAALADKPPKLPLATLNNGHRDVFMRAVGDAQIVVDGFPISDVA
                     RDVCNVYFCQGHPVFDDHKGLGLGMLEPARGLLSGSDARALQMDSQAAKGSTTLQPGV
                     LDNGRGEKAGDPATCELSLQLQWGK"
     gene            <1468395..>1469465
                     /locus_tag="THITE_2142980"
                     /db_xref="GeneID:11518782"
     mRNA            join(<1468395..1468506,1468622..1469251,1469356..>1469465)
                     /locus_tag="THITE_2142980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651510.1"
                     /db_xref="GeneID:11518782"
     CDS             join(1468395..1468506,1468622..1469251,1469356..1469465)
                     /locus_tag="THITE_2142980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651558.1"
                     /db_xref="GeneID:11518782"
                     /db_xref="JGIDB:Thite2_2142980"
                     /translation="MTTPMADDVPRYVGVPAESLSPEDFETASIRSAAPSYTSDAPSY
                     HSTNPNPDPLPAYSPPAPRSTPSATAAAPRNHSVSSLLDPSPTTTSSSSSSASQPRRY
                     GLPPVPPAPPRPQDIPLLSPPRLPAWSAAAHSPFSHANPTARLYHNVARRRASASASS
                     SSSSSSSSSSSWSGSAHLHDGMLMRRNLLERIEEEERNRVRPLEDPYLVGEEAAARAR
                     AERIAREGERRALGDEILVREDRRWDWFLAQMKDWEERDRSWKQFRRDFDRRLSNRFS
                     FRIGTRS"
     gene            complement(1469950..1471253)
                     /locus_tag="THITE_2112010"
                     /db_xref="GeneID:11518783"
     mRNA            complement(join(1469950..1470177,1470241..1470411,
                     1470474..1470589,1470664..1470746,1470856..1470886,
                     1470997..1471253))
                     /locus_tag="THITE_2112010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651511.1"
                     /db_xref="GeneID:11518783"
     CDS             complement(join(1470135..1470177,1470241..1470411,
                     1470474..1470589,1470664..1470746,1470856..1470886,
                     1470997..1471044))
                     /locus_tag="THITE_2112010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651559.1"
                     /db_xref="GeneID:11518783"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="JGIDB:Thite2_2112010"
                     /translation="MAESELSPKFAPFIGMGGIAAAMIFGCMGAAYGTAKSGIGIAGV
                     GTFRPDLIMKSLIPVVMSGIIAVYALVISVLIATDLQPPAFGANYSLFNGFMHLACGL
                     SVGLTGLAAGYCIGVVGDKGVRSYMLQSRVFVGMVLILIFGEVLGLYGLIVALILNTK
                     SKG"
     gene            1472451..1477105
                     /locus_tag="THITE_2112014"
                     /db_xref="GeneID:11518784"
     mRNA            join(1472451..1472677,1472823..1475335,1475398..1475737,
                     1475805..1476655,1476720..1477105)
                     /locus_tag="THITE_2112014"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651512.1"
                     /db_xref="GeneID:11518784"
     CDS             join(1472828..1475335,1475398..1475737,1475805..1476655,
                     1476720..1476857)
                     /locus_tag="THITE_2112014"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651560.1"
                     /db_xref="GeneID:11518784"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="JGIDB:Thite2_2112014"
                     /translation="MADYQRDRMPPPRLQPQHPGYGPSNTYQRDAAFSNIFGAAPPPG
                     RSQTMTSSVAPPQFMQDGRTHTMSSTTSGMSETHRSPPMRPPPGGDYRDQFAPPRPRP
                     NDGGPGYGHYQGQPRSVSGGQQVPSPQYLQQQQQARRPYPGSPPSQHPGPPRFEPQRG
                     PPPPQGYYNNAPRTPAQRFHPDGRPPAAMNADPYRSQSLANYPRPQMYQPPPQPYQQQ
                     QAPANAFRHAQYNQHSARTTAQGRIVPERHMEDRSMSMTGYPSHDRHDRDAHQMMSGR
                     VIPNRKPVGAPPPAHDYMGSHAPPNLGHPAGYGPPGSQTRTTSMASSIGHDSTRSMSM
                     ASTIVPPSMAPSEKTDTQTVVQRTSMTNSVNGERPPTAKIRPPIVYPALLSRVAECFR
                     QKIVTGDRTKNELTYKNAFSGAEAVDVLSYIIRTTDRNLALLLGRALDAQKFFHDVTY
                     EHRLRDSTYEMYQFRETMTEEAEEKPAVNGVFVLLTECYSPTCTRDQLCYSIACPRRL
                     EQVSRLNLKMGPGLKREGEANMNDDDADQTDEQKLWINSVPKEIADSIGDREKKRQEV
                     ISEICYTERDFVKDLEYLRDFWIYPLRGKINGMSPIPANRRERVVKTIFSNIIDSPSI
                     HGVSSRFARALTERQQKMPVVKNIGDVFLEFVPQFEPFILYGSKQLEGKFEFENERSI
                     NKDFARFVDEVERRRESRKLELNGYLTKPTTRLARYPLLLENVLKYTEPDNPDKEDLP
                     KVLTMIRDLLTRVNEETGKAENRFNLRRLHEQLRFRPNERVDLKLTEEGRELVVKSQF
                     KKSPTENADITAYLFDHAVLLVRIKQVGKTEEYKAYRRPIPLELLSIKEMEEVIPQAG
                     AVKRSSSGILPALRNNGNEAKKGEGWPVTFRHLGKNGYELTLYAANQSGRQKWLEKID
                     SAQQRLRARADFLNTTIISSGFFTGTNKVNCVAPFDGGRKLIYGTDNGIYMSDRRSKD
                     NATPKRVIDVPSVTQVDVLEEYQLLLVLSNRSLLSYQLSALDPNEPISSKRAKKIQSH
                     CNFFKTGICLGRHLVCCVKSSALSTTIKVYEPTDAMARIKKQKGISKMFNAGQDELKP
                     FKEFYIPTESSSVHFLKSKLCVACARGFEVVSLETLETQSLLDQADTSLDFVARKEGV
                     KPIHIERLYGEFLLNYSEFSFFVNRNGWRAKPEWRLDWEGTPQAFALSYPWILAFEPN
                     FIELRHIENLAVHIVPHRNIRMLHSSTHEILFAYEDERGDDVIEAIDFWKSQRKSEVL
                     PAGASPGSPPGSSAAH"
     gene            1478575..1479671
                     /locus_tag="THITE_2112018"
                     /db_xref="GeneID:11518785"
     mRNA            1478575..1479671
                     /locus_tag="THITE_2112018"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651513.1"
                     /db_xref="GeneID:11518785"
     CDS             1478731..1479498
                     /locus_tag="THITE_2112018"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651561.1"
                     /db_xref="GeneID:11518785"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="JGIDB:Thite2_2112018"
                     /translation="MSLLPAESSLSGPAARSTPTPSTTTASTPAPPAPNSNSNNNNNP
                     PSYAQSQTTAQPPALPARNQPPQPPAKPVLARARALYRYAAGDARDVSFERDDALAVF
                     EYMNDDWWLGRNERTGEEGIFPRSYVVVVGGPAADDNGAGGAGEKVGLPPAGGGAVAA
                     YNQQPPYQQGGYPGAGAGSGGGGGGGGYPVSPVPVGGYSAPPPPAGQAPVPYQDGQHG
                     GGSKLGEQGKKFGKKLGNAAIFGAGATIGSNIVNSIF"
     gene            complement(1480599..1482989)
                     /locus_tag="THITE_2112019"
                     /db_xref="GeneID:11518786"
     mRNA            complement(join(1480599..1482191,1482249..1482989))
                     /locus_tag="THITE_2112019"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651514.1"
                     /db_xref="GeneID:11518786"
     CDS             complement(join(1480616..1482191,1482249..1482838))
                     /locus_tag="THITE_2112019"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651562.1"
                     /db_xref="GeneID:11518786"
                     /db_xref="JGIDB:Thite2_2112019"
                     /translation="MMPMMPMPRYPLRPADPVSRRNRLPELADAGYVSEVFGWPDGTT
                     EADIEEELMAKAAKLGITLPEHAKRSNAHDRTASAADSPIRAGSPGSPGSDGIADAAA
                     MTSQTSDHATPTHEPSSEPTGRRRSRSLNFSQYDKYISQLNAALGQAKFPQPHDGYTG
                     VSAGAANRPGPRKGVKGFTRSLASRLRGRRPINDLPMPCICCRELFATGSHSVLHTLP
                     CGHKYCRDCLAVVISQSLADECKMPPKCCTEPIPSAIIKLVLPRDKQQEFLKAVVLYS
                     TPWETRIFCPKASCGEFIPPATRVDPKHPSEVLCAKCKTRVCIMCKRAAHQLGQDCPE
                     DHELERVLKMGEKSGWRRCYKCRMLVELAQGCTHITCRCKAQFCYICGAVWDPAVGCP
                     NFCNGEEELERRRVEEEARLAEIEAEKMAQEKAAEAEDAAKQEAERRTLESSEFRALR
                     AQLEAEMARFKGYEQKVQEAMRERQSIKKLALVDKFSDLTDKMRDRHARTEQHLEDRQ
                     VMAEIELQSQLEEKEKKVRLKLKYMEDYCHGHGAGPAKDHDDKRNTSSGSTDENGEWP
                     QRQVTERDLEQLRQQYLVRDGMEQRHRSQIHGLREKQAKSMEELMERHEREMEALLER
                     RAEEIEDLAVAFANEEDVLQQTFAERRARLLRRWELAAEILRVEMERRYGKPFAALAL
                     PAWPETAEDGAGGGEDVLAAGVAVGAVDHGGDGIVGVAR"
     gene            complement(1485166..1488174)
                     /locus_tag="THITE_2112022"
                     /db_xref="GeneID:11518787"
     mRNA            complement(1485166..1488174)
                     /locus_tag="THITE_2112022"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651515.1"
                     /db_xref="GeneID:11518787"
     CDS             complement(1485214..1488060)
                     /locus_tag="THITE_2112022"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651563.1"
                     /db_xref="GeneID:11518787"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="JGIDB:Thite2_2112022"
                     /translation="MDGKQPLPAGKGPESRKRKESPALIKEVKSRPQDGGRAASAAAT
                     TASTGRAAKRVKFQDARNIRTQPSDAALEDGKLDLQKFLNAREFEIKALESSMRKCKA
                     ANATRVFQSVPRAMRRRTASHNAKRVPKRLRERARREMIEDNTPTVEARKRRPRTTRA
                     RLRAETAKRLGLLAARKRKKKKQQLEKAAAEGASMSEESAKPKVHTRPARPKIRRDML
                     NEPPRAESKFRKRQINKTWLPTHLWHAKRAKMTEPSKPLWRFAIPLTPTEKCYRPTHR
                     ASGQKGVVVWDTSYMSTIGLYGAAEGVERVLRALGLTQEGLWAALGQKWRAGVRKWSG
                     MLSKQTKDSRRDIGPATIIWNPQAPDAEDAAADSSHAKKPQRQLLIRTHPSCFLELFQ
                     ELLKLVRMQTPRLHIEDLRFEVGSIELTGPGSTETLLGVLQPWYDKPGNEDRHGQVFK
                     SLVGITNPASLPKDALLAFSVKDPRLAYPPRTVDIPSGGANAALVETITNWPVEETLK
                     PFGIFSRDARFQASRLPSQKAINRRKGAGAPGEPLQVTPSDPPIPIMLLASRSPAGGQ
                     AQGTWTLLAPWKCIMPIWYTMMHYPLSTGGNPRLGGLDEQRQIAFEHGSPWFPGDFPA
                     SDAGLSWELEQRAKRKRDWDRRPKGKRVEWGSLDLGAGRKGEIGDGLACDFEHLFALS
                     AGEPANPQGIDSSIADAPEPMDIDLPEPSEGTQARSKTGSSAPALRLIQRLTKEAFAS
                     LLTSSDPGKPPANSIVAINLTFVTRGVANTCARIYRLPSRKKSRIAEPSEDAEVLATD
                     PVSTSPGPLLPPDLRDQWLRKLPSPSSDRGRRARARLAAPPHAPPGIDMETRKKLLAQ
                     SLVGTELPYPRPPANQLDIGGHHPLCPGEEDLIGFVTTGAFSLSEGRGTAVGSISAQR
                     ALEALREGGAREGKLCIVRNAGESVGWLARWELV"
     gene            1489173..1490955
                     /locus_tag="THITE_2112023"
                     /db_xref="GeneID:11518788"
     mRNA            join(1489173..1489263,1489333..1490955)
                     /locus_tag="THITE_2112023"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651516.1"
                     /db_xref="GeneID:11518788"
     CDS             1489375..1490742
                     /locus_tag="THITE_2112023"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651564.1"
                     /db_xref="GeneID:11518788"
                     /db_xref="JGIDB:Thite2_2112023"
                     /translation="MVKWHLPHSIHGEHRGRTQKCPILNHRVEYGYSKIIPVRIAIDR
                     NGNLSECPIEYEVLQEFSGSGTAGGSGRDEKITLGTVRLNLSEYVEESEGILRDPPTA
                     AAVKEALASPGSKSGQRPKRSSLSNVGPAGPESSPRSSHDEERPASDVLDGVVRRYLM
                     QDSKINSTLKISILMIQVDGERNYVAPPPKSVPFFGGIAGLVSGDAFEPVDTGANAPG
                     HAPSSFTGKFRDMFEIQDMYRRALAASWASQPGELPADQCIEDIFAGGEGFGAPPKSH
                     TRGHSRHQTAVAGHDRGGPGTDDTAPAPRRSLPRDNSGSVSDDEDNGDTMGTLRPRDL
                     ARLRSHIRDHSVASDRSTATVLGAERDLDRESSRAIGLGGNGPSLREPFPLFPPLHRR
                     EDSKITHDGGGLRSRSSSLISLATTIGSERDRGRDGFKRAKEVDEFEVREDLVAWTVP
                     DNQFR"
     gene            <1491835..>1492971
                     /locus_tag="THITE_129198"
                     /db_xref="GeneID:11518789"
     mRNA            join(<1491835..1491984,1492267..>1492971)
                     /locus_tag="THITE_129198"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651517.1"
                     /db_xref="GeneID:11518789"
     CDS             join(1491835..1491984,1492267..1492971)
                     /locus_tag="THITE_129198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651565.1"
                     /db_xref="GeneID:11518789"
                     /db_xref="JGIDB:Thite2_129198"
                     /translation="MEPVRDNITAVDGDIAAVHANSGDVPAVAAVPADVVVNGVAHNG
                     SLGGRDTTQLSIRGVPLHRPLPHEHLSGLAPGTVLICGHMVCVPCWVAWGGDHVEFRA
                     EVENGSEYQEGDFDEGPDDNEQQLQEGEEEAEEGEDDDDDMLGQEHPDENGDEDEQQQ
                     AGPDDQDDGEGEDEGEDEDEDEGEISEVDEDQFPDPPPQPAYEWRPPMKCPVCQLVLE
                     HPGCGCPILPEDMPPSLEEDEDAAGGREYSYADDQWARRYPQTLPERADGAVSPFCAP
                     CAARIGGN"
     gene            complement(1493755..1495966)
                     /locus_tag="THITE_2112026"
                     /db_xref="GeneID:11518790"
     mRNA            complement(join(1493755..1495382,1495441..1495966))
                     /locus_tag="THITE_2112026"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651518.1"
                     /db_xref="GeneID:11518790"
     CDS             complement(join(1493770..1495382,1495441..1495576))
                     /locus_tag="THITE_2112026"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651566.1"
                     /db_xref="GeneID:11518790"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="JGIDB:Thite2_2112026"
                     /translation="MGDSGPKAGLEPSERTAIGITFGNSNSSIAHVVDDKAEVIANED
                     GDRQIPTILSYVDGDEYYGQQAKNFLVRNPTNTVAYFRDFLGKEFKSIDPTHSHASAH
                     PQEAGETVSFTVKDKEGEEAAPSTLSVSEVTTRYLRRLVNSASEYLGKKVTSAVITVP
                     TNFNDKQKAALVAAAAAADLEVLQLISEPVAAVLAYDGRPQAKIEDKIIVVAELGGTR
                     SDVAVVASRGGMYTILATVHDYEYGGVALDKVLMDHFAKEFMKKNAGAGDPRENARSL
                     AKLRLEAESTKKALSLGTNASFSVESLIGGVDFASTINRLRYETIARTVFEGFNRLVE
                     SAVKKAGLDVLDVDEVILSGGTAHTPRIAANFRSIFPPSTRILAPSTYASAINPSELQ
                     ARGAALQASLIQEYEAEDIDQSTHAAVTTVPHTTNAIGVIALGGDTAADEVFVPVVPP
                     ETAVPARRTVHLSAPGGGDVLVRVVEGNTHIKVTKPEPKAKENGDAKAAKAEDADEED
                     DSDFSEDEDEEEEEEEKREKVWKIGATLAEAGLKGVSKGAKVEVSITVNADLSVIVTA
                     REVSGKGGVRGTLPSA"
     gene            <1496137..>1497013
                     /locus_tag="THITE_2046078"
                     /db_xref="GeneID:11518791"
     mRNA            join(<1496137..1496334,1496429..>1497013)
                     /locus_tag="THITE_2046078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651519.1"
                     /db_xref="GeneID:11518791"
     CDS             join(1496137..1496334,1496429..1497013)
                     /locus_tag="THITE_2046078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651567.1"
                     /db_xref="GeneID:11518791"
                     /db_xref="JGIDB:Thite2_2046078"
                     /translation="MASDHLFVLPGETIDPALVPTHKKHPLRLGPGLRHIPPSDIVPT
                     VAGQLITNPLKNSMWVEFNSQRYIPTTGDLVLATVTRNAPEAYLCSLSAYTPAATLPH
                     LAFEGATKKTRPQLAPGQLVYARVALAHRHMDPELECVSAATGRADGLGPIAAGNGCV
                     FDVSLGFARRLLMARSREDGGVGVLEMLAGQDPEVVVGGAGGGGGLAFETAVGRNGKV
                     WVGSESAKTVVLVGRALQETDRARLGLEGQRRLVKRLLREMR"
     gene            complement(1497673..1500170)
                     /locus_tag="THITE_2112027"
                     /db_xref="GeneID:11518792"
     mRNA            complement(join(1497673..1497974,1498041..1500170))
                     /locus_tag="THITE_2112027"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651520.1"
                     /db_xref="GeneID:11518792"
     CDS             complement(join(1497692..1497974,1498041..1499905))
                     /locus_tag="THITE_2112027"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651568.1"
                     /db_xref="GeneID:11518792"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2112027"
                     /translation="MLIPRSTPLSSGAIAGAVVGSVVGALLLALCLFPLVVGARRRRL
                     RARHDGDPGLAEMGQAPGGPIPADDSSYKNSSGSALEAVNTVDEARQPPVAPSASVTV
                     QHDPLSPGPSPTSPPPKTDLQPQGDRQEPSPATAPSPARSPAATSSTPRYGSRTTAGR
                     ESTRDLSGSDSYGPPSRELTSITSVGITAEPESFDRPSGSREHSHFHLPDSIRNLLHS
                     RRSSHLRRDSKRSTQAGTESARSPSIATNDVLPQLEPTSSGLEIDTETPGLAWDYFHD
                     PTLGAEVYDSFPHSLPAPVSAAAAPSTDAPAPVPLGSALPASQIPATAGDTVPHLTAR
                     PITEEPDAISSDTDATATPAQSSKQNTALQGKRLGGSLQRTDSLPPPTIVADLPSPPL
                     LQYNIGPSGNPMEMMKPTNPTESAWMLEHEMRLIQSAPPLPAHEPQLPISVPLDEGQG
                     ALFGHDLLKPEPPPAFQPPFQSPYQSPPQAASEFEIEMHKPIPEQPPGFNEPNVLTTP
                     DYSTPPPSTGPSTQSTPNTKLTPFTASPSPPAEMEATINSQLRPPSPGISAGASPSPG
                     PSLSPGLSPDISRGRSPGPTPSRSPGASPGRSPARPPGGFVCDVCGVVKSSYHQFNHH
                     RRYHDRPYECTHPGCGRSFGTITHLNRHVNDKHVKTRKFYCTQPDCAYSRQGGKSFPR
                     KDNWKRHMMNKHHIDPQNETDEEVLADVAMDET"
     gene            <1502844..>1504433
                     /locus_tag="THITE_2029826"
                     /db_xref="GeneID:11518793"
     mRNA            join(<1502844..1503135,1503226..>1504433)
                     /locus_tag="THITE_2029826"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651521.1"
                     /db_xref="GeneID:11518793"
     CDS             join(1502844..1503135,1503226..>1504433)
                     /locus_tag="THITE_2029826"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651569.1"
                     /db_xref="GeneID:11518793"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="JGIDB:Thite2_2029826"
                     /translation="MRHTILLFAATAAALVTPDQGKQQVALMDSDDKVTFRPDNAVQA
                     WWDALPDAAHLLSSLEQRITEELERLRLNDFFALYGDEYHGDREDDHPRPRHPRHGRH
                     GRHDHHGDPTKTIYELIKQSNHTTKLAKLVDEHDEIKQLLQDTEHNHTLFVPTDRAFA
                     RIPHHRHRRGGGGGKSDSNANTDDDNDGDDDDKHPHKPPKEFVLALLKYHLLPGLYPL
                     RRIQTHTTLPSELHPAALNATTTTVPSHPSQGNPQRIRAFTLPLIHHTRLNFYTRLLP
                     GRHASNLPAKNGLLHAIDHVLVPPPPQTALVRLLPSHFSTLALALETTGLGRELAGAA
                     RRGGGTLFAPTNRAWARLGRPANAFLFSPPGRKYLAALVRYHVVLNETLYSDAYYSAK
                     GQAVEIGNEEEEEAGGGAGGSWHADLASWLDGKPISVDVKSWNGFVSIVLNGHVRVAV
                     RDVVAADGVVQVVERVLIPPHRHGGQGDEEEEAEEMSVEVLKSRLEPYLE"
     gene            complement(1504380..1506400)
                     /locus_tag="THITE_2112030"
                     /db_xref="GeneID:11518794"
     mRNA            complement(join(1504380..1504564,1504634..1505796,
                     1505867..1506400))
                     /locus_tag="THITE_2112030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651522.1"
                     /db_xref="GeneID:11518794"
     CDS             complement(join(1504636..1505796,1505867..1506103))
                     /locus_tag="THITE_2112030"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651570.1"
                     /db_xref="GeneID:11518794"
                     /db_xref="JGIDB:Thite2_2112030"
                     /translation="MDDTAAPPPSSQASSSHSPFGPLPASLLLDQELARKERLRRRGN
                     LTTGCRELDEYVLLGGFERGSVVGVSAEEEEMGLAIGFQIVARLLASQTSARAMIVTT
                     LPVTVLLPKLRRALLGQLGAPRGGLVQDHQSRVRECLERISIARVFDIEGLREVLAEM
                     EDGVREADTRSSQPVGGGVVGQEPAAGAATKEATEGEKRHTTEVLDSEGEDGLSSPEP
                     TPNTDPALPPNKPHHDGRPDTAEPTPSSAALPDLILITHTSTLLSALFTGRDKDVAHN
                     TMLQLSSHLRSLTRSSSHSTPPLILFLNSTNAPSSSQYHSSDSPSAPAEAAAPVGQTR
                     PPKQQDPTLRSIFNPPPPPPAQGYHGFAAAARRSKPAFGLVFAQMLDLHLLCTRVPRT
                     RADVAALVASPGAWAARESVTSVWVVEVLLDEIGVYGKGADGGCDWGEWRSREQRWGV
                     VDADAEGRVVDAVIP"
     gene            complement(1507905..1510679)
                     /locus_tag="THITE_2112033"
                     /db_xref="GeneID:11518795"
     mRNA            complement(join(1507905..1508920,1508980..1509442,
                     1509515..1509759,1510126..1510270,1510334..1510433,
                     1510486..1510679))
                     /locus_tag="THITE_2112033"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651523.1"
                     /db_xref="GeneID:11518795"
     CDS             complement(join(1508067..1508920,1508980..1509442,
                     1509515..1509759,1510126..1510153))
                     /locus_tag="THITE_2112033"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651571.1"
                     /db_xref="GeneID:11518795"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="JGIDB:Thite2_2112033"
                     /translation="MADSQSGQQDQRSSGLLLNLSSNNPFRNRAVSPVGPQSPASPFD
                     DPPPRPLSRNPFLDPAIAGRSSFSDIRSASEAMSLDKRPSLTADEIFGSLSLEDSSSK
                     SAAPPRPDGAKPPAPPMGHRGPPPPNRDGLPPPNRRGPPPNHRPTRSQEEALRARRTQ
                     EKGDRSDRPDPSRSPQRRPERRPRRNSDSSIVDADRIMTEEEKKQREQRRRERERRHR
                     ENRDKKPVNRKLDIIDQLDATSIYGTGMFHHDGPFDALNPHRNRKGSRRAPMQAFPEG
                     SLNNTIGGAGPLNARPDHATFLGHQEDEAFKDWSMGGKDRSSSKGEVPVFDPLSRGTV
                     LHGDESLGLGTSTFLEGTPAARTAIQKREEERAAEAMNEGLQRKKSLAHRIRNINRGG
                     RDIQASGRLTNPETGYGVRRSPAQNGPASASLSERNPFFSEFGSGKGEDDFTVRRTDT
                     NGSKGSPTSPKGGGGPVLERRSTTDATTTTAAGPGEEAQPKVSGILGRMKSLKGRRQR
                     PGPAPPAGGDADAGPAPGTAV"
     gene            1516382..1518071
                     /locus_tag="THITE_2112039"
                     /db_xref="GeneID:11514724"
     mRNA            join(1516382..1516444,1516706..1516790,1516960..1518071)
                     /locus_tag="THITE_2112039"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651524.1"
                     /db_xref="GeneID:11514724"
     CDS             join(1516779..1516790,1516960..1518033)
                     /locus_tag="THITE_2112039"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651572.1"
                     /db_xref="GeneID:11514724"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2112039"
                     /translation="MTTMDLRVGNKYRIGRKIGSGSFGDIYLGTNIISGEEIAIKLES
                     VKAKHPQLEYEARVYKSLAGGVGIPFVRWFGTECDYNAMVLDLLGPSLEDLFNFCNRK
                     FSLKTVLLLADQLISRIEYIHAKSFIHRDIKPDNFLMGIGKRGNQVNVIDFGLAKKYR
                     DPKTHFHIPYRENKNLTGTARYASINTHLGVEQSRRDDMESLGYVMLYFCRGSLPWQG
                     LKAATKKQKYDRIMEKKMTTPTDVLCRGFPNEFAIYLNYTRSLRFDDKPDYSYLRKIF
                     RDLFVREGFQYDYVFDWTVYKYQKNAQAIQQAAGNTTNQAVQDQKDSQQASARKEAQQ
                     ALPRGARKQLTADAQDTNRAVGGSDRM"
     gene            1519813..1521980
                     /locus_tag="THITE_2112046"
                     /db_xref="GeneID:11514725"
     mRNA            join(1519813..1520065,1520233..1521980)
                     /locus_tag="THITE_2112046"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651525.1"
                     /db_xref="GeneID:11514725"
     CDS             join(1519890..1520065,1520233..1521799)
                     /locus_tag="THITE_2112046"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651573.1"
                     /db_xref="GeneID:11514725"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="JGIDB:Thite2_2112046"
                     /translation="MKPPTTSTLDATTMTPSTLDLFILTFNCAKNLINTSVFAAHLYG
                     ALTQNATGLPDLVVFSLQEVAPLSYAFIGSYFLNPYYARFGEALNLASERVLAAAADD
                     ANDRDASSSSSAARPPYTLVRSKNVGMTSILLYARDPAAIRKIEEAECGFGAADIGNK
                     GAVGLRVTWSDSASSGGTPRTTELTFVAAHLAAMEWNLKKRNSNWRSIVSGLTFANPR
                     AVLPGLFPPADPSLPPTPDRSGAGDIAPPPPPPPRPTRLPTGDSPDPSEEEPESDGEE
                     DEDGDTHPLLPTTTTTTTTPPPPYDREARAALHALSVYKPTAHLFVAGDLNYRIGSTT
                     PPPLAAFPSLDPASEHYFPAFFARDQLTREREAGRTMHGLSEAEVRFAPTYKLDVLPP
                     AASGDDGQAEAEAEAEAEVVPWQFAPHRWPSWCDRVLYLDVPAWAAAKAAAADGHGHG
                     HGHGDDGPMLRVDVRAYDALPVVRTSDHRAVFFRARVPVLGEDEMRPPPEMVAEAEAE
                     AEAERAAAAKLDPRLRLPVPVDVHAWERRAAARRKELVIGWSAYVWSTREGALLLATA
                     LAVGVGGWWLWRAW"
     gene            complement(1522731..1524449)
                     /locus_tag="THITE_2112048"
                     /db_xref="GeneID:11514726"
     mRNA            complement(join(1522731..1523168,1523260..1523800,
                     1523870..1523965,1524029..1524449))
                     /locus_tag="THITE_2112048"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651526.1"
                     /db_xref="GeneID:11514726"
     CDS             complement(join(1522841..1523168,1523260..1523800,
                     1523870..1523965,1524029..1524224))
                     /locus_tag="THITE_2112048"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651574.1"
                     /db_xref="GeneID:11514726"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2112048"
                     /translation="MAATVAHSQHAPPPGLHPLQTAPVKAAGSGQEPTQEKNILDDKP
                     FDIGAGRLSASDFVRVRTLGTGTFARVCLVRPSHGTEADRSKVYALKILRKTEVIKQK
                     QLDHVRHERQILADVRGHPFITNFLASFADHDFLYFLLDYVPGGELFTYVRKFRRFDE
                     DTARFYAAEIVLVLEHLHEEQGGVAYRDLKPENLLLDAEGHIKLVDFGFAVRLGNNES
                     GHPVETYTMCGTPEYIAPEVIHNKGHTTAVDWWALGILIYEFLMGFPPFWHSNKMELF
                     KQIVEKPVVFPSEPPVSAAAQDIIRQLCTVDRSRRLGNISGGAARVKEHPFFAAVDWD
                     AVYHKRRPGPIIPPVRFPGDTQCFDVWPEEDEHWDEYTDELAERYEACFSDF"
     gene            1525149..1525611
                     /locus_tag="THITE_2112050"
                     /db_xref="GeneID:11514727"
     mRNA            1525149..1525611
                     /locus_tag="THITE_2112050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651527.1"
                     /db_xref="GeneID:11514727"
     CDS             1525162..1525428
                     /locus_tag="THITE_2112050"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651575.1"
                     /db_xref="GeneID:11514727"
                     /db_xref="JGIDB:Thite2_2112050"
                     /translation="MSLKPICPKRGGPVPMVDGPRPPGLGSEMSDAGRRQRGIGNPAG
                     SQAEGERQPANAADGCRAELPAVSDNGSWSRSRRSACRYVVSEP"
     gene            1526191..1530421
                     /locus_tag="THITE_2112051"
                     /db_xref="GeneID:11514728"
     mRNA            join(1526191..1526692,1526773..1530421)
                     /locus_tag="THITE_2112051"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651528.1"
                     /db_xref="GeneID:11514728"
     CDS             join(1526270..1526692,1526773..1529970)
                     /locus_tag="THITE_2112051"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651576.1"
                     /db_xref="GeneID:11514728"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="JGIDB:Thite2_2112051"
                     /translation="MQAFSSFVQKAQQLLDPSQGLNLSDSDRNPSKASLFQSQFRLPS
                     SQHPLYEITAELTIPPANATQGDRDRDRGYQYAGKLHLSEAFLCFSTTPSSFLQSAST
                     STSSIFTGQTHGSGPSGNGFTFPLCSIRRVERLHSQNFQFALSISTWNGISQDAAKEK
                     DRKDLREQRITIQLAGSRQACERFCDGLKKGLRANVGNVGKMKQVTAECYSEYLLRPE
                     DKKNAIPPDAGLGMLFKYPGDPKKLRDRAKMRLWAEYLRDNGRNMTLLRQPTFHKLIR
                     VGLPNRLRGEIWELTSGSLYLRLENPTLYADTLSKFSGKESLAIDEIEKDLNRSLPEY
                     PGFQSDEGIGRLRRVLTAYSWVNADVGYCQAMNIVVAALLIYMSEAQAFFLLSALCDR
                     FVPGYYSTTMYGTLLDQKVFESLVEKTMPILWEHLVKSDVQLSVVSLPWFLSLYINSM
                     PLVFAFRVLDVFFVEGPKVLFQVGLAILRINGEELLDAADDGAFISVLKSYFASLDES
                     AHPKSENPKLRAVTKFQELMVVAFKEFSGITHSSITELRLKNKDAVLNNIESFAKRTA
                     IRNLGPDSKLLSNDELGALYDRFYGVLYERQQRDRIIKQELARRAKSSRSRIAEAASE
                     GGHGIEKGRVGLGPSTSLMDYDAFREFLAGICKWAISDAPSTPRRDAVTEKEKGFYGS
                     FRRSDSLLSPWGAGSEPADHEFLRRLFQKWDTDSSSALTLQKVVSGLARIKGKRDIMG
                     TINYFFELYDDDGDGKVDREGILRMSEALLFLSRRGLEGTLSPSNSTLTLSGEGANND
                     QGDVLGQPVSERFLGSVSAFIRRCFEYADPDHPSNQDSAVQELGDKLASTDLKEEPES
                     EQLANPDAFAIGDDDDEDDLLAMDSPTSSPKAAAQRPASNQPPPPTIQLNSPTTQLSP
                     GDDIAARRRVSKAQSEKANIALDPSNPLHITLPTFRMVVLADELLEQFFESAFPASFH
                     LIDGIAGPTSATTSTAASPLTTFSSLGFGAGRAANPAAAAAGQGPAAFGAAGAAVAGA
                     GGAGRGLRGVLDNIVTDGMRVAAEVRRRMEEAQRELERNALPGQQSQQQRGSGARDDE
                     DDEDDEELGAPPGAGSAGGNGKGAAAAAAAGAAGRYAYAYGGDAERRSVRSSDRDLLT
                     GADAEASDAAPVGDVPAIEGGVVGGGLGEGGSSSVGVSGGGRGRAAEMGTGKVVGIEF
                     DG"
     gene            complement(1530423..1530929)
                     /locus_tag="THITE_2112052"
                     /db_xref="GeneID:11514729"
     mRNA            complement(1530423..1530929)
                     /locus_tag="THITE_2112052"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651529.1"
                     /db_xref="GeneID:11514729"
     CDS             complement(1530692..1530925)
                     /locus_tag="THITE_2112052"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651577.1"
                     /db_xref="GeneID:11514729"
                     /db_xref="JGIDB:Thite2_2112052"
                     /translation="MSSRNTPCILPPLSPALASACLGGHWGWDEGNATQNRPRCLPPG
                     INPKKVGRLRSQPSKIVTMDGAGGNGVCHVDAS"
     gene            complement(<1531746..>1534070)
                     /locus_tag="THITE_35556"
                     /db_xref="GeneID:11514730"
     mRNA            complement(<1531746..>1534070)
                     /locus_tag="THITE_35556"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651530.1"
                     /db_xref="GeneID:11514730"
     CDS             complement(1531746..1534070)
                     /locus_tag="THITE_35556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651578.1"
                     /db_xref="GeneID:11514730"
                     /db_xref="InterPro:IPR010730"
                     /db_xref="JGIDB:Thite2_35556"
                     /translation="MEGTLCSLCAGLDVYGAVECLLSREGAYSDDSVCLESPWHGTLA
                     AVDASSASCGLCSIVMKGWQASREVVVEQATRDAMFDPLDPPQGLDAPVRQITEYRNS
                     PVSLEIVRRARRVDDGRRNQSSLFLRAQCCGPATRTSFDVLDPVTVELRIMREKPDAV
                     AEDPASGSANRVSTAQIDLNTDLLVPEDPLSQTSLDTVCGWLKTCVNHHGTACIPSAA
                     PKGWLPTRLLEIGPGGHSIFLRETQAMKLAADVRYVALSHCWGQGRTPFTTTRQTMPS
                     RMAGIDVGVLPQTFQDSVGLTNSLGLQYLWIDSLCIIQDDAGDWAKEAAQMANVYRYA
                     HLVLNAANSDADAAGFLSPRHAQDTVRLPPATPGRRHLCLQLCPPESRRWIDPAGPDN
                     LNWEPISRRAWCLQERCLPMRSLQYGSHQAFWECEMMRASEDGDAITQEKGHLKRLCE
                     TANIADSVFARPDRDPSSEREQKVNWGDWHRMVEDYTARHITAHTDRLPALSGLAQAV
                     VRESGGEYLAGLWKSGLIEGLLWHKAQPGRDITPTPEYVAPSWSWASVIGPLQFPIYT
                     WYTQRAFWKAKMADFEPLAEYVRHSTVNRDADPYGRLAEGYLVLKAPLLPVLSVRRRQ
                     GQAPALRSLFGQAPARSEVADAVVKLATPSGNVWVEGGFDDTRRGADHPENLVVVFLA
                     RLPHVLDDGFVEHRFGLILRPVRGEAALYRRVGFVDGVLLSKSFFDAVRGRGEYSIIG
                     YRRPFARGDLDEDKRDNDLAADPLMLDKTDVRIC"
     gene            complement(1535229..1539462)
                     /locus_tag="THITE_2112055"
                     /db_xref="GeneID:11514731"
     mRNA            complement(join(1535229..1538965,1539023..1539462))
                     /locus_tag="THITE_2112055"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651531.1"
                     /db_xref="GeneID:11514731"
     CDS             complement(join(1535387..1538965,1539023..1539253))
                     /locus_tag="THITE_2112055"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651579.1"
                     /db_xref="GeneID:11514731"
                     /db_xref="JGIDB:Thite2_2112055"
                     /translation="MSAKLTLCRTRLAAHLYAEHLLDREHFSEWLVFNLENSSEARLP
                     MWMLITQLYWKDLLKLRKYGRRLVAALISHHHLISNHPDKDILSPLLQSLTQSLNTLI
                     LSSPENFLSPLTWPKYRDGLKACLPAGDETRLNVFGAINLRNEQLAAAANRSQPAARH
                     ILVRMLDGTLQTPMAAELPSQCWGISKDKEALAKALLEWSTSLYRPGLAKIYVASRIL
                     QHWNTLGLDPTLAVLDFLSAGACQERKRKCALYHVVCELARSGIFSLPRYIQWLIPLG
                     GIRNPEDVLPDGPGPTRLLAEIPPHALSASQRNLRSGMLRRASFSVADEAQDTELAIR
                     HLKHTLGLAVDPADPILQRVPLSIAKLCKKIKSASRALKAEVGSWLCSSFAAHADARA
                     EEGAPQVPDISPAIFYAVRSVLEAAEDFSMLGDILKTLTKHSGVEILAAVADTVSRHF
                     FIFSALGDSVPLFRNLHERLTTAVREGGMAVRPLLASLVTLAPRIPGMEELASQLRRD
                     LALSDRQNPVDACSPVSDNMVSRLQDDAGELHEEIEKLLAAGSSLDRNTMERLFQTIT
                     QRLQACWGKAQDRQRAYSSLLGRLRVFDSQHFDGLMVKWLLYLRTLSSRPSILQIFPL
                     LVSVGCLDLGAILATAADFPTGQGAGGARAAATGAGAPQVVQLTYRSRYMQEVLQLLT
                     APLPQNDLMTVDEVYRFAILQDQAIRECPKEVLGLILLASAEYSYAKAQNDFEALPLD
                     SPSVVENLVELLKRLVLRDATGVARALGARSQNPHVSGWIDAVTTKLLIPAADTPAPV
                     TFDQVLELTNEFTLPFCQVKLALSLSSGEQNTQEAADRQQSHVELFANAMDKAITAGN
                     ISWVGMLSCLSPDITQHLKLRAQNRFLELLPSLRSMPNTDAAALAQDLQMAENLLSVI
                     DAVVRGSAARQTSLPPSIVDKLVDLWEILAAPDDRDPGTPDPALAAAKSTVLTSWLPL
                     TLNLITLHAQAQAQAQAQTQAPPENSSKPAAGNSSDVRPKILVACAGIMQELDALVLV
                     SAPTPAAAGAAAPADPPPSAGAAPAAAAAAAALARRVFDLSCLLVDTLSEDARAMCVR
                     AMRDGAAADARLRYIFSIGAASGEGGGDGVVGGAGGGAGTLWLSQREKVSSSSANVNA
                     NASASVAAAAGAGAAGGGSARSGTTTTNTGVPTNTTTPTTTTPTTTTPTTTTTTTPAT
                     NPSNTLFSGLLGTPASLWGLDRGQAGERLSVFQYRRWETLSEPTPNVGENDTALSLSL
                     FEARRVQ"
     gene            1543245..1544307
                     /locus_tag="THITE_2112057"
                     /db_xref="GeneID:11514732"
     mRNA            join(1543245..1543423,1543510..1543621,1543766..1543863,
                     1543927..1544307)
                     /locus_tag="THITE_2112057"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651532.1"
                     /db_xref="GeneID:11514732"
     CDS             join(1543381..1543423,1543510..1543621,1543766..1543863,
                     1543927..1544027)
                     /locus_tag="THITE_2112057"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651580.1"
                     /db_xref="GeneID:11514732"
                     /db_xref="JGIDB:Thite2_2112057"
                     /translation="MESKKEKDMRQPDLIIPYQEPAPKGDNAEFSSTLSSTLPMAAIF
                     LRNRYVGWAAVVFSIQSWLGESEETRKSPSAPGYFSVGMSLMSLIVTYLPIFLPPQPG
                     LQQGSATGAAAPAAS"
     gene            complement(1544429..>1547622)
                     /locus_tag="THITE_2149810"
                     /db_xref="GeneID:11514733"
     mRNA            complement(join(1544429..1544781,1544858..1545034,
                     1545163..1545221,1546206..1546999,1547380..1547446,
                     1547602..>1547622))
                     /locus_tag="THITE_2149810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651533.1"
                     /db_xref="GeneID:11514733"
     CDS             complement(join(1544763..1544781,1544858..1545034,
                     1545163..1545221,1546206..1546999,1547380..1547446,
                     1547602..1547622))
                     /locus_tag="THITE_2149810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651581.1"
                     /db_xref="GeneID:11514733"
                     /db_xref="JGIDB:Thite2_2149810"
                     /translation="MRPARSARALQGSSQPAWRTERSELSPGFGAGGRPLDYKELLYE
                     FQNHVNKQRDTPTALVSVSNRIVDTVQRALKKHEEEDESPADIWIVFIEVPAGGGSAP
                     ARFHAARHLAEQIGHRNPALFHHETVFEWAIPEHYEVHRVSLQTLLSRGLDRELGTQA
                     SFPTTRELRCSLAAGFERRDPWELGLDLGFFAKCFGARAPLKWIAIRLYCDCVAARFD
                     EHTLTFDLEYAHGLRETVDATFFRAVDDGLDTAVFDWWLTDSEFLDDYEEFKSWQTHM
                     LEGDTVSQRDIEAVEQEAVLDRRYLSRLKAAHSLLLRRHSQVKQKVMKPAALAAAALS
                     LCVSLASAGVVITPIKPDQVVPKSGGDCFFGVTTPQGCGPLRSN"
     gene            complement(1548178..1549861)
                     /locus_tag="THITE_2112060"
                     /db_xref="GeneID:11514734"
     mRNA            complement(join(1548178..1548451,1548564..1549275,
                     1549407..1549506,1549563..1549861))
                     /locus_tag="THITE_2112060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651534.1"
                     /db_xref="GeneID:11514734"
     CDS             complement(join(1548190..1548451,1548564..1549275,
                     1549407..1549455))
                     /locus_tag="THITE_2112060"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651582.1"
                     /db_xref="GeneID:11514734"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="JGIDB:Thite2_2112060"
                     /translation="MKFLMIWLLGDLANLSGALFTSLAPSTIALASYFCVADLILISQ
                     CTYYNTINARRREHHRRHHHHHHHDRRPSTATVDSDLAATTSTAATAAPPTETDALLP
                     KHNYDDDEHPDHRHYHHHQHHHHNGAHRPRRDSSPGGGLPGSHRRHELRRRESTGLVD
                     PLTRIITGEDDTPDSNPWLHNAVSLLAVWAVGAAGWFVSNKMGVWGLGGDGGGPGGGA
                     SPVPGGGDGGDGEMMKEPVAVVGMVLGYASALCYLCARIPQIIKNYREKSCEGLALLF
                     FLLSLTGNFTYGASVMAYCQDRDYFVRALPWLLGSLGTMVEDCIIFVQFRIYSPKRQP
                     KAAASA"
     gene            1550529..1551983
                     /locus_tag="THITE_2112061"
                     /db_xref="GeneID:11514735"
     mRNA            join(1550529..1550851,1550925..1551611,1551761..1551983)
                     /locus_tag="THITE_2112061"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651535.1"
                     /db_xref="GeneID:11514735"
     CDS             join(1550791..1550851,1550925..1551611,1551761..1551933)
                     /locus_tag="THITE_2112061"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651583.1"
                     /db_xref="GeneID:11514735"
                     /db_xref="InterPro:IPR003154"
                     /db_xref="JGIDB:Thite2_2112061"
                     /translation="MKLSSLAVGASAVPAALAWGGFGHISVAYLASNFVSPATTSYFQ
                     ALLGNDTGDYLAGVATWADSVRYTKWGRFSADFHFIDAKDDPPSYCGVDFDRDCKKDR
                     GCVVSALYNYTTRLLATDNDAAGGELPASERAIAAKFVVHFVGDIHQPLHTENVARGG
                     NGIPVTFGGARFNLHHVWDTSIVEKLVGAAAHRRPYEAAKRWADELTEEINGGKYSQD
                     RIDWLRSANLSDPIATAIEWATESNAFVCTTVMPNGPEAIKGQELGSDYYEAAAPVVE
                     LQIARAGYRLAAWLDLIVSSINSQSSPGDL"
     gene            1555526..1557567
                     /locus_tag="THITE_2112063"
                     /db_xref="GeneID:11514736"
     mRNA            join(1555526..1556004,1556061..1556146,1556202..1557567)
                     /locus_tag="THITE_2112063"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651536.1"
                     /db_xref="GeneID:11514736"
     CDS             join(1555691..1556004,1556061..1556146,1556202..1557556)
                     /locus_tag="THITE_2112063"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651584.1"
                     /db_xref="GeneID:11514736"
                     /db_xref="JGIDB:Thite2_2112063"
                     /translation="MLMKTAVTALLALALAAEAASVHQYRSPLALERRQNRGGNRGGN
                     NKGNNNNANNNANNNNNGNNNGNNNNAASVTCLAPNALQTASESTGQNSAVAADGQVN
                     SATDPANFINFCAGQTLTNGLQNRDGSCNGIVMGKIPAANKMVSTVILNPKNNDNLQA
                     LTSFNVTLNVANMQLGSFTNATSTYYAAPQDLSGNGQIIGHTHVTIQDTGNTLNPTQP
                     LDATQFAFFKGINDAGNGQGLVTTEVTGGLPKGCYRVCTMSSASNHQPVLMPVAQRGA
                     QDDCRYFSVGGACGNGGNNANNNNAGNNANNNNAGNNANNNAGNNANNNAGNNANKGG
                     NNANNNNAGNNANNNNAGNNANNNNAGNNANNNAGNNANKGGNNAKGGNNAGNNAGNN
                     AGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAGNNAG
                     NNAGNNAGNNAGNNAANNAGNNAASNAGNNTANNAGNNANNNAGNNRGAKAVDNGAAA
                     SNIGGIAAPAVQSTGDSARPFSVNGDTFATKAAAVQRACAIQNNACANAVNSGQVQGS
                     SVADCNQQEAACRAAGGA"
     gene            <1559920..>1560762
                     /locus_tag="THITE_34314"
                     /db_xref="GeneID:11514737"
     mRNA            join(<1559920..1560385,1560458..1560542,1560711..>1560762)
                     /locus_tag="THITE_34314"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651537.1"
                     /db_xref="GeneID:11514737"
     CDS             join(1559920..1560385,1560458..1560542,1560711..1560762)
                     /locus_tag="THITE_34314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651585.1"
                     /db_xref="GeneID:11514737"
                     /db_xref="JGIDB:Thite2_34314"
                     /translation="MTAPTPTTQQARAAQASHPAQPPPPLPNPDRNHNQNQDDRTPAL
                     TALTTQIQTRLLTVYRDLRQLPTLAHPEIILHPADRDLVRPPRPPLRGLAAAQRHEEA
                     LVAAARGTLVMDVSSVTVGEGGVFACVMGVLRAGGDWNGDGNGSKGDGDGDGDARPKP
                     RGKIAVPFCGLWRFDGEGRAVEHWENAADPEALAQWLRGE"
     gene            complement(<1561361..>1564506)
                     /locus_tag="THITE_38081"
                     /db_xref="GeneID:11514738"
     mRNA            complement(join(<1561361..1561506,1561597..1562316,
                     1563051..1564166,1564236..>1564506))
                     /locus_tag="THITE_38081"
                     /product="uncharacterized protein"
                     /note="Has EST support"
                     /transcript_id="XM_003651538.1"
                     /db_xref="GeneID:11514738"
     CDS             complement(join(1561361..1561506,1561597..1562316,
                     1563051..1564166,1564236..1564506))
                     /locus_tag="THITE_38081"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651586.1"
                     /db_xref="GeneID:11514738"
                     /db_xref="JGIDB:Thite2_38081"
                     /translation="MVVSSMQPHTHPQQGPLPPHLQHSRPSSIVHQQHHSQTPAQQQQ
                     QQAQHSGAYSYPQQSQASNSQDHTLPYYAHPSPYSTPGATSGYTTADTGDMMAATMPR
                     PYPPISYHTPQSNSPASVASPSGHDQQRSMYAQPPSQLHQQQMYYGAPQQQYSSMPAQ
                     AAQSPYAQHAQQPHQPMASQPSMMMSHTPPQHPISQHPSQHSQAGMTVSPRPDKIETH
                     SLGHRISGPSAPVAMGGASSASPQNGAPLSTPTTTGSGVNANAAPGPIPATTPLVVRQ
                     DTNGVQWIAFEYSRDRVKMEYTIRCDVESVNQDELTPEFKSENCVYPRACCPKEQYRG
                     NRLQYETECNTVGWALAQLNPPLRGKRGLIQRAVDSWRNSNQDPRLRSRRVRRMAKMN
                     YRNGKAGSTTPHATHIPAPGAPGSTGMTTPTPMGPGSTPAMGKPGLPMAQQMHHHHGG
                     QQDGSAQGGDEVGEGNYGDNQSHHHHHHQPPVQPGSDERPAHVFTGYDAYHGAPHASS
                     SMSMHDSLGDASHGAAGPLAAHRSTSSRGAHDGPDDLFPDIPEAKKRKFILVEDSDRN
                     SRLRVRVTLDGVDTHEIPDSFRKSSSVYPRSYFPREMQSPPPSATGSSFFTDDLTDTE
                     DDGTTDTEGRRPGRAGRSARARTMVKVPLAEGREGEVAIPRMRKMFRGKEVRLNDLGY
                     RMAWLQSRVFAGRTVFLQRALDCYRNKTRNAMESMMQDVKTAAPHYETRVGKRKWNER
                     MRAGEKEDES"
     gene            complement(1577919..1581428)
                     /locus_tag="THITE_2112073"
                     /db_xref="GeneID:11514739"
     mRNA            complement(1577919..1581428)
                     /locus_tag="THITE_2112073"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651539.1"
                     /db_xref="GeneID:11514739"
     CDS             complement(1578379..1581192)
                     /locus_tag="THITE_2112073"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651587.1"
                     /db_xref="GeneID:11514739"
                     /db_xref="JGIDB:Thite2_2112073"
                     /translation="MADPARYRYADSAERRSPPLYNPARASMPITSAGYSSLYSGDLH
                     AMSASHHGGLVSRPVDEYRTSTIPVSANTYAVRKEPLSRSTSVNESTRVHRLTDPEGK
                     RPIIVTTKHHPSAPRSGSPSRDPYWSKDEGQYYAQPASSIPRSRAGDHAHSAAAMDEE
                     EYQRLKDRTHQDRLGHRTGEPYRTSRPGPLYAGSDHRTSTLDFDEGYEYTKPSDLVRY
                     DLDHDLHRRRIRRESLDRYYRPTVSISTDLTRPFDQPDRRARGPPPPTTWGLDKINRS
                     AAGGIYDGAGARMPLPPSATLPPDTRRLEIPGSPREEPRGFRPLSMVQDEPGRRGHYG
                     DYYYDDILPPRDIRERELEYFQDDGVVARGFGIRVDSNDLEGRRRLPERLYLDERRER
                     REPQKRYEVREPRKRPDGDLEIVHHEFEDRDRRRHHEHDHAVASEAGRDRKDKRSDDD
                     EPDSKKDSLRDKAAAGLRLAAATVGIGSALKDKNDKPNKEPSPTRRHPEEDVDSRKPD
                     DGDSREKSSRKPDDSDSREKSSRKEPLLGDEDFEIVEYPRDREEPRSGTATEPEAPGP
                     KKSGDAGVSSRDHSSSNDEGKTKSRRRPRHSVFNPNDTAALAEMKARLAELKTDNAAR
                     KSEKPERTVADDKETSPATKEPPPEDKTSSTEKREPDPDAAALVPTDGDDKSRDERQA
                     RVVPPPKETAQEKKPLKGILKPPRAHFPEEPNPVREGVAPHKDDKSKANVPPGARWTK
                     ISRKMVNPEALTIGKERFEVRDDFVIVLRVLSREEIQAYAEATATLRRMSHLPPPPPF
                     AVLRKLEGRRGRLLTNVPFRREQSGEGGSSSAKCGKRRSVTMTVTVSETETETATEAV
                     NENGTVGVTGMASTTRTTTTRRGATASTDAKGMTMSGGSATAKRTGIDDPTGASPMRR
                     RRMRVGRGMGRGRGMMGIIARIE"
     gene            complement(1582302..1583837)
                     /locus_tag="THITE_2112074"
                     /db_xref="GeneID:11514740"
     mRNA            complement(1582302..1583837)
                     /locus_tag="THITE_2112074"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651540.1"
                     /db_xref="GeneID:11514740"
     CDS             complement(1582426..1583613)
                     /locus_tag="THITE_2112074"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651588.1"
                     /db_xref="GeneID:11514740"
                     /db_xref="JGIDB:Thite2_2112074"
                     /translation="MTSLPTVNAGRILAKPMRSRVHIHYDNDDDCVVFIRCNGRGFHI
                     ELSPFFLCNSPLITSRYHKFTAAVRGRSDMDAEEEGHSDDEDPEEIEARFYDWLIAVF
                     EPVFAKVAPDIPPAFNPDLIRTGEAKPLLSDYLFPEIHRCRLESEDDKPFPVHMPDEE
                     SQFSEPLCHIPPDLAKELEKHVKFFDPSAVEVSFRRPKQALDDQPTRVLVDLYGSGEK
                     TTCFFKGFGAGEFIPLENELETHLRLLKSNVVPEARVVRLLGVVAAEDDGRVAGLLLT
                     YVDCRSENDGVLDGIFLRRTPIPLRERWVSQIKEAVQQLHEGGVVWGGAKADNVLIDK
                     KNDAWLIGLGYGYTEDWADSEKAGTKEGDLQGVERIVVYLFSEGYESASSEDELDFDS
                     SSE"
     gene            1587885..1589261
                     /locus_tag="THITE_2112076"
                     /db_xref="GeneID:11514741"
     mRNA            1587885..1589261
                     /locus_tag="THITE_2112076"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651541.1"
                     /db_xref="GeneID:11514741"
     CDS             1587932..1588918
                     /locus_tag="THITE_2112076"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651589.1"
                     /db_xref="GeneID:11514741"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="JGIDB:Thite2_2112076"
                     /translation="MNTEPSAEDERPQILRDTLQQISSTAAGADTKCCVICLGDLVEQ
                     CEARPCRHDNFDYLCLVTWLEARPTCPLCKSDVSEVRYDLGDDGNHRKIYHVPERPAD
                     CAVESGRLAASPSGVRHSSRAGLPPRRRPREDEAIRRRRLVYRYQLYSLHVGSNNRQP
                     ANWRYKVLSPQLFVTDPELVSRARMWLRRELRVFRFLYTEDTDDLPPDHGLVRRCRPC
                     KAEFLLEYIIAILKSMDMQGSAGQAEELIQEFLGRDNARLLLHELRAWLRSPCKSLSE
                     WDRVVQYRGGDILRPVSQERSEAVSSDGAHSERPTTFDLYPRVNHPTPRWDE"
     gene            complement(<1591408..>1594424)
                     /locus_tag="THITE_2086740"
                     /db_xref="GeneID:11514742"
     mRNA            complement(join(<1591408..1591988,1592069..1592460,
                     1592698..1592993,1594305..>1594424))
                     /locus_tag="THITE_2086740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651542.1"
                     /db_xref="GeneID:11514742"
     CDS             complement(join(1591408..1591988,1592069..1592460,
                     1592698..1592993,1594305..1594424))
                     /locus_tag="THITE_2086740"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651590.1"
                     /db_xref="GeneID:11514742"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="JGIDB:Thite2_2086740"
                     /translation="MSHVFEDLAGAGDLTSSAEDQRWETLAVAMTTGNGVGCAEVANL
                     DFEARVPVPFSVFPSSYRESETATQTTTHEEVEIKLPQHAGREGQHSSSFQAQAHLPP
                     RGEGRFREEEVRITREEEEYRRPGIRDEYVERDDYRRPKSTYSETRIEVDTTHRAHNT
                     AIDVAESEYRSRFQPNYRKEFSVTGSTVDGPGYNPTHKTSTHVDEYTVDGPRSRPVYK
                     ESVEVTGTTVDPPAPRSTYHEKVDIVEETVEVPRYPKAQPKKSKMGYYDEDGHYHSFR
                     RGLHKLADRIAHPEAHERIEVDEVREVRRPRGSSEAPAAPNTVTIPCHHIRLGDILIL
                     QGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQY
                     RVLDMQDGTIVAMTETGDVKQNLPVIDQSNLWGRLQKAFESGRGSVRVLVVSDHGREM
                     AVDMKVVHGSRL"
     gene            <1595474..>1598830
                     /locus_tag="THITE_2086741"
                     /db_xref="GeneID:11514743"
     mRNA            join(<1595474..1595506,1595579..>1598830)
                     /locus_tag="THITE_2086741"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651543.1"
                     /db_xref="GeneID:11514743"
     CDS             join(1595474..1595506,1595579..1598830)
                     /locus_tag="THITE_2086741"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651591.1"
                     /db_xref="GeneID:11514743"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="JGIDB:Thite2_2086741"
                     /translation="MKQRFSSLDVRVIAHELAEALVSLRLSNIYDLNSKLLLLKFAKP
                     DNRQQLLIESGFRCHLTDFARAAAPAPSQFVSRLRKFLKTRRVTGVSQIGTDRIIEFQ
                     FSNGAYRLYLEFFASGNVILTDADLKILALLRNVPQGEGQEPQRVGLTYTLENRQNFG
                     GVPALTKERLRGALKTASEQAATKKAKRKGSDELRRGLATTITELPPVLVDHVFRLTS
                     FDPTTKPADILENEALLDALFQSLEKARSILDEVTSSPSARGYIIAKRNPRAADQVAD
                     GEETTKEKAQNLLYEDFQPFLPKQFEDDPTCQVLSFDGFSKTVDEFFSSLEGQKLESR
                     LQEREATAKRKLEAARRDQAQRIEGLQEAQLLNLRKAAAIEANVERVQEAMDAVNGLL
                     QQGMDWVDINKLVEREQRLHNPVAEIIKLPMRLEESIITLLLGEEEEEAEAEANMDFD
                     YDTDEEAAEETAAGKAKGPDKRLAIDINLKLSPWNNAREYYEQKRTAADKQQKTIQQS
                     EIALRNAEKKISEDLKKGLKQEKPVLQLIRKQMWFEKFLWFISSDGYLVLGGRDAQQN
                     EILYKRYLRKGDVYVHADMHGAPSVIIKNNPKTPDAPIPPSTLAQAGSLSVCCSSAWD
                     SKAVMGAWWVNADQVSKSAPTGEYLPAGSFMVRGKRNALPPALLTLGFGLMFKISEDS
                     KSKHVKHRLYDSADVSTTGAASVSTPTEAKDDTTSRLESLAESSDEEEVEDDREARVN
                     PLQSSAAEQEEASGPISESDVTPPREELASLEATAERPTTAEPQEEPSPPGTEDAEAE
                     EEADASPAPSLPTTTPSTRPETPSTTSQPQKSQQQKKQQPPKRGQRSKAKKIATKYKY
                     QDEEDRALMEELLGVAAARQKAEAEAAARAKREAEAAAALERRRQAQERAKQQIAAHE
                     EARRRAMLEGEDVLDDDDDPAAGAGAGAGAGAGALGPLDALVGAPLPGDEILEVVPVC
                     APWNALGRVKYKAKLQPGHVKKGKAVKEIVERWRLAAGKKGVVDERAQDVEKMWPREV
                     ELIKGLKVEEAFNVVPVSKVTVMMSGGTAGGGGSGGKGGGKGGSGGGGGGGGQKGGKG
                     KAGKKK"
     gene            complement(1599638..1601669)
                     /locus_tag="THITE_68454"
                     /db_xref="GeneID:11514744"
     mRNA            complement(join(1599638..1600479,1600561..1601277,
                     1601350..1601406,1601460..1601669))
                     /locus_tag="THITE_68454"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651544.1"
                     /db_xref="GeneID:11514744"
     CDS             complement(join(1599862..1600479,1600561..1601277,
                     1601350..1601406,1601460..1601543))
                     /locus_tag="THITE_68454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651592.1"
                     /db_xref="GeneID:11514744"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="JGIDB:Thite2_68454"
                     /translation="MADAALKPDRDFSSEVDKQIPEAEKLAKTDIHAAIEKLSVLEKQ
                     TRQASDLASTSRILVCIVTICKNAGDWSLLNDQTLVLSKKHSQLKQAITKMVQTVMSF
                     LDETPNLETKLSVIETLRTVTEGKIFVEVERARVTKILSDIKKKQGDLKGAADTLCEL
                     QVETFGSMNRREKVEFILAQVELCIENGDWTQAAILSRKISTRYLARKPKKTPEQLEK
                     EKKEREKKVKADEEEPEEDEDVTELKLRYYKQQIQLAQHDAKYLDVCKHYRQVLDTES
                     VEEDPDQLRYVLQRIIFFIILAPHDNEQHDLLHRIHKDARISLVPEEAELLKLFTVHE
                     LMRWPEVARVFGPHLLSTDVFDSAPGQSSDEQAFSRWQDLRKRVIEHNVRVVAKYYTR
                     IRMGRLTQLLDLTEDETEKYISELVTAKTVYAKIDRPARIVSFAKPRDADDILNEWSF
                     NMRSLLGLLERIDHLITKEEMMARIQTGAKSKKGKESKRAR"
     gene            1603064..1605361
                     /locus_tag="THITE_2112085"
                     /db_xref="GeneID:11514745"
     mRNA            join(1603064..1604101,1604162..1604292,1604347..1604449,
                     1604581..1604676,1604732..1605361)
                     /locus_tag="THITE_2112085"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651545.1"
                     /db_xref="GeneID:11514745"
     CDS             join(1603395..1604101,1604162..1604292,1604347..1604449,
                     1604581..1604676,1604732..1605194)
                     /locus_tag="THITE_2112085"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651593.1"
                     /db_xref="GeneID:11514745"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="JGIDB:Thite2_2112085"
                     /translation="MERLQTGPALSAVPVSESKSKKRSRAETDASPTETSAPATLLAA
                     KPADPRPGTDQVPRAAAKNIGDSSRSPSLDPPASAAARPAVALSTNLRANASASTPTF
                     SLAESSSLSETLSSTASLPSLSLSAGARGGSPSPPYMFSGSSRPPDSPIEPADDVEGS
                     TDRDELEEQAAVAQAEEGSIVVDSDDLGTDDGYGTDNNTTASTSLAESVRDYVYENGR
                     RYHRFREGRYNFPNDDVEQQREDMKHSMVKMLCGQLYFAPIGEHPHEILDIGTGTGIW
                     AIEMGDLFPGANILGVDLSPIQPEWVPPNVRFMVDDIEWLHPRNYFDYIHSRHTVMAI
                     KDWPKLMRRALEHLRPGGWFEMQEVYHYPISANNSMPADHPVAQYWTLINEGLTNLGV
                     NFHAVAGGRLADMMRDCGFVNVTERVLQIPLGTWPKNKVLKTVGLYWRTILIDGIQAI
                     ALGPLTRGCGWSREQVELFLVDVRKAYHDNSMLAYMPLHLVYGQKPAAY"
     gene            <1606759..>1607055
                     /locus_tag="THITE_2086744"
                     /db_xref="GeneID:11514746"
     mRNA            join(<1606759..1606767,1606831..>1607055)
                     /locus_tag="THITE_2086744"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651546.1"
                     /db_xref="GeneID:11514746"
     CDS             join(1606759..1606767,1606831..1607055)
                     /locus_tag="THITE_2086744"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651594.1"
                     /db_xref="GeneID:11514746"
                     /db_xref="JGIDB:Thite2_2086744"
                     /translation="MPRGRIAHRISQSLAQRPAQRIASRVASRIAQILACRLACRIAS
                     RDFCGDMPNRERGDARCKILVGAHGLPLAGICF"
     gene            1608146..1610370
                     /locus_tag="THITE_2112095"
                     /db_xref="GeneID:11514747"
     mRNA            join(1608146..1608187,1608250..1608326,1608575..1609045,
                     1609105..1609150,1609201..1609884,1609990..1610370)
                     /locus_tag="THITE_2112095"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651547.1"
                     /db_xref="GeneID:11514747"
     CDS             join(1608629..1609045,1609105..1609150,1609201..1609884,
                     1609990..1610297)
                     /locus_tag="THITE_2112095"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651595.1"
                     /db_xref="GeneID:11514747"
                     /db_xref="InterPro:IPR001077"
                     /db_xref="JGIDB:Thite2_2112095"
                     /translation="MAKLRLSSLFHSSPVSSTDAETKKQNRRSISALSASLRHKDVET
                     NGTSKVAKPETSSEPSDTSRMAALAQKISKETEKLEAYMKANGLPMPSFDVDAPADFP
                     HLPDDIQQSRQEIIYATKELNRLAHGPRESVRWGVWEFLDVLALTAVNHYGLAKLVPV
                     DSTITLDELQTKTSLDPINLARLLRMAMTNGIFREPSPGVIAHTAASRVLAEDENMQA
                     WIGFNGEDIFPAAGHVLQALKAYPEATSLTRAGFQFAFNTVDQEPMFATFGKDPDRAR
                     RMGRAMASLTGGEGYEPSYFVDVEKGGYDFSDIDAVGGTFVDIGGSHGFICVELANRY
                     KNMKFVVQDLQKTVDSAPNPISPDPQVAERITLLAHDFFTEQVTKDADVYFFRWIMHN
                     YSTPYAVRILRNLVPALKPGARVIINDHCLREPGRENPWDERVMRRMDVVMLALLNAQ
                     ERTEAEFRALFAAAADGFVFKVSLRCALVAFNFY"
     gene            <1612996..>1613612
                     /locus_tag="THITE_2086746"
                     /db_xref="GeneID:11514748"
     mRNA            join(<1612996..1613059,1613089..>1613612)
                     /locus_tag="THITE_2086746"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651548.1"
                     /db_xref="GeneID:11514748"
     CDS             join(1612996..1613059,1613089..1613612)
                     /locus_tag="THITE_2086746"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651596.1"
                     /db_xref="GeneID:11514748"
                     /db_xref="JGIDB:Thite2_2086746"
                     /translation="MVAPSDSVDDAVASGFALVWFSLGLLLGFTAIYGIGVGLSFATC
                     TMIAAVEAQNDDLAAAQGTMAQARVFGGAPGLAVCTIVFNIKLQNSLGPDSKSNLGHQ
                     ELDQIHRNLITGLALSDDFRQDVIRIYLGAFGDQSLVILAVAVVALLMSLGTYKSVPS
                     HVVDVMVQHKELAGRPSGRGDVELSSVSSVRSLVR"
     gene            complement(<1615680..>1617149)
                     /locus_tag="THITE_2048148"
                     /db_xref="GeneID:11514749"
     mRNA            complement(join(<1615680..1616300,1616370..>1617149))
                     /locus_tag="THITE_2048148"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651549.1"
                     /db_xref="GeneID:11514749"
     CDS             complement(join(<1615680..1616300,1616370..1617149))
                     /locus_tag="THITE_2048148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651597.1"
                     /db_xref="GeneID:11514749"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2048148"
                     /translation="MPHPLALFSLRPLNERAQQVVAHPCNSHLVSFSNHHQVWVLDVG
                     HVRSASGDVSTLATLGRGGDILVDGSNISKIQCSFEIDRETNVVMFYDRSHSQTSQVF
                     GENAAPFVYHRPRKVVVQEGLNTIIGMGGVNSNLVMFKLDWHCTAKEMPLKVKERQSR
                     PAGLQDNPRLAQTLVVPNTLAPSRMKTRIHTPGPRRLGIEWRQIGDPIGKGHFATVYK
                     ALDVYTGKIMAVKVMPLPESRGGYDRWTDLKDEIEILSSISHSHVVEYISSQGWGCGV
                     AEIFMELKEGTLRSLVCGGCSVSLRDLATTAFHHMLQALDFLSTRGIIHRDLKPENIL
                     YTTRQDGFHFQLGDFGNSNREKHEDKFAGTAIFMSPEIYYEFPWQTPKADVWSLFATL
                     LWTLDTGGFRRLEAGYRDYDDIQSTVQSLAEAPEMAPTREMARSSAQTRASAAQMLVR
                     LFDGKGLTTPRSQVHPL"
     gene            <1618007..>1618294
                     /locus_tag="THITE_2047963"
                     /db_xref="GeneID:11514750"
     mRNA            <1618007..>1618294
                     /locus_tag="THITE_2047963"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651550.1"
                     /db_xref="GeneID:11514750"
     CDS             1618007..>1618294
                     /locus_tag="THITE_2047963"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651598.1"
                     /db_xref="GeneID:11514750"
                     /db_xref="JGIDB:Thite2_2047963"
                     /translation="MDDSLRGSGLFKADQALAALVNDPERLERERARFDRSPPAYRSE
                     PSGTTTRSQSTNPRSEAQLLRDERKWQLRLEHEASLPCCQFRDQYLEELDRL"
     gene            <1620887..>1621669
                     /locus_tag="THITE_26762"
                     /db_xref="GeneID:11514751"
     mRNA            join(<1620887..1621037,1621179..>1621669)
                     /locus_tag="THITE_26762"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651551.1"
                     /db_xref="GeneID:11514751"
     CDS             join(<1620887..1621037,1621179..>1621669)
                     /locus_tag="THITE_26762"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651599.1"
                     /db_xref="GeneID:11514751"
                     /db_xref="JGIDB:Thite2_26762"
                     /translation="AATALSLPGARGPPLPTPSHGPGGTFSITCAARIAATPDACLDV
                     IVSASEYPKWNRFIRKCVIDSAAADSAKLRLHTPFTFHVWLDPSAPDGAPASATSALE
                     VSALERIDDDGAASPPPGFPSLPRARAPLAETRRGWRIAWRPRSSWRNAPLWLLRSER
                     VQELVEVDGGRATQYYCWETFYGPLAPLVRRLTGRQVERGFDAWMEGLRGMVEG"
     gene            complement(<1621944..>1622484)
                     /locus_tag="THITE_2086750"
                     /db_xref="GeneID:11514752"
     mRNA            complement(join(<1621944..1622145,1622260..1622282,
                     1622377..>1622484))
                     /locus_tag="THITE_2086750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651552.1"
                     /db_xref="GeneID:11514752"
     CDS             complement(join(1621944..1622145,1622260..1622282,
                     1622377..1622484))
                     /locus_tag="THITE_2086750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651600.1"
                     /db_xref="GeneID:11514752"
                     /db_xref="InterPro:IPR013097"
                     /db_xref="JGIDB:Thite2_2086750"
                     /translation="MTSTTVRRITLFKVPDEDKQLKLVKAYRTMKKELLEEKKRSILL
                     LDVAKATDDPRSKGYTVAAIMSFGSRADMEEYEECPAHKALQEVAKGLVAEPPLVVVL
                     EGETDVTN"
     gene            1623464..1623904
                     /locus_tag="THITE_2112102"
                     /db_xref="GeneID:11514753"
     mRNA            1623464..1623904
                     /locus_tag="THITE_2112102"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651553.1"
                     /db_xref="GeneID:11514753"
     CDS             1623637..1623867
                     /locus_tag="THITE_2112102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651601.1"
                     /db_xref="GeneID:11514753"
                     /db_xref="JGIDB:Thite2_2112102"
                     /translation="MPYTSPPTPQVMPSAQCPESSAQCANECNAMRPPEPPFQNTADA
                     NASPEPPSMGQPQPSRPFDLSPTSAWSGRQAP"
     gene            complement(<1623942..>1628708)
                     /locus_tag="THITE_2076488"
                     /db_xref="GeneID:11514754"
     mRNA            complement(join(<1623942..1624517,1624623..1626287,
                     1626411..1627188,1627279..1627999,1628060..>1628708))
                     /locus_tag="THITE_2076488"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651554.1"
                     /db_xref="GeneID:11514754"
     CDS             complement(join(1623942..1624517,1624623..1626287,
                     1626411..1627188,1627279..1627999,1628060..1628708))
                     /locus_tag="THITE_2076488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651602.1"
                     /db_xref="GeneID:11514754"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="JGIDB:Thite2_2076488"
                     /translation="MHPSILDTSIIDLLEADPRPSLIVALAPHSPTVVYTNPAFARYP
                     ALLDLIASHGDDCRPLWEWITASSGSPGPEATERGGRSACSFSYSDIYWTKSVVHEQM
                     VVIGANEQIPLSQPPSQPPYKVRLGAADPQPSNGSTPRRIMPVEVDSAAAPVENQALS
                     LPLSDPDRRVRFGPALAPGSSPTSNPKERPPSRAGAVQSLGRSISDPGWILPDTTPEQ
                     RPFLDHINSVDWAATPLGPMRGWLPKLEETVNQILVDSRPIAIYWGPSYITIYNEAFS
                     KLCGSKHPVMLGMPVQEAWAEAGQRLRDTMRAISPNQKGPVEDEWRFFVEREPEVEGG
                     PPLLEETYLKWSIIPIVEDNVCLGFMQPVAETTSLRLWERRMKMLIDLGEVLVTARDV
                     HSYWGMAIQQLGTVEPRYDIPLAIMYSVEDDPDATASPSSSGGPAKICRLQGTLGVPE
                     NHPIAPDDGTWPPSLLEGLQWRGFEGDRCRAAVICPIRPTKEEDAMGLLLLGLNPRRP
                     YDNDYRQYIALLSQKLATSLASVVLLEEEAKRGRNAAEQAAVDQAMLKEKLEVQTKEA
                     NESMQMFETVAEFVPVGMCFGDPEGNITYANDAWYRITGYPGAGRPIANQGFLACVLE
                     EDRPKFIAEYEKLKTTGNVEFEFRVKRQANAASPVLSGPLSRTSPSFEKAGFDLSSLE
                     NPKERHVLATARAEYANGSVIRVLTCLTDVTAHRRAAEEAVRRAQQAENLKRMAEFAT
                     VGMYDMDLDGRLIGANKVFFEMCGLEKVDPAEVDLRPFEICVCKEDLPLLTEKLEKMV
                     REDKVQNVEVRLNTTWTPEDGPGHKVVVPRWVQATLMPVRTTEGVVQSFTGCLSDVSL
                     QKWQLDWEKERKEEAIESKRQQENFIDMTSHEMRNPLSAIIHCADAITATLSRVQQLL
                     GGGVSYWADKRDAGSSSGANASQEWLAEARGLVENAIDTAETILGCAQHQKRIVDDIL
                     TMSKLDSSLLSITRVTVDPIKMVKEALKMFEVEARRVDINLSMVVDSSYHDLNIKFLD
                     FDPSRLKQVLINLLTNALKFTKTGPMRNVTVAVSASLVPPTEATSKVQFIPRSPESVE
                     QTIPSNRADTVFLLFEVEDTGEGLTEEEKKSLFQRFVQASSRTHVKYGGSGLGLFISR
                     RLTELQNGSIGVASQPGVGSTFAFYIEAYRPNEAAFREAEAAGASAQSALSMQRAGPS
                     LSRRGSHKTRAGSNSTLDNESGKGTTSAGSSSGASPIATAAVTPSSEINISLSPTLAP
                     PAPQIKGVLLRRTDRYRLPVPAPFASSSSSSQSSSTSSNPLSSTSSSSSSTTTQQPQQ
                     PQQEEDEKQHQHTAPFPLSMILMDIEMPIQDGLTCTRNIRELERAGRIAGGRIPIIAV
                     SANARMEQVREAKEAGCDDVLVKPYRMPELLERMRLVMSRVVVDAGLDGGEAGSVGEG
                     EGISDGEGEQKADGKGEEKGKGENGE"
     gene            complement(1629631..1630839)
                     /locus_tag="THITE_2112104"
                     /db_xref="GeneID:11514755"
     mRNA            complement(join(1629631..1630172,1630186..1630347,
                     1630366..1630447,1630478..1630613,1630752..1630753,
                     1630764..1630839))
                     /locus_tag="THITE_2112104"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651555.1"
                     /db_xref="GeneID:11514755"
     CDS             complement(join(1630221..1630347,1630366..1630447,
                     1630478..1630547))
                     /locus_tag="THITE_2112104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651603.1"
                     /db_xref="GeneID:11514755"
                     /db_xref="JGIDB:Thite2_2112104"
                     /translation="MMPRCQRCPQCQRYSHNTAVPAIPMMPRCQRYSHDAAVPAMPAV
                     PAIQPQYRDARDASDTHGASDTATMPRCPRCSQCQRYSHNTAVPAIQP"
     gene            complement(<1631544..>1631998)
                     /locus_tag="THITE_2112107"
                     /db_xref="GeneID:11517724"
     mRNA            complement(join(<1631544..1631736,1631832..>1631998))
                     /locus_tag="THITE_2112107"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651556.1"
                     /db_xref="GeneID:11517724"
     CDS             complement(join(1631544..1631736,1631832..>1631998))
                     /locus_tag="THITE_2112107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651604.1"
                     /db_xref="GeneID:11517724"
                     /db_xref="JGIDB:Thite2_2112107"
                     /translation="SWAPTAVPNRHADRYADRSSISRAQAAGPTAVPTAVPTAVPTAV
                     PTAVRYPGRRPRILGANCRTDRRSISCVPTAVPTAVQYPGCQPPYRPPFNILGADRRA
                     DRRSISWVPTAVPTAVR"
     gene            complement(<1634408..>1636140)
                     /locus_tag="THITE_2064866"
                     /db_xref="GeneID:11517725"
     mRNA            complement(join(<1634408..1635838,1635922..>1636140))
                     /locus_tag="THITE_2064866"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651557.1"
                     /db_xref="GeneID:11517725"
     CDS             complement(join(<1634408..1635838,1635922..1636140))
                     /locus_tag="THITE_2064866"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651605.1"
                     /db_xref="GeneID:11517725"
                     /db_xref="JGIDB:Thite2_2064866"
                     /translation="MAVPRAAWEGGAREFAMLQAAMSDAAIVCHAPPDFPFNAEILGV
                     CAVSTENADQNKYGWMVADFLHWKLLFHGTWLSTIDIPSFLASVDGVDMINDGTIDSI
                     VGAQKKDVISLPGSNHGFLTAFLDRLAEAARVACSRRTTLVLLVFSPITPEQDICVDL
                     GGEKTYLTSDQLRMTIDEAIPSDVQLPVILVTPSPFTGGWLCRPSFMGRPTCDSSHTM
                     MRIIAMACGGAFAERFISSFTERDSPLMTEAERAKVKYNDPMPLRPTAQQIDSLHRLH
                     RQIHESLEHRFSTSARDHAFILNTDAARDPSVFSDSWLAYAPRRGRGMTFWASRWRGL
                     RPVIDHTHRFECLGEAFGGTRDSQLFHLRYLAAIELDTCPGDWARQVNGATSELLKSL
                     AERLTLSEDDVMRVLDAIEFRSSSMALAQMVAKAFNLPVPDGESCRYWNDKIDGVDDD
                     YYKKLQAAFGEARDFFSQVALLPSEKRHEFKNVRFWRAARWLSAAVALHFKNGSVDDV
                     RKFVSKDVASLMAKVFETQKALLLNDQAVNRAGRNWIAALGL"
     gene            complement(1637499..1638019)
                     /locus_tag="THITE_2112109"
                     /db_xref="GeneID:11517726"
     mRNA            complement(1637499..1638019)
                     /locus_tag="THITE_2112109"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651558.1"
                     /db_xref="GeneID:11517726"
     CDS             complement(1637745..1637915)
                     /locus_tag="THITE_2112109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651606.1"
                     /db_xref="GeneID:11517726"
                     /db_xref="JGIDB:Thite2_2112109"
                     /translation="MMCLGMGWYLVLLLWVAGYSCLRVHLGLGVDRESGKSMLATWLA
                     GWMAGWNIPLRG"
     gene            complement(1638021..1641373)
                     /locus_tag="THITE_2112111"
                     /db_xref="GeneID:11517727"
     mRNA            complement(join(1638021..1639914,1639971..1640031,
                     1640089..1640297,1640368..1640973,1641089..1641373))
                     /locus_tag="THITE_2112111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651559.1"
                     /db_xref="GeneID:11517727"
     CDS             complement(join(1638053..1639914,1639971..1640031,
                     1640089..1640297,1640368..1640973,1641089..1641215))
                     /locus_tag="THITE_2112111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651607.1"
                     /db_xref="GeneID:11517727"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="JGIDB:Thite2_2112111"
                     /translation="MYPSGQRDRDSRGDYRSRSPHARRSDDHHSHHRDGDYRRSRKDS
                     PDPPRDLNYDDNDDGADDYRGHDRDHYRMPREGHYAGNKATSSRRNDGSGRHYVRDPG
                     PVPGLHRGVRPLSAPDASPPGQENGDRHGLDVFDTSTYAGRGDAHHGLDRGAAAASHA
                     GHPPLRDSGGNRSSGASHRGVGNYHDRHHFSRRRLEGSGRAVVLDGLPEDATERDVLY
                     GLDYVTRDRHFSSDLVRIARVRYDHDGRRIAFVEFHRRSDAEHFYDRYYPEISFPLEH
                     SRGLDSEPVTVGVSFPNNDETHSSRESRRDDDGWDCIQCGAMNYPHRAVCYKCKAERP
                     DDHDASGPFLTGETDECPQQTPSQYVVVRDLEGSVTEEVLAKGVMKLFVENPEPAKEA
                     PTTTNKLKSTAPTNSTAGLGAKPGSLRRVFLMRDRKTNESWRYGFAEFATVDDARAAV
                     AKFRASTKFTIASKPVVVAFIHTGVFVPAFDAPATENQEFSFTPIYNPAVRVKYWDER
                     AYPSAHVVSTDPLPGAPSPDKPVGDGEAAKPGAKPSKKAKSTKESATAPKIAMIPQMQ
                     LWAKASAELHGAQPAADENVPSVQEPDEVRPGAARPARAASREVEEAQEDGPVAAQWG
                     DQYLSYADWDALTCLACGWEAPSQAHIDERGWPQSRSDLLIEHEGRAHDFFRDDTEAK
                     SKAVAALTALGRDPRLVVRRTPRLKSDRLPVYKSYADFDRLRCVLCRRVFKHVRLLWL
                     HEQQSALHKRMLADPQNRARAAAEFKKAGAKMRVLEPDPAFRRRWEAQRARVVAQQGQ
                     PQAQLYRDRALERRKAFGQPKQPATTSTTTGAAATAAGTTTTTTTTAPAKRKDAPREE
                     AEAEKEQQQQRAAKKSKGADMLAKMGWTEGAGLGAEGAGRTEAIATEVYAPGVGLGAE
                     GGRLGDAAEEAARNTRGGFAAFVEKTRERARERFEKMAGS"
     gene            <1642045..>1642635
                     /locus_tag="THITE_34477"
                     /db_xref="GeneID:11517728"
     mRNA            join(<1642045..1642180,1642289..>1642635)
                     /locus_tag="THITE_34477"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651560.1"
                     /db_xref="GeneID:11517728"
     CDS             join(1642045..1642180,1642289..1642635)
                     /locus_tag="THITE_34477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651608.1"
                     /db_xref="GeneID:11517728"
                     /db_xref="InterPro:IPR003448"
                     /db_xref="JGIDB:Thite2_34477"
                     /translation="MATTDEDTFLEQEGCYVALTNSPLNLQSIVDRVRSPQAGAIVLF
                     AGTTRDSFDNKPVKELQYTAYRPLALRTMLSICAALRAKHALKGIAMVHRLGVVPIGE
                     ESILIAVSAPHRQAAWRAGEEALEECKARVEVWKREEFEDGEGVWRANRDGVRGERVG
                     "
     gene            complement(1643617..1646502)
                     /locus_tag="THITE_2112113"
                     /db_xref="GeneID:11517729"
     mRNA            complement(join(1643617..1645104,1645169..1645615,
                     1645672..1645965,1646046..1646502))
                     /locus_tag="THITE_2112113"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651561.1"
                     /db_xref="GeneID:11517729"
     CDS             complement(join(1643701..1645104,1645169..1645615,
                     1645672..1645965,1646046..1646318))
                     /locus_tag="THITE_2112113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651609.1"
                     /db_xref="GeneID:11517729"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="JGIDB:Thite2_2112113"
                     /translation="MALRFLRSLRRRREDHVVPDSGPDPDGSAGSIEADSTGFASLKQ
                     FEKMHRLDPNLPLDELEEVDIALNSANVEKEAEIEQILAEDNSPYPEVRASVRNFDVD
                     MPVNTIRAWAIGLFLCTVGSAVNMLLSLRNPSIALTTFAIQLIAYPLGLLWDLIFPDR
                     VFNLWGLKFNFKPGPFNFKEHVIIVVMSNAAYGGGALYATDVIIAQRMWYHQDFGWLW
                     QIMFGITTLCTGYGLAGLARRFLVWPAAMIWPTDLVNCALFYTLHDHSRTDPTRANGW
                     SISRYKWFMLLFSGAFLWYWFPGYLFQGLSWFCWLTWIWPDNVIVNQLFGGYSGYGLF
                     PITLDWSIVSGYVNSPLIPPFHAIGNVIGGVTLFLVIVSIGIQYSGIWYSQHLPVQNS
                     HAYDNTGHLYNVSAILNEHLRFDEAKYKAYSPLYLPTQFALAYGLSFAAVAAVITHVA
                     LYHGREIWTQWKLARSQEDDVHMRLMKKYRDAEDWWYTVLFVIMIGLSFAVVCAWDTE
                     FPWWAYVVCILIPLVWTVPIGIVQAVTNIQLGLNVVTEYIVGYMIPGRPLAVMMFKNY
                     GYLCMAQALYFIQDLKLGHYMKVPPRVMFWSQLIASIWSAVVQVAVMNWALSAIPDVC
                     DENQAHQWSCPNARVFYTASIIWGAIGPARMFSGDALYSSLQWFWLVGAIAPVLTWFL
                     ARRYPRGIWRYVNMPLIFGGSGMLPPATVFIYYCWGIVGTVFNFFVRRRWKGWWLQYN
                     YVTSAALDCGLIVSTLVIFFALYLSGTQAPQWFGNTSTLKTLDMLTLAVQSPVPPGET
                     FGPSTWP"
     gene            complement(1649046..1649136)
                     /locus_tag="THITE_t80"
                     /db_xref="GeneID:11517730"
     tRNA            complement(1649046..1649136)
                     /locus_tag="THITE_t80"
                     /product="tRNA-Pro"
                     /note="Anticodon: AGG"
                     /anticodon=(pos:complement(1649102..1649104),aa:Pro,
                     seq:agg)
                     /db_xref="GeneID:11517730"
     gene            complement(<1649356..>1651194)
                     /locus_tag="THITE_2143024"
                     /db_xref="GeneID:11517731"
     mRNA            complement(join(<1649356..1650301,1650396..1650689,
                     1650756..1650824,1651166..>1651194))
                     /locus_tag="THITE_2143024"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651562.1"
                     /db_xref="GeneID:11517731"
     CDS             complement(join(1649356..1650301,1650396..1650689,
                     1650756..1650824,1651166..1651194))
                     /locus_tag="THITE_2143024"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651610.1"
                     /db_xref="GeneID:11517731"
                     /db_xref="JGIDB:Thite2_2143024"
                     /translation="MAAVAGPLRRGFQSDLGVVTEGREPPAFAFAFDIDGVLLHVSKP
                     IPGATEVLQFLHDYNIPFILLTNGGGKHETERVRDLSEKLGVPLSTDNFVQSHTPFRE
                     LLEGPDSLRDKTVLVTGSDYEKCRAIFKEYGFQNVVTPADIYAADPTIFPFQPVSTFT
                     APSQPLPKPLYHPSTSPTTSSVPSPSELAPYLKIDAIFILNDPRDWALDTQILTDLLL
                     SHGGYLGTYSARNGAAALPNRGWQRDGQPRLYFSNADLLWSAAHPLPRLGQGAFQAAL
                     AGLWRRVTGGAAELERTCIGKPFGGTYRFAERVLTRHRSEVLRRLVAGTAAAAAATTT
                     TTTTGRRREGGKGKGEGGEAAGGGGDGLTTVYMVGDNPESDIAGANGHVSEDGAEWVS
                     VLVKTGVWREGRGTKLEGEFKPRAVVDDVKAAVEWALRREGWRGGVWEGKKLS"
     gene            complement(1653115..1654988)
                     /locus_tag="THITE_2112118"
                     /db_xref="GeneID:11520849"
     mRNA            complement(1653115..1654988)
                     /locus_tag="THITE_2112118"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651563.1"
                     /db_xref="GeneID:11520849"
     CDS             complement(1653187..1654836)
                     /locus_tag="THITE_2112118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651611.1"
                     /db_xref="GeneID:11520849"
                     /db_xref="JGIDB:Thite2_2112118"
                     /translation="MADLLGGGAAAGPATTNGHAASSSRPTAPPAQTGSPQQVIRGPR
                     MIMRERAEREARQRAEREQMERARAEEEARRLEETQRRAAEQRPPVAGAVSGGDVPKD
                     PAAQRRQQRAQEAQPGARVPTSMPSVPTQQPSAAVPPLRSTRVPATGQSSQTFPSAAQ
                     PGISATGGPQPGESSTQGMGASRIKNTFPHAFERWEALSAHWEGMTSFWLRRLQENTD
                     EIERNPITTQLSRQVADLSAAGANLFHAVVELQRLRASSERKFQRWFFETRAELERHQ
                     EVNAMLEAQMEQERQARADAVRGSAQHETENVKLRKMVAEMRRELLISKEEARRAWEE
                     LGRREQLEREHTVSLQQGLPTIVGGVQVVPMTQGMPSRAASRHNRSQSQAADTSEYVA
                     AQGCQYPEYASAAAPGASSAHQQPGEASGHEAGEYGAGSEAGYSEGEYMMDARGNFLR
                     DEHGNRIPFHSPTASPSQGRRSDAGAEDYETPAAQATTSYPPSSSHWAGAYSEAPEYS
                     GQGYASPGWETIPRHHHPTRLSDVIEEDENSRASMSQVSRA"
     gene            1663689..1665495
                     /locus_tag="THITE_2112124"
                     /db_xref="GeneID:11517732"
     mRNA            1663689..1665495
                     /locus_tag="THITE_2112124"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651564.1"
                     /db_xref="GeneID:11517732"
     CDS             1663944..1665455
                     /locus_tag="THITE_2112124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651612.1"
                     /db_xref="GeneID:11517732"
                     /db_xref="JGIDB:Thite2_2112124"
                     /translation="MWSMKRSRANGHVEISEHTEIRRKPMPSSNQQVANFSYPRTDFV
                     HLYRRDDPVVRDSLGSESSPPPMVEDHGSDLSAEDDCQYRVAGSELWDSWPAREHKGK
                     KIDYPAFIKSPTDVRDDRSHREPAKSQRTPPTTRGPALSSGSQSSQVLSRPADVQGPE
                     PQPSAPKPPPKVTYSLFPPAEIHPKHAPVPLQPPSGTRSMGLEPSPRSLPSTQKMRNA
                     AADGKGRVTSAYRPGSSRATTPISVHGSSITAGSSLLLRSPGPTPPASPSDVRGSSEV
                     PNYPSARAEKSSTSNSNQRNFSLSKITTRSSPSLANLAKAHHQASKTGHHHKPVTPAD
                     LYDRPLPPLPTERPETPPQVSVFETDTDDEADEDDGRPTSEAKKFARRLMHGLVHHHL
                     HHHHDNEKRDKGTAPDHKRSISDDGPSGSKEGGGGGRMGISRTFNAAARYRHSGGTAD
                     AAGPPRAAVSMDLPRDSGHRQYQQMADEGEKGGRFWSGRASNELLGRIWKRRC"
     gene            complement(1666905..1669877)
                     /locus_tag="THITE_2112125"
                     /db_xref="GeneID:11517733"
     mRNA            complement(1666905..1669877)
                     /locus_tag="THITE_2112125"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651565.1"
                     /db_xref="GeneID:11517733"
     CDS             complement(1667121..1669829)
                     /locus_tag="THITE_2112125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651613.1"
                     /db_xref="GeneID:11517733"
                     /db_xref="JGIDB:Thite2_2112125"
                     /translation="MNAPDARSFNDEHVEQARPLLQHPAELRLGLPALSSEQELDSTA
                     HPPPPTAPHYRYTPGFPPAAPDPVSPATTPTLSEPDLGGPGGVFGPPAVAPSYGPPVI
                     VEGPYRRVPDFPPPVDSYQQPAWEASLNAAMLTDFRDELARLDGVITPGVDNTPFIHY
                     AVEALTRDRDTGYSTAAPSGTSSLGPVFGSGQQQQPQQYQQHPPRSYQSEPAQQRPPV
                     AVPAPAHPPAAHPPAETALPDPPLQQPLRPFIPGPRESAQSLADTLLKKGSRPPQPHE
                     WRPVETDELLARAPELPPLSFRPWPLRPPALFGFMALCVLLIAALILSAVYSQLHHGL
                     LAWATLYGGRYFLFRIFPSLIGAVVLLYAQYIAKTMFRILPFVRLASSVPEEREGALF
                     QELYPSFLWPHLVGPWNVWVPTLVTWLMNFTIPLQSSVFTVILVDQTWTWATVQGVAW
                     TLVALYLALLVSTVIVWRYWATLESTGLIWDPRSLADIAALVSETNTAGDYRMTQLAR
                     TRDGIRFALRRRVGDRLCYWTWKDGRHGFWHTLGSPMDEANLIPIPDLASGQPMQRHD
                     EKQTGGLFGTDPDENHDIEASRTSTPARHRYLPWCLRSSQLLWFTVTAFILLLAIFIV
                     SFLPSTRIAKGFPPDLKADPQPGAFSSADFLYSFLPSLLGTLVFLAFQPLDTHLRVLQ
                     PWAALSQPRGAPAHRSILADYAACAPIQCTLHALRNRHWRVAVLSLLSTLFVLIPVLA
                     GGAFMALTNTSSSSESTQSYGEVLIYPNTPAYAILLALLLLYLGALASLLPARANLRM
                     PHAVTCLAEIVGYLVAADLRDEPAFKRCVSRDEMVGKMGLAGAGGGRAQGESWWVFSG
                     GSGPGNVGGEAAATGGAGEELAVRRVKRFTEKRRVRKSQIRRVALL"
     gene            complement(1671175..1673451)
                     /locus_tag="THITE_2112126"
                     /db_xref="GeneID:11517734"
     mRNA            complement(join(1671175..1672213,1672296..1673451))
                     /locus_tag="THITE_2112126"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651566.1"
                     /db_xref="GeneID:11517734"
     CDS             complement(join(1671245..1672213,1672296..1673249))
                     /locus_tag="THITE_2112126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651614.1"
                     /db_xref="GeneID:11517734"
                     /db_xref="InterPro:IPR002573"
                     /db_xref="InterPro:IPR007521"
                     /db_xref="JGIDB:Thite2_2112126"
                     /translation="MAALGLSSAPSASPRLGRKLRKRSSKTLARPASSDTEWYDGDVL
                     VPSCDAFLDNSKTLAYTGGQAASDSSVSASSRKEDNWLTFKNEIIRLAHTLRLKGWRR
                     VPLDSGDSISVERLSGALTNAVYVVSPPSEALLPREPGKKQPTKVLLRIYGPQVEHLI
                     DRENELGVLKRLARKKIGPRLLGTFLNGRFEQYLNATALTPASMREPETSRQIAKRMR
                     ELHDGIELLEEERDQGPGVWKNWDRWLSQVEKTVLYLDKQILSGAQTHRLPGGVWKTR
                     GFVCGVQWPVFKALVDKYRKHLEAYYGNAKNIRDKLVFAHSDTQYGNILRMRPDDQKS
                     PLLQPANEHKQLVVIDFEYAAANLPGLEFANHFSEWTYNYHDPVRPYACDHALYPTPD
                     QQRSFVKAYVDHRPQLPYPDSNPSPSLSVTPVRGEGPSGSSSSGGGGGGSGGGLLTNG
                     GLSGEAAAAGAAGLRATPSSSSIGEFMLDARVPPGGWKEEERKREEEAERRVRELLEE
                     TRLWRTANSAQWVAWGIVQAKITAVEEEEADVAALSEASDANAGVAGMGGDGGGVVDG
                     AIGAEEEAERQQQQQQQQQQQQQQQQQEEAEEFDYLAYAQDRAYFFLGDCVAMGLVTT
                     EELGEEVSRRIKVVEY"
     gene            complement(1673952..1674461)
                     /locus_tag="THITE_2112128"
                     /db_xref="GeneID:11517735"
     mRNA            complement(1673952..1674461)
                     /locus_tag="THITE_2112128"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651567.1"
                     /db_xref="GeneID:11517735"
     CDS             complement(1673983..1674168)
                     /locus_tag="THITE_2112128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651615.1"
                     /db_xref="GeneID:11517735"
                     /db_xref="JGIDB:Thite2_2112128"
                     /translation="MSAPPPGNSAQPRRSALKADGESPRTPPLGASMKGLSYYCLSLS
                     LPSRTCFPIARLPTLRP"
     gene            complement(1675108..1676198)
                     /locus_tag="THITE_2076497"
                     /db_xref="GeneID:11517736"
     mRNA            complement(join(1675108..1675588,1675657..1675866,
                     1675944..1676198))
                     /locus_tag="THITE_2076497"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651568.1"
                     /db_xref="GeneID:11517736"
     CDS             complement(join(1675157..1675588,1675657..1675866,
                     1675944..1676180))
                     /locus_tag="THITE_2076497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651616.1"
                     /db_xref="GeneID:11517736"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="JGIDB:Thite2_2076497"
                     /translation="MAPPPATTARAVVNALPRATASPQCTRFTRLLSTARIAQAKRPS
                     APRPSSFQSPPCQPLVQRRFKFKTVEEAKSRYRSGPFSWKAGLLFVITAAGLVWYFES
                     EKERMRRKRIAESTKGVGKPKVGGPFELIDQYGNKVSDQDLKGRYSLVYFGFTHCPDI
                     CPEELDKMARMFDLVEAQRPGALTPVFVTCDPARDGPKELKEYLVEFHPKFVGLTGTY
                     EQIKAMCKAYRVYFSTPSDVKPGQDYLVDHSIYFYLMDPEGDFVEALGRQHSPEQGAK
                     VILDHMKDWKGVLKTS"
     gene            1676588..1678696
                     /locus_tag="THITE_2112132"
                     /db_xref="GeneID:11517737"
     mRNA            join(1676588..1677674,1677738..1678696)
                     /locus_tag="THITE_2112132"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651569.1"
                     /db_xref="GeneID:11517737"
     CDS             join(1676786..1677674,1677738..1678438)
                     /locus_tag="THITE_2112132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651617.1"
                     /db_xref="GeneID:11517737"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="JGIDB:Thite2_2112132"
                     /translation="MNFSTSFFAPDLAPADDSSHPEQDRQQQQQGPTKRAMDRASNDA
                     HPIASDPVDHELTGDGSAVGKNRSSNSTDPAPKMPAPKKKKSTAAAAKGPAKRARPGA
                     ARVGGPKKARGGGAKKAKTGAPDASSNQPGAADADGDGGNSSESDNGPYCLCRGPDDH
                     RFMIACDRCEDWFHGECIGMDKHTGENLVQKYICPNCTDGGRYTTRYKKMCSLAGCNN
                     AARIYDSSRPSIFCSSEHCQAWWEQLIGTLPKSKSAEDFDRLTQEEFMGLLDAPSAPA
                     SSDDAENLPNAPWKLGKTPFEIPPDFWDQPASAAALTEEERTLLTTSAATRYQLGEEI
                     VLCKKMLQLIDMALKQREAAIAAGKGTAKDLCGYDTRLDTVGATHQFALFLQSPQGET
                     IFKTGRLDSLPDGTTISSDPANNNNNSNPNPNEPTTTDLDTTSSAPFQGMCLRRKCKP
                     HNGWSSILAKGARHDIKELAAQAKELLDAEQRVRDGAAGRFRRRLKERNRVIVLDGSG
                     GSSSSSSSSAADGSNGMEIRT"
     gene            complement(1679570..1680574)
                     /locus_tag="THITE_2112133"
                     /db_xref="GeneID:11517738"
     mRNA            complement(1679570..1680574)
                     /locus_tag="THITE_2112133"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651570.1"
                     /db_xref="GeneID:11517738"
     CDS             complement(1679776..1680339)
                     /locus_tag="THITE_2112133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651618.1"
                     /db_xref="GeneID:11517738"
                     /db_xref="JGIDB:Thite2_2112133"
                     /translation="MSQQQQDASNAVPDTQLGLTEDEIQLLRHGQQAVAAAGGSTSSR
                     AASRASSQGLLMVDTSSLTALGRHFDRVMQSIQQRLDYLMQQSEIVTLSVYDRAGNLI
                     DNADAEIARYHEIMAQIDELELDFDRISHIREIVHGFRQRAEELERELERAGGGSSSR
                     RERHGHGPGHSSHRSHGHSSSSGKRRT"
     gene            complement(1689852..1691146)
                     /locus_tag="THITE_2112134"
                     /db_xref="GeneID:11517739"
     mRNA            complement(join(1689852..1690310,1690375..1690787,
                     1690848..1691146))
                     /locus_tag="THITE_2112134"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651571.1"
                     /db_xref="GeneID:11517739"
     CDS             complement(join(1689972..1690310,1690375..1690787,
                     1690848..1691040))
                     /locus_tag="THITE_2112134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651619.1"
                     /db_xref="GeneID:11517739"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2112134"
                     /translation="MAGTMVTTQYAQAPHHNLHYGYVPPPSPPMDESAKCSLPSISNL
                     LGLADQGSPTSETSPQSQQQSHVSTKSETRPNSSHYANPALVRPALPPSPPMSSDASF
                     EGFNSPSTRSVSQVSNGSNYYFETTPPLQVESDSRQMTAASAVPRVSVQTSAYQPHFA
                     SPAYISQPAMTSYYPPIQAAAPPPPPPPPQMSGLYYQRPLPQTFPPPLPVSVTLAPAP
                     GNPWQHHHYIAPSASGSYPQSQDRYICQTCNKAFSRPSSLRIHSHSHTGEKPFKCPFP
                     GCGKAFSVRSNMKRHERGCHNYDSSSSTNSSTSNVSRP"
     gene            complement(<1698229..>1699167)
                     /locus_tag="THITE_111639"
                     /db_xref="GeneID:11517740"
     mRNA            complement(join(<1698229..1698330,1698460..1698630,
                     1698740..1698991,1699069..>1699167))
                     /locus_tag="THITE_111639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651572.1"
                     /db_xref="GeneID:11517740"
     CDS             complement(join(1698229..1698330,1698460..1698630,
                     1698740..1698991,1699069..1699167))
                     /locus_tag="THITE_111639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651620.1"
                     /db_xref="GeneID:11517740"
                     /db_xref="JGIDB:Thite2_111639"
                     /translation="MAVSSPSNVRRGALGQFPGAVELRGGPTSTQYCVKAHPILAFPR
                     AQGLPSAVVFASFSLPSESMTALQGRSLLLPVYEWPRERSGAPTWLAFCLWGRDSQGE
                     TQPTVPRTPSYSARECPAQDFSLMNYCVILLSALPLWARFSACSRFDLAAAKQDSFRA
                     SQEPLLKQPRALESRRELQVANPGLVFPGAGAKVLTRSEVPDSRRFR"
     gene            complement(<1702283..>1704748)
                     /locus_tag="THITE_2043949"
                     /db_xref="GeneID:11517741"
     mRNA            complement(join(<1702283..1704126,1704176..1704634,
                     1704709..>1704748))
                     /locus_tag="THITE_2043949"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651573.1"
                     /db_xref="GeneID:11517741"
     CDS             complement(join(1702283..1704126,1704176..1704634,
                     1704709..1704748))
                     /locus_tag="THITE_2043949"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651621.1"
                     /db_xref="GeneID:11517741"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2043949"
                     /translation="MSESDKYEVLEKIGHGSFGVIRKVRRKADGMILCRKEISYLKMS
                     QKEREQLHAEFQILSSLRHPNIVGYYHREHLKASQDLHLYMEYCGNGDLGRVIRSLQE
                     KNQYAEESFVWSIFSQLVTALYRCHYGVDPPEVGKNVLGLGTTARPKPPPGAMTILHR
                     DLKPENAVFLGEDNSVKLGDFGLSKVMQSHDFASTYVGTPFYMSPEICAAEKYTLKSD
                     IWSLGCIIYELCTREPPFNAKTHFQLVQKIKEGKIAPLPAIYSAELFAVIKDCLRVNP
                     DRRPDTAMLLNLPVVRLMRKEKEVVDFSKTLKAKEEALNRRIRELDQKMTAIDQDKAS
                     MRQEIDASLRREWEVKARLEIDRLVAAEIEQLQRKFEQEVQMRVEMELQNRKATAHKE
                     DEAHDLSSSISKSSHPQSSVGSVVSEFPSTTDISEFSVESPDTSMHPLKKSARTPFAR
                     AQTMFAVPPAGTPMDVEMASPSPMTIASLSLSPRRNAATRPPTVNPANIFSANQMAGD
                     ARWETAQEQMGSDSESDDEINIPSPTRMIKSSKNPFTSKARPQLHAQKSMPAHRLQSK
                     QSQALQGKTIPVAASTPDLQTAIRAIGSNGALQDRSNSPNRRLSKIPSAANLKNNHTP
                     GDGSAAGLNRKPSLGKNLKDGSEHQQQQQQPSGAPSNPPQLLSKAAAPGSKNNNIRGR
                     TLVELQQARAGGRPLSAVLSSGDVAAAVGGASNFTTTNAACVSPVRAFREHAAAANRG
                     ATAAVAAATTVLSDPPAVWDPERDEMPSPFLVRRKPVRTN"
     gene            1705302..1707817
                     /locus_tag="THITE_2112140"
                     /db_xref="GeneID:11517742"
     mRNA            join(1705302..1705784,1705848..1705896,1705971..1707817)
                     /locus_tag="THITE_2112140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651574.1"
                     /db_xref="GeneID:11517742"
     CDS             join(1705563..1705784,1705848..1705896,1705971..1707679)
                     /locus_tag="THITE_2112140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651622.1"
                     /db_xref="GeneID:11517742"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="JGIDB:Thite2_2112140"
                     /translation="MVLRKFELETKLKDDAQLIRSGVLRNDHPLDLSPEFHDFLQACR
                     RGDLKRCQELISAGVNINAKDQFDYTPLVVASLCGHYELVQLLLESGALADPDSFERE
                     RAVYNALNNKIRNLLVSYDYSKTADPLQPWSSHITSLLVRNTPATSDITLSASAENFR
                     LHKFILSARSPYFMRKFAEAPETQTWKLSPAIPVEAFRVVLRYLYLGDLPRDLVGPNS
                     AATEEEVFKGIDRLCKQLELERLWEAVLSINDRRLARQRQQDEVQRAQAQVEALFHNT
                     VLKHKIVVDTRKAGDVKWPHHNAIFADCILRADEQSDQEDDTDAEDLSNGSAIPVGPI
                     ATSQPDKARKPPRRSVLFPVHKPFLIRSPYFETMFSSDFLEAQERDHLHIIKVDCSPQ
                     VLEIILRFLYTEKADCPLEHALDLLYAADMLLLEKLKTKAAITISTLGSGTSNALVDR
                     THNSHPNASGGSNAGQPLPSSTNDDDEQPRDGGSADADAVEVEPINVYDVIHAAWDLK
                     VQRLEEFAARYLAGRLEDYIDEDEFAELIRESAARLRERQETDTIELLDDIRYYLSER
                     FRLRFEGEGLEEMLDEGADAVVAGEGGGEGQPVGKNGEDVKVGEVGGNGGRGGGGVRT
                     LNGEVVEDEFASDAVNYQILLEKIDRMLEKLKLDA"
     gene            complement(<1721145..>1721321)
                     /locus_tag="THITE_35525"
                     /db_xref="GeneID:11517743"
     mRNA            complement(<1721145..>1721321)
                     /locus_tag="THITE_35525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651575.1"
                     /db_xref="GeneID:11517743"
     CDS             complement(1721145..>1721321)
                     /locus_tag="THITE_35525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651623.1"
                     /db_xref="GeneID:11517743"
                     /db_xref="JGIDB:Thite2_35525"
                     /translation="KDYIKKVYKVLQRLRDVGLNLDLKKYIFVVKEVKYLKYIVEAKV
                     YIRPNPKKIKAIYK"
     gene            <1738908..>1740941
                     /locus_tag="THITE_111636"
                     /db_xref="GeneID:11517744"
     mRNA            join(<1738908..1738930,1739473..1739535,1739631..1739656,
                     1739857..1739905,1739953..1740011,1740343..1740372,
                     1740588..1740620,1740700..1740718,1740856..1740875,
                     1740910..>1740941)
                     /locus_tag="THITE_111636"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651576.1"
                     /db_xref="GeneID:11517744"
     CDS             join(1738908..1738930,1739473..1739535,1739631..1739656,
                     1739857..1739905,1739953..1740011,1740343..1740372,
                     1740588..1740620,1740700..1740718,1740856..1740875,
                     1740910..1740941)
                     /locus_tag="THITE_111636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651624.1"
                     /db_xref="GeneID:11517744"
                     /db_xref="JGIDB:Thite2_111636"
                     /translation="MSIQLYLSNIRVKGCYTQMVLSDHLAVNVLSNYKEVLVFISVIS
                     FYSKVLRCYIIRVVSSSLRYLCYRLTFNGTCFITAIFVVMIVYIIKVALEIFSTSLIF
                     SVIIIEGLPLPLGEI"
     gene            complement(<1745223..>1745495)
                     /locus_tag="THITE_2047525"
                     /db_xref="GeneID:11517745"
     mRNA            complement(<1745223..>1745495)
                     /locus_tag="THITE_2047525"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651577.1"
                     /db_xref="GeneID:11517745"
     CDS             complement(1745223..>1745495)
                     /locus_tag="THITE_2047525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651625.1"
                     /db_xref="GeneID:11517745"
                     /db_xref="JGIDB:Thite2_2047525"
                     /translation="VYIYINDIIIASKNIEEYLKYIKIVLNIFNKVYIYISIEKSFIA
                     YSLIRFLSYIVNSKRVAKIDDRIAIFKKLKFPNIFKTLEQYLSIAE"
     gene            complement(<1756714..>1758366)
                     /locus_tag="THITE_119824"
                     /db_xref="GeneID:11517746"
     mRNA            complement(join(<1756714..1758189,1758310..>1758366))
                     /locus_tag="THITE_119824"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651578.1"
                     /db_xref="GeneID:11517746"
     CDS             complement(join(1756714..1758189,1758310..1758366))
                     /locus_tag="THITE_119824"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651626.1"
                     /db_xref="GeneID:11517746"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="JGIDB:Thite2_119824"
                     /translation="MASPIPPELPPELASLPAEPESVAEVEHAVTLARQCRRRLVTVG
                     SGHSPSDLTCTSSWMLNLDRLAGVLTADPATGLCTVQAGIRLRALSAALAAAGLALPS
                     LGSIDEQSIAGAISTGTHGSSLRHGLVSECVVALKVTLADGKTRECSPQQRPELFRAA
                     LLSVGALGVVVEVTLRAVPAFSLAWSQTIDADARLFSTWEGELWKQAEFVRVWWFPYM
                     RRAVVWHADKVPREDIESGRVRHRRPRTSFLDSRLGYHVYHNLLALARWFPRITPWIE
                     WFVFGLNYGFRNGERTRVSGVQPSYEAFLLNCLYSQFVNEWAIPLHKGPEALQRLSAW
                     LNRLRPGDPGYVEHRIPFSAEGLWVHSPVEVRVSDTTVNASAARGNRPWLDVTPADGP
                     ALYLNATMYRPYFRDPTGEATERYYAAFEWLMRDLGGRPHWAKTFTVSPDEFASWYGD
                     DWRAFRQVRDAADPEGMFVGPWHRRYLLGERSSAGGEGGEMERLPLEEVGFFTREPAK
                     GG"
     gene            complement(1758845..1760484)
                     /locus_tag="THITE_2112141"
                     /db_xref="GeneID:11517747"
     mRNA            complement(1758845..1760484)
                     /locus_tag="THITE_2112141"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651579.1"
                     /db_xref="GeneID:11517747"
     CDS             complement(1758941..1760014)
                     /locus_tag="THITE_2112141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651627.1"
                     /db_xref="GeneID:11517747"
                     /db_xref="JGIDB:Thite2_2112141"
                     /translation="MMGGQNCHAEITFDDGATWLARFRLARVSSPPLEVRDYILRSEV
                     ATMLFLHSQTRVPVPKVIDWATESDPENDVGPGYILMEKVKGKPLDWQSLTAGQKDQV
                     MEQLVDIFLEIEKHPFDRIGSLMPPASGSTGFEIQGIAHHSLFNMAERGGRPLGPFDS
                     SAGAARAIVETYLDMIENGEICAEFLDDERLAHQFSLDIIDDVWKGPRPGERFYLKHP
                     DDKGDHILVDESLNIVGIIDWEWTRTVSREEAFSSPCMMWPVARFYEGSNELSEEELR
                     FAHMFRSRGRDDLAECVLQGRKVQRFYFALGPACGAHGDRKTFRDLLAGLRRAVGYEE
                     GKWEAWKNKTGQRSGENKDGVCS"
     gene            <1761622..>1764006
                     /locus_tag="THITE_119822"
                     /db_xref="GeneID:11517748"
     mRNA            join(<1761622..1761640,1761696..1761732,1761949..1762074,
                     1762128..1763906,1763952..>1764006)
                     /locus_tag="THITE_119822"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651580.1"
                     /db_xref="GeneID:11517748"
     CDS             join(1761622..1761640,1761696..1761732,1761949..1762074,
                     1762128..1763906,1763952..1764006)
                     /locus_tag="THITE_119822"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651628.1"
                     /db_xref="GeneID:11517748"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="JGIDB:Thite2_119822"
                     /translation="MFYSHEILTNQAHGVATVWVYSQQCHYVLTDAERVQAHMRAFYS
                     ALGGRDNALDPQAGKSKREELILQDDPEFDLNTDLPAFHFDEDGNLVVPRGSQSSRKT
                     SSQLSPLQGDGSFSGSNRSFLAAFDLSHSPLGGENSLIGEAFGAGTMTPGKGDDDLVP
                     FGEDERELQAIDDWGIEIDADGNIIPVLEEPQLPRLPHPEEEETAQLQEDEFMPIDDQ
                     GDVIMGGTGDIFHSDPPIPLRQEQQQQNQQGNQGSEREQDEREAAAQEEASSRQAQVR
                     ARRQRRRPILAPDDQTKISRQELKSWSANYLANAEQASQTRRGVTATEARQNAFNLVF
                     GGGIARVGVPTGIPGFPHPLASHFAGEGLQARLLGIIVTHPDGEDPEGPRGRRRSALE
                     ALELEEDEAPRRVRRRLSEEPSQDNQHSQPQLPQPDDGLPPLLGDDELPPVEVGRRAE
                     FVLPDIPSDTPWNRGSSQIPSSSVKGGGSKPPSRQVSASPLHGRGNRSLMPGDEIERY
                     SDNAPFPGSDGFEPLHSGPAGSLLSSPLFPGGTAQSASQIMRHALDREGQNFLDYVAA
                     IAKEHGSLDAPATIANTGSGSGSVSSPARRWIEFDRLFEPEDRTRAVAAQAFYHVLSL
                     ATKSVIKVAQDGQGGTEPFGVIRLGVDTGIEEDGDEQEQQQEEILGD"
     gene            complement(<1764687..>1766430)
                     /locus_tag="THITE_2086774"
                     /db_xref="GeneID:11517749"
     mRNA            complement(join(<1764687..1764982,1765210..1766285,
                     1766357..>1766430))
                     /locus_tag="THITE_2086774"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651581.1"
                     /db_xref="GeneID:11517749"
     CDS             complement(join(1764687..1764982,1765210..1766285,
                     1766357..1766430))
                     /locus_tag="THITE_2086774"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651629.1"
                     /db_xref="GeneID:11517749"
                     /db_xref="InterPro:IPR002005"
                     /db_xref="JGIDB:Thite2_2086774"
                     /translation="MEPLSDTLWDVVICGTGLQQSLLALALSRSGKKILHIDPNEFYG
                     GAEAALSLQEAEQWVGRISSGTGGGLFRAAAVSRSEDDTRLSPSRAYSLALAPTVIHA
                     RSALLSQLVSSRAYRQVEFLAVGAFYIFKPPQDPAQKPTLARIPSTREEVFSTTAVAT
                     KSKRLLMKFLKFVLDYEASPQRELWQPHADAPLTDLLRQEFKMDAELQTYILTLTLSL
                     DDRISTRDGLAVIHRHLSSMGVYGPGFAALYPKWGGLSEIAQVSCRAGAVGGAVYMLA
                     TGIKETESTDDGVKLLLTSGDSVKARMLVRADDSPNHNQLSIRRLVAVVDSPLSSLFE
                     AAVEGAPKPAVAVIAFPVGSVEEASGTESQRPIYLSAHSSDTGECPAGQTDALDLALQ
                     AFLRAVPEDRVPKVLFKLQYDQLDGGSESLGSHGPVFTFPTRSSPLSFDDSVLEPVRE
                     VWKKMMGDAAVEAEYMVFEDREGAVDDDDVY"
     gene            complement(1768683..1770284)
                     /locus_tag="THITE_2112144"
                     /db_xref="GeneID:11517750"
     mRNA            complement(1768683..1770284)
                     /locus_tag="THITE_2112144"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651582.1"
                     /db_xref="GeneID:11517750"
     CDS             complement(1768939..1770075)
                     /locus_tag="THITE_2112144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651630.1"
                     /db_xref="GeneID:11517750"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="JGIDB:Thite2_2112144"
                     /translation="MTTPTSTSTPTPAPTLSFPRPVFAKLSPHPYLLRSLAPSSPDRP
                     PVRTNGRAPHEARAVHVNASSLSHAHGSALVRAGDSTVICGVRGELLPVERIPLFRPR
                     NRKTLHGDDEDDAAQQEGGRGITGSGTGTGRGELRDYDLLVPNVELATGSAPQFLPGV
                     PPTALAQTLASRVYSLLHATGLVRAEDLRVWYRPGEKGGRRAGEDVEMGEAEEEDKEK
                     EEERVVAYWVLYIDLLFVSFDGNPFDVAWAAVVAALRDTRLPVARWDPDREMVVCSRT
                     ERRKLDVRGLPVACSAAVFMEKEHREAAAGAGEGRHWILLDPDRLEESLCQEVITMVV
                     DCSDGETRIKSIEKLGGTVLGRELIRGFAGVAERRWKTVRDAMP"
     gene            complement(1770487..1772110)
                     /locus_tag="THITE_2112145"
                     /db_xref="GeneID:11517751"
     mRNA            complement(join(1770487..1770570,1770694..1772110))
                     /locus_tag="THITE_2112145"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651583.1"
                     /db_xref="GeneID:11517751"
     CDS             complement(1770707..1772014)
                     /locus_tag="THITE_2112145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651631.1"
                     /db_xref="GeneID:11517751"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="JGIDB:Thite2_2112145"
                     /translation="MPTWAAPPPAASTSLYLALGAASLSATILLLTRSLAPSNTQPPP
                     PYPSPLQTHIPHLSPSELSALPYPPDLLPGHRSVPTAYGTIHVFELGPAAGPKVLLLH
                     GISTPSAALAGLALALARRGCRVMLFDLFGRGFSAAPRDLPHDLRLYTAQALLALASS
                     PLPWTGDDAFHLVGYSLGGGLAVGLARWLPRMVRSVVVIAGGGLVRRAHVGWRSRLLY
                     SGAWEVCGVLERVRRRLVWWRLRPREQQQQQQQQQQDEKEEGITETRMAAEAVRVREK
                     HKGSDASGGGSFDNAVLLASRPEHAVSSVMAWQLRHHEGFIPAFVSSIRHAPIYEQDE
                     DWRALGRLLAERRERLASQDTAEDLPGLRGGKILLVFGASDPVIVKEELIHDATAALG
                     EEGFETVVLDAGHEVVMTKAEEVAAAVASFWRRTEKGAQELGR"
     gene            complement(<1772270..1772932)
                     /locus_tag="THITE_2169934"
                     /db_xref="GeneID:11517752"
     mRNA            complement(<1772270..1772932)
                     /locus_tag="THITE_2169934"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651584.1"
                     /db_xref="GeneID:11517752"
     CDS             complement(<1772598..1772916)
                     /locus_tag="THITE_2169934"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651632.1"
                     /db_xref="GeneID:11517752"
                     /db_xref="JGIDB:Thite2_2169934"
                     /translation="MSRLFRSRQSSSDALQDACWSLLDADIPPPQQSSRRGRGLSAGG
                     DCPPRPWRAAAESRPSWTTERPPPRKLVKDMNGSGRPSFSLELSDSEAEKEKGLVRRQ
                     IARL"
     gene            complement(1773527..1774319)
                     /locus_tag="THITE_2112147"
                     /db_xref="GeneID:11517753"
     mRNA            complement(join(1773527..1773637,1773694..1773726,
                     1773789..1773895,1773974..1774319))
                     /locus_tag="THITE_2112147"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651585.1"
                     /db_xref="GeneID:11517753"
     CDS             complement(join(1773585..1773637,1773694..1773726,
                     1773789..1773895,1773974..1774059))
                     /locus_tag="THITE_2112147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651633.1"
                     /db_xref="GeneID:11517753"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="JGIDB:Thite2_2112147"
                     /translation="MSGRYAFAKGLKELRFLFCQTAEHSAATRSFLTRAYPIMKKNNP
                     SIPILLREAQGTLPRVYARYEFGKETSESLEGLSDKQIEETVTKLVKE"
     gene            1774381..1775935
                     /locus_tag="THITE_126270"
                     /db_xref="GeneID:11517754"
     mRNA            join(1774381..1774448,1774507..1774922,1775033..1775185,
                     1775382..1775935)
                     /locus_tag="THITE_126270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651586.1"
                     /db_xref="GeneID:11517754"
     CDS             join(1774729..1774922,1775033..1775185,1775382..1775517)
                     /locus_tag="THITE_126270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651634.1"
                     /db_xref="GeneID:11517754"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="JGIDB:Thite2_126270"
                     /translation="MPPTSNLFRAARPAFRARHFFFRPKQRNTARFQSTAAGSAEQAT
                     AESWAKRMWNSPVGLKTVHFWAPIMKWALVIAGISDFTRPAEKLSVSQNVALTCTGLI
                     WTRWCLIIKPKNYLLAAVNFFLGIVGVVQITRIGLWRQSQKAIAAAKPEEVKEAVVKS
                     "
     gene            complement(1775971..1778134)
                     /locus_tag="THITE_2076519"
                     /db_xref="GeneID:11517755"
     mRNA            complement(join(1775971..1777579,1777682..1778134))
                     /locus_tag="THITE_2076519"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651587.1"
                     /db_xref="GeneID:11517755"
     CDS             complement(join(1776326..1777579,1777682..1777993))
                     /locus_tag="THITE_2076519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651635.1"
                     /db_xref="GeneID:11517755"
                     /db_xref="InterPro:IPR011602"
                     /db_xref="JGIDB:Thite2_2076519"
                     /translation="MPEGIYQAEPPVRPADADAPEQQHRRQNDHGTGRQRTATGTTEI
                     DETLSHPGSVRINVKGAFIVDQETATPITPDGRSGSPGRHETKDIRLPNHTAVVSHIA
                     VDIGGSLAKLVYFSREAHTTEPGGRLNFISFETDRIDECLDFMHRLKDKHLQLNGSGN
                     GNGDGSSNRLANDLCVMATGGGAYKFYDKIRDVLGVDVLREDEMECLIIGLDFFITEI
                     PREVFTYSEANPMHFVEPSENVYPYLLVNIGSGVSFLKVSGPRKYERVGGTSLGGGTL
                     WGLLSLLTGARTFDEMLELASQGDNTKVDMLVGDIYGTDYGKIGLKSTTIASSFGKVF
                     RKKRQAEQEAEDSGGQRHKDHHRQSRQQQHQPQPSAPHPSSQPSQPGQPSADEAGRPS
                     QEQEGSSYDESRPFSAADISVSLLYAISNNIGQIAFLQSQIHGLSHIYFGGSFIRGHP
                     QTMNTLSYAIKFWSKGTKQAYFLRHEGYLGAVGAFLKRQPRNWGRRGSFEEAGAAGGP
                     AMDLRLRARGGGE"
     gene            complement(<1778956..>1780552)
                     /locus_tag="THITE_2045267"
                     /db_xref="GeneID:11518796"
     mRNA            complement(join(<1778956..1779336,1779403..1779800,
                     1779874..1779950,1780006..1780310,1780364..>1780552))
                     /locus_tag="THITE_2045267"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651588.1"
                     /db_xref="GeneID:11518796"
     CDS             complement(join(1778956..1779336,1779403..1779800,
                     1779874..1779950,1780006..1780310,1780364..1780552))
                     /locus_tag="THITE_2045267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651636.1"
                     /db_xref="GeneID:11518796"
                     /db_xref="JGIDB:Thite2_2045267"
                     /translation="MGLLPLNYRPPAYVEKSGPIASQGSLHDDRASSKSLRTGLSASS
                     GGIPAALSFDRIIEGTTCPPCTLRDFMNYLIYVEHSAENLQFFLWYRDYVRRFANAKT
                     PDISLAPEWTQAMEDEAVMRIKKEQAEKARRPPQGAAEIFKGTDFEKGADTTRESVTV
                     TVTSNILTTNTSSNRSQASQAFASAGLKAPFTIQPFRRELDRVIATYIMDGAPRQLNL
                     TDQEQKTVLHALSFTTHPSVLRSIANGVEATLRQQAHPNFIRWSIRNGNPPRITFAAG
                     LGAAVVLFGVVAALVLTLSSAGRGYRALAAIAWVVGFTIWMAAYKGMCVVLHGRHHRH
                     IRPWDLFASDSDDDGNGHDDGNGHDDGHHDDDSIRAAKSAFDSFGSGNSYEDEPWVVG
                     YRKRNILRKIFDREVWIEEPALRQIQDTIFVQSVLLAVVCAGVLTGVFVAVPAGRFF"
     gene            complement(<1789663..>1789899)
                     /locus_tag="THITE_2048768"
                     /db_xref="GeneID:11518797"
     mRNA            complement(join(<1789663..1789767,1789813..>1789899))
                     /locus_tag="THITE_2048768"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651589.1"
                     /db_xref="GeneID:11518797"
     CDS             complement(join(1789663..1789767,1789813..>1789899))
                     /locus_tag="THITE_2048768"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651637.1"
                     /db_xref="GeneID:11518797"
                     /db_xref="JGIDB:Thite2_2048768"
                     /translation="LRDYITVYFDDILVYSSRSQKDYIRKVYEKYIFTVKEVKYLGYI
                     VEVGVYIRPDPKKIKAIYE"
     gene            complement(<1795657..>1795863)
                     /locus_tag="THITE_2046114"
                     /db_xref="GeneID:11518798"
     mRNA            complement(<1795657..>1795863)
                     /locus_tag="THITE_2046114"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651590.1"
                     /db_xref="GeneID:11518798"
     CDS             complement(1795657..>1795863)
                     /locus_tag="THITE_2046114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651638.1"
                     /db_xref="GeneID:11518798"
                     /db_xref="JGIDB:Thite2_2046114"
                     /translation="KEYLKYIKIVLDILDKVYVYISVEKSFIAYLLVRLLGYIVNSEG
                     VAKIDDRIAIFKKLKFPNTLETLE"
     gene            complement(1801131..1802671)
                     /locus_tag="THITE_2112159"
                     /db_xref="GeneID:11518799"
     mRNA            complement(join(1801131..1802200,1802255..1802671))
                     /locus_tag="THITE_2112159"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651591.1"
                     /db_xref="GeneID:11518799"
     CDS             complement(join(1801439..1802200,1802255..1802485))
                     /locus_tag="THITE_2112159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651639.1"
                     /db_xref="GeneID:11518799"
                     /db_xref="JGIDB:Thite2_2112159"
                     /translation="MAGLAFENSNLTDLPPIENEILEGAPSSTWRDLRNPKLRRFPRH
                     GAEITWLDFLGHGIAGLVFKVTIGGGDPVALKIFWRARRPKPRPRPNDDGFIQDEWPF
                     EDECRNVALLEKLKWIITTADADRRPLPILRRPKTAHDIAANLRGFSDEARDSPRPTR
                     PPDDPIPMPPVPALTECYGWTTVRRDAIPRVSPPVSDYVDADIDWHWALVYELVPGAP
                     QDLAVGQAHLDFFYAMGFAMEAYKPDNWRGGRLVDFNDVSAPFSTGWRLSAVAVRDAR
                     AWFWTLGFEDERRVKRRIVTGVGGRAVRRTGREGGSVPASVAVDNIQGAGKFKA"
     gene            complement(<1807634..>1807816)
                     /locus_tag="THITE_33328"
                     /db_xref="GeneID:11518800"
     mRNA            complement(<1807634..>1807816)
                     /locus_tag="THITE_33328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651592.1"
                     /db_xref="GeneID:11518800"
     CDS             complement(1807634..>1807816)
                     /locus_tag="THITE_33328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651640.1"
                     /db_xref="GeneID:11518800"
                     /db_xref="JGIDB:Thite2_33328"
                     /translation="SRKDYIRKVYKVLRRLRDIGLNLDLKKYMFIVKEVKYLEYIIEV
                     GVYIRLNPKKIKAIYK"
     gene            complement(1812177..1814140)
                     /locus_tag="THITE_2112160"
                     /db_xref="GeneID:11518879"
     mRNA            complement(1812177..1814140)
                     /locus_tag="THITE_2112160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651593.1"
                     /db_xref="GeneID:11518879"
     CDS             complement(1812314..1813939)
                     /locus_tag="THITE_2112160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651641.1"
                     /db_xref="GeneID:11518879"
                     /db_xref="JGIDB:Thite2_2112160"
                     /translation="MARETILSVLSRRNPTPRPRSIGPAPNTFNKEWLDFDDWAPWSE
                     FTARKLRALYRDVVDAPWKDAYVEPRLSEFDTTYGDEDGFEHQILSRSTVPAVNAALL
                     QAQKLCNHLPLLHLGRRGRCRYGEDGRIHPDWVLVSSNEFMSDQRFASIMPGDTKLSA
                     RWQPNLYLKNREQWKHPIRQVLTYSNEVWCRYGFLITDNELVVFQFAIEHVDPGIATF
                     RNPRQSQQPQHQRVVSTVSDLSDSVQAMSISSRTQSYVETGKGYEYQNPRYRVIPWAN
                     HGEGDLTVKSALFYLCMMAGYGSRHVATAYPKLNTWWYLSDGTLRHNTTGFTKNRALS
                     KDKLEDPNAEMAQQAGPAAAAEYPEVEEEGQDADLGYTYQEQPTPWGSGDPGPAYPRD
                     LTYGSAGVDTEVSEAAQELDEDFEEEGEMSKAVQGNEDEEHEHEDEDDGSRAPGQAMG
                     GIGKGKNRAQQSSTSVSDRVLPKLKVKAGTPIVKVRFTRHNGVVCFKTRSGKLAEMKE
                     KDWEWMEYKGRQMLVRRGGKTVYIADDVYVANT"
     gene            complement(1822982..1823764)
                     /locus_tag="THITE_2112161"
                     /db_xref="GeneID:11518880"
     mRNA            complement(join(1822982..1823199,1823307..1823472,
                     1823579..1823764))
                     /locus_tag="THITE_2112161"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651594.1"
                     /db_xref="GeneID:11518880"
     CDS             complement(join(1822993..1823199,1823307..1823472,
                     1823579..1823670))
                     /locus_tag="THITE_2112161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651642.1"
                     /db_xref="GeneID:11518880"
                     /db_xref="InterPro:IPR009783"
                     /db_xref="JGIDB:Thite2_2112161"
                     /translation="MATESKPPFPPFTRETAQHKVKTAQAAWNSKDLELVQYAYTPDS
                     IWRNRDTFLQGREQIVEFLRKKWAKEQGYRLRKELFAFTDDKIAVQFWYEWHDETGQW
                     WRTYGLEDWTFAKNGLMRKRQMSGNDVKITEEERWFKEGVDVDAVEISERHW"
     gene            <1824630..>1825303
                     /locus_tag="THITE_2046329"
                     /db_xref="GeneID:11518881"
     mRNA            join(<1824630..1824750,1824838..1825040,1825127..>1825303)
                     /locus_tag="THITE_2046329"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651595.1"
                     /db_xref="GeneID:11518881"
     CDS             join(1824630..1824750,1824838..1825040,1825127..1825303)
                     /locus_tag="THITE_2046329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651643.1"
                     /db_xref="GeneID:11518881"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="JGIDB:Thite2_2046329"
                     /translation="MTTLTPGASFPSGVTFSYIPPTGTLDLTVCGRPITYDASKEFQT
                     GKTVLVAVPGAFTPTCQEQHVTSYLANLAQLRAKGVDRIVFIASNDAFVMSAWGKANG
                     VKDESILFMSDPNAEFSRSIGWANGDRTGRYAVVLDNGKVVYAGVDTVRGSIEFSGAQ
                     AVLAKL"
     gene            complement(1825367..1826735)
                     /locus_tag="THITE_2169937"
                     /db_xref="GeneID:11518882"
     mRNA            complement(join(1825367..1826112,1826286..1826429,
                     1826624..1826735))
                     /locus_tag="THITE_2169937"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_003651596.1"
                     /db_xref="GeneID:11518882"
     CDS             complement(join(1825822..1826112,1826286..1826429,
                     1826624..1826674))
                     /locus_tag="THITE_2169937"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_003651644.1"
                     /db_xref="GeneID:11518882"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="JGIDB:Thite2_2169937"
                     /translation="MRTYDDSFSGQRIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRK
                     NPRRIAWTVLYRRQHRKGISEEVAKKRTRRTVKSQRAIVGASLDVIKERRSMRPEARS
                     AARLAAIKESKEKKQAAQAAKKAEKAKLAAQAAKGQPQGRIASKQGAKGAPVKVAAKS
                     R"
     gene            1827107..1828894
                     /locus_tag="THITE_2112167"
                     /db_xref="GeneID:11518883"
     mRNA            join(1827107..1827265,1827342..1827372,1827435..1827718,
                     1827806..1828894)
                     /locus_tag="THITE_2112167"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651597.1"
                     /db_xref="GeneID:11518883"
     CDS             join(1827127..1827265,1827342..1827372,1827435..1827718,
                     1827806..1828821)
                     /locus_tag="THITE_2112167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651645.1"
                     /db_xref="GeneID:11518883"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="JGIDB:Thite2_2112167"
                     /translation="MAVDVDADAIASAVLDEFRKLPAKRKPAVRDNGLREWVPMSGIV
                     VKGPDFLKCVALATGMKCLPASKLAQANGVALHDWHAEVLAIRAFNRFLLDECRRLAQ
                     DSTYESEFLRRRTREELATNAGTLTGPWHRQPFAWREELTLHMYCSEAPCGDASMELV
                     MSSQPDATPWTIPASLSPAPSPTPPPPPNTVTTTTTESLLPTTTPTPAPTQPATTTTS
                     TPLLLGRGYFSRLGIVRRKPARPDSPPTLSKSCSDKLALKQCASLLGALAALLVSPRG
                     AYLATLVLPAAQYDAGACRRCFGGGAGVAGAGPDSNSSGGGGGLGGGGGGSGDTKAAA
                     GRMAAVSGRVWDGTGYGFVPLRVVTTKKEFEFSRRSLTAAANGGGEIKLAASNLAVAW
                     TRNGEVEEGLIGGVLQGRKAFDVKGASLTSRRKMWAAAVEVAAALGDEEIARALGKDT
                     YDGVKEGPLLASRRIVKQEVREEALKGWQRNVGDGNFHL"
     gene            complement(<1829138..>1829850)
                     /locus_tag="THITE_2045627"
                     /db_xref="GeneID:11518884"
     mRNA            complement(join(<1829138..1829367,1829440..1829612,
                     1829795..>1829850))
                     /locus_tag="THITE_2045627"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651598.1"
                     /db_xref="GeneID:11518884"
     CDS             complement(join(1829138..1829367,1829440..1829612,
                     1829795..1829850))
                     /locus_tag="THITE_2045627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651646.1"
                     /db_xref="GeneID:11518884"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="JGIDB:Thite2_2045627"
                     /translation="MADVQERLKKLGASARIGIGKGTPRRKVKRAPARSSGDDKKLQQ
                     TLKKLNVQPIQAIEEVNMFKSDGNVIHFAAPKVHAAVPANTFAIYGNGEDKELTELVP
                     GILNQLGPDSLASLRKLAESYQNMQKGEKEADDDEIPDLVAGESFENKVE"
     gene            complement(1830233..1831169)
                     /locus_tag="THITE_2112176"
                     /db_xref="GeneID:11518885"
     mRNA            complement(join(1830233..1830675,1830758..1830942,
                     1831015..1831169))
                     /locus_tag="THITE_2112176"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651599.1"
                     /db_xref="GeneID:11518885"
     CDS             complement(join(1830518..1830675,1830758..1830942,
                     1831015..1831067))
                     /locus_tag="THITE_2112176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651647.1"
                     /db_xref="GeneID:11518885"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="JGIDB:Thite2_2112176"
                     /translation="MAAKKPFNWWLWTKMLVVGGAVIVGGPALTRWVMPTDEELFQRY
                     NPELKKRSLERRVERQQEFDDFVTRLKEYSKSDKPIWIVQAEAEKERARQAAAEAARM
                     AEEAKARREAIRREAGLPAQPVSSESEGR"
     gene            1833256..1836838
                     /locus_tag="THITE_2112178"
                     /db_xref="GeneID:11518886"
     mRNA            join(1833256..1834060,1834125..1836476,1836599..1836838)
                     /locus_tag="THITE_2112178"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651600.1"
                     /db_xref="GeneID:11518886"
     CDS             join(1833520..1834060,1834125..1836476,1836599..1836732)
                     /locus_tag="THITE_2112178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651648.1"
                     /db_xref="GeneID:11518886"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="JGIDB:Thite2_2112178"
                     /translation="MAYNGQYAGGPGPGLGPQRPPPQRQYPPGPGGPPQQYNAPPQHQ
                     QYDQHQDGYGHAYDGYGNGYDQSYGQGYGGQYDDRGYERGGPPNQDYQQDYQQDYPQE
                     YQQEYYDPGPNAPGRGGPPMPGGRGGPMRPPPGDAGRGGPYPPRGGGYAPGPGGPPGP
                     AGRGYPPPSRDGRPANLDPGANRPPTGGPRPASPGGPGFGGPFPAFPGAQHKTDLERE
                     QQIVAQMAGMDISAQGQRPPGRGPNGAPPQQRGPMRPPPNGYGGPGPMGLPRAATQPY
                     PPHDYPDQRRGPHPGPGYGPQAGAYPEDGFGPPPRSMTMPARDHMDMRQAGPPIRRDS
                     AGAPYSDPVARGMPQRPSTAQGMRQPPQRIYPPNNNGPPQEGYREPPHRAGPDSGYGG
                     QDRPSSIDNFYDYYGANDGYPAQNPASETSELPNFDAISSQRPRTSFDRHMQAGPQPR
                     EQAQRGPGRYPEVSRAKSQPDLRNSQTAVFEMAGDVPPLPTQQPGQPHQPPPGGGLPG
                     GPQPYQQRSPPPPGQPGPAPGPGLPPGPAPYRPGAQPPPQSGPNPDSLPSHPTPVRPG
                     HMPGSVVNLNDRPPPVRNYSGGTNYSANSSYSGNAPAPAAGGYPQGPPPPHQAANSPA
                     PKQAEAPVTVEELEHLRAVVKNDAGDQASALRLAKRLVEASDALVPNLPDPKARARSR
                     ERYLVDAHKILRKLEKANNPDAMFFLADCLGRGLFGSEPDNAHAFSLYQSAAKLGHAA
                     AAYRTAVCCEIGNDEGGGTRKDPLKAIQWYKRAATLGDTPAMYKVGMILLKGLLGQPR
                     NPREAISWLKRAAERADAENPHALHELALLYESAEPNDVIIRDEPYAFSLFKQAGELG
                     YKFSQFRLGCAYEYGLLGCPIDPRQSIQWYSRAATQGEHQSELALSGWYLTGSEGVLQ
                     QSDTEAYLWARRAAMAGLAKAEYAMGYFTEVGIGVPANLEDAKRWYWRAAAQDFPKAR
                     ERLEDLKRSGKSGPRPRERISRSKIGKQQEGECTVM"
     gene            complement(<1837787..>1841697)
                     /locus_tag="THITE_2086793"
                     /db_xref="GeneID:11518887"
     mRNA            complement(join(<1837787..1840352,1840464..1840887,
                     1840980..>1841697))
                     /locus_tag="THITE_2086793"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651601.1"
                     /db_xref="GeneID:11518887"
     CDS             complement(join(1837787..1840352,1840464..1840887,
                     1840980..1841697))
                     /locus_tag="THITE_2086793"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651649.1"
                     /db_xref="GeneID:11518887"
                     /db_xref="JGIDB:Thite2_2086793"
                     /translation="MALAMTPRVRLPGSSKTAWTWGSTANSMIIPQPLMGFYWNMPDD
                     APCLLSLDHQVKQPRRVDLATTPYRTIIAWDADSIRTGAEKLRASHADVVSTMTRPKT
                     WEDLYQWFDSHDLWHVGAWNLWQVAHYLCDENEARLGLSRADEDAAKFDEIAAWAYRW
                     CTRASNRCRLATWNQTGDILAILAPAEQAEIRDCEDRDLAVLRGALHHWYIEYGPSRS
                     LAGGGISADIPQPSLRAFSVDDNDLSLPTFSWPRQASHGHVRRRSDSLPATPARPATA
                     HPEASMASWSRPARIQPGAVVDASPDAERARRVRHQASRSGPVRPVMTADSSPTRGAG
                     VENSGPSRLPRRSRPQTQDRSTSASMQPAAAKSPNAPQHPPGTPRDLHQAGLDNSDIR
                     EILVEHFSRWGHVEDCQLKVPAGRKKYAFVRYTSEASAQLAVARAAEQKEHVHPDVHP
                     ILADAKVTHPWFSKFFVPNSGAPPPRGRQHSLAAQCQQPTRPVNSTWRPREFSRTTSQ
                     WSAGSSTLPATPSRHQELKQPVASPIDAGTARIPGRVNSWVHNSVQHQNVYQRTPPRG
                     WAIRTASFPGPGGPVHPPRARSPGGHFGPHPPNGPPNMPMPFGLIPVPPPPNVFFGVG
                     PRRFPRYPPVVEGPPPAPETPRAQAPQFSSQPQNDCSLTPSPAAPEGDTAVQTKPPSE
                     AVVFSENYVRHGHVKDSLSNSPSHTPIRVRFPGTSPEKNQTAPAPTAQQDDCPVLMPS
                     ANRVHLDSPVRRITFGDFGVHSPLGSPTERVHSHADNEHKDNGTALQAEPHERDGNGA
                     PALAEPSEPKNHPDPNENFAWQLEEPSRRATGDVRLEPDYFNSTVRRNPQARRPGQIP
                     PWWMAQNTHPSQSWDPNRAAAYWPPIPPPMPPYSVLFYNPRHYNNHRPAYPHLHPHPQ
                     AHPPHPFFQPQEETQGLAGPAQPVPPHQGRPKSKNKPNNKPIPNRGTTPTPTPRAQLN
                     ETGTTSTLGTHAAAIALRTALTPTNNQPATRESTTSARSPARSKWKHNKTSTNKDKGK
                     DRGSHSQSQSRSQPQSRLQSRPQSRSQPRPHSQPQFRSRPQSRSQSRSQSRSQFRAHT
                     PAARPGYGSGPVPRPMSTPALAQARGAVPPVSSSAVEGPPSWVQGPAAQPTAGSGAGA
                     SRVMLPNGGNGGSSDSSSSAAVAAGGKGKARDDSGNGGGNGGGGYRADAGGSLRVPRK
                     RWGKKSAGRVDVRGVFADREEEEGPAQGEGE"
     gene            1841726..1842749
                     /locus_tag="THITE_2112180"
                     /db_xref="GeneID:11518888"
     mRNA            1841726..1842749
                     /locus_tag="THITE_2112180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651602.1"
                     /db_xref="GeneID:11518888"
     CDS             1842256..1842687
                     /locus_tag="THITE_2112180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651650.1"
                     /db_xref="GeneID:11518888"
                     /db_xref="JGIDB:Thite2_2112180"
                     /translation="MGEERVLGVEKSFESGCARTDEEVRHEKRKRKRKQKQTMGREEE
                     EHAVGVEKGSRPGCGKTEEEFRHEKRRRKWERKWKQKEEEEEEAERAAAHAHERGKGN
                     GELPDMGRNDFVYLLQPPWERPSSEHMQTRAPNSCTCTHLA"
     gene            complement(1842750..1843712)
                     /locus_tag="THITE_2112181"
                     /db_xref="GeneID:11518889"
     mRNA            complement(join(1842750..1843083,1843236..1843565,
                     1843659..1843712))
                     /locus_tag="THITE_2112181"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651603.1"
                     /db_xref="GeneID:11518889"
     CDS             complement(join(1843000..1843083,1843236..1843565,
                     1843659..1843670))
                     /locus_tag="THITE_2112181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651651.1"
                     /db_xref="GeneID:11518889"
                     /db_xref="InterPro:IPR012882"
                     /db_xref="JGIDB:Thite2_2112181"
                     /translation="MFRFHKPLDIITLFHKASSPASMRLAAALRQASAAASETSTEDQ
                     ASDHSAQSEAERRPEFKLEITENPPTPDQLRTILEYAGRHRISSIVKGATDEREAMRK
                     FHENVENFQRPVVVDWNNGRAQAGENESEILKMINALPK"
     gene            <1844707..1846422
                     /locus_tag="THITE_2076533"
                     /db_xref="GeneID:11518890"
     mRNA            join(<1844707..1844948,1845039..1846422)
                     /locus_tag="THITE_2076533"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651604.1"
                     /db_xref="GeneID:11518890"
     CDS             join(1844707..1844948,1845039..1846215)
                     /locus_tag="THITE_2076533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651652.1"
                     /db_xref="GeneID:11518890"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="JGIDB:Thite2_2076533"
                     /translation="MPSNDSDGTFMVHTSLLFDPLKKAFVCDVSIGVDPRSGSIRALH
                     RRTSSPSFRSNDIDLRGKVVLPGLVDSHTHIFLHSDNQQMLLQSPVERVVRATNHARA
                     ALLAGYTTYRDLGTEALGSADASFRDCVNRGLTPGPRMFVATEAIASSGGYEIRVENR
                     FARRSGGGGGGGELALSVPRAADTADGVDGVRAAVRRRVGEGADVIKFYADYRKRVMR
                     FPPDVPGPGGSVLFPPEKRRNPALLLFTELEMSAIVAEAKRADVPVAAHCGETETAMM
                     AAQAGVTSVEHVFEDSARLGDAFLERLRDAGTIWVPTLATAEAYYAGQVIFEWCKTTV
                     KKAADMGVKLAAGGDTGVFNHGLNVREMEIMIEAGVPVEDALVAGTYNGWLACGGDSC
                     GFRFGFWEPGNRADIIALDADPRTDAKALRKVSFVMKDGRVWKRDGQPVDMVAPSQWP
                     PEDVGLGARHRRDAPSLTGACT"
     gene            <1847365..>1851503
                     /locus_tag="THITE_2045005"
                     /db_xref="GeneID:11518891"
     mRNA            join(<1847365..1847914,1848036..1848132,1848221..1848310,
                     1848374..1848665,1848787..1848915,1848982..1849050,
                     1849123..1850824,1851271..>1851503)
                     /locus_tag="THITE_2045005"
                     /product="glycoside hydrolase family 35 protein"
                     /transcript_id="XM_003651605.1"
                     /db_xref="GeneID:11518891"
     CDS             join(1847365..1847914,1848036..1848132,1848221..1848310,
                     1848374..1848665,1848787..1848915,1848982..1849050,
                     1849123..1850824,1851271..1851503)
                     /locus_tag="THITE_2045005"
                     /note="CAZy_ID 269798"
                     /codon_start=1
                     /product="glycoside hydrolase family 35 protein"
                     /protein_id="XP_003651653.1"
                     /db_xref="GeneID:11518891"
                     /db_xref="InterPro:IPR001944"
                     /db_xref="JGIDB:Thite2_2045005"
                     /translation="MRLRLALLLLTSTAVVLCRHIFSSSSSSSPSSSSSHLPSSEFNP
                     LSILPRLISRPSTPPSANPQPNPEPNPNQNRNEKLPPRADATYAPPTWDNATLVLLGQ
                     RAMLFGGEFHPFRLPVPALWSDVLEKMRAAGLNAVSFYVPWALLEGRPGEVRAEGVFD
                     VAAFCRAAAEVGLWLVARPGPYINGEVTGGGLPGWIQRLRGHPRTSDADYLAATNNYA
                     ANVGAIIAKAQINNGGKVILYQPENEYSVSRTLIGFNFPDPGYMQYVEDQARRAGVVV
                     PFMNNDAWSAGHNAPGTGVGQVDIYGHDLAPLDPDCDDMAWEKGALRETQYANHLNVS
                     ASTPYAIPDGGVLDYWGGTGFARCAERFNAEQARVFNKNNFAAGVKIFSLYMMYGGTN
                     WGNLGYDSGYTSYDYAAAIAEDRTLTREKYSEIKLQANFFKVSPGYLVATPDLKPTTG
                     VYSPGHEDITVTAVVGPQGSFYVARKTAYRDASPVNFTLRLPTASKGAVTIPHLGGAL
                     TMPGRDSRIYVTDYPVGAMTLVYCTAEIFTWQKFDNGQTVAVLYGGVVGETHELLLQR
                     GGADLQATVTRSPEVRTSLEGQFVYAQWTTTGDRQFVRVGNTYIYLVDRNAAYNYWVA
                     DTPGQPPLIVNGGYLIRSAALANGTLTIRGDFNRTTTLELIGVPQAATSLVINTTPTP
                     HRADDDGHWLAQIAYSPPSITLPDLSAVAWSYIDTLPERQSSFSDAAWPSANHTFTNN
                     TYLQAPQTPTSLYASDYTFHAGGALLFRGHFTATGGESAVTLHTQGGRAYAAAVWLDD
                     EFLGGWAGNSSASSHRDTFAVRLVPGRAYALTVLLDNMGNAQNALVGGDDMKAPRGIL
                     QFNFTMGGGGAAPAVDWKVTGNLGGEDYVDKARGPLNEGGLWAERQGFHLPGAPTSSG
                     GWTAGSSPMKGIGEPGVGFWRAEAELDIPGEQWDVPLSFEFPPIDTTGAQGRYRAVLW
                     VNGFQFGRYISHIGPQTSVPVPEGILNYHGTNTIAVALWALQPGGARIPSLSLRAGTP
                     VLTGRRPVVGVAAPAWTQRPGAY"
     gene            complement(<1852969..>1853958)
                     /locus_tag="THITE_153186"
                     /db_xref="GeneID:11518892"
     mRNA            complement(<1852969..>1853958)
                     /locus_tag="THITE_153186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651606.1"
                     /db_xref="GeneID:11518892"
     CDS             complement(1852969..1853958)
                     /locus_tag="THITE_153186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651654.1"
                     /db_xref="GeneID:11518892"
                     /db_xref="JGIDB:Thite2_153186"
                     /translation="MLCGIHCPSSPSSNHHPRFLRSFRSHKNLRQDHLGSTSTSSSRS
                     QEMHHHRYQPSGASASSPARPSLDSSPRPSTSSRSDVSIDWDPLRLHPPSLAPGPVPP
                     LQDAFSGETSRASRRYHHHHQPPHELRHTRSSHNLRHQTRLSPPPPLSHRPLHGSFPS
                     SSPSHSTVIYDGFDFGLGNAAAATAAHHQATAAAAAKACCTAPTPRSITTTAGVMTAP
                     HRRDPSPAPSDASSECSLALSGGGGGRNATSPSLGGRGGGSSGDDDDGAMGLYMRGLA
                     PAPGPRPRPRPRPRPGWEGSEVEDFILRGGWKRRGIVFVDEDGLEGEEEAFEI"
     gene            complement(1856968..1859426)
                     /locus_tag="THITE_2112186"
                     /db_xref="GeneID:11518893"
     mRNA            complement(join(1856968..1857390,1857464..1857604,
                     1857670..1858521,1858598..1859426))
                     /locus_tag="THITE_2112186"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651607.1"
                     /db_xref="GeneID:11518893"
     CDS             complement(join(1857137..1857390,1857464..1857604,
                     1857670..1858521,1858598..1859282))
                     /locus_tag="THITE_2112186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651655.1"
                     /db_xref="GeneID:11518893"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2112186"
                     /translation="MDSPFEAPGRFPTAVDGFHRHSQSTSSHLGLDFSSMMHPQLGSG
                     QRAPSDAARLPSSGDGGAGAGVGAPYESHDDLCVDRCMGVGLYNGSQQFNHRGGPGSL
                     QTRRPRDSSVSRFDFPLGLNEWSVPPPTDPYQSWFSQHHLPAPAVPCSDEDCQSLGDS
                     CCDSQCTMTGKCTNIACADTEDACTDQNCPSRPSVSVPSSEVVNGAAALISINHSPEE
                     SPDHFGLQQPVMGSLDFGLTANTPQTFLLPSGFLPGPLGNMANHLLVAHGDAGPSNCT
                     RPCPLDDPQNYPFCHLPLYNNPSTFSHFNPVGSDLETNPSFVECGAEIHDPESFLAHF
                     NSQHRPYFTTSGVPNLVRASTEATEASQPGRQSILASTEAMSPPATPLDTSDSGRSSG
                     TPSPLTPLSNSVEMTDAKPEASPHVRSTSVTSSADHSLELGAEEEHRCLWRDEATSAI
                     CGQIFSDAEELFRHASEAHIKHAPKGAQGFRCGWNDCPRSEPGAAGFPQRSKIERHMQ
                     THIGHKPHICPTCNKGFSAKQALTQHMFIHSNEKPLVCNICQKAFRYPSALTMHQRVH
                     SGLKPLKCPVCGKGFSESSNLSKHKRTHEVKGRFICTVPGCDRNFHRQDQLRRHMKTH
                     QKEPSVASRESTLEQLPQT"
     gene            <1860622..>1861167
                     /locus_tag="THITE_153184"
                     /db_xref="GeneID:11518894"
     mRNA            join(<1860622..1860876,1861009..>1861167)
                     /locus_tag="THITE_153184"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651608.1"
                     /db_xref="GeneID:11518894"
     CDS             join(1860622..1860876,1861009..1861167)
                     /locus_tag="THITE_153184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651656.1"
                     /db_xref="GeneID:11518894"
                     /db_xref="JGIDB:Thite2_153184"
                     /translation="MGNLCSTERERDAFAQPGRRLGAAPAARTSASVPTSAEQGPRKV
                     GGPPQTLGGGAGSGAGQAAAAPGAAAAAADDAQRRAATAAEDRFQKSKPKKGKLQAQL
                     DRQRAMTDAQVLRQAGETERRQRELDQSRSVLNHD"
     gene            complement(1861332..1865355)
                     /locus_tag="THITE_2112188"
                     /db_xref="GeneID:11518895"
     mRNA            complement(join(1861332..1864574,1864629..1864997,
                     1865061..1865355))
                     /locus_tag="THITE_2112188"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651609.1"
                     /db_xref="GeneID:11518895"
     CDS             complement(join(1861497..1864574,1864629..1864997,
                     1865061..1865195))
                     /locus_tag="THITE_2112188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651657.1"
                     /db_xref="GeneID:11518895"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2112188"
                     /translation="MARPRDSRSPSPAGSHAARRRKDDERRDRDRDRDRDYRRRSRSP
                     DRRYRDRERDYGRERDRDRDRDSYRWRDRSLDRRDDDYYRGSRRDGGTARDRRRSRDR
                     GPDRPRSPDRRGPRGGDASRDYRDKRDDSRDRRSRRDGSHDSASQHGDGGRSRAHKAD
                     GVAGRDSEDSQSVKSTQTQAQTEAEKKAERLRKLQAMKEKHALKEAREADVTAGSTRQ
                     LLAEMDQKASGAADLRSPLPTQASPAPASPAAAAPAPYAGKFDPKAIAKNSKAARSQS
                     PAKLGDAQLGASGGRTSDVRTEASSKGAGLLPANRAVSAFGFQKNADAQKSASKRKLD
                     MDDEEIIKRKLVKLPDFVPENADSTSPAEGDAEEDGEEDLDLRMARNEEDMAEAHRIL
                     QERRDERIQKEGMAMDVDTETPNGEIKDEPMPPVPPTADIEEEDVDPLDAFMADLEHT
                     GTAGGVGSKPPKPSQNAKKGFEPEAYFSEDDYGFEADNADPASILAMAAKKKKKDIPT
                     VDYSKIELNPIRKNFWVEPQELSQMTEEEAADLRLELDGIKVSGKNVPRPVQKWSQCG
                     LTRPILDTIEGLGYEKPTPIQMQALPVIMSGRDVIGVAKTGSGKTMAFVLPMLRHIKD
                     QDPVSGDDGPIGLIMTPTRELCTQIYSDLLPFTKALKLRAVAAYGGNAIKDQIAELKR
                     GAEIIVATPGRMIDLLAANSGRVTNLKRATYIVLDEADRMFDMGFEPQVMKIFNNVRP
                     DRQTILFSATMPRIIDALTKKVLREPVEITVGGRSVVAPEITQVVEIIEESKKFVRLL
                     ELLGELYADDDDVRALIFVERQEKADDLLRELLRRGYGCMSIHGGKDQEDRNSTISDF
                     KKGVCPILIATSVAARGLDVKQLTLVVNYDAPNHLEDYVHRAGRTGRAGNTGTAVTFI
                     TEEQENCAVGIAKALEQSGQPVPERLNEMRKAWREKVKAGKAKDASGFGGKGLEKLDK
                     DREAARMRERKTHKAEGEEDDFKEEETAEDGKKDKATLAIEAAASAIVSRDAAKAEAE
                     ARAAAADGAAKTGAATSTGKGGGGALDKAASAISEINARLARAGQLRAGQPIDNKGPD
                     AGAFHATLEINDFPQKARWAVTNRTNVAKILEATGTSITTKGNYYPPGKEPAPGGEPK
                     LYILIEGDTELVVSRALAELTRLLREGTLAAADAESRAPVSGRYTIT"
     gene            1866094..1867362
                     /locus_tag="THITE_2112191"
                     /db_xref="GeneID:11518896"
     mRNA            join(1866094..1866720,1866792..1867097,1867185..1867362)
                     /locus_tag="THITE_2112191"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651610.1"
                     /db_xref="GeneID:11518896"
     CDS             join(1866181..1866720,1866792..1867097,1867185..1867265)
                     /locus_tag="THITE_2112191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651658.1"
                     /db_xref="GeneID:11518896"
                     /db_xref="InterPro:IPR000910"
                     /db_xref="JGIDB:Thite2_2112191"
                     /translation="MWSSIGRATVRQVRVARLPIRSASRLAVQLAPRRATPSIPSGIR
                     VAAVFARGFAQRSRPKQTSTSEAPKTKKAAAAKKKTGKPKARTAAKKAASRPKKELTE
                     EEKAKLAEREKRRELDALKKKALLKEQPAPLPTAPWVLFVSTRMKELTSQTPGAQVVF
                     SDLMPKVAAEYKALPPAELEKLKATASQNKIANEIAKKNFIESRPVHEIRAANLARKA
                     LRRKFGVQRVGTLSDPRFPKQTVGPYFAYLKSRLHAADLAGLDHSAKTARLASEWKNL
                     GEEERKPFIEMSATDSLRYQREIEAYRKEAGL"
     gene            complement(1867717..1869247)
                     /locus_tag="THITE_2112193"
                     /db_xref="GeneID:11518897"
     mRNA            complement(1867717..1869247)
                     /locus_tag="THITE_2112193"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651611.1"
                     /db_xref="GeneID:11518897"
     CDS             complement(1867799..1869109)
                     /locus_tag="THITE_2112193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651659.1"
                     /db_xref="GeneID:11518897"
                     /db_xref="JGIDB:Thite2_2112193"
                     /translation="MDRPEMEILVHIAAPAMAADDAKYRTLAAAYLAFEPRTKTAVVT
                     HAQMGTGEDIDCTEESQPEDELPRPQSSIQSPLLSFRSVANNLSSPLPPQAAGGCIPE
                     SQLSWRAPPSVIQDSMPDNDLVYPQYCTPTRLLEHYASTTLDSSQPISSPVPQGRQTP
                     PPALPNSHEEFPRQEDDDAANKQPSEVKDGSAGTTDSPRPGKSRKSPVASARSAVTEE
                     PRGPSSSCHGRQARPTSSFRAESEPPLAKRPRTSRDPPCEKPMIRSASDLGPRIRRAG
                     ILPAHHQTSTYDKLEILSPPPPTEKRELRPEDMITDVLASLARNLDLEKRFRPESQTR
                     ELRPFERGYWLVDCTTWDPDLKRSAWEYLAKYLGSGAAGWGTTCKRDAAFSWIRLYCW
                     GCVVGHMYLVLYLMSKRRVLYTGTSWIAADGAPVVVMGAKQAPA"
     gene            1869672..>1870874
                     /locus_tag="THITE_129164"
                     /db_xref="GeneID:11518898"
     mRNA            1869672..>1870874
                     /locus_tag="THITE_129164"
                     /product="sterol-4-alpha-carboxylate 3-dehydrogenase"
                     /transcript_id="XM_003651612.1"
                     /db_xref="GeneID:11518898"
     CDS             1869762..1870874
                     /locus_tag="THITE_129164"
                     /note="orthologue of Saccharomyces cerevisiae ERG26;
                     orthologue of S. cerevisiae ERG26"
                     /codon_start=1
                     /product="sterol-4-alpha-carboxylate 3-dehydrogenase"
                     /protein_id="XP_003651660.1"
                     /db_xref="GeneID:11518898"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="JGIDB:Thite2_129164"
                     /translation="MVSEKKPELGSVMVIGGCGFLGHHVVRLLLRDYTCAVSVVDLRC
                     TRNRRPDSDGVVYYEADITDVDKLESVFAKAKPDVVIHTASPAPQANDSVSHALFKKV
                     NVDGTAAVIKACQHTGVKALVYTSSASVISDNKSDLINADERWPMVRGKDQTEYYSET
                     KAAAEELVLAANRAPESPTFLTCAIRPSGIMGEGDTMQLYHMINVYRQGRTNVQIGDN
                     DNLFDFTYVENVAHAHLLAARALLITAASKTVPLDHERVDGEAFFITNDSPVYFWDYA
                     RAIWAAAGCPHGTEHVRVLPRSVGLLLGALSEAFCWAIGKPPTFTRQRIIYACMTRYY
                     DISKAKKRLGYKPLVSLDEGIRRAVKWALEQEQNKQ"
     gene            complement(1871774..1875974)
                     /locus_tag="THITE_2112195"
                     /db_xref="GeneID:11518899"
     mRNA            complement(join(1871774..1872339,1872403..1874411,
                     1874468..1875158,1875223..1875640,1875804..1875974))
                     /locus_tag="THITE_2112195"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651613.1"
                     /db_xref="GeneID:11518899"
     CDS             complement(join(1871875..1872339,1872403..1874411,
                     1874468..1875158,1875223..1875579))
                     /locus_tag="THITE_2112195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651661.1"
                     /db_xref="GeneID:11518899"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="JGIDB:Thite2_2112195"
                     /translation="MAGYDHGGGSGSDWGQGRASGDDVPYRMDQDTANLAPPSARHNG
                     GHGSPGGRPPASPALSAGDTDTESRRSGERNRSRPRGARSASGQVRSCKKCGEPLTGQ
                     FVRALDGTFHLDCFRCRDCGQIVASKFFPADDEDGGGQYPLCETDYFRRLGLLCHQCG
                     GALRGSYITALDRKYHVDHFTCSLCPTVFGAQDSYYEHDGQVYCHFHYSTQFAQRCNG
                     CQAAILKQFVEIFRNGQNQHWHPECYMIHKFWNVRLNPPQEATVPIRDDPDGRERVRQ
                     EEERMEEKVYRIWSVLSSFEESSAACISDMLLHVSNGAYIDGVMVAKRFIFHVDILFR
                     SADRLDATMAQLDMNALAYGREAKLLCKKIVAFFSLLSKTQDKAVGKPGVTQDLLGLV
                     TGLAHYLKLLIRICLQGALRIEKERTTADGLFHFLDDLGDLETLKMDDNSTTTLQLTS
                     GMSRLSAHDSDQCVLCRKPIEDECAKNGDKRWHLPCASCYRCGRELGRKLQDARLNPY
                     DGRILCTTCEPDSAPNAAPFEHVTKLQQYVFLLQVALARLLEILRSNGVLPSSSSDPN
                     GNGSGTADGRSGPHAGEHAHHRRESSYESALNDVRRLKSTRLDKHLSSSFRKARTSRI
                     LDGPESSSARPGSAGGGPGEGGPNKGFQIVEERGPIDEEDMTLPNQDALTLDDIPRIV
                     AAERANREQRPYPPARQEFFRSPGTESRPGPGAPGGSGHQRNLSDGKAAGARAPADPS
                     LQRTRRYFSELSGLEYFLVRHLAVLTMHPMVSSEFTLEELLSFIESRKPPTFWKNIGK
                     AFKNDGRKNVKKRGVFGVPLEVIVERDGAESTDGVGPGTLRIPAVVDDIISSMKQMDL
                     SVEGVFRKNGNIKKLGELVEKLDKEEEVDFSTTHVVQVAALLKRYLRELPDPLMTHKL
                     YRLWLAAAKVPDEQKMRHCLHLTCCLLPKANRDCLEILFCFLKWVGSFHQVDDESGSK
                     MDIKNLATVIAPNVLFDKNKTSSLDSDPMYAIEAVEVLIANIEEMCLVPGYIVNALND
                     PALFGSSGELTTKEILKRLSERAANGLGPTQYADVSEIVGRHEIPSRPPPRRMETDPS
                     QWQQQESSVRPVQEPTAPFAGPPHMGTPSPKRGGPYDAPPAQQSPYGQFEHSGTPDAN
                     MRGGQGQREWRNSGWGRQNSGLTTSTV"
     gene            complement(<1877287..1879118)
                     /locus_tag="THITE_2076548"
                     /db_xref="GeneID:11518900"
     mRNA            complement(join(<1877287..1877442,1877517..1877934,
                     1878008..1878093,1878155..1879118))
                     /locus_tag="THITE_2076548"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651614.1"
                     /db_xref="GeneID:11518900"
     CDS             complement(join(1877287..1877442,1877517..1877934,
                     1878008..1878093,1878155..1879102))
                     /locus_tag="THITE_2076548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651662.1"
                     /db_xref="GeneID:11518900"
                     /db_xref="JGIDB:Thite2_2076548"
                     /translation="MKRFWTRRDTDMDPHRDRPEQSPDPRRSAEGNPPDEHTRLLPNR
                     VDGTPYLSPDDPAVSPYNLWTVRLVRWVTVALTCIAFAWWVLMVVDVFITPPGLHVRG
                     SPFFAFCYASIALVTLIISLLFFAVPSKLGRVLSIVNAGVLLADAIIILAVPGLRHAE
                     IWAGIVSVVWAAVMAIWFVAVDRTVQWGKAEEEQRLTGRPESRRTVLEWIEVMLSTIV
                     LVVITLVVLLMTCTLILRAVDSTLVPPGERYWVDGDRYQIHLYCHGNQTGAGGNKTTT
                     VLLEGGEDPVERGLWQFAENAVKNGSIGRFCFADRPGLAWSDTAPSPFSASIASDALS
                     EALARAGEQGPWVLASAGIGSLYSRVFSSRHADEVQGILMMDPLHEDLLSRVGAPGRG
                     FLLWIRGVISPCGVDRILGAILRGRRAADRVWGRSSYQSGTTIFAKLQESLVADSLTK
                     RDVISSRAIQVGSTPLVVISSGQKIHKDSEWEDKQRDLSHLTENLQAWDIVDDAPHRI
                     WDTLSGRQAVEKRLKQLVNNPSVLQDL"
     gene            complement(1879340..1879863)
                     /locus_tag="THITE_2112202"
                     /db_xref="GeneID:11518901"
     mRNA            complement(1879340..1879863)
                     /locus_tag="THITE_2112202"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651615.1"
                     /db_xref="GeneID:11518901"
     CDS             complement(1879594..1879824)
                     /locus_tag="THITE_2112202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651663.1"
                     /db_xref="GeneID:11518901"
                     /db_xref="JGIDB:Thite2_2112202"
                     /translation="MADQDMLETGVCLDSRHSYEGPSLPASDLVQRSAAAYVTGKGIK
                     NRAEKQEDSVAGAIAAAHSIPLRRSPLRLCLP"
     gene            1881253..1882538
                     /locus_tag="THITE_2112203"
                     /db_xref="GeneID:11518902"
     mRNA            1881253..1882538
                     /locus_tag="THITE_2112203"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651616.1"
                     /db_xref="GeneID:11518902"
     CDS             1881381..1882409
                     /locus_tag="THITE_2112203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651664.1"
                     /db_xref="GeneID:11518902"
                     /db_xref="JGIDB:Thite2_2112203"
                     /translation="MAGLTIATDAGTAPVASTTDPRRNSTSTRTSSPHRPPISPITPP
                     LGPTRLPGHGPLTTMPDKGSDANATADFARGRPVFTHTTQTDQVGITPPPAQPIDFES
                     NPDVLALKSAISILQLQRARATADIQTLKRAKDAALADPEAFVTDLHEGRVQVVGDPL
                     LSGAGVRTTAEEDSDSDSDSDEDEEEQPDGQTGQPRAKTEADGDTAMANGAEAPPKPP
                     SRPKKPKQKTRRKPGAADTSKPPPWQRLPKMQSVVRCPPINWAQYGVVGESLDKLHAE
                     QVAAPTPGAPLVLGPGGTYEFKAGDGGDQANSAAGGGEQPRRLVGIAAPYNPLRDKLD
                     KKGKGSKR"
     gene            complement(<1883041..>1884857)
                     /locus_tag="THITE_2045310"
                     /db_xref="GeneID:11518903"
     mRNA            complement(join(<1883041..1883916,1883969..1884064,
                     1884299..1884381,1884535..1884633,1884715..1884748,
                     1884825..>1884857))
                     /locus_tag="THITE_2045310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651617.1"
                     /db_xref="GeneID:11518903"
     CDS             complement(join(1883041..1883916,1883969..1884064,
                     1884299..1884381,1884535..1884633,1884715..1884748,
                     1884825..1884857))
                     /locus_tag="THITE_2045310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651665.1"
                     /db_xref="GeneID:11518903"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="JGIDB:Thite2_2045310"
                     /translation="MADQSVFRITKELSDLQKNSDLSLAVACRDIDVRNVKALIIGPH
                     ETPYEFGFFEVFAASHRDHDERGPLQIQPQHLCQWQSLLSLMSANPYENEPGFEDANE
                     PSDKKHQKEYVQKIRHETLRISVIQRLEEYLKIGPDGAVVAPTATKDEYDLDMNTIED
                     ESSAPFEPFKDLCKRRFLWYYDSYLAAIQKGKEEVKDGQSFARMPFEGSSNTMEGKFN
                     YSELERRLRNIKKTLDEETESWAAEGLEAKAKETTVAVNLQRQFEQIVESFKRSDVPH
                     NLELLDGNPFVWILTYFGKPMTNLDGGLFRIRLCFSPRFPEEQPRIRFETRMFHHRIA
                     ADGTPCYVAPANRREDVKTHIEAVIEALEEEHPPYDPRTLVHPEAFKLYWGSPEDRRM
                     YNRRLRRSVQQSME"
     gene            1885427..1887003
                     /locus_tag="THITE_2112208"
                     /db_xref="GeneID:11518904"
     mRNA            join(1885427..1885768,1885826..1885904,1885980..1887003)
                     /locus_tag="THITE_2112208"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651618.1"
                     /db_xref="GeneID:11518904"
     CDS             join(1885650..1885768,1885826..1885904,1885980..1886933)
                     /locus_tag="THITE_2112208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651666.1"
                     /db_xref="GeneID:11518904"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="JGIDB:Thite2_2112208"
                     /translation="MSNFFDLKARKAAAANGAASSSAEKQTNETARVQPWVEKYRPKT
                     LSDVTAQDHTVSVLQRTLQASNLPHMLFYGPPGTGKTSTILALAKELYGPELMKSRVL
                     ELNASDERGISIVREKVKDFARTQLTNPPPGYKARYPCPPFKIIILDEADSMTQDAQS
                     ALRRTMETYSKITRFCLICNYVTRIIDPLASRCSKFRFKSLDQGNARRRLEEIARLEG
                     VGMEDGAVDALIKCSDGDLRKAITFLQSAARLVGASSAGSDGKDEDRMGVDKKLVTAK
                     VVEDIAGVIPDDTIQKLVAAMRPRAAGETYQAIAKVVEDLVADGWSAGQTMAQLHQAV
                     VYDETIPDIQKNRIVMVFSEIDKRLVDGADEHLSILDLALRISGILAGR"
     gene            complement(1886977..1888815)
                     /locus_tag="THITE_2112209"
                     /db_xref="GeneID:11518905"
     mRNA            complement(1886977..1888815)
                     /locus_tag="THITE_2112209"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651619.1"
                     /db_xref="GeneID:11518905"
     CDS             complement(1887073..1888629)
                     /locus_tag="THITE_2112209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651667.1"
                     /db_xref="GeneID:11518905"
                     /db_xref="JGIDB:Thite2_2112209"
                     /translation="MGAEGEDTLKEIRKTLEPYVRPREEAARIRQILAVHLASCLPDG
                     GAVGPLALIDADSIDTSSTARGLQKTYLEALSANIKARKEFAACCLEPRRPAGTATAA
                     EQRLDRLQEHLAAIRLRQRREKLQAIERGLNALGQKPAASPGFLDPAEIFRDSRPLPN
                     VPQELVAAVTLDETISAPRVRDLIDQLEKHVLQTKLLLRREEQLLEKAKARSTARPGT
                     ISEGAKFEALNRTRAELINWIEAELGKAAGDDGNADGQDSQKHRASADHVNMEEQLVS
                     ITEKYTRYLDVRKKLLELVGQQPQPTIKLPTKEANPPVPAVPSPPPTAHVLTPYFEHL
                     LSVAQEQKGLIAHKSHLSAVIAKQLRENDQVLDHLAEESQLLPAHPMPGPQQTRAAFA
                     DATSNETPGASSRVRPWVFAADSAKICTLEAVAEKIEEGQVALEKSMGILAETGRLVG
                     QSPPERKEAEVPFTTEEDIWLAEGQPPKKMAGLRKHTDRTANQPAQAKTVWDMLDGNL
                     GLLRSDRDSP"
     gene            1889185..1896066
                     /locus_tag="THITE_2112210"
                     /db_xref="GeneID:11516774"
     mRNA            1889185..1896066
                     /locus_tag="THITE_2112210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651620.1"
                     /db_xref="GeneID:11516774"
     CDS             1889285..1895908
                     /locus_tag="THITE_2112210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651668.1"
                     /db_xref="GeneID:11516774"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="JGIDB:Thite2_2112210"
                     /translation="MSNYHRDVSQYKYSAMSNLVLQADRRFVTRRTDEPTGDPESLAG
                     RLSIKDMGSRVARTTAPKPKKTSAMPDVERGSMREGADVLQFVKQKGKAESRGGGILS
                     GADALIEGIRYRPRTQPTRDAFNLILTIVAEHLGDVPHEVVRSAADATLEYLKDDDLK
                     DFDKKKEIDDILGVSMSPKQFNELVNLGKKITDYDAQDEDEDVEEVKRAGEDEIDGRQ
                     GVAVNFENEEDDGMVDVVRDESSEDEADLEDEEDRPELQEVADAGEAGQDRDEEEAGL
                     GDGDAMVIEAVPSGKVETQEKNYVPARDIDAFWLQRQIGRLYPDAHIQHDKTLQALRI
                     LSGEPDEPGGEEKQLRDIENDLMELFDYEHHEIVQKLIENREKVVWLTRLARAEDREE
                     RETIEREMASEGLRWILDELHGKPKDDQKKPKMEIKMDIDKDAFANGQPQKPEQREGG
                     LVGGLQPKKLINLENLVFDQGNHLMTNPRVKLPDGTTKRTFKGYEEIHVPPPRRRTDP
                     GEQNIPISEMPEWARLPFSTTKSLNRIQSKCYPAAFEDDGNMLVCAPTGSGKTNVAML
                     AMLREIGKNRNSRGEIDLDAFKIVYIAPLKALVQEQVGNFGKRLEPYGIKVSELTGDR
                     QLTKQQISDTQVIVTTPEKWDVITRKATDISYTNLVRLIIIDEIHLLHDDRGPVLESI
                     VSRTIRRTEQTGEPVRIIGLSATLPNYRDVASFLRVDFDKGMFHFDGSYRPCPLRQEF
                     IGVSDKKAIKQLKTMNDITYQKVLEHVGQHRNQMLVFVHSRKETAKTAKYIRDKALEM
                     DTIGQILKHDAGTREVLSEAANSVNNTDLKDILPYGFGIHHAGMSRADRTDVEDLFAS
                     GHIQVLVCTATLAWGVNLPAHTVIIKGTQVYSPEKGSWVELSPQDVLQMLGRAGRPQF
                     DTYGEGIIITTQGEIPYYLSLLNQQLPIESQLASKLVDSLNAEIVLGNIRSRDEGVEW
                     LGYTYLFVRMLRSPGLYSVGPEYEDDEALEQKRVDLIHSAATVLKKSNLIKYDEKTGR
                     MQSTELGRIASHYYITHGSMDIYNKLIQPSMNDVELFRVFAQSAEFKYIPVRQEEKLE
                     LAKLLARVPIPVKESIEEPTAKINVLLQAYISRLKLEGLALMADMVYVTQSAGRILRA
                     IFEITLKKGWASVAKLALNLCKMAEKRMWPTMSPLRQFPNCPPEIVRKAERIDVDFSS
                     YFDLDPPRMGELLGLPKAGKTVCSMVSKFPRVEIQANVQPMTRSMLRIELTITPTFEW
                     DVDVHGLAESFWIVVEDCDGEDILFHDQFILRKEYAEAEANEHIVELTAPISEPMPPN
                     YFISVISDRWMHSETRLAVSFEKLILPERFPPHTELLDLQPLPPSALKAKDFAALYPD
                     WQQFNKVQTQTFNSLYNTDNNVLVAAPTGSGKTVCAEFALLRHWAKQDPGRAVYIAPF
                     QELVDLRFQDWQKRFSNLRGGKDIVKLTGETTGDLKLLEQGDLILATPLQWDVLSRQW
                     KRRKNVQTVELFIADDLHMLGGLNGYIYEIIVSRMHYIRTQTELPLRIVGLSVSLANA
                     RDVGEWIDAKKHDIYNFSPHVRPVPLELHIQSYTIPHFPSLMLAMAKPTYLAVTQMSA
                     DQPALIFVPSRKQTRATARDLLSACLADDDEDRFLHVEVDQIRKLLERVQEEALAEAL
                     SHGVGYYHEALSQSDKRIVKHLYNNGAIQVLIASRDVCWELDCTAHLVIVMGTQYFEG
                     REHRYVDYPLSEVLQMFGRAVQPSKDGRSRGVLMLPAVKREYYKKFLNEALPVESHLH
                     NFLHDAFVTEISTKMIESGEDAINWATFTYFYRRLLANPSYYSLTDPTHDGLSQYLSD
                     MVEVTLKELADSRIIEMDEDDGTVAPQNAAMIAAYYNISYTTMETFLLSLSHKTKLKG
                     ILEIVTSATEFESIQIRRHEEAILRRIYDNVPVKLAKPVLDSPHFKAFVLVQAHFSRM
                     SLPIDLAKDQEVILTKILSLLSAAVDILSSEGHLNAMNAMEMSQMVVQAMWDRDSPLK
                     QIPHFTPEVVKVANKYGIRDIFDFMEKMNPDENADYGSLVRDLGLSQAQLAQAAHFTN
                     TKYPDISLEFEVEDQDSIRAGEPAYLKIHIEREVEEGEEFDATVHAPFYPGKKSENWW
                     LVVGEESSQTLLAIKRVTVGRELNLRLEFTVPTPGRHDLKLFLMSDSYVGVDQEPTFS
                     VMVEEGMDVDESGEEEE"
     gene            1897113..1899065
                     /locus_tag="THITE_2112216"
                     /db_xref="GeneID:11516775"
     mRNA            join(1897113..1897685,1897768..1898101,1898156..1898395,
                     1898472..1899065)
                     /locus_tag="THITE_2112216"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651621.1"
                     /db_xref="GeneID:11516775"
     CDS             join(1897237..1897685,1897768..1898101,1898156..1898395,
                     1898472..1899014)
                     /locus_tag="THITE_2112216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651669.1"
                     /db_xref="GeneID:11516775"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="JGIDB:Thite2_2112216"
                     /translation="MTDDAAPAEPAPQAADASEAAEPEQAEQTEQAEQAEQAESAAAG
                     ADKSKSKRKSIGGGDTKGKKLNKKASKPRMLHLDAKPGDHFFVKLKGFPQWPVIICDE
                     DMLPASLLKTRPVTAKRADGTYREDYADGGKKVADRTFPVMYLHTNEFGWVCNTDLIE
                     LDPSTVLDVKLDKMRKPLQAAHQLAAEQHPLSYYKEVLQNYQEELIEKEKAKAAKAAT
                     PKGKKSKAASQEDEDVEMEDAPDVETPAKDKKAKKRKAEDSAETPQRSDSVKKPKIKL
                     TTSATPKAANGGAASTPKSGKAGESKSAKAKSKKAKEEGDKEVEKEAPAPKEPELSAE
                     DKHARKKKEVLFLRHKLQKGLLTRDQEPKEEEMKLMSDYITKLEGFPDLEVSIIRATK
                     INKVLKAILKLEHIPKEEEFKFKPRSQVLLDKWNKLLAVEGAPAAPAAEVNGTSKAPT
                     QANGVKEKSEAAEPPKAKEETDEGAKSEPQDTKTKSEKEPEGEVKEAPKAATKPVEGS
                     EAAEKPAAEQVRL"
     gene            1899976..1902678
                     /locus_tag="THITE_2112219"
                     /db_xref="GeneID:11516776"
     mRNA            join(1899976..1900141,1900211..1900441,1900506..1900582,
                     1900654..1900870,1900953..1901095,1901180..1902678)
                     /locus_tag="THITE_2112219"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651622.1"
                     /db_xref="GeneID:11516776"
     CDS             join(1900091..1900141,1900211..1900441,1900506..1900582,
                     1900654..1900870,1900953..1901095,1901180..1902596)
                     /locus_tag="THITE_2112219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651670.1"
                     /db_xref="GeneID:11516776"
                     /db_xref="JGIDB:Thite2_2112219"
                     /translation="MTESEGGRMQFEEDDHRAAFVFSNLRAEDAAAKHSSRPAKRRKV
                     ARPDAPKPQAVAEAEASFPPLFDGAESPDAVRLRKELFETSWPIVEDGIQHVLREANR
                     TTLDEVTSFLQRAAEAKTGKIAAGFIITGPNIASQDLLFEQLAETLSAATQASFVRLR
                     AADAPNLKAALKKIIRDATTGRSEDGDGMDAEGRKYLDYDLEGLLAFLAQHQLPLRVI
                     VSFQDSEAFESGLLSDLIALFHSWRDRIQFDVLFGIATSVELFEARLLKSTARQLYGA
                     QFDVVQADSVLESVIKSAVAGTRATLRIGPSLLRSLVERQQGQAAGVQAFISSLKYAY
                     MCHFYANPLSVLLAGDDRLQPTLLQPEHIEAVRTLDSFQSHVEAAVEARQLNHAQSLI
                     EDDQYLATQILRQAQKRQAYLLHLLRSLHLVQCTGLSTASFVELYISALSGGIDIEQA
                     SGTVPLEDAIKRLNPGDFLSLVGRLLSAVRTGSSELGLRGWEAEAEELVGALGELRDE
                     VEGLVERSKSNGATLKSKYSAQSRILRTTVVAQKVQLSRDTATLTEEDKAYTKAVDTL
                     LELASQALHCDPIESLFLHEAWVFDSKAPYRDVFVPAPGATFDRALSRPQDYLACACC
                     SKANGGLASTLPTTAILYHLYTEAGALINVADLWSAYYALVGDESDVGLDERSALVCF
                     YRGLAELRMMGFVKQSRKKADHVAKLKWL"
     gene            1903148..1904096
                     /locus_tag="THITE_2112223"
                     /db_xref="GeneID:11516777"
     mRNA            1903148..1904096
                     /locus_tag="THITE_2112223"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651623.1"
                     /db_xref="GeneID:11516777"
     CDS             1903371..1903955
                     /locus_tag="THITE_2112223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651671.1"
                     /db_xref="GeneID:11516777"
                     /db_xref="JGIDB:Thite2_2112223"
                     /translation="MEQPSPTQPNNDFNNTTPTSSSSNSSTTTTTTRTAFGTRRAVKN
                     PAFEAKLAQMSLQLAPLVQLTTGQVHPAFPRTLLAFWLLTDEQLESLAHFYHQRTPCR
                     WTRHYPCPVAWPPGMTLEEKRRKLGRFIGLRGCETPIERLVSDEVAGRLGRSEDEICE
                     DARRARLEGAASGGSGRNGQHDEVDEVRRKMGWY"
     gene            complement(1904084..1905589)
                     /locus_tag="THITE_2112226"
                     /db_xref="GeneID:11516778"
     mRNA            complement(join(1904084..1904784,1904860..1905161,
                     1905233..1905589))
                     /locus_tag="THITE_2112226"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651624.1"
                     /db_xref="GeneID:11516778"
     CDS             complement(join(1904488..1904784,1904860..1905161,
                     1905233..1905338))
                     /locus_tag="THITE_2112226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651672.1"
                     /db_xref="GeneID:11516778"
                     /db_xref="JGIDB:Thite2_2112226"
                     /translation="MFDVNWRGLLLPLAYLAVLVGTFMTFSTVYRKRKAVRSANLAPW
                     FGPHLQRNIYLSLLHMEPEEGSEKAPKVPDSVIRAALLRRAVEDIHRIIQIRTAKAAC
                     SSLLQRGSVGDDLWQRFQRAEKEMEDELRDVVMEANALVPGWGQVIFQSANEIAANKL
                     LRDRLDEIEARTEQDKEWWEKRRASIKQDFMKELDAESEKAQAKAGSEDEPVLVDTDT
                     PSATPSGASKKKKGKK"
     gene            1905940..1908426
                     /locus_tag="THITE_2112228"
                     /db_xref="GeneID:11516779"
     mRNA            join(1905940..1906108,1906178..1906305,1906366..1907848,
                     1907921..1908032,1908157..1908426)
                     /locus_tag="THITE_2112228"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651625.1"
                     /db_xref="GeneID:11516779"
     CDS             join(1906025..1906108,1906178..1906305,1906366..1907848,
                     1907921..1908032,1908157..1908161)
                     /locus_tag="THITE_2112228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651673.1"
                     /db_xref="GeneID:11516779"
                     /db_xref="InterPro:IPR007716"
                     /db_xref="InterPro:IPR007717"
                     /db_xref="JGIDB:Thite2_2112228"
                     /translation="MLLRLRSPDGMFRLTVDKDDTFGKLIDQLVPKLPPTVDPQSITL
                     SNHPSNSAESRKIGEISQFKISQVGLSHGDLIFVNYQHQDVVTNGGAAGDLPKSSATP
                     LASSTNRLNGKPVLPTEDHPIDPPPNTSAERIKNPWEVVRQSPLDDRLDKQDGKIPRK
                     RDPKMCRHGPKGMCDYCMPLDPFNPQYLEEKKIKYMSVHAYMRKINSATNKPELGSSF
                     IPPLVEPYYRVKPDCPSGHPQWPEGICTKCQPSAITLQPQPFRMVDHVEFASPQIVDR
                     FLDAWRKTGTQRLGILYGKYLEYDVVPLGIKAVVEAIYEPPQIDEVDGISLNPWDNEQ
                     EVNQVAKFCGLEQVGVIWTDLLDAGKGDGSAVCKRHADSYFLASQEIAFAARMQAQHP
                     KPSKWSDTGRFGSNFVTCVVSGNEKGEISIAAYQMSNDAVEMVRAGIVEPSADPGLML
                     VREEEEDDGSVSRTRYIPEVFYRRINEYGANVQENAKPAFPVEYLFVTLTHGFPEAPK
                     PLFQDSGFPIENREHVGEAQEVSAVAKTLKVNQKDDNLHLSDFHLLCFIHQMGVLAKD
                     EEALLCRVATQHDLAESFQLRSTTGWQTLHMILQSTG"
     gene            complement(<1909115..>1909746)
                     /locus_tag="THITE_153166"
                     /db_xref="GeneID:11516780"
     mRNA            complement(join(<1909115..1909132,1909238..1909439,
                     1909649..>1909746))
                     /locus_tag="THITE_153166"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651626.1"
                     /db_xref="GeneID:11516780"
     CDS             complement(join(1909115..1909132,1909238..1909439,
                     1909649..1909746))
                     /locus_tag="THITE_153166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651674.1"
                     /db_xref="GeneID:11516780"
                     /db_xref="JGIDB:Thite2_153166"
                     /translation="MDLQSTDRGSLQSRARRPPLRMDQEKAGEGEEGGRAGGAAARSF
                     ARDIGNSPASLLSEEEWLRSAARSLSPDPRGLLILLLFAYALVLQGIPRRRRLVPMYM
                     VAA"
     gene            complement(1909724..1914570)
                     /locus_tag="THITE_2112231"
                     /db_xref="GeneID:11516781"
     mRNA            complement(join(1909724..1910445,1910508..1911884,
                     1912093..1913774,1913881..1914570))
                     /locus_tag="THITE_2112231"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651627.1"
                     /db_xref="GeneID:11516781"
     CDS             complement(join(1910338..1910445,1910508..1911884,
                     1912093..1913774,1913881..1914226))
                     /locus_tag="THITE_2112231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651675.1"
                     /db_xref="GeneID:11516781"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="JGIDB:Thite2_2112231"
                     /translation="MLSAVCKAGRAPAVLRHGRRVPVSSPQLRTLTSGVPKNGIFRAQ
                     AEVPGPKLSQKRLFSAAAARLSAGAAQPAPDPKAYLSSGVIKPKELIDVKKVLVIGSG
                     GLAIGQAGEFDYSGAQALKALKEAGVASVLINPNIATIQTNHVLADEVYYLPITPEYV
                     EYVIQKEKPDGIFLSFGGQTALNLGVQMQKLGLFEKYGVRVLGTSVRTLELSEDRDLF
                     AKALEEINIPIAKSIAVNTVDEALEAASKVGYPIIVRAAYALGGLGSGFANNEEELRN
                     MAARSLTLSPQILVEKSLKGWKEVEYEVVRDANNNCITVCNMENFDPLGIHTGDSIVV
                     APSQTLSDEEYHMLRSAAIKIVRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSA
                     LASKATGYPLAYTAAKIGLGHSLPELPNAVTKTTTANFEPSLDYIVTKIPRWDLSKFQ
                     HVKRDIGSAMKSVGEVMAIGRTFEESFQKAIRQVDPRFIGFQGDKFADLDYELQNPTD
                     RRWLAVGQAMLHENYSVDRVHELTKIDKWFLYKLQNIVDCTKELQQIGSLRSLKKEHI
                     LKAKKMGFSDKQIALAVGSTEDEVRARRLEFGIRPWVKKIDTLAAEFPADTNYLYTTY
                     NASSHDVTFEDNGTVILGSGVYRIGSSVEFDWCAVSATRALRNMGEKTVMINFNPETM
                     STDYDEADRLYFEELSYERVMDIYELEQANGVVVSVGGQLPQNIALRLQETGGAKVLG
                     TDPRDIDRAEDRQKFSEILDSIGVDQPAWKELTSIEAAEQFADEVGYPVLVRPSYVLS
                     GAAMTVIRSKEDLKDKLEAAANVSPDHPVVISKFIEGAQEIDVDGVASGGKLILHAVS
                     EHVEQAGVHSGDATLVLPPVSLDETTMQRVKEIAQKIAQALKITGPFNMQIIKADNPD
                     GGAPELKVIECNLRASRSFPFVSKVLGRDFIDVATKALVGKQVPDPTDLMAVKRDYLA
                     TKVPQFSWTRLAGADPFLGVEMASTGEMACFGKDLVEAYWTSMQSAMNFRVPEPGEGL
                     LFGGELSKSWLTTVVDYLAPLGYKLYAADEEVKQHLESTSKHKINVEVIEFPKEDKRA
                     LREVFKKYDIRGVFNLAQARGKTVMDVDYVMRRNAVDFGVPLFMEPQTAMLFAQCMSE
                     KLPRPEGIPSEVRRWSDFIGGKPL"
     gene            1915497..1916908
                     /locus_tag="THITE_2112233"
                     /db_xref="GeneID:11516782"
     mRNA            join(1915497..1916007,1916077..1916908)
                     /locus_tag="THITE_2112233"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651628.1"
                     /db_xref="GeneID:11516782"
     CDS             join(1915769..1916007,1916077..1916848)
                     /locus_tag="THITE_2112233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651676.1"
                     /db_xref="GeneID:11516782"
                     /db_xref="InterPro:IPR013715"
                     /db_xref="JGIDB:Thite2_2112233"
                     /translation="MNDDPGPSSATRQLPRRSDGDVDAASEQHDGGPGESGGRRPVDE
                     DKRRQGLAKKLEFISHLQKSLDMMVVVYICTLYSMECSFFRFLLRLLPHYSFLTPKDG
                     LVLPAEQPHIYSIFVPGVLCMLAHILFALPTAGEAARGYLHGGVIVDFIGQKPPTTKL
                     AFVYFDLAILGTQCLMLAVHREREKLKKIVSPSLRTISPSGGHSEGSAAAQTTQDLDA
                     EERGVLRVAMSVAAGGGTELLSASESGSSQESGGTPAPGDSERTGDTYSSATASVDLL
                     DMLRSGNALLSNFHVIDAVRSVGSGGQNAAAYSLRTLGYSATLAALAAERRSRLVRDQ
                     RR"
     gene            complement(<1916969..>1918192)
                     /locus_tag="THITE_2048302"
                     /db_xref="GeneID:11516783"
     mRNA            complement(<1916969..>1918192)
                     /locus_tag="THITE_2048302"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651629.1"
                     /db_xref="GeneID:11516783"
     CDS             complement(1916969..1918192)
                     /locus_tag="THITE_2048302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651677.1"
                     /db_xref="GeneID:11516783"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013796"
                     /db_xref="JGIDB:Thite2_2048302"
                     /translation="MSGSRPEFLRFTGHRAFTQRLVLATLTGRPVHISKIRSSSPTNP
                     GLAPHEISFLRLLEAVTNGSVIDVSYSGTTITYQPGLITGTVPGVGVSLPSDTIEHVL
                     PATCTRAVTYFLIPLALLAPFSKGHMNVRFSGPGVITSATHGTGDLSIDTFRTALLPL
                     YGLFGIPPARIELRVLARSCPGPGGKGGGGVVEMRFASQVRLPKTLHLNRRPGRIRRI
                     RGVAYCTGVSASHNNRMITAARGVLNQLVSDVHVAAQYDPAPLVGEKGSAQKKKTGIG
                     FGLSLVAESSAEGVIYAADEVAPPEGGVVPEDIGTRCAYQLLEVIAQGGCVTAAAAPT
                     VLILMAMGSEDVGRLRLGREVVGREEIIQLARDLKTFGASSWGIRDAGDDDGAGDLMI
                     SVKGTGVGNVGRKVA"
     gene            1918336..1921143
                     /locus_tag="THITE_2112235"
                     /db_xref="GeneID:11516784"
     mRNA            1918336..1921143
                     /locus_tag="THITE_2112235"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651630.1"
                     /db_xref="GeneID:11516784"
     CDS             1918619..1921096
                     /locus_tag="THITE_2112235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651678.1"
                     /db_xref="GeneID:11516784"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="JGIDB:Thite2_2112235"
                     /translation="MPPRTLALELGRRSAYVCKACLDSLRPANARPWLARQSSSSTAR
                     RVQPPPPAARRQDQPKPDPAEIERLLLEDPDRSDASANGEPLDINFFTQEAPGRLRRL
                     RDKEEFGVVHGGLDAEVEKAINDLERQMVNTVKMLQRMEEQGEQDKADALRKQFKKKL
                     RLQYKGKTGPEAEEYGLLRITGFSGPRQRVVANLNAFLARDSVVKGGIPRARDVAECW
                     KYYSAARKTLSTAWHNVPQEVWNFLWMILSWEGDGVENPNRMQHIYILAKDMQAAGVP
                     LRDSQQLLAIEAMFIEGWEEEAIAAWKKAVVTLGSKPETFTDYWELGVRMCSLHGDTD
                     RALRAADTLLKSSHPPNARILIPVIRALAAKRATVERAWESYRDMRTLLGESMTIEDY
                     DEVIAVFLASDNVEYALQAFVDMMLSGTVDIRGRTRLPMSVGNHFFIGKWLKRLIGVG
                     DLEGAYKVVAYVQAKGVTPSPIQLNGLIGAWLRSGTAENVEKADKLAWSMIRARLDFV
                     KLRQRRGLVSFYDPYDAPVVQGSEGAPEFVCQTRATAETFSLLAENYCSRRLHGRLQE
                     LFEVLKEAEIGPTSFLMNQLIRSYSQNGEAEEAVRLYRTMTREQNIRPDGHTFLTLFN
                     SLSVNRLIQRDPALSRQDVALIREFFRDLVEADWTFDTPEIFAQLPRTILFSMLKAKD
                     YTGMIVAGRAMKELFGFHPPEALLIELASGIGSLQVKTRRNMERLVAGRRTIETLMRN
                     HRMELVKRGHPGVEMTEEEEINELRDVLERLVLLKAGAQDADPNEVQRIVEEAAQEMG
                     VYDIVVRKDADQIAKHRKLGKQTAGLV"
     gene            complement(<1921190..>1922350)
                     /locus_tag="THITE_2143078"
                     /db_xref="GeneID:11516785"
     mRNA            complement(<1921190..>1922350)
                     /locus_tag="THITE_2143078"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651631.1"
                     /db_xref="GeneID:11516785"
     CDS             complement(1921190..1922350)
                     /locus_tag="THITE_2143078"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651679.1"
                     /db_xref="GeneID:11516785"
                     /db_xref="JGIDB:Thite2_2143078"
                     /translation="MASESLKRKLPPPDQRNRTTPAEKENKGQEEEEVEDYMSMTFDD
                     DDASHQKGIETSLQRRLRLRREAEARARPKSKAELAAEAESRREAALSQSLFVSQPKS
                     KGLAMMAKMGFKGGALGKQPPPEQNEQNRQLSDGGGVSKEGEGGGGGGGGGGGGGGGW
                     GGGPRTEPIRIEIKDGREGIGLESERKRKLREAAEAAGERAKRARAEEGEFRERIRRE
                     REEARWERQFVAAQKVAERMAGEREDDDRDAAEQQQAADRAVSRRCPLKAIPVVWRGL
                     VRAREEAERDRRMRYDLEQGLSSLPTYEDPEEDEDDKKALGKTRTAYVAAEDLDEEDP
                     ELDQFNALPPDERLRRVVQYLREEHRYCFWCKFAYPDADMEGCPGLTEEDHD"
     gene            1923549..1924376
                     /locus_tag="THITE_161956"
                     /db_xref="GeneID:11516786"
     mRNA            1923549..1924376
                     /locus_tag="THITE_161956"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651632.1"
                     /db_xref="GeneID:11516786"
     CDS             1923687..1924229
                     /locus_tag="THITE_161956"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651680.1"
                     /db_xref="GeneID:11516786"
                     /db_xref="JGIDB:Thite2_161956"
                     /translation="MRTPRRSRDRWAQQAVRGSGCSGPRRPRTTAGQPPSRAERTNGK
                     ALPPSRTTQNSQSTQLPGDQASSSSLAGGLRSHCRTAASLSWAGLLGRPANVHGKRGV
                     PRRQLARPAMRPARQTGHGRARGWAARGNEPVRCFSGGRCKPSDPPQCAVPWVGTTTV
                     VHTYPGRCVVTLDFRRTSCQ"
     gene            1931560..1934111
                     /locus_tag="THITE_2112240"
                     /db_xref="GeneID:11516787"
     mRNA            join(1931560..1931717,1931787..1932310,1932615..1934111)
                     /locus_tag="THITE_2112240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651633.1"
                     /db_xref="GeneID:11516787"
     CDS             join(1931800..1932310,1932615..1933846)
                     /locus_tag="THITE_2112240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651681.1"
                     /db_xref="GeneID:11516787"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2112240"
                     /translation="MDTMMTPQPTGPAFFFYSPDPNAEGRQHGRFIPQQNNMLPVVPP
                     LPSTPVYSRPGSSSSQPPLLPKGMSGVPVLPSSLTPVVSPMPISHKPTIVLDTEVRDA
                     DGPYSPSTPPLSSSGSAISSPGSCDMLQTPLNPMFSGLDGKDAGNADGELESFPNLDW
                     SACASPPLTPVYLASQAQAPRAAGAPLNTRACDLLSPASSCPSLSPSPSPYAQSSVSS
                     DDFCDPRNLTVGSVNSTLAPEFSALPTRCAGEDEDQKFVLRGAAPANSPNSSLDFQSQ
                     LSTTLPSFDALSDLDSEDDFVNGLVNLNDCVAAAPSSRSRASSDALSLDPANYLCGDD
                     SEDFEAADSFGADSLLSPADSCEDGDAHRDKRLKKSRSTSKPTMSSAADSQSGSTQSQ
                     SPPGNQESTSSSNATEAKNGGSESNSGSENAGPAPLPAPTNRRGRKQSLTEDPSKTFV
                     CDICNRRFRRQEHLKRHYRSLHTQEKPFECSECGKKFSRSDNLAQHARTHGSGAIVMN
                     LIDDPDAVAAAAAMPPGFPHPVMMGTGMVGGDDYHTLGKVLFQVAAEIPGSASELSSE
                     EGSDRGKKKRKRTD"
     gene            1935774..1938966
                     /locus_tag="THITE_2112245"
                     /db_xref="GeneID:11516788"
     mRNA            1935774..1938966
                     /locus_tag="THITE_2112245"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651634.1"
                     /db_xref="GeneID:11516788"
     CDS             1936271..1938760
                     /locus_tag="THITE_2112245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651682.1"
                     /db_xref="GeneID:11516788"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="JGIDB:Thite2_2112245"
                     /translation="MATEAGEDEHDLNSFMYQTVGHQVVPLYAEATGIPLYRRAIAGG
                     ATQPGKEYSHYRRSGEPPERRSPSGFTSRSGGDARHALGQHDDLQEPGDVAGSPQHAG
                     PEEHRHPADDGTAPEEPDETESMVPLLQAIQKAHPEANALCAGAILSTYQRTRVESVA
                     TRLGLTPLAYLWKFPVLPGPGQSTGSPGSDAQLLDDMAAAGMEARIIKVASGGLDDSF
                     LWTNVASAAGKERLARAMRRFGTAETGAVIGEGGEFETLVLDGPPSLFQKRIVVAEED
                     RRVISEGGGSAWLRLQNARLENKGATNTTDGMECRVRVPDLLDPKFNGVLGALSCPDA
                     GEPLPDPQSRPLDVEDGNSVKLGSLQSGVNRKLQTWCFVVGRSASIEAETQTIVELIR
                     ERLRQHCLPSSAILSATVVLRRMADFPAINNIYGTLFTEPNPASRVTISCGESLSAAA
                     AAAADTGIAVYLNVHTALPPGQRHGLHVQSRSYWAPANIGPYSQAISVPVASLGSAGS
                     DASSASGPRLVSVAGQIPLVPATMALPPGAPEDTLPLQLALSLQHLWRIGAEMGVQWW
                     TSAVAYFPKCAAGDDGGRMVRKARLASQAWRTAHQSKPSPSPGDEEDEDEGGPDLWDR
                     RYNAQYMAFATGEEENKGAPPLPDRAVLASSPAVLSPTATAAVPPLFVAEVDELPRGA
                     GVEWHAHLGVAHARERSVVLREARLPAPGGEEEGREVAVWQVIVPAATAEERRTSFVQ
                     TVVAEPYSGSARPGSSHARVARAALSQLGDVGLAGELAAAVRYMDAELLKAGAEKVGM
                     EELGPVVLCRSLWDAKGTRLAAVTVYHSVFC"
     gene            complement(<1939173..1941331)
                     /locus_tag="THITE_2076582"
                     /db_xref="GeneID:11516789"
     mRNA            complement(join(<1939173..1939828,1939923..1940352,
                     1940428..1940633,1940739..1940880,1940974..1941159,
                     1941318..1941331))
                     /locus_tag="THITE_2076582"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651635.1"
                     /db_xref="GeneID:11516789"
     CDS             complement(join(1939173..1939828,1939923..1940352,
                     1940428..1940633,1940739..1940880,1940974..1941069))
                     /locus_tag="THITE_2076582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651683.1"
                     /db_xref="GeneID:11516789"
                     /db_xref="InterPro:IPR002018"
                     /db_xref="JGIDB:Thite2_2076582"
                     /translation="MRYAAPPLGSLRWRAPVEPVQTDPGTVEKATTFRPVCLGTGAPY
                     PADGQDEDCLFVNVWAPANATARSKLPVWVFIQGGGYVANSNANWDGAEVVQRSGHSI
                     VMLNFNYRVGLWGFLASERVRADGALNAGLLDQRMLMQWVKRHISAFGGDPDHVVIHG
                     ASAGAGSVAMHLVAYGGRNDGLFVGGMAESVFFPAQPTVAELEYQFDRVVGQTGCDTV
                     APARQMACLREKNVAVLQAANQAQPFPGRTGPPVPLFYWTPCVDGDFLRDLPYRLFER
                     GQFIGVPMLFGSSTDEGSVFAVDAASPSDVATFFRDNYPLLTANDTSAILARYPQLPP
                     VPQHRPWFPTASRAYGEATFICPQHNLLRSLSNQPKVGHGGSSSSSLGLYAYRYNVHD
                     AENLAAGLGVPHLFDAAAIFGPDSLGPGGARASYKTYNAAVVPLMMGYWLSFVRALDP
                     NVHRMSGAPVWECWNEEGGDAGRRMLIETQGATMESTPAEEAERCSFWLALGRERMEQ
                     R"
     gene            complement(<1942160..>1943476)
                     /locus_tag="THITE_2043312"
                     /db_xref="GeneID:11516790"
     mRNA            complement(join(<1942160..1942292,1942507..1942511,
                     1943045..>1943476))
                     /locus_tag="THITE_2043312"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651636.1"
                     /db_xref="GeneID:11516790"
     CDS             complement(join(1942160..1942292,1942507..1942511,
                     1943045..1943476))
                     /locus_tag="THITE_2043312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651684.1"
                     /db_xref="GeneID:11516790"
                     /db_xref="JGIDB:Thite2_2043312"
                     /translation="MRPLPLAAALGRGSWWRYAAVAAAMTGAVVLYAWVDLHFSLPWN
                     PDRPTLPSFPAAPLANACDGIGKTTSELAAVTAARAPIPNIVHYVWLLADPVVFSLGF
                     TVFVTVYSSHLFLRPDRIYIHTDASPELWDRAKTAGDTWTKRQQIRGWDGRITLRYVL
                     AQQSNYARAVFPAVWHAVQAGVIPVEEAS"
     gene            complement(<1944199..>1945802)
                     /locus_tag="THITE_2086830"
                     /db_xref="GeneID:11516791"
     mRNA            complement(join(<1944199..1945542,1945608..>1945802))
                     /locus_tag="THITE_2086830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651637.1"
                     /db_xref="GeneID:11516791"
     CDS             complement(join(1944199..1945542,1945608..1945802))
                     /locus_tag="THITE_2086830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651685.1"
                     /db_xref="GeneID:11516791"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="JGIDB:Thite2_2086830"
                     /translation="MPRRRGPRGRAQASSGSGQEPQHNEKAIVVQHVDLVAAYQTDDG
                     PPPSINDVVGDAPSGMESAETEPIGNIVPPSPPTPVELEMCSTSQTAELGDLADSAGD
                     VAEDEADDVSTVVGSTPPTFSRASEANGLALSDGGLAKDARGLDYPPLTDEAGAEAAA
                     RERDRMNAYRAGSIRFAPWNIPYRRRLQTLAVVLHSLSIAGLVSFFFFLCAIPLTWPL
                     LIPYLLHMLLSKSATDGRLRARSERLRRSVVWKFFGDYFPAQLHKTHELPATRKYIFG
                     YHPHGIISHGAFAAFSTEALGFADKFPGITNSLLTLDSNFRIPLYRDYILAMGIQSVS
                     KESITNILSRGGADGAGMGRAVTIVVGGARESLEAQPGVMHLVLAERKGFVKMALRTG
                     ADLVPVLAFGENDLYDQVSPQHHPLLRRLQMWVLRTLKFTLPFLHGRGIFNYDVGLMP
                     YRRPLNIVVGRPIAVTRVPDAEMESREVDRLHREYVRELQRMWDAYKDVFARGRKEEL
                     QILK"
     gene            complement(1947200..1949478)
                     /locus_tag="THITE_2112250"
                     /db_xref="GeneID:11516792"
     mRNA            complement(join(1947200..1947663,1947733..1949478))
                     /locus_tag="THITE_2112250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651638.1"
                     /db_xref="GeneID:11516792"
     CDS             complement(join(1947335..1947663,1947733..1949329))
                     /locus_tag="THITE_2112250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651686.1"
                     /db_xref="GeneID:11516792"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2112250"
                     /translation="MDSDRGPTAAEAPRAPSTSTVPQPVSAPFAPVGDLTRQKSLKRA
                     RETTPTSQDSLVPGGDISPSKIARLVGFARHSHQPSTDGAVGDGASGKDELQQQQQQQ
                     QQPPQQQQEQLLPELEHSEHQVSAQKALDDLMSGVAADVNQPRDAPSDTGQSEAEAAA
                     AAAARALSSVHIPTEHVAADDLQDVSPQSGTSAASLEDGERQGADSPNAMDVDPHNGE
                     NAYGQQPEAQMEDKTATSLSYPGTMPAPGPPQRMMSMPIPNPQTPTVDLPPSSPSSNK
                     KHKCPYCETEFTRHHNLKSHLLTHSQEKPYVCQSCQMRFRRLHDLKRHSKLHTGEKPH
                     VCPSCDRKFARGDALARHSKGAGGCAGRRQTMGSFSLKDGYDGANAAADSSAMSAELY
                     EGGVGSDMSEEERRRLSMPSIKTQHVGGQAGAEGYMAGHSNTYPPAGARPGASGGLYP
                     PNVDRGASSSNTSPSVPSSHTPHTSISSIPLSAGSSSMYSQSGMTESPKPLSPGAASA
                     NAAGQPRPANEQQQGAAGAALPSHGNAAPGQPAATRGRGGAASGGAPPQGPENNGVTE
                     PGPALWAYFQHLEGAVNRLTSQVEADARSRAQLVEKLEAHDQHIAALAAEVAALRQQL
                     AGPQQEDSPADSGVAQP"
     gene            1953563..1956050
                     /locus_tag="THITE_126254"
                     /db_xref="GeneID:11516793"
     mRNA            join(1953563..1953786,1953923..1955255,1955321..1956050)
                     /locus_tag="THITE_126254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651639.1"
                     /db_xref="GeneID:11516793"
     CDS             join(1954041..1955255,1955321..1955374)
                     /locus_tag="THITE_126254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651687.1"
                     /db_xref="GeneID:11516793"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="JGIDB:Thite2_126254"
                     /translation="MKGIIKSAVAAAVVVGVAAQPHNHGHRHLHAKNHARSPVEKRDT
                     VIVTKVVEGPTVVVYELDGQRVDAAQAEDGISKGLYVVMGSSQPTFSAPPPAVTTSKA
                     STDLGGEFFEKATTTTSTSTTPTTTSTPTPKKSTSAAPQPVATGINVDFPSGKVKCDK
                     VPTEYGAIEVPWVGTNGWTTLANIGTWIKGVAISKIESPTSGTCEPNMMCSYACPPGY
                     EKSQWPEEQGASGQSVGGLWCNADGYLELTRPSHPKICEPGAGGVYVRNELSGNAAVC
                     RTDYPGNEAMVIPLDTSPGNTYPLTNPDSSTYYVWEGKPTTAQYYVNNMGVAVEDACV
                     WNSGPYPTSAGNWAPTNIGVGKSSDGITYISIFPNSPTSTAVLNFDIEITGDISGTCS
                     LKKGVYSGNNGCTVGMKPGGTATIVFKNSS"
     gene            1956580..1961940
                     /locus_tag="THITE_2112257"
                     /db_xref="GeneID:11516794"
     mRNA            join(1956580..1960573,1960648..1961940)
                     /locus_tag="THITE_2112257"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651640.1"
                     /db_xref="GeneID:11516794"
     CDS             join(1956684..1960573,1960648..1961302)
                     /locus_tag="THITE_2112257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651688.1"
                     /db_xref="GeneID:11516794"
                     /db_xref="InterPro:IPR002860"
                     /db_xref="JGIDB:Thite2_2112257"
                     /translation="MRVRGAVQAAAVLASALWLSPLAAAKNDRPTFHTKAFENIPKNL
                     NYFPDSDVVLFQDTEDNNVYRSDDHGVNWERVEAVPEGRAWLLYMHQFDSNRAYILTE
                     GDTHFRTSDRGKTWEKFDSGAEMSMFRGDILQFHAADPDRIIFNGMACQGIFCQEVAM
                     YTTDGFKTPAKELRRNTDGCWWAKSSDLFSTGSEDLDKNRILCIVRDAFSPFKQDQRL
                     LISDNFFQPTDESRDIQEFEPDLDVNKPVQGVVNVAVVKKYLLAATTSLNTDEMALFV
                     TDDTKKWHRAIFPAPHDSHDHRVMQEAYTVLESTNYSIQIDVMVTRPSNPMGVLFTSN
                     SNGTYFTENIEHTNRNHRGHVDFEKIAGIQGIFLVNKVDNWEEVSKEASTKKRLVTEI
                     TFDDGRTFESVTADGKRIHLHSVTELSNVGRVFSSPAPGLVMAIGNTGDYLKDYWEDG
                     NLYVSDDAGKTWSKALDGPHKYEFGDQGSILVAVRDSKEADVGEINYSLDHGVTWKKE
                     SLPDGLKLRPYILTTTQESASLKFLLIGETEKSPRWQVISIDFDGLHEATCTDDDMED
                     WSARVDKDGKPTCLMGHTQTFRRRKKKAECFLKQEFKHAVAKTEDCPCTDDDYECDFN
                     FEREDGRCVAKGPIVPPEGACRDGKPDETFKGTSGYRKIPGNTCKPSKEMDEKYKDVD
                     RKCSEIGGKLPGPATDKVNQTPNSFKKQWDAWEKHYLERGDSSSTDDETIIMRGRKGD
                     KYGDIYITHDHGKTWHSPKELEDEKIWLIIPHHHFKDMVFFVTNGKKVIYTTDRGRSF
                     HSFKAPHEPHPDVFPLAFHPDKKDWLIWMGKKCEYGDCYEVASYTKDRGDHWETPSRY
                     VRRCEFTGSKAYKYPDRKGEQILCLKHEREDKDKNNPLVLVSTNDWFANEEIRQRNVK
                     EFATMAEFIVVATEDTAKKTLQVSASLDGTVFADARFPYGFEVPHQHAYTVLDSSTHA
                     VNLFVATEVAEGRTYGTILKSNSNGTSYVVSAKNVNCDEDFYVDFEKMLGLEGVALVN
                     VVANPDEKGSAPKKLRTMITHNDGAQWAYLPTPRDDEFGKFPCQSDGNEKCALHIHGY
                     TERRDHGKTYSSKGAVGLMFVWGNVGDSLGPRKDADTFMTTDAGITWKRVRQGQWTWA
                     IGDQGAVIVLVQTTAGGTKKTKTLLYSLDQGQTWQEHEFWPEEVEVWDVTTLRSGSSR
                     DFLLWGKDGEGTFTLNLDFSGFSERMCKYDDDPEKSDYYIWSPKHPLQPDGCLFGHVS
                     QYLRKKSDRKCYNDFKLQPLYGKQNCTCTREDFECDYNYELDRFGQCSLVSGLQPKDP
                     QTWCKEHPDAIEYHEPTGYRRIPLTTCVGGRAFDQESPSHPCAGHEDEFERAHAASPV
                     AIFFAVTIPFALAGAAGWYVWRNWNGKLGQIRLGDQGTSVFEADRPWVKYPVIALSAV
                     VALVGALPLVAAAAWRSVRGLAERWGLAPGGGRGRWSRLGGGTRRFTTRDSFARGSGD
                     YTIVDDDEGELLGEDSDEEV"
     gene            complement(1962816..>1966513)
                     /locus_tag="THITE_2153998"
                     /db_xref="GeneID:11516795"
     mRNA            complement(join(1962816..1964773,1965602..1966422,
                     1966471..>1966513))
                     /locus_tag="THITE_2153998"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651641.1"
                     /db_xref="GeneID:11516795"
     CDS             complement(join(1963274..1964773,1965602..1966422,
                     1966471..1966513))
                     /locus_tag="THITE_2153998"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651689.1"
                     /db_xref="GeneID:11516795"
                     /db_xref="JGIDB:Thite2_2153998"
                     /translation="MNKQQGRSRLERPSNGAIPGSASPGVHRGVMLALDAHDGDDKRA
                     TGAASPRGKEPLLVRQTTSSFDPSGSSWQLPFFVNNSSSSSIALYGDPSSPSALDNDC
                     FPSPVPILAPHADCLPLFYTFYRSPSASRLSDTSSFCSSALSLSDDSGGTPSTMPGLT
                     CDAAAEPRFLGPSGVDSLSSPSATSLVDTGIDTAQLRPISAKSGRSERTAKPLRLARW
                     TRWHHCHQAEAADRSAADGKTSHSFYVWGSPQQPSRSRSSSIQKRQSGTGAVPQMTRE
                     QFEALPLAIQRKYFSTLERLRFAQESGLVDGISRHYHDISSFKRWKPRQERDAPEHTG
                     GRRRRGSIVGSHPSAPDSSTSLSGLSEATQEVGPRREEQIAVAGRQRTTVILDAADEA
                     VYKLNQQSSRRNLSTTASTSSPFLSPARDSMEFSNGLEKHADESDGHVHVPQSFYDSF
                     RWLDEEEDLDLRLFLDDYHANLREDPPTTKQRPSFRRHMSISKIPFGRRSSVSSSRPG
                     TNGTATPASPIHSPAGSVSNGLAHVRRKSRALSLITPRHAPQPSITAFDPAAAHYQDP
                     EARLKLRVYLASPQKFDEAVEFGFPSADALSAAPMLTLDTNGISRGHSKQKSGVDSPP
                     YMRTFLADGDDDDNLFLNDDQLSLADSDSPKTPEPLEHSRAIGARHARLASAGLASGG
                     DLGRRTPEGGCYAQAPASSREMTLRMTLTRPDLRAHEDEMYGRLQKQGYQQQQSRRPK
                     ARETRGVYPGPGAPKDSLEKFPEIDHWNGGAAEKGVMRRFWNRMRRV"
     gene            complement(<1970241..>1971982)
                     /locus_tag="THITE_2143087"
                     /db_xref="GeneID:11516796"
     mRNA            complement(join(<1970241..1970540,1970591..1971141,
                     1971206..1971393,1971455..1971591,1971695..>1971982))
                     /locus_tag="THITE_2143087"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651642.1"
                     /db_xref="GeneID:11516796"
     CDS             complement(join(1970241..1970540,1970591..1971141,
                     1971206..1971393,1971455..1971591,1971695..1971982))
                     /locus_tag="THITE_2143087"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651690.1"
                     /db_xref="GeneID:11516796"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="JGIDB:Thite2_2143087"
                     /translation="MLPMIARRGVPGHGARVASQLGSSRAVGSIPRLQAQVADVSNGL
                     DQSVLSTSARRDETLTVHPVVNFTPQNCDEFWRKVPLWEKVSAREFISYRWSLYGFLE
                     AVVPEEIPYDEAGTRMQTRSEYIQDVEDGITAATMAIRMTPYILSRINWRDPRHDPIL
                     RQFLPLKSVMMPDHPKLTLDSLHEEEDSPVQGLVHRYPDKALFLPTSVCPTYCMFCTR
                     SYAVGANTETVTKASLRPTRRRWEAALAYIESQPGLHDVVVSGGDSYYLNPEHIRDIG
                     ERLIGMPNIRRFRFASKGLAVAPGRVLDESDGWVSAVIDVSNKAKRAGKAVAWHTHFN
                     HPNELSWISSAASQKLFEAGVMVRNQTVLLRGVNDDLKTMSALIRGLADNNIFPYYVY
                     QCDMVKSVEHLRTPLQTILDLEAKIRGSIAGFMMPQFVVDLPGGGGKRLACSFESYDR
                     TTGISKYTAPAVTGRNKENRVYEYYDPIDSLPKNAAT"
     gene            1973810..1975595
                     /locus_tag="THITE_2112263"
                     /db_xref="GeneID:11516797"
     mRNA            join(1973810..1974130,1974221..1974323,1974381..1974583,
                     1974651..1974729,1974810..1975595)
                     /locus_tag="THITE_2112263"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651643.1"
                     /db_xref="GeneID:11516797"
     CDS             join(1973815..1974130,1974221..1974323,1974381..1974583,
                     1974651..1974729,1974810..1974972)
                     /locus_tag="THITE_2112263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651691.1"
                     /db_xref="GeneID:11516797"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_2112263"
                     /translation="MPTTIAFSVVGQWFEARKGIATGCVTLGAPLGGIFFSLLLQVLF
                     DRFPWKTAALVLAATMACLLSLGSLLVETNLPVQPANEDSEPALSSVLRSPKFWLVSY
                     AVFAYELVLFVQWGTIPSYAVSANVGNKQFYLMMSYNIGAVMGRTLPPWLSDRALGPL
                     NAIIVMNIFTLLVVLAIWLPVGGSSVAALFVVMVLMGIGTGSFVPLGVSCINALCTPE
                     HTGTWLGSAYSIVSVATLLGNPVSSAILARYHCDGLLAFLAAVLFSGMISAAALRWLF
                     HGRRWIFKARV"
     gene            1977420..1977989
                     /locus_tag="THITE_2112265"
                     /db_xref="GeneID:11516798"
     mRNA            1977420..1977989
                     /locus_tag="THITE_2112265"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651644.1"
                     /db_xref="GeneID:11516798"
     CDS             1977536..1977799
                     /locus_tag="THITE_2112265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651692.1"
                     /db_xref="GeneID:11516798"
                     /db_xref="JGIDB:Thite2_2112265"
                     /translation="MSAIEVSSTTLEVSSTTRRPLSQRKHQASLRVRQDQASPETSLR
                     DAPLTHQASLRIRQDRAEEGGLQTRSRSNHEGDYDPDVNVAAS"
     gene            complement(1978419..1979528)
                     /locus_tag="THITE_2112268"
                     /db_xref="GeneID:11516799"
     mRNA            complement(join(1978419..1978648,1978711..1978789,
                     1978846..1979528))
                     /locus_tag="THITE_2112268"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651645.1"
                     /db_xref="GeneID:11516799"
     CDS             complement(join(1978473..1978648,1978711..1978789,
                     1978846..1979094))
                     /locus_tag="THITE_2112268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651693.1"
                     /db_xref="GeneID:11516799"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="JGIDB:Thite2_2112268"
                     /translation="MFFLHNLERRVTLHPSYFGRNMHELVTTKLVKDVEGTCAGDYYI
                     IAIMDTFDVSEGRILPGSGLAEFTVGYRAVVWRPFKGEVIDAITQTVNPHGFFAQAGP
                     LRLFVSSQLMPDEIQYDASATPAQFTNNADIVIEHGTHVRVKIIGLRTEVGEMWAIGS
                     INGDFLG"
     gene            1980941..1982292
                     /locus_tag="THITE_2149855"
                     /db_xref="GeneID:11516800"
     mRNA            join(1980941..1981207,1981322..1981405,1981480..1982292)
                     /locus_tag="THITE_2149855"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651646.1"
                     /db_xref="GeneID:11516800"
     CDS             join(1981175..1981207,1981322..1981405,1981480..1981941)
                     /locus_tag="THITE_2149855"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651694.1"
                     /db_xref="GeneID:11516800"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="JGIDB:Thite2_2149855"
                     /translation="MSLDVEKQLTFYGAYHHNRVNVIIHMICVPLILFSAFEIASNYG
                     PFFTLPSWLQVPYLEPNLGTFAALTWGGLYLLLEPVAGGALALICLGAAAGTNYLRLQ
                     DPAGTTRVAVAVHIVCWLLQFIGHGKFEGRAPALLDNLFQAIFLAPLFVWLELLFALG
                     YRPELQKRVNKAVELEIAKFRERKAKKAGKTQ"
     gene            1982639..1983602
                     /locus_tag="THITE_2112269"
                     /db_xref="GeneID:11516801"
     mRNA            join(1982639..1982774,1982911..1983602)
                     /locus_tag="THITE_2112269"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651647.1"
                     /db_xref="GeneID:11516801"
     CDS             join(1982735..1982774,1982911..1983413)
                     /locus_tag="THITE_2112269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651695.1"
                     /db_xref="GeneID:11516801"
                     /db_xref="JGIDB:Thite2_2112269"
                     /translation="MDFPLHWTLDFLQDILPPETVAQVQNFLLNPSSPLHNLRRHLAA
                     AAAHMYPLVAAALGRLTELLSASPNVVAAAVILALAVLVMQILSFVHRLVLFWTRVAF
                     RLLFWAAVGLLVSVAWQRGWERTLRDVVVLGSQLVGWVAGVVDLWVREYERAQAQAQA
                     QSRSQSRSQSQRRYGDYQHW"
     gene            complement(1983599..1985025)
                     /locus_tag="THITE_2112271"
                     /db_xref="GeneID:11516802"
     mRNA            complement(join(1983599..1984636,1984716..1985025))
                     /locus_tag="THITE_2112271"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651648.1"
                     /db_xref="GeneID:11516802"
     CDS             complement(join(1983791..1984636,1984716..1984763))
                     /locus_tag="THITE_2112271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651696.1"
                     /db_xref="GeneID:11516802"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="JGIDB:Thite2_2112271"
                     /translation="MSKFGVMVMGPAGVGKSTFCASLITHLQLSRRSAFYVNLDPAAE
                     HFEHQPDLDIKDLISVEDVMEEVGLGPNGGLIYCFEFLMQNLDFLSEALDSLTEEYLI
                     IFDMPGQIELYTHVPVLPTLVKFLSQPGALDIRLCAAYLLEATYVIDRAKYFAGSLSA
                     MSAMMMLEVPHINILSKMDLIKDQMRKKDFKRFITPDTSLLEDDPADLARKRAGVNID
                     AHYADPNDKDVVMSGASFKQLNTAVANLLESFSLVSYLKLDCTDEESVAAILSYIDDC
                     IQYHEAQEPKELPDEEYEEAE"
     gene            complement(1985152..1985837)
                     /locus_tag="THITE_2112272"
                     /db_xref="GeneID:11516803"
     mRNA            complement(1985152..1985837)
                     /locus_tag="THITE_2112272"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651649.1"
                     /db_xref="GeneID:11516803"
     CDS             complement(1985378..1985707)
                     /locus_tag="THITE_2112272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651697.1"
                     /db_xref="GeneID:11516803"
                     /db_xref="JGIDB:Thite2_2112272"
                     /translation="MACNELDRGHPGLAGILLANVGILANVGILGWRASSWVCGHPGQ
                     RGHLPRFAGILANAGIFLGSRASWPTRASSWVRGHPGQRGHLPGFAGILANTGIFLGL
                     RPSSWPT"
     gene            1987114..1989647
                     /locus_tag="THITE_56460"
                     /db_xref="GeneID:11516804"
     mRNA            join(1987114..1987228,1987561..1987684,1987741..1988406,
                     1988464..1989647)
                     /locus_tag="THITE_56460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651650.1"
                     /db_xref="GeneID:11516804"
     CDS             join(1987595..1987684,1987741..1988406,1988464..1988925)
                     /locus_tag="THITE_56460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651698.1"
                     /db_xref="GeneID:11516804"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="JGIDB:Thite2_56460"
                     /translation="MAANGANGTNGSANGVSGRKHYNEGTFLFTSESVGEGHPDKIAD
                     QVSDAILDACLAEDPLSKVACETATKTGMIMVFGEITTKAKIDYQKVVRNTIKDIGYD
                     DSSKGFDYKTLNLLVAIEEQSPDIAQGLHLDDRLENLGAGDQGIMFGYATDETPELFP
                     LTLLFAHKLNAAMAAARRDGTLPWLRPDTKTQVTIEYKHDNGAVVPLRVDTVVVSAQH
                     SADITTEKLRKEILEKIIKKTIPAKYLDDRTIYHIQPSGLFVIGGPQGDAGLTGRKII
                     VDTYGGWGAHGGGAFSGKDFSKVDRSAAYVGRWIAKSLVAAGLARRALVQLSYAIGVA
                     EPLSIYVDTYGTSEKTSDELVKIIRDNFDLRPGVIVKELDLAKPIYLQTAKNGHFGTN
                     QNFSWEKPKPLKF"
     gene            complement(<1991151..>1993645)
                     /locus_tag="THITE_26581"
                     /db_xref="GeneID:11516805"
     mRNA            complement(join(<1991151..1991404,1993360..>1993645))
                     /locus_tag="THITE_26581"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651651.1"
                     /db_xref="GeneID:11516805"
     CDS             complement(join(<1991151..1991404,1993360..>1993645))
                     /locus_tag="THITE_26581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651699.1"
                     /db_xref="GeneID:11516805"
                     /db_xref="JGIDB:Thite2_26581"
                     /translation="PGVERRHHGHNVGTRATTWALGAYRGHRGHNAGTTATTRAPRPQ
                     RRHQGHTVGTMATTRAPGPQRGHRGQNIGTTATTRAPGLQRGHRGHTAGTGGTEGMPW
                     APGPQRGHRGHAVGTGATTRAPGACYRHRGHNAGTGATTWAPGACRGHRGHAVGTGAT
                     TQAPGAYHRHRGHAIGTGAT"
     gene            <1995497..>1998453
                     /locus_tag="THITE_35727"
                     /db_xref="GeneID:11514756"
     mRNA            join(<1995497..1996291,1996348..1996796,1997067..>1998453)
                     /locus_tag="THITE_35727"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651652.1"
                     /db_xref="GeneID:11514756"
     CDS             join(1995497..1996291,1996348..1996796,1997067..1998453)
                     /locus_tag="THITE_35727"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651700.1"
                     /db_xref="GeneID:11514756"
                     /db_xref="JGIDB:Thite2_35727"
                     /translation="MEAANAHYHNGHGQQSGPPLPASPTLTNPDMILPDYDDRSDSPD
                     PDMNRASHPSLMMWKNAHDSSTAGPDIHQMFVATGLAGPRPYGPAGPVTPTTPIIYGN
                     GTMLSDIGEVTEVESTVGKPSPTRTKSGIRRPGSPTRIGVNDVARRSSPTMGSSAVSK
                     KKSKQSLTAKRERRGSMDSDSTITTQDHQGLFADFDDSVSVGDSVFQGDDEESMASSY
                     VEGTAAVEPARPGVAKPDNVDRLSTYSTTSLSRRAEEILANAKRRLTTMEGNLTRARS
                     SLQYTSPYGSDGSTPSPPLQRAATAMYPLANGAGSSASTADSAPGHTRMSSDVAMRNG
                     LPYRVTLPRSQSALGAAGGYRQPLTASRSVDYIRGDKEEESHRRTPIANSLQETGLKP
                     LTEAEVARLGEADSASQNARLEANPPSRNPWNGEESSVDGDAREHNTGDEHAEGNDTD
                     YFDAEHEVHPEQATARVTDAGSLSPPAPALEAEGEVQDDGSDMLTENGDVDEDQQDEF
                     HDADEADYMSESGESLYHDTVQHQISHEDREDAFDYEHFFLHSALGTMSLRRRASSES
                     LTSEDSVETTRGPVANETKSDDGSAAEPRVWSRRNSSNSISTIDTFATAHEGRSLKSP
                     ALSEEVPNPPTRTNEGSIRAASAQSHRYRSGSTATTKRRSFNTGSTRPLTSQTGARDS
                     DGSISPIAEEGRSSSVAETHASQTSRRLSVIHRPISTASSLHRPSISSFDSVGTNRSF
                     PLVNKTSLPGSKKANSTGVLTPRDSPDQELNTIASRLMSDLGSAAAEQQQHHHGAAAN
                     GGGGGGEAKMMAFGPHPLEALLREDKYLVERLVASVGRCVLGLTENGRASAESRMYRR
                     RLNAAMRVLEGFDAADDDAV"
     gene            complement(1999340..2001022)
                     /locus_tag="THITE_2112278"
                     /db_xref="GeneID:11514757"
     mRNA            complement(join(1999340..1999570,1999648..2000380,
                     2000447..2000714,2000978..2001022))
                     /locus_tag="THITE_2112278"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651653.1"
                     /db_xref="GeneID:11514757"
     CDS             complement(join(1999484..1999570,1999648..2000380,
                     2000447..2000649))
                     /locus_tag="THITE_2112278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651701.1"
                     /db_xref="GeneID:11514757"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="JGIDB:Thite2_2112278"
                     /translation="MASEEVPKTCKVILADTIAKKLLAEVRETLASVQGPESSKPTLV
                     AFLANGDPAADQYAEWSKKTCEENGFHFDLRKVDKEDLEEAIVAANQDDSVDGILVYY
                     PIWRNNKQQDRYIQETVALSKDVEGLCHTHLFNMYHNVRFLDPPTNQKKSILPCTPLA
                     IVKTLEHLQIYNPILAYGNRLFGKTITVINRSEVNGRPLAALLANDGATVYSVDITGV
                     QVFTRGSGIRAPRHQVHDKEGWELKDVLPLSDVVIAGVPSEDFKVPTELLREGAVCIN
                     FSSYRNFDGPAVKEKASIYVPSVGKVTIAVLLRNLVRLIANRPRPEGAADAAIEKARN
                     EAFKDG"
     gene            2001699..2005977
                     /locus_tag="THITE_2112283"
                     /db_xref="GeneID:11514758"
     mRNA            join(2001699..2001923,2001982..2002128,2002349..2002938,
                     2003033..2004679,2004736..2005977)
                     /locus_tag="THITE_2112283"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651654.1"
                     /db_xref="GeneID:11514758"
     CDS             join(2001836..2001923,2001982..2002128,2002349..2002938,
                     2003033..2004679,2004736..2005728)
                     /locus_tag="THITE_2112283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651702.1"
                     /db_xref="GeneID:11514758"
                     /db_xref="JGIDB:Thite2_2112283"
                     /translation="MAQFKQWALQYVLSDDETAQSEIARKAAREIESSRASSAAVGNW
                     AASVQQWMTPASADDEQMEDGDQGGSGDIIARAKVLRLIGFFGAMFSYDHKAGITASA
                     KALRQLYRMKSFKPDMGSKILEDVCKIKEDFRLQTAATRLEIYELFLSLVQDPAVSSE
                     LKHKYGSSCGFVVDLLQLCQSERDPRNLMVWFKTLALLLRDYDPSPEVTEEIFKTFSA
                     YFPISLRSSATPIGITAEDLKEAVRSCFAAHQRVAPHAFPFLIQKLDQGDAVTVAVKV
                     DILKTIRACIELYDNPQASIVPHIEKIWNSLKYEVRNGEVKETIDATLDVLRAIARKL
                     DGTKTQKLDVSLLKSYVDLVSRDCRDDLANPTYTKQAGLLLMTVISANIRAYVLYNAS
                     FIGTVRQNLRQPKSPAHTCDLLLLLNSLLKTRIELLKDRSCGHPDDEASLRTESRTHL
                     DTLFHDVYLPIWTDKANESAPEARDVVKQAIQGLALLASQQILRPDGTLVLLCSRSVC
                     SEICSLLTRTILRSLTLSPNDNNRADETTLEDEAVLALRTIVMSYTDGYDEIASRAMS
                     EIRHRDWTNPSDYALRALQDLLSRLSFIGCSEIPSSIAAETPSRKRYSPVQHFITFTA
                     SLLDAFPLSSQTGSPRPNDSVEGPSANAHVISSLHAGVLWFLDACEAKYGRQAFPSSG
                     SGENWVGEYEKLPEDWLLQLQRGDGASDVLLLPPLTDENPEVCRQFLKLSLFMVRSLY
                     RSARSGPRAPWDERALIPLSQMAALVVRNLDEALQVSCNLAHEAFNFFGGSDSASAQP
                     HSSELSLNLLTLGILQGLRPGALAGLYEPGGAAEKLMCNVTDFGSSPSRESDIRAAIG
                     AILANKYKGGPSTSDPEVVVMRRVFDFWANWMKEATTSAPLDREAFHAHSTVAMNVLA
                     GAAARQDKHVLNLVPALHQAAASQHLNGEIVAQSLGLVVKQNELLSPNNHAVVKRFYK
                     QWAYSHLAKPLLQDAQPAAADSHTAARYRLAILSMVSNCPFAVYQDDLEPLIRLLVTA
                     LNNHAGLSEEVAWSQVAAALEILADILANEPDALKGHLRETIGGASRVYQECSRKIEA
                     VPPVTRTRCRKLALQVLGAIPTRFEERYVLSYSPPTQRMLAVACGDPVRNVREVARKA
                     RASWAKVV"
     gene            complement(<2006111..>2006897)
                     /locus_tag="THITE_2086847"
                     /db_xref="GeneID:11514759"
     mRNA            complement(join(<2006111..2006769,2006855..>2006897))
                     /locus_tag="THITE_2086847"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651655.1"
                     /db_xref="GeneID:11514759"
     CDS             complement(join(2006111..2006769,2006855..2006897))
                     /locus_tag="THITE_2086847"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651703.1"
                     /db_xref="GeneID:11514759"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="JGIDB:Thite2_2086847"
                     /translation="MAVSQEKVTVYNLADLKTTSDDAIPNYLNSLKFRQSHRLTDVRL
                     ALGYSALALAAACFAWDYKLGFESTKHLTAAAVVVYTLLNGALTFWLFYVERGTVYVG
                     TAPSGETLRISTATKKNVPTYHVTVEVQPKNGGKKEVLKISRAFTEWFDGAGHFVAAP
                     FQSMLASAVPVVGKLDPKRAAPQESAMPVPAAYTPEMLDVLAKANASVVGSAAEEATG
                     SETPVPKKGGKKRRA"
     gene            2007178..2008365
                     /locus_tag="THITE_2112286"
                     /db_xref="GeneID:11514760"
     mRNA            join(2007178..2007317,2007376..2007409,2007505..2007865,
                     2007931..2008092,2008159..2008365)
                     /locus_tag="THITE_2112286"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651656.1"
                     /db_xref="GeneID:11514760"
     CDS             join(2007271..2007317,2007376..2007409,2007505..2007865,
                     2007931..2008092,2008159..2008337)
                     /locus_tag="THITE_2112286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651704.1"
                     /db_xref="GeneID:11514760"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="JGIDB:Thite2_2112286"
                     /translation="MAQVPVQTIHRDPQLFYWILFPITIVMILTGVLRHYASVLMASA
                     PKKLDQKTMREQRALLHGINVRSNYHVLSKSSFTARRDALITAYESGDYLKDPDARGQ
                     PPPNPMSDPSAMEGMMGMMKNQMAMIIPNTLIMSWINAFFSGYVIMKLPFPLTIKFKS
                     MLQAGVATKDMDPRWMSSISWYFLCIFGLQPIFNFLLGSENAANQMAQQMTQMGPQAG
                     QMFGPGVDPNKQFLAEAENLAVIEHHSVLDGVEQRLLEGIKV"
     gene            complement(2008365..2009513)
                     /locus_tag="THITE_2112289"
                     /db_xref="GeneID:11514761"
     mRNA            complement(join(2008365..2008633,2008694..2008757,
                     2008826..2008912,2008986..2009082,2009150..2009248,
                     2009323..2009367,2009444..2009513))
                     /locus_tag="THITE_2112289"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651657.1"
                     /db_xref="GeneID:11514761"
     CDS             complement(join(2008393..2008633,2008694..2008757,
                     2008826..2008912,2008986..2009082,2009150..2009248,
                     2009323..2009334))
                     /locus_tag="THITE_2112289"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651705.1"
                     /db_xref="GeneID:11514761"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="JGIDB:Thite2_2112289"
                     /translation="MFILTKIADLVQIAPHDFRKQSYVAIEDNINSKYANKVVQKIGL
                     CICLWDILWTSEGLIGQGDGMVNVNVEFRMVVFRPFKGEVIVARITDQSSEGIYLATD
                     FFDNIFVPWTELPEGSEFEPNENLWVWKEEDQVMYFDNNEMVRVKVISEEWHDQTPLK
                     PIETEEGAEEQPAAVNSKPPYKITGSMNGPGLGCCLWWE"
     gene            2010104..2012393
                     /locus_tag="THITE_2112291"
                     /db_xref="GeneID:11514762"
     mRNA            join(2010104..2011287,2011347..2012393)
                     /locus_tag="THITE_2112291"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651658.1"
                     /db_xref="GeneID:11514762"
     CDS             join(2010233..2011287,2011347..2012133)
                     /locus_tag="THITE_2112291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651706.1"
                     /db_xref="GeneID:11514762"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="JGIDB:Thite2_2112291"
                     /translation="MSYNYGPPPPPPPPAPPSGGPGGYTSYGPPRGGHSGRGRGGLDR
                     GGYHQPHPGYGYGQQPPYGSQNPASYAGPSAQPGYAQPPQHSWNPEHGQHHAPQGAPH
                     APLPVHNYHPNYAPQLYQHQPPYGAQPPYQTAPQPPYGQPYPAPTPQAGPPAQQWGPP
                     SQSPPSHGAYGGGGRGGRGGYNERGGHKGQLMGPPIRMGFDGGNPQAPPAPVSAPYPY
                     GGPPAPPAPFPPPYQGYPPPGPYMPVPSPFDAHSGHGSRHHGRGGFHHSKSRPQFGGD
                     KNRSRNHNQSKGQTAQTAQTTQTPPIQHQKPDAASAGKKKKRKTNTLGLTPGDESDED
                     DENEEERLNEMYGAEAPNPQTSSEIAAWIAERRARYPTKSRVEAKKAALKAQNGDANQ
                     ERSSLELKAEKLRKQLEKVESSIKRKREQQDEGDEMRDLDLGSPSSSNAGSDDEKPES
                     MSSRPQPSNVPPPLKKADPTKHCKYYSTGGTCGKRGKCRFVHDPAVREAALRERELNG
                     GRMTLQQRLILNDKDQEDLAIVETLKYLQDKGILPKKTAGAPASDKSSETATAPQSEL
                     PARPAEEGSSNGLPPIPPSSSSADDHTTKYAGWNLSGFGNTGVSSSE"
     gene            complement(2013065..2014902)
                     /locus_tag="THITE_2112292"
                     /db_xref="GeneID:11514763"
     mRNA            complement(2013065..2014902)
                     /locus_tag="THITE_2112292"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651659.1"
                     /db_xref="GeneID:11514763"
     CDS             complement(2013225..2014592)
                     /locus_tag="THITE_2112292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651707.1"
                     /db_xref="GeneID:11514763"
                     /db_xref="JGIDB:Thite2_2112292"
                     /translation="MAKFRLRMLPFSLVALVGLMASVGTAYSPLADASTASPSPSADV
                     ELICHTDNPAECYPKVFQPTHEFQVVHDDQDLPQGLHVRLDVFTGKKEAKINVPDESD
                     PALEGLPVDSSVVIVDRDQPEPDGPSHDQARLPPNAPAYDPAGKIKKPKSADAGEGSA
                     FYRSLTILKKGLDVDGALEMLEDISHDIYYGLKIAEDYDTVHELSCLASSSSSAAGED
                     NGTAENQATRARLAALTLSSTVQNNPKALAEIERHWPKLSAARCPSSPVPLGEATFTL
                     FPPSPSRSPNHHPADAAALTKARVSLLSGLLKSPALRRAFLASDGPSHLVRLLASSPS
                     TSTSTSTSAADDDEAWAPAQRAAAFLLIDNFLDPDMGATLGEWPTRAQLADGDCAARD
                     GKGGSEEEAVEECLDWHVQRIATKYKGVSDHWSHDLRSKLGKYRTAAAAGAAAQDESR
                     KKLDL"
     gene            2015091..2016384
                     /locus_tag="THITE_2094941"
                     /db_xref="GeneID:11514764"
     mRNA            join(2015091..2015450,2015534..2015775,2016099..2016384)
                     /locus_tag="THITE_2094941"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651660.1"
                     /db_xref="GeneID:11514764"
     CDS             join(2015310..2015450,2015534..2015775,2016099..2016237)
                     /locus_tag="THITE_2094941"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651708.1"
                     /db_xref="GeneID:11514764"
                     /db_xref="JGIDB:Thite2_2094941"
                     /translation="MSALRPRAAQLARTARRAAQTGARSTRSYASSHGHHEPAHTVEE
                     PLGTAFYIAVGVIPASIFVYTVSRPGENGELSFIHKWLQKISDYRNKWERQNHLMAAA
                     LQQAAHDKHLLYTAERSRHYELTYPEVFTHGSPFNVPAGHYTNIDKVIAHYKQQHLEE
                     EARKAKKLAAASP"
     gene            2016395..2017938
                     /locus_tag="THITE_56443"
                     /db_xref="GeneID:11514765"
     mRNA            join(2016395..2016642,2016826..2017938)
                     /locus_tag="THITE_56443"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651661.1"
                     /db_xref="GeneID:11514765"
     CDS             join(2016583..2016642,2016826..2017770)
                     /locus_tag="THITE_56443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651709.1"
                     /db_xref="GeneID:11514765"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="JGIDB:Thite2_56443"
                     /translation="MASTSGSTPDEVFDASKHAKAPPRFYISAPQDAPAVRVGLVSPT
                     IGYGLFAARDFAKDEFIFHEAPMMTALFNEKFAADQTLVQSQVAAYRAALASHPATAV
                     AFPVPAARFGIAPPAFDRAAAVLASGELGRNLAHGRFAGSTVTRDQYDAYVAGIKAVE
                     KPSEADARDACLDFFKHYAFEVGGRGAGSGVAAAAAAASSFSASASSSSSSSSCPASS
                     ASVTREACIYLLGSLINHCCTVPASSSGFLGSSGKRSSSSSLSGTEQGPNCCWRIGPS
                     GLAHFVKPRHICVQARRAIREGEQLTWDYGKREKGFVCECDTCRGSFVGGLGQICAIL
                     "
     gene            complement(2017892..2019117)
                     /locus_tag="THITE_126248"
                     /db_xref="GeneID:11514766"
     mRNA            complement(join(2017892..2018233,2018309..2018605,
                     2018767..2018843,2018972..2019117))
                     /locus_tag="THITE_126248"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_003651662.1"
                     /db_xref="GeneID:11514766"
     CDS             complement(join(2018164..2018233,2018309..2018605,
                     2018767..2018843,2018972..2018989))
                     /locus_tag="THITE_126248"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_003651710.1"
                     /db_xref="GeneID:11514766"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="JGIDB:Thite2_126248"
                     /translation="MADVEYNAEEAAELKKKRAFRKFSYRGIDLDALLDLNSDELRDV
                     LHARARRKINRGLKRRPMGLIKKLRKAKQEAKPNEKPDLVKTHLRDMIVVPEMIGSVI
                     GIYSGKEFNQVEIKPEMVGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK"
     gene            complement(2019290..2020671)
                     /locus_tag="THITE_2112302"
                     /db_xref="GeneID:11514767"
     mRNA            complement(join(2019290..2019945,2020004..2020671))
                     /locus_tag="THITE_2112302"
                     /product="glycoside hydrolase family 53 protein"
                     /transcript_id="XM_003651663.1"
                     /db_xref="GeneID:11514767"
     CDS             complement(join(2019495..2019945,2020004..2020605))
                     /locus_tag="THITE_2112302"
                     /note="CAZy_ID 269705"
                     /codon_start=1
                     /product="glycoside hydrolase family 53 protein"
                     /protein_id="XP_003651711.1"
                     /db_xref="GeneID:11514767"
                     /db_xref="InterPro:IPR011683"
                     /db_xref="JGIDB:Thite2_2112302"
                     /translation="MMLAAVFTLSLGLSTANAALTYKGADWSSVLVEERAGISYKDAN
                     GNTQPLEKILAANGVNTVRQRVWVNPADGNYNLDYNIALAKRAKAAGLGVYIDFHYSD
                     TWADPGHQTTPSGWPSDIDNLAWKLYNYTLDSANAFQDAGVQPAIVSIGNEITNGLLW
                     PTGKASNWGNIARLLHSAAWGIKDSRLNPKPKIMIHLDNGWNWATQNSWYTNVLKQGT
                     LLQSDFDMMGVSFYPFYSSSATLASLKSSLSNMASSWGKELVVAETDWPTSCPNPRYS
                     FPSDVKNIPFSAAGQVTFITDVANVVASVSGGVGLFYWEPAWIQNANLGSSCADNTMF
                     SQSGQALSSLSVFKQI"
     gene            complement(2020673..2022968)
                     /locus_tag="THITE_2112304"
                     /db_xref="GeneID:11514768"
     mRNA            complement(join(2020673..2020920,2020971..2021289,
                     2021368..2022968))
                     /locus_tag="THITE_2112304"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651664.1"
                     /db_xref="GeneID:11514768"
     CDS             complement(join(2021092..2021289,2021368..2022342))
                     /locus_tag="THITE_2112304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651712.1"
                     /db_xref="GeneID:11514768"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="JGIDB:Thite2_2112304"
                     /translation="MAALPASVPPTHPAVVITAIRQPLEITNLPTVPPGDGEVLIHVT
                     WTSSSPLDLHRADGGLLVSTTPFPMGSSFAGTVVALGGRGRGGASSADSRLRVGDQVF
                     GFAMDGSAEAAGAQTYVTQPTWRVSKLPPNLTLAEAVGVPTNLVTAFHAITADLGLEL
                     PWPVPQGWTPPRADELVLVWGAASSVGMYVLQVLRHWGYRNVLAVASGKHHDSLKALG
                     AKECFDYRNAGVVDEILGYVERVKGRVANGPKLPSIVDCIGSKEGTLRPLTKIAEPGS
                     NVAVMLPVINVHASEDQVPEYEMDVSKVLPGEWREGVDVKGTRTHFYARNEFFKEHLQ
                     AEIVPTLLEQGVVQPNKQRFVEGKTLLERAQNALNLLRSQAVSGEKLVWRVAEEED"
     gene            2022982..2024333
                     /locus_tag="THITE_2112307"
                     /db_xref="GeneID:11514769"
     mRNA            join(2022982..2023861,2023929..2024333)
                     /locus_tag="THITE_2112307"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651665.1"
                     /db_xref="GeneID:11514769"
     CDS             join(2023396..2023861,2023929..2024251)
                     /locus_tag="THITE_2112307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651713.1"
                     /db_xref="GeneID:11514769"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="JGIDB:Thite2_2112307"
                     /translation="MPSPRRLRVLVYLVFAGFVTLLFFTSRARHAREADTRSLRDFYS
                     KTAAAIDKAHGETVMAKHDVDADGDIDADDDVLAREMAARLRQAEQRAKDSAEAKGPS
                     KPDPPEKVIGVGSAAKGQERGGPKAKAEVEVKESEEEDPEVEVQLNDILKKAPVIIFS
                     KSYCPYSKRAKGILLEKYVIEPTPYVVELDLHPLGPKIQARLGEMTGRKTVPNIMVYG
                     KSIGGGDDIAALDREKALADKITSLGGSRVQVSERFVGSSQKKD"
     gene            2024694..2025683
                     /locus_tag="THITE_2112309"
                     /db_xref="GeneID:11514770"
     mRNA            2024694..2025683
                     /locus_tag="THITE_2112309"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651666.1"
                     /db_xref="GeneID:11514770"
     CDS             2024906..2025442
                     /locus_tag="THITE_2112309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651714.1"
                     /db_xref="GeneID:11514770"
                     /db_xref="JGIDB:Thite2_2112309"
                     /translation="MASVPGGCICYINNTGSVPFPLEFSASRASSTRRDPALVTHASS
                     SQSDLPASFRKHKTYTALCKTYDRILFKVPELVVCIAEKLCLRELWSLMSSSKGLYTL
                     IKTSSRPRRGLRGGGPPARNVPNGALLLSTEAQRRPGLVCHFFDACPGRAQKTRLVGP
                     GLRWVPSRVLQPLHQVII"
     gene            <2026928..>2029563
                     /locus_tag="THITE_2154006"
                     /db_xref="GeneID:11514771"
     mRNA            join(<2026928..2026972,2027130..2027554,2027683..2028256,
                     2028361..>2029563)
                     /locus_tag="THITE_2154006"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651667.1"
                     /db_xref="GeneID:11514771"
     CDS             join(2026928..2026972,2027130..2027554,2027683..2028256,
                     2028361..2029563)
                     /locus_tag="THITE_2154006"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651715.1"
                     /db_xref="GeneID:11514771"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="JGIDB:Thite2_2154006"
                     /translation="MDTCPKWAGEPQELANGIVGFGISLYPDLCCQACHDSLSSLYLT
                     CTTFTDGGDMAGMDMRKRDMGDMMMMGTTSDECRANNTAWLQTMAYCIQQNCDADGYP
                     ADKQAECFSNQAVAGAPKPTFQESLPAVPPTVELPADAVWLNTTSLVNKDLYYSTVAL
                     YFVVIGICIVCGLLAQAASAIPRFQKALQASAVWSSLRRLVFLPALFGGRRLEPLPGS
                     FGYVPGRALSLFIAVYVVLNIIFSAVSFGSFQPNVYFFSKGFELCEYVGNRTGTLSLV
                     NMSIAILFAGRNNVLIALTGWSQTTFLTLHRWTARVAAIQAVVHSIVYTLAYFEPGYD
                     GASAYAAKAAESFYWWGIIATIAMCLAVGFAFLWLRARFYESFLLLHIALVILTLVGC
                     WYHLVPHFGFDYGYQVWLYICFAFWAADRLARLARIGYYNTLGGSKAVVEPVPGCDNI
                     MQVTVFPRVISGFGPAQHSFLYLPGLQGRFWESHAFSVAGWRTPGRARRTGPAPAAPA
                     PEFDSDEKETNVEHSRAVLSANTEAQTPGPAAVRFLIRAHSGITLTLRRRLLSSPSRS
                     KLELSVYTEGPYAGHRATLAPLFVADTIICVAGGIGITHILGFVQAYASGKLRENAGE
                     SQGKSRNTMEAKRFILAWSAREMALIEHVKQNFLADVEGVECWFWCTDSSFTSPKDES
                     SDEGGQGVKAGRMDIESVLRAAAEPGQQTAVLVCAPGGMADEVTRQVVRCVKDGLKVE
                     LVEETFAW"
     gene            <2030110..>2031195
                     /locus_tag="THITE_2086860"
                     /db_xref="GeneID:11514772"
     mRNA            <2030110..>2031195
                     /locus_tag="THITE_2086860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651668.1"
                     /db_xref="GeneID:11514772"
     CDS             2030110..2031195
                     /locus_tag="THITE_2086860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651716.1"
                     /db_xref="GeneID:11514772"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003421"
                     /db_xref="JGIDB:Thite2_2086860"
                     /translation="MQTNVSIVGAGPAGFALAADLQRHGKGVLLYAHPTHLGHANRVR
                     DRGYLKASGALEAWATLRVTSDMGEVVAFSETIILTVPSTGQETVLRELKRFALHRHI
                     IIAVPGNLFSLIADLDVGCIFETNLSPYSCRMEEDGLTVLGRKNLVFIAPLQRGLSAA
                     IYDTVRDIFPVELRWCSSVIEVCLSNVNGVFHPLMMLMNAGRIESTAGDFLLYRDGLT
                     RSVANAMLAVDRVRIQIGQALGLRLKSAVDISNECYGQSFTDLVDLAQNSPPHNRLKA
                     PSSMSNRNISEDVPDLLVCWYSLAEKLGIDATPIKAVIVLVEMATGNDYLGTGRNLRR
                     LQLQDMSLGELIGRFGGEPCDMIASRL"
     gene            complement(<2031269..>2033006)
                     /locus_tag="THITE_34254"
                     /db_xref="GeneID:11514773"
     mRNA            complement(join(<2031269..2032102,2032179..2032635,
                     2032783..>2033006))
                     /locus_tag="THITE_34254"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651669.1"
                     /db_xref="GeneID:11514773"
     CDS             complement(join(2031269..2032102,2032179..2032635,
                     2032783..2033006))
                     /locus_tag="THITE_34254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651717.1"
                     /db_xref="GeneID:11514773"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="JGIDB:Thite2_34254"
                     /translation="MLPAHRPEKLPSTSSPESAPLGTGEGDHGTEPEAEPIISVGWDE
                     PEDQDRENPLNWSPVVKWTNILTISVISFLVPLVSSMLAPAVQLVMQDFETESTSFAT
                     FSVSIFVLGFACGPLLLAPLSELYGRAIVYNVTNVLFLAFTVLCAVSRNPPMLLLSRF
                     LSGFAGVATITIGSGTIADLMPREKRGKAVSVWSVGTILGPMVGPIIGGYVTEVAGWR
                     WMFWAVSIVIGVVTIFAFFVLSETYPAVLLERKAARLRRETGDHRYRSKLASDVSSAE
                     LFRRSIIRPTKMLICCPLVTIMCSYVAVLYGILYLLFATYSFVFKEVYGFSTFAAGLV
                     FITGGVGTLLGLLYTGRFSDRSLKKQAAAGKPVTPEHRLPLVITLPGALAFPLGLFIY
                     GWSVEVRAHWIVPQLGTAVTGLGSILVFIGIQTYLIDAFEEYAASVIGANAVLRGTAG
                     ALIPLCGLNLYNVLGWGWGNSLLAFVALAFAPVPWVFGVYGARIRSFKFFQLKA"
     gene            complement(<2033578..>2034360)
                     /locus_tag="THITE_2086862"
                     /db_xref="GeneID:11514774"
     mRNA            complement(<2033578..>2034360)
                     /locus_tag="THITE_2086862"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651670.1"
                     /db_xref="GeneID:11514774"
     CDS             complement(2033578..2034360)
                     /locus_tag="THITE_2086862"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651718.1"
                     /db_xref="GeneID:11514774"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="JGIDB:Thite2_2086862"
                     /translation="MADTEELARGYTLVNDTQYNAGLFLLQRLAVVPGMRVLDVGCGP
                     GNLTAYIAQLVGDDGTVVGIDPSKERIAIALRTAVRPNLTFLEGRAEDLSRFPAASFD
                     IVFVNSTFHWVRDQPAALREFARVLRPGGRLGISGGSGDFVAAHEKIKADVLSREPYR
                     RYPEESPPVFLKRREMEGLLDDAGFADRTIVVNKIVKAARDADAMIDWLDTSSSGKTY
                     GSIPLHLRPSAREEMKREWDKLVTEEGIRMEMELLVTVAVKN"
     gene            <2034909..>2036708
                     /locus_tag="THITE_2143111"
                     /db_xref="GeneID:11514775"
     mRNA            join(<2034909..2034962,2035035..2035274,2035348..2035594,
                     2035675..>2036708)
                     /locus_tag="THITE_2143111"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651671.1"
                     /db_xref="GeneID:11514775"
     CDS             join(2034909..2034962,2035035..2035274,2035348..2035594,
                     2035675..2036708)
                     /locus_tag="THITE_2143111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651719.1"
                     /db_xref="GeneID:11514775"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="JGIDB:Thite2_2143111"
                     /translation="MASSFPLATAVTATLAILLVARAVFQIVQRRLFHPLRSVPGPWV
                     NSVSELPAALALVTGNQHLYYQSLHEKYGPVVRVSPNELSFISVEAREEIYGLRKGGL
                     NMEKSPIFLGAVGKVDGQTGVSLALNRDHARQRRALGNLFTNSSLLRLESLLQAQVHK
                     FVAILETMAAGNRSLNVSDWYTYLAFDMMGDLCFAEPFGCLDQASNTQWSTSVINVFV
                     AATWTQGIRRISGVGTWLESLMTRLLVPAKAAAWRTIHLENSREKTVRRLADSDRDHP
                     DFISQILNSESAKSLSRTEIILNMALFISAGTDTTATALTGWTYFVCTHPDVYGRLVG
                     EIRGAVTAADDIRWEKVRELRYLEATLNEALRLFPPSPASQQRIVPPGGATIDGYYVP
                     EGTTVGVSPWAATRSRLNFHEPDEFRPERWLVGTEACEGPGEPGHSSFGGDRLNASLP
                     FGTGPRVCIGKNLAYMEMRLIAAHLLWNFDIELDRGEHEEENRVWGLDGRMKPMKVFH
                     SMTKPPLWVRLQPAKR"
     gene            2039967..2041477
                     /locus_tag="THITE_2112310"
                     /db_xref="GeneID:11514776"
     mRNA            2039967..2041477
                     /locus_tag="THITE_2112310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651672.1"
                     /db_xref="GeneID:11514776"
     CDS             2040219..2040944
                     /locus_tag="THITE_2112310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651720.1"
                     /db_xref="GeneID:11514776"
                     /db_xref="JGIDB:Thite2_2112310"
                     /translation="MSRTLLRSVLELRTPATRLLPSTRPTAAAAAATGPLRAAASLRL
                     FNQTAQHIEPVASDSNNAANANLPSSSSFFASSTPSQQQPPAPTAPQQQQQQQAEQQR
                     SPAAPKPLSESVRTLLPILAAQPGHYITVHIQGQRFLVTAGDSVRLPFRLRGVVPGDV
                     LRLTRASVLGSRDFTLRGAPYVDERLFECRAVVTGTESEPLRIKIKKKRRCRREKHVK
                     SKHRYTILRISELRVRTEALNEA"
     gene            complement(2041478..2044735)
                     /locus_tag="THITE_2112311"
                     /db_xref="GeneID:11514777"
     mRNA            complement(join(2041478..2042662,2042721..2044735))
                     /locus_tag="THITE_2112311"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651673.1"
                     /db_xref="GeneID:11514777"
     CDS             complement(join(2041775..2042662,2042721..2044346))
                     /locus_tag="THITE_2112311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651721.1"
                     /db_xref="GeneID:11514777"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="JGIDB:Thite2_2112311"
                     /translation="MARDENAALFSDDESTKDLEALKPMKLSALTKALLGDNVSNGST
                     TPPRRSSIPGPVRPTPGDHESSWRRTRDGQIRRTPSPSGWEPRKQENSSPTPVNKTPS
                     PSPSRPQSPVPRKRVVRLGTGHSANSAQRSNPSTAHHHSQRASLSISTRGKRPQSSDG
                     SKVTKESPAVSQEQPAKTPVVPLRTVRIAVSSSGRKPTDGSSDVRPKYNTRSAAREAQ
                     SGPVSSTRSSAAASQSSMRVKRVAKNPGSFLSGPARRGLRRQSEEEPEAQPEVDADGS
                     SQEPRSQHPQSGSHQDPPQSAASRYDDSAASGSPISARVSALAALRKQKSTFMSPYGQ
                     QKSEDEHLKLLYRMPAPLPQDVAKEDKENNISSKIPAAAPTSIATKNRPPSAADEKVP
                     AQIAPPATSASIKAAPKDNDNVLAAKPHNAPQRSAAPPPPPKMSVVETATTAAGASTA
                     ASKKKQFLFRVNGRMYTRLDTLGRGASSKVYRVSAENGKILALKRVSLEGLDDRTIKG
                     YKGEIDLLKRLSGVNRVIQLIDHEFNEEKQMLSIVLEVGELDFLTFLRSRTSEDSKFD
                     PVFVRYWWKEMVECVQAVHAKDIIHTDLKPQNFVIAQGRLKVIDFGIANAIQTDMTVN
                     VHRDAQVGTPNYMSPESLMDFKEYALNSANQGSSGVPLLHRPKHFKLGKSCDVWSLGC
                     ILYQLVYGMGPFGHISNVVHRIHAIINFNHQINFPETTQDGVRVPPSLIRTMRRCLQR
                     DQSLRPSCDELLSETDPFLYPLELSPSVFAAADHGDVLPITSDLLRDVIWNVVRRCRQ
                     GNVDENEALRLWPAAYWASCKKVLAGMNASGGGGNGRQA"
     gene            complement(2044736..2045682)
                     /locus_tag="THITE_2112314"
                     /db_xref="GeneID:11514778"
     mRNA            complement(join(2044736..2045270,2045327..2045459,
                     2045520..2045682))
                     /locus_tag="THITE_2112314"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_003651674.1"
                     /db_xref="GeneID:11514778"
     CDS             complement(join(2045224..2045270,2045327..2045459,
                     2045520..2045678))
                     /locus_tag="THITE_2112314"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_003651722.1"
                     /db_xref="GeneID:11514778"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="JGIDB:Thite2_2112314"
                     /translation="MKHLAAYLLLGLGGNSSPSAADIKALFDSVGIEADDERLEKLLS
                     ELEGKDINELIAEGSSKLASVPSGGGAAVAAAGGAAAGGAAAEAPKEEEKKEEEKEES
                     DEDMGFGLFD"
     gene            2046112..2047865
                     /locus_tag="THITE_2112315"
                     /db_xref="GeneID:11514779"
     mRNA            join(2046112..2046455,2046514..2047865)
                     /locus_tag="THITE_2112315"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651675.1"
                     /db_xref="GeneID:11514779"
     CDS             join(2046450..2046455,2046514..2047665)
                     /locus_tag="THITE_2112315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651723.1"
                     /db_xref="GeneID:11514779"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="JGIDB:Thite2_2112315"
                     /translation="MPILDLLASITGEKPTPSSNPPPRPSTVQPKRKAEDELRSGGLK
                     AARTDSVPEKPSRPSSDSPRPSPRPADRPLGNSSDKPSSKPQSTVSKSATNERPGVAS
                     PNVNSTAKMPANGNKTLPSRPVTGNQSAADPAPPKKRSYAEIMARAKANAEQREALGK
                     IHHKTVERSMTMKERKELKAEELRKAKSAARKVVSGRTSASSTLARDTGQASGARDRA
                     LSGSTNGKKTAAVEEKKVKKAALATTGYTGTARPRTGAATTARSGAVSRPTTGAESRD
                     RARYGGPLSMSRKRYEEEDDDLDDFIEYDDEEEEQSGYGIGRRYQYDSYDDESDMEAG
                     LSVIEDEELEADRHARREDQEQEALEKRLKREKEERKRKLLQAAKSKTGVR"
     gene            2048433..2050518
                     /locus_tag="THITE_126245"
                     /db_xref="GeneID:11514780"
     mRNA            join(2048433..2048563,2048648..2048666,2048749..2049130,
                     2049193..2049224,2049284..2049306,2049362..2049410,
                     2049525..2049641,2049758..2049791,2049851..2049941,
                     2050003..2050518)
                     /locus_tag="THITE_126245"
                     /product="ribosome biogenesis protein NSA2"
                     /transcript_id="XM_003651676.1"
                     /db_xref="GeneID:11514780"
     CDS             join(2048561..2048563,2048648..2048666,2048749..2049130,
                     2049193..2049224,2049284..2049306,2049362..2049410,
                     2049525..2049641,2049758..2049791,2049851..2049941,
                     2050003..2050038)
                     /locus_tag="THITE_126245"
                     /codon_start=1
                     /product="ribosome biogenesis protein NSA2"
                     /protein_id="XP_003651724.1"
                     /db_xref="GeneID:11514780"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="JGIDB:Thite2_126245"
                     /translation="MPQNEYIERHRKLHGRRLDHEERARKKAAREGHKQSENAQNLRG
                     LRAKLYAKQRHAQKIQMRKTIKQHEERNVKGAPAEKEPSEPIPAYLLDRANPTTAKAL
                     SSQIKNKRAEKAARFSVPIPKVRGISEEELFKVVKTGKKTQKKGWKRIVTKPTFVGPD
                     FTRRPVKYERFIRPMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKG
                     TIIEVNVSDLGIVTASGKVAWGRYAQITNNPENDGCLNAVLLV"
     gene            complement(<2050961..>2051957)
                     /locus_tag="THITE_2154010"
                     /db_xref="GeneID:11514781"
     mRNA            complement(join(<2050961..2051337,2051431..2051561,
                     2051638..2051664,2051735..2051850,2051931..>2051957))
                     /locus_tag="THITE_2154010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651677.1"
                     /db_xref="GeneID:11514781"
     CDS             complement(join(2050961..2051337,2051431..2051561,
                     2051638..2051664,2051735..2051850,2051931..2051957))
                     /locus_tag="THITE_2154010"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651725.1"
                     /db_xref="GeneID:11514781"
                     /db_xref="JGIDB:Thite2_2154010"
                     /translation="MSGALESLRAAAERIVLDPKYHDLLTVVKGARNGAVYGTKVRFP
                     HALVMIMLFRSGTLREKAWLIFRATRTHARNLAKFAAIYKATCLLLKHFGPTPGKEGP
                     YDSFIAGLLGGYVVFGRRSKRSGRISSVNQQIVIYVFARVVLALARLAVKPGAGLPLV
                     SDPARSAAISRYAWPLFASLSWAAVMHLFKWHAAELQPSLRSSMTYIYANADSWDGLR
                     TLVWHNK"
     gene            complement(<2052977..>2055263)
                     /locus_tag="THITE_10560"
                     /db_xref="GeneID:11514782"
     mRNA            complement(join(<2052977..2054243,2054332..2054858,
                     2054961..>2055263))
                     /locus_tag="THITE_10560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651678.1"
                     /db_xref="GeneID:11514782"
     CDS             complement(join(<2052977..2054243,2054332..2054858,
                     2054961..>2055263))
                     /locus_tag="THITE_10560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651726.1"
                     /db_xref="GeneID:11514782"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="JGIDB:Thite2_10560"
                     /translation="RRRRLALSCRECRRRKVKCDHDTPSCANCLRNKTQCIYKAFSDD
                     APPYIRRPGLGRPGDAVDPGSAAPRPTAASSSPPSRAVHAHTIASTPQTDNANGSNVA
                     SDGPGDLPQSMSARRPGRQEPTLSDLLDRIQKLESSTPRTEAGRSPVVHEVAGAEPVA
                     RRPPAGSQQEWQAVLNKPRDWGRSRWISKAPEFGTMIRCYSEIMCKKSQDASFQAPET
                     TRLITEAADFLQKCKSRAKSIKVSRPTRSPPSTEAGSATYSREMADVLAKLYFTSIES
                     AHRILHAPTFWAEYEKYWERPESASPDLRHKVNLVIGIGSSLYDYGDAAASQRRTELL
                     HQWIYSAQTWLSGPLEKDRLDISGLQVYCLTILARQIFSIGGDTVWMSMGSLVHRAMQ
                     VGLHLDPKHLPAMPALQAELRRRLWATILEFVVQSSLDAWMPPRIALSEFDTEPPSNI
                     NDEDMDESTTAVQPRPRDTFTSTSLQLALLESLPTRLRIVELLNGMHSELRYERVLSL
                     TSELTSALQNQATLFQSPGNGSTPFHRNYLDYLTRRFIIPLHYPFSHQARVNPLFHRS
                     VKLSLDAGLALVSPEPDDGMFTRLTTISGGMFREGFQSATTAISLELLTHVATQRSDG
                     SLHRVHHYRGFLKQAVRDLIGVSEQRIRMGETNVKSHMFLSMILAEVEAVEDGKPVEV
                     EVARAARDSLRFCEGLL"
     gene            <2055762..>2057039
                     /locus_tag="THITE_2045639"
                     /db_xref="GeneID:11514783"
     mRNA            <2055762..>2057039
                     /locus_tag="THITE_2045639"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651679.1"
                     /db_xref="GeneID:11514783"
     CDS             2055762..2057039
                     /locus_tag="THITE_2045639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651727.1"
                     /db_xref="GeneID:11514783"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="JGIDB:Thite2_2045639"
                     /translation="MPARSLRVLISGGGIAGNAVAFWLAKQGHDVTVVERFPNLRATG
                     LQLDLRGPGIEVLRRMGLEEAFQAKAAPEQGMQWVDSKGRRRAYFPVNTSGTGRQSFS
                     SEFEIMRGDLCRLLYGAARSCKSAPQYVFGTSVESLDQRNDAVDVRFENGKTDRYDLV
                     VGADGQWSRTRKMLLGPGAPDGLQRLPGLYFAYFTMRKPIKEGEEYIATSYMAPGRRG
                     MLTRRHSPDEVQVMLSCKTDASRLENVPRGDAKQEKEVLAEVFKGAGWQTDDILKGMH
                     AADDFYCERVGLVKLQSWSSGRVALVGDAAYCPTVLTGMGTTCAMVGAYILAGEIGRH
                     CGQKGSGDVAAALKSYEQKFRPFMEAMQEGILEKAESQWAMGGSAFGIRVLNCIMGLL
                     SFFKVNVADVFGIRETVKGWQLPDYKEMAKTEA"
     gene            2058479..2060571
                     /locus_tag="THITE_2112324"
                     /db_xref="GeneID:11514784"
     mRNA            join(2058479..2058932,2059010..2059247,2059325..2060571)
                     /locus_tag="THITE_2112324"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651680.1"
                     /db_xref="GeneID:11514784"
     CDS             join(2058610..2058932,2059010..2059247,2059325..2060305)
                     /locus_tag="THITE_2112324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651728.1"
                     /db_xref="GeneID:11514784"
                     /db_xref="JGIDB:Thite2_2112324"
                     /translation="MHLLARRCCSHPGIRALHLSRIVAPRWAEHSSSLDTHRPLSPFL
                     VRRNYIQASKFPRWAEAIVIGGGPAGIAAVGTLLDHIPEGTIVWIDRSSFKGGSIGQL
                     YREVPSYSPAGDYLRYARTPKSFRDIVNAAPKPNAITALEELQPDMTCSLSYAADMLE
                     LITNGLLKHDRVEPVVGNVTNLGRNPGTRRWYVTLEPNEIGHDQSVLKYQTPMVVYCT
                     GSHPITTELPLDIPRLSLETGLAPSRLAKLLPTDKPCTVAVIGDGHSAVLTLRNLFYL
                     AAISHRHLRIRWFTRTANLRYAEETPEGVILNENTGLMGEAARFARAQLEGDKLETSD
                     AGAFITRVILPTSAGNDESATRSPEELESEVLAQNLEGVDYVIQAIGFTRSRLPALVP
                     RLSPYRDPLGKPKRMVFNALTGWFFPNFASRSNVIGLFGAGSAFPELEFTSEGWRSPA
                     VSIWKFMRFLQRMVPKWIEATKKGKFAEPPNRQECIEEAPRVVPPERLECIEEAPRLH
                     GGGSS"
     gene            complement(2060490..2062385)
                     /locus_tag="THITE_2112326"
                     /db_xref="GeneID:11514785"
     mRNA            complement(join(2060490..2060569,2060733..2062385))
                     /locus_tag="THITE_2112326"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651681.1"
                     /db_xref="GeneID:11514785"
     CDS             complement(2060858..2062138)
                     /locus_tag="THITE_2112326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651729.1"
                     /db_xref="GeneID:11514785"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="JGIDB:Thite2_2112326"
                     /translation="MARAAISLIALAAAAQALPRQSPSLKRDGASFTSQGCFVDNANN
                     QRLLSGASYADDGMTVESCAAFCTKFKYFGVEYGRECYCDNSLSATATADSDCAMPCA
                     GDADETCGNGNRLNVYLNNNYVAPKVATLSVPYLGCFVDQGARVLPDDLLGADNMTAQ
                     VCAAHCADYSYFGVEYGRECWCGNSPPTTTAAESDCSMVCAGDDTQICGAGNRINVWG
                     SPLASPDTVGDYEYVGCFTDSNDNRSLRGLVTYDPAMTLEKCAAACSLYSYFGVEYGT
                     QCYCGASLEPSAQQVPQAQCSLRCGGDYNNVCGDADRLNVFLTSECKDEPANVPSVDG
                     FSYKSCWTDDVNNRSLADNVLRSDDMTVEKCAAFCQGSSYFGVEYGRECYCGNVLGGA
                     SASEDECSEVCFGNGAEWCGAPSRLNVYSAVLRR"
     gene            2066857..2069252
                     /locus_tag="THITE_2112328"
                     /db_xref="GeneID:11514786"
     mRNA            join(2066857..2066987,2067130..2069252)
                     /locus_tag="THITE_2112328"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651682.1"
                     /db_xref="GeneID:11514786"
     CDS             2067417..2069123
                     /locus_tag="THITE_2112328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651730.1"
                     /db_xref="GeneID:11514786"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="JGIDB:Thite2_2112328"
                     /translation="MLGPARYEEKVITNGTTARMVLVFLRELLEQLPAGEQVQQSYGC
                     PMTKCHRTFSAPLQVIQHLLSCPELLNGEFDCDKCNTWHSFPTNEKDWAQWTGWRSPT
                     SPHPIQRKRSLGSKMKETFALRKKDASRKQNSVFDPHFKGTYPMDTRPSTAASETPSM
                     AFASRAFEQHGVFPAQPEQRLDFSALQKPMSPNGLLDVSDSMFWSGLNASDLPSTVSS
                     VAISSAADESPSEPFSQNTSQTTLFSSGLGPYQSPTSAARDSSKTLEARPFIFATQPP
                     FGPALTSLPAHPPSVSAMSLDDPAPANQAPLSPAELGQTATNGGQAWWDPKVDVETTR
                     ATPPSSGPGQGPCFPLQTPIESILPGSVNSGLSSPTSPCEDGPPYYQMAPAAAPPISR
                     ALSHESMHTGITTVFGTPTPEGGARGALSPHGENNNNNSNSNNNNAQRSVTVPPKALP
                     ESSVEDLVCDECQWKPRGVKENLKGYLRKHKNTHKGVRLACDVPGCVKTFSRLDNLKK
                     HKKDKHGIEDTGSAVAAKRATGDLAKRMEEGAETKRPATVESEIRGPTEDYSMLWPAL
                     HF"
     gene            2069771..2070922
                     /locus_tag="THITE_2112330"
                     /db_xref="GeneID:11520531"
     mRNA            join(2069771..2070338,2070424..2070922)
                     /locus_tag="THITE_2112330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651683.1"
                     /db_xref="GeneID:11520531"
     CDS             join(2070189..2070338,2070424..2070684)
                     /locus_tag="THITE_2112330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651731.1"
                     /db_xref="GeneID:11520531"
                     /db_xref="JGIDB:Thite2_2112330"
                     /translation="MEGAHTQKGPKKMSHPHHPHHVVPKHESGYTDEAAEECHDLIDK
                     AEEDAHLHDPNSMYSITDKPEPVHRMKGGLESAGAGAGAGVGAAGAGTGTGAGTSAET
                     PRSTAEKMQETGKHIKSTIGEKVEHMKEKMGMKK"
     gene            complement(<2072655..>2073419)
                     /locus_tag="THITE_111545"
                     /db_xref="GeneID:11520532"
     mRNA            complement(<2072655..>2073419)
                     /locus_tag="THITE_111545"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651684.1"
                     /db_xref="GeneID:11520532"
     CDS             complement(2072655..2073419)
                     /locus_tag="THITE_111545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651732.1"
                     /db_xref="GeneID:11520532"
                     /db_xref="JGIDB:Thite2_111545"
                     /translation="MPNSQSKLDLHEQHLAKVQGPSAGTSTGTHFNDPVQQSLPIEVV
                     GASEHQCRGVSSDMAQQGRTRLPHKEDDSWTDHDSAIYMRSDSSSVESSSDTEGKFVV
                     PLVQGEQLQEQREQATFLLNWQWKMDIARLDGRKYTWTETRLRNFQWSEEFYVDESGF
                     LGVLAERANEQFRAAIADDPASYGAASCHWHKTKAPARLPRRKKTENEKEETPTVPKI
                     VLTDPQGENWFLNDLRYYPDDFDEDDEEEEDESIYW"
     gene            complement(2075870..2077802)
                     /locus_tag="THITE_2112332"
                     /db_xref="GeneID:11520533"
     mRNA            complement(join(2075870..2076354,2076419..2077438,
                     2077504..2077802))
                     /locus_tag="THITE_2112332"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651685.1"
                     /db_xref="GeneID:11520533"
     CDS             complement(join(2076047..2076354,2076419..2077438,
                     2077504..2077621))
                     /locus_tag="THITE_2112332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651733.1"
                     /db_xref="GeneID:11520533"
                     /db_xref="InterPro:IPR001092"
                     /db_xref="JGIDB:Thite2_2112332"
                     /translation="MDQQRPASQKFPAGLAGVLNSPEENRDSAYYSSTDASSKHTSAA
                     SGIGVLSPPHSGFQPSPVDKTPSPTATTSHLLPQPLVSPTTSNGNMSVASIVSPTTPG
                     SADPRRFDRPQSLDSAPSSATFLSGEVPEALSRRESVDSRINQGFHDMRLGNSPYASH
                     NHSTTSIHTTLQQQRNPRPGLDNLAVHRISNGYQPSADRNPEGHPKTMRIAPAITGPA
                     TSQIARAAEPTKGQAWAFPEEEIQRMPSAAAQSLGDSRRSSVAESLASSQYTTDGRLP
                     PGQRRLEDSMGASAYQRLSNASGEYSTVHHHTLQHKQLGDLRNEEAGSHAGTQPYSRT
                     PELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRQNELIR
                     QLQALNSAQQNEIEMLRRELQERMHGAPPPRPADPYAGDQFGRPRPPELPPLRSLQSA
                     APPSGGPESMTGVQYEAPRANGYRTAEPTRF"
     gene            complement(2084731..2084802)
                     /locus_tag="THITE_t79"
                     /db_xref="GeneID:11520534"
     tRNA            complement(2084731..2084802)
                     /locus_tag="THITE_t79"
                     /product="tRNA-Gly"
                     /note="Anticodon: TCC"
                     /anticodon=(pos:complement(2084767..2084769),aa:Gly,
                     seq:tcc)
                     /db_xref="GeneID:11520534"
     gene            complement(2084810..2084889)
                     /locus_tag="THITE_t78"
                     /db_xref="GeneID:11520535"
     tRNA            complement(2084810..2084889)
                     /locus_tag="THITE_t78"
                     /product="tRNA-Ala"
                     /note="Anticodon: AGC"
                     /anticodon=(pos:complement(2084854..2084856),aa:Ala,
                     seq:agc)
                     /db_xref="GeneID:11520535"
     gene            2085048..2086699
                     /locus_tag="THITE_2112338"
                     /db_xref="GeneID:11520848"
     mRNA            join(2085048..2085193,2085267..2085525,2085598..2085721,
                     2085789..2085918,2085982..2086699)
                     /locus_tag="THITE_2112338"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651686.1"
                     /db_xref="GeneID:11520848"
     CDS             join(2085192..2085193,2085267..2085525,2085598..2085721,
                     2085789..2085918,2085982..2086444)
                     /locus_tag="THITE_2112338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651734.1"
                     /db_xref="GeneID:11520848"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="JGIDB:Thite2_2112338"
                     /translation="MHSVRRAALRAALSASRVVCNQANSTRLATRTAAEWNYTRPALP
                     HTLRFFSQTVRKAYENRELEQAQRKDEENFEKQAAADAREDVETEADIQEAMQEVSPS
                     SSEEPGSPSSSEEPRPAPGAMSKAQEIQNSVFVRNLVFEVTEEHLQKAFSKYGEVAST
                     FIARDPRGLSKGFGFVTFTTPEAVETACSQVNGSFWHGRRITCVRRTQPAPAGVKKPA
                     KSPPGPTAQLFIGNIPYETTDAELNRLFRGIENLRDVRVAVDRTTGWPRGFAHADFTS
                     IEAAIEAKKRLEGTMLGNRLLRVDFATGYQRRSRSPPQQQPVEDAETEQ"
     gene            2087069..2089556
                     /locus_tag="THITE_2112341"
                     /db_xref="GeneID:11520847"
     mRNA            join(2087069..2087403,2087520..2089556)
                     /locus_tag="THITE_2112341"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651687.1"
                     /db_xref="GeneID:11520847"
     CDS             join(2087233..2087403,2087520..2089310)
                     /locus_tag="THITE_2112341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651735.1"
                     /db_xref="GeneID:11520847"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="JGIDB:Thite2_2112341"
                     /translation="MSFLGGAECSSAGNPLSQFTKHVQDDKSLQHDRLAGRGPSPAVG
                     GFRSAVHNAPQDEIVNGFLHRTPGLPEMPLEQQGPMNQVHIDQSHGVHLRAHSASPMS
                     SAWAPPDTQAAMEAAFNAPPETHFSPEEFAKFQHMNGSASSTARAGPMPGPSAGMLAQ
                     SHIPGALGGMSHPMMMRPMFQPMYGPQMHIAPRQPQQEAEGKGKGKVVELDESQWEEQ
                     FRQMELHDRQLREEQDEAQAMERELDRMDEKLLHSETGYGDLESIWRGIQAEREAMNE
                     LDDVEDDFAKFDSSHFGGDNLHDWGLNNRYGADPIVQEYLFEEENLFQDQPNPFEEGV
                     RIVKEGGNLSLAALAFEAAVQKNPDHVEAWVYLGNVQAQNEKEEAAIRALEHALKLDP
                     NNLAALMALAVSYTNEGYDSTAYRTLERWLSVKYPQILAPTELSSAAEMGFTDRAQLH
                     ERVTDLFLSAARLAPDGEHMDPDVQVGLGVLFYGAEEYDKAVDCFQAALHSSELGTSN
                     QREQVHLLWNRLGATLANSGRSEEAIAAYEKALSINPNFVRARYNLGVSCINIGCHAE
                     AAGHLLAALDMHKTVEKSGREKARELLGAGADAANADARIEAMTTQNRSTTLYDTLRR
                     VFTQMGRPDLAEKVVVGVDPDIFRGEFDF"
     gene            complement(<2090222..2092491)
                     /locus_tag="THITE_2094955"
                     /db_xref="GeneID:11520536"
     mRNA            complement(<2090222..2092491)
                     /locus_tag="THITE_2094955"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651688.1"
                     /db_xref="GeneID:11520536"
     CDS             complement(2090222..2092396)
                     /locus_tag="THITE_2094955"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651736.1"
                     /db_xref="GeneID:11520536"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="JGIDB:Thite2_2094955"
                     /translation="MGKNRKNKSNRGIFATTTTLAMNGGESDDAVHGAVTAVAAGASP
                     VDTAADLAGTPQTLASKESSAGSLKRPSPHDADDDDGWQTIERGRPVKKHKKVPGPNS
                     NRYPAIYFSPQARLQAMISVSSLRDLIVYIFADGPAPQWVAVKHRPEFRKIVAIVVPG
                     LEEAMFKENVDFSTYNKLPPDQATDRIATAPDDYYPRVLKEEALPPALKPFAEMFPHL
                     WPVRAPGDDKYAKLYSPLQSMLTVPLSKEKKGGVQPLNEPRGWKDERTRITEFLATTD
                     ELMEHGFPIHPAMLPDGAKRDAFRDPDGFVHTRVTRLEEGDVPEAEIEQGSITAGRQV
                     LALDCEMCMTGEKEFSLTRISLVSWDGEVVLDELVKPDKPIIDYVTRFSGITKEMLDP
                     VTTTLSDIQSRLLDLLHPRTILVGHSLDSDLKAIRLAHPFIVDTSILFPHPRGPPLKL
                     SLKSLAQKYLNREIQKGDGTIHGHDSIEDAKTCLDLVKKKCEKGKAWAAGDVQGENLF
                     KRLARAGTAYRATAGPGATGGLPVGKSSAAVDWGDATRSACNAATVTISCESDAEVEA
                     GIIRAVKGDPDGLEVPGGGVDFVWARLRELEALQGWWNRNKVVGDGPGGPPPSSQTED
                     AGSGDPGDSPLERCLTSLSQRLKRIHDALPPCTAFIVFSGTGDPREVGRLQAMQAQFR
                     REYNTPGSKWDQLSVQWTDKEEQALRRAVRAARRGIGFIGVK"
     gene            2092757..>2093879
                     /locus_tag="THITE_56406"
                     /db_xref="GeneID:11520537"
     mRNA            join(2092757..2093008,2093096..2093182,2093234..>2093879)
                     /locus_tag="THITE_56406"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651689.1"
                     /db_xref="GeneID:11520537"
     CDS             join(2092830..2093008,2093096..2093182,2093234..>2093879)
                     /locus_tag="THITE_56406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651737.1"
                     /db_xref="GeneID:11520537"
                     /db_xref="JGIDB:Thite2_56406"
                     /translation="METAFCECRKCDAPIGRFANLWTQIGKSYFSPVVEPEDDLAVQC
                     QGSVRVGEPDTLVEECHLQDIVCANCGALLGLKCVQTPVNHVLDQNQLLLRLASIDLL
                     DSTGQEIEFAIKRVLSVAEPSRVTRTHRPDPSQGAGFSSAFPEPAELEKLRADLHSQR
                     EDIRRIDNNGFRIVSALDKRASRIEVEITKLKGKADSSHGAIGNLQQDIGSMKADIAA
                     VRASVQDPTALASLEARLASVTCTLGEVAQHFTSLKEEIDELKSELSGQRRAMEGLES
                     ETRAKVTAARHAEDMASLRAEIMHLRRQ"
     gene            complement(<2094427..>2096301)
                     /locus_tag="THITE_68287"
                     /db_xref="GeneID:11520538"
     mRNA            complement(join(<2094427..2095322,2095377..2095566,
                     2095636..2095806,2095867..>2096301))
                     /locus_tag="THITE_68287"
                     /product="uncharacterized protein"
                     /note="Has EST support. in only one exon"
                     /transcript_id="XM_003651690.1"
                     /db_xref="GeneID:11520538"
     CDS             complement(join(2094427..2095322,2095377..2095566,
                     2095636..2095806,2095867..2096298))
                     /locus_tag="THITE_68287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651738.1"
                     /db_xref="GeneID:11520538"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="JGIDB:Thite2_68287"
                     /translation="MPPQLPPGVRVHHDHTTSPSPGSKRRSLIATRAFAPGTPIATFS
                     NPLLALPDGATMRTTCNYCLRVGASSSSSSTTDNNKNNSSSGDGSSSSNGTPLRACTA
                     CKAAVYCGAACQRAHWRAVHRAECKMFSRVRESAGKEWLPTPAFGGGGGAWALEGNVE
                     GFRADEALWRDFELQAAAAAVYAGLLESEETLEKAREVLCKIQTNAFNRLDADTGLSG
                     IFLDVGLAMVNHSCVPNAFIGFDRRTAVLRAERPIQEGEEITISYIDNALPKSARQEA
                     LRLYHFRCDCPRCRDDLDVYEVCQTSPDIPLNSFSLQPDLSKLRSPPVDRSRVSKGEI
                     EAIYNRWQKLDKPKGDDEEEHTNLARARWELCRPLIEAKLWAVEPLPTTILELATCWQ
                     TSYKMVVYALPLLCFLCTQCDPFKLVAPFMPARIKSIVAVVKLLAVTGELTASGALAT
                     RCSHEGVVGTLAMADQVSMCEALLRLAVHHGSIGAAEDWDVLKQAKSMLEDVESLEGR
                     DQESALVRAWATDPEDPDGAAFFERQVLSPVNSLASFAIEILEATLRGKGLIRK"
     gene            2096872..2098148
                     /locus_tag="THITE_2112352"
                     /db_xref="GeneID:11520539"
     mRNA            join(2096872..2097102,2097219..2097380,2097470..2097579,
                     2097642..2097759,2097885..2098148)
                     /locus_tag="THITE_2112352"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651691.1"
                     /db_xref="GeneID:11520539"
     CDS             join(2097060..2097102,2097219..2097380,2097470..2097579,
                     2097642..2097759,2097885..2097943)
                     /locus_tag="THITE_2112352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003651739.1"
                     /db_xref="GeneID:11520539"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="JGIDB:Thite2_2112352"
                     /translation="MASRGSQQQQQGEAVDLASLSAQQLSAVKKQLDGEVEHLSASYA
                     QLAAAQAKFKECLRIVKSGSSALDKDKPILVPLTNSLYVKGQLSDPDRVLVDVGTGYY
                     VEKDTKSAAEFYDAKIKELAGNIQGLEGIVQAKTNNLRVVEEVLRQKVLAQGLGAGGQ
                     PAS"
     gene            complement(<2098354..>2100002)
                     /locus_tag="THITE_2143130"
                     /db_xref="GeneID:11520540"
     mRNA            complement(join(<2098354..2098885,2098941..2099228,
                     2099282..2099877,2099934..>2100002))
                     /locus_tag="THITE_2143130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_003651692.1"